BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14418_g1_i1 len=1808 path=[1785:0-1231 3604:1232-1232
3017:1233-1307 3092:1308-1807]

Length=1808
                                                                      Score     E

ref|XP_009617817.1|  PREDICTED: cytochrome P450 CYP736A12-like          442   4e-173   
ref|XP_006350392.1|  PREDICTED: cytochrome P450 71A1-like               403   1e-161   
ref|XP_004237368.1|  PREDICTED: cytochrome P450 CYP736A12-like          394   5e-158   
ref|XP_009346975.1|  PREDICTED: cytochrome P450 CYP736A12-like          367   8e-144   
ref|XP_009336569.1|  PREDICTED: cytochrome P450 CYP736A12-like          364   4e-143   
ref|XP_002275826.1|  PREDICTED: cytochrome P450 CYP736A12               358   6e-142   Vitis vinifera
ref|XP_008374738.1|  PREDICTED: cytochrome P450 CYP736A12-like          361   9e-142   
ref|XP_008240284.1|  PREDICTED: cytochrome P450 CYP736A12-like          366   2e-141   
ref|XP_007209911.1|  hypothetical protein PRUPE_ppa004377mg             358   3e-141   
ref|XP_008360900.1|  PREDICTED: cytochrome P450 CYP736A12-like          364   8e-141   
sp|H2DH18.1|C7A12_PANGI  RecName: Full=Cytochrome P450 CYP736A12        355   2e-140   
gb|AAL66194.1|AF386512_1  cytochrome P450                               367   4e-140   Pyrus communis
dbj|BAD15331.1|  cytochrome P450                                        357   5e-140   Panax ginseng [Chinese ginseng]
ref|XP_008374739.1|  PREDICTED: cytochrome P450 CYP736A12-like          354   6e-140   
ref|XP_009337234.1|  PREDICTED: cytochrome P450 CYP736A12-like          361   1e-139   
ref|XP_009337209.1|  PREDICTED: cytochrome P450 CYP736A12-like          352   2e-139   
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   3e-139   
ref|XP_007036492.1|  Cytochrome P450 superfamily protein                348   2e-138   
ref|XP_010094782.1|  Cytochrome P450 71A1                               349   3e-138   
ref|XP_009337257.1|  PREDICTED: cytochrome P450 CYP736A12-like          351   4e-138   
ref|XP_009337244.1|  PREDICTED: cytochrome P450 CYP736A12-like          347   3e-137   
ref|XP_003528941.2|  PREDICTED: cytochrome P450 750A1-like              345   2e-136   
ref|XP_009337218.1|  PREDICTED: cytochrome P450 CYP736A12-like          347   2e-136   
ref|XP_004299223.1|  PREDICTED: cytochrome P450 71A1-like               343   2e-136   
gb|KHN20714.1|  Cytochrome P450 71D10                                   343   6e-136   
gb|KDP20096.1|  hypothetical protein JCGZ_05865                         350   1e-135   
ref|XP_003530005.1|  PREDICTED: cytochrome P450 71A1-like               343   4e-135   
ref|XP_008393300.1|  PREDICTED: cytochrome P450 CYP736A12-like          342   2e-134   
ref|XP_002275714.2|  PREDICTED: cytochrome P450 CYP736A12-like          335   3e-134   Vitis vinifera
ref|XP_010663579.1|  PREDICTED: cytochrome P450 CYP736A12-like          329   1e-133   
ref|XP_010045641.1|  PREDICTED: cytochrome P450 CYP736A12-like          333   4e-133   
ref|XP_010047217.1|  PREDICTED: cytochrome P450 CYP736A12-like          343   4e-133   
ref|XP_003534174.2|  PREDICTED: cytochrome P450 750A1-like              334   6e-133   
gb|KHN32022.1|  Cytochrome P450 71A1                                    333   1e-132   
gb|KCW79058.1|  hypothetical protein EUGRSUZ_C00484                     341   2e-132   
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              338   3e-132   
ref|XP_008385725.1|  PREDICTED: cytochrome P450 CYP736A12-like          339   3e-132   
ref|XP_007152786.1|  hypothetical protein PHAVU_004G159500g             326   3e-131   
gb|KHF97324.1|  Cytochrome P450                                         328   7e-131   
gb|KHG07950.1|  Cytochrome P450                                         329   4e-130   
ref|XP_010036876.1|  PREDICTED: cytochrome P450 CYP736A12-like          333   7e-130   
gb|KHN32024.1|  Cytochrome P450 71A1                                    330   8e-130   
ref|XP_007036495.1|  Cytochrome P450 superfamily protein, putativ...    332   6e-129   
ref|XP_002511968.1|  flavonoid 3-hydroxylase, putative                  329   6e-129   Ricinus communis
gb|KCW48536.1|  hypothetical protein EUGRSUZ_K02211                     329   1e-128   
ref|XP_004490596.1|  PREDICTED: uncharacterized protein LOC101501242    326   2e-128   
gb|KHG22812.1|  Cytochrome P450                                         316   2e-128   
emb|CAN69565.1|  hypothetical protein VITISV_033534                     312   7e-128   Vitis vinifera
ref|XP_007160365.1|  hypothetical protein PHAVU_002G315400g             325   8e-128   
ref|XP_007036496.1|  Cytochrome P450 superfamily protein, putativ...    328   1e-127   
ref|XP_004490599.1|  PREDICTED: uncharacterized protein LOC101502297    319   2e-127   
ref|XP_002275691.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X1    309   5e-127   Vitis vinifera
emb|CAN69566.1|  hypothetical protein VITISV_033535                     328   5e-127   Vitis vinifera
ref|XP_007152789.1|  hypothetical protein PHAVU_004G159800g             340   7e-127   
ref|XP_003525259.2|  PREDICTED: cytochrome P450 750A1-like              315   1e-126   
gb|KEH27058.1|  cytochrome P450 family 71 protein                       310   2e-126   
ref|XP_004301062.1|  PREDICTED: cytochrome P450 71A1-like               327   2e-126   
ref|XP_010036875.1|  PREDICTED: cytochrome P450 CYP736A12-like          319   2e-126   
ref|XP_010045642.1|  PREDICTED: cytochrome P450 CYP736A12-like          312   3e-126   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               314   5e-126   Vitis vinifera
gb|KHG22550.1|  Cytochrome P450                                         307   6e-126   
gb|KHN20715.1|  Cytochrome P450 71A1                                    318   6e-126   
gb|AFK79030.1|  cytochrome P450 CYP736A53                               315   1e-125   
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g             321   4e-125   
ref|XP_002310014.1|  cytochrome P450 family protein                     318   4e-125   Populus trichocarpa [western balsam poplar]
ref|XP_002310015.1|  cytochrome P450 family protein                     320   4e-125   Populus trichocarpa [western balsam poplar]
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             317   9e-125   
ref|XP_007152783.1|  hypothetical protein PHAVU_004G159300g             306   1e-124   
ref|XP_003615666.1|  Cytochrome P450                                    314   2e-124   
ref|XP_007152790.1|  hypothetical protein PHAVU_004G159900g             332   1e-123   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like          327   2e-123   
ref|XP_004236729.1|  PREDICTED: cytochrome P450 CYP736A12-like          306   2e-123   
ref|XP_007152787.1|  hypothetical protein PHAVU_004G159600g             326   2e-123   
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          313   5e-123   
ref|XP_007212357.1|  hypothetical protein PRUPE_ppa014572mg             306   6e-123   
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like          308   7e-123   
gb|KCW83844.1|  hypothetical protein EUGRSUZ_B00712                     298   9e-123   
ref|XP_004304846.1|  PREDICTED: cytochrome P450 71A1-like               307   9e-123   
ref|XP_002310007.2|  cytochrome P450 family protein                     314   1e-122   Populus trichocarpa [western balsam poplar]
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    312   1e-122   
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          306   2e-122   
dbj|BAP15886.1|  cytochrome P450 71AU50                                 301   2e-122   
ref|XP_010111002.1|  Cytochrome P450 71D10                              309   2e-122   
ref|XP_008227094.1|  PREDICTED: cytochrome P450 CYP736A12-like          301   2e-122   
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          303   3e-122   
ref|XP_007048087.1|  Cytochrome P450                                    306   4e-122   
ref|XP_003615667.1|  Cytochrome P450                                    305   6e-122   
ref|XP_004512940.1|  PREDICTED: cytochrome P450 71A1-like               298   7e-122   
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             304   9e-122   
gb|AES98625.2|  cytochrome P450 family 71 protein                       305   1e-121   
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             310   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          305   2e-121   
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         305   2e-121   
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             303   4e-121   
ref|XP_010099912.1|  Cytochrome P450 71A1                               304   4e-121   
ref|XP_003615665.1|  Cytochrome P450                                    311   7e-121   
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             307   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_003615674.1|  Cytochrome P450                                    320   2e-120   
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg             300   2e-120   
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             298   3e-120   
gb|AES98632.2|  cytochrome P450 family 71 protein                       319   5e-120   
ref|XP_008364815.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    306   9e-120   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               304   1e-119   Vitis vinifera
ref|XP_006363549.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    301   2e-119   
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          297   2e-119   
emb|CBI21489.3|  unnamed protein product                                301   3e-119   
ref|XP_007221131.1|  hypothetical protein PRUPE_ppa019068mg             300   3e-119   
ref|XP_008346790.1|  PREDICTED: cytochrome P450 CYP736A12-like is...    290   2e-118   
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             309   2e-118   Populus trichocarpa [western balsam poplar]
emb|CBI15434.3|  unnamed protein product                                303   2e-118   
ref|XP_003531375.1|  PREDICTED: cytochrome P450 750A1-like isofor...    300   3e-118   
ref|XP_008346791.1|  PREDICTED: cytochrome P450 CYP736A12-like is...    288   4e-118   
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          296   5e-118   
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               295   1e-117   
gb|KHN29102.1|  Cytochrome P450 71A1                                    295   2e-117   
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          296   2e-117   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          295   3e-117   
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             291   3e-117   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              301   4e-117   
ref|XP_006428066.1|  hypothetical protein CICLE_v10025445mg             283   6e-117   
ref|XP_010663583.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X2    275   1e-116   
ref|XP_007211074.1|  hypothetical protein PRUPE_ppa017688mg             311   1e-116   
ref|XP_007159747.1|  hypothetical protein PHAVU_002G263700g             300   3e-116   
ref|XP_006346716.1|  PREDICTED: cytochrome P450 71A1-like               293   5e-116   
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             283   5e-116   
ref|XP_011100886.1|  PREDICTED: cytochrome P450 CYP736A12-like          291   6e-116   
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   298   8e-116   Vitis arizonica x Vitis rupestris
ref|XP_006493867.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    280   9e-116   
emb|CDP18035.1|  unnamed protein product                                282   9e-116   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   297   1e-115   Vitis arizonica x Vitis rupestris
gb|AFK79031.1|  cytochrome P450 CYP736A54                               288   2e-115   
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          285   3e-115   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    293   3e-115   
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         277   5e-115   
ref|XP_010537441.1|  PREDICTED: cytochrome P450 CYP736A12-like          301   5e-115   
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          286   6e-115   
gb|EYU24035.1|  hypothetical protein MIMGU_mgv1a020942mg                292   9e-115   
ref|XP_004504031.1|  PREDICTED: cytochrome P450 750A1-like              296   9e-115   
ref|XP_011078642.1|  PREDICTED: cytochrome P450 CYP736A12-like          294   2e-114   
ref|XP_010694276.1|  PREDICTED: cytochrome P450 CYP736A12-like          287   2e-114   
ref|XP_010537439.1|  PREDICTED: cytochrome P450 CYP736A12-like          304   5e-114   
ref|XP_004237154.1|  PREDICTED: cytochrome P450 CYP736A12-like          283   1e-113   
ref|XP_009608339.1|  PREDICTED: cytochrome P450 CYP736A12-like          288   1e-113   
ref|XP_008364814.1|  PREDICTED: cytochrome P450 CYP736A12-like          285   2e-113   
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          284   3e-113   
ref|XP_004162313.1|  PREDICTED: cytochrome P450 71A1-like               284   6e-113   
ref|XP_006365792.1|  PREDICTED: cytochrome P450 71A1-like               272   1e-112   
ref|XP_009372721.1|  PREDICTED: cytochrome P450 CYP736A12-like          282   1e-112   
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             292   3e-112   
ref|XP_009767392.1|  PREDICTED: cytochrome P450 CYP736A12-like          284   3e-112   
ref|XP_004153472.1|  PREDICTED: cytochrome P450 71B13-like              283   3e-112   
ref|XP_003596030.1|  Cytochrome P450                                    288   3e-112   
ref|XP_008440670.1|  PREDICTED: cytochrome P450 CYP736A12-like          283   5e-112   
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          279   5e-112   
ref|XP_006365795.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    270   6e-112   
ref|XP_011100884.1|  PREDICTED: cytochrome P450 CYP736A12-like          278   1e-111   
ref|XP_010537440.1|  PREDICTED: cytochrome P450 CYP736A12-like          289   2e-111   
ref|XP_009378500.1|  PREDICTED: cytochrome P450 CYP736A12-like          288   2e-111   
ref|XP_008385983.1|  PREDICTED: cytochrome P450 CYP736A12-like          286   4e-111   
emb|CDP01387.1|  unnamed protein product                                284   6e-111   
ref|XP_009607201.1|  PREDICTED: cytochrome P450 CYP736A12-like          278   9e-110   
ref|XP_008460602.1|  PREDICTED: cytochrome P450 CYP736A12-like          270   3e-109   
gb|EYU24037.1|  hypothetical protein MIMGU_mgv1a005167mg                291   6e-109   
emb|CDP12933.1|  unnamed protein product                                280   2e-108   
gb|KHG07602.1|  Cytochrome P450                                         258   3e-108   
ref|XP_011090604.1|  PREDICTED: cytochrome P450 CYP736A12-like          263   8e-108   
ref|XP_009770873.1|  PREDICTED: cytochrome P450 CYP736A12-like          272   1e-107   
ref|XP_006354708.1|  PREDICTED: flavonoid 3'-monooxygenase-like         269   1e-107   
ref|XP_006354701.1|  PREDICTED: cytochrome P450 84A1-like               272   2e-107   
gb|EYU31078.1|  hypothetical protein MIMGU_mgv1a004963mg                270   2e-107   
gb|KHF98693.1|  Cytochrome P450                                         258   2e-107   
ref|XP_004237435.1|  PREDICTED: cytochrome P450 CYP736A12-like          268   2e-107   
ref|XP_006354704.1|  PREDICTED: cytochrome P450 750A1-like              271   3e-107   
ref|XP_010537437.1|  PREDICTED: cytochrome P450 CYP736A12-like          300   4e-107   
gb|EYU24036.1|  hypothetical protein MIMGU_mgv1a005182mg                287   4e-107   
ref|XP_004162326.1|  PREDICTED: cytochrome P450 750A1-like              272   7e-107   
ref|XP_004143566.1|  PREDICTED: cytochrome P450 750A1-like              272   7e-107   
gb|KCW79056.1|  hypothetical protein EUGRSUZ_C00482                     340   8e-107   
ref|XP_009615258.1|  PREDICTED: cytochrome P450 CYP736A12-like          268   8e-107   
ref|XP_009782203.1|  PREDICTED: cytochrome P450 CYP736A12-like          270   1e-106   
ref|XP_003630098.1|  Cytochrome P450                                    261   1e-106   
emb|CBI15435.3|  unnamed protein product                                240   2e-106   
ref|XP_009770688.1|  PREDICTED: cytochrome P450 CYP736A12-like          269   2e-106   
ref|XP_010050339.1|  PREDICTED: cytochrome P450 CYP736A12-like          341   2e-106   
ref|XP_004253509.1|  PREDICTED: cytochrome P450 CYP736A12-like          264   3e-106   
ref|XP_009607200.1|  PREDICTED: cytochrome P450 CYP736A12-like          266   3e-106   
ref|XP_004301061.1|  PREDICTED: cytochrome P450 71A1-like               340   6e-106   
gb|AES98630.2|  cytochrome P450 family 71 protein                       259   7e-106   
emb|CDP12853.1|  unnamed protein product                                251   8e-106   
ref|XP_011090597.1|  PREDICTED: cytochrome P450 CYP736A12-like          265   8e-106   
ref|XP_004237505.1|  PREDICTED: cytochrome P450 CYP736A12-like          278   9e-106   
ref|XP_004291274.1|  PREDICTED: cytochrome P450 71A1-like               340   1e-105   
ref|XP_003615672.1|  Cytochrome P450                                    259   1e-105   
ref|XP_009372715.1|  PREDICTED: cytochrome P450 CYP736A12-like          261   1e-105   
gb|KCW78883.1|  hypothetical protein EUGRSUZ_C00326                     338   4e-105   
ref|XP_009372727.1|  PREDICTED: cytochrome P450 CYP736A12-like          263   4e-105   
ref|XP_008385982.1|  PREDICTED: cytochrome P450 CYP736A12-like          264   5e-105   
ref|XP_006348217.1|  PREDICTED: cytochrome P450 71A1-like               270   5e-105   
ref|XP_008344234.1|  PREDICTED: cytochrome P450 CYP736A12-like          260   8e-105   
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               280   1e-104   
gb|KHN38214.1|  Cytochrome P450 71A1                                    259   2e-104   
ref|XP_009372726.1|  PREDICTED: cytochrome P450 CYP736A12-like          260   3e-104   
ref|XP_006366158.1|  PREDICTED: cytochrome P450 750A1-like              260   4e-104   
ref|XP_006354722.1|  PREDICTED: cytochrome P450 71A1-like               270   5e-104   
ref|XP_009631554.1|  PREDICTED: cytochrome P450 CYP736A12-like          265   6e-104   
ref|XP_004237615.1|  PREDICTED: cytochrome P450 CYP736A12-like          271   8e-104   
gb|EYU31074.1|  hypothetical protein MIMGU_mgv1a005121mg                255   1e-103   
ref|XP_010094781.1|  Cytochrome P450 71D8                               333   3e-103   
ref|XP_004143572.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    271   3e-103   
ref|XP_004172515.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    271   4e-103   
ref|XP_006367702.1|  PREDICTED: cytochrome P450 71A1-like               264   8e-103   
ref|XP_008441066.1|  PREDICTED: cytochrome P450 CYP736A12-like          280   1e-102   
gb|EYU31075.1|  hypothetical protein MIMGU_mgv1a005090mg                255   1e-102   
ref|XP_009372725.1|  PREDICTED: cytochrome P450 CYP736A12-like          260   1e-102   
ref|XP_004162328.1|  PREDICTED: flavonoid 3'-monooxygenase-like         280   2e-102   
ref|XP_011090598.1|  PREDICTED: cytochrome P450 CYP736A12-like          256   2e-102   
emb|CDP01384.1|  unnamed protein product                                265   2e-102   
ref|XP_004153471.1|  PREDICTED: cytochrome P450 71A1-like               263   4e-102   
ref|XP_004143494.1|  PREDICTED: cytochrome P450 750A1-like              255   6e-102   
ref|XP_004162312.1|  PREDICTED: cytochrome P450 750A1-like              255   6e-102   
ref|XP_006354705.1|  PREDICTED: cytochrome P450 750A1-like              251   8e-102   
emb|CBI15433.3|  unnamed protein product                                331   9e-102   
ref|XP_004237617.1|  PREDICTED: cytochrome P450 CYP736A12-like          252   1e-101   
gb|EYU27291.1|  hypothetical protein MIMGU_mgv1a023536mg                262   3e-101   
ref|XP_004143569.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    278   3e-101   
ref|XP_002514610.1|  flavonoid 3-hydroxylase, putative                  328   5e-101   Ricinus communis
ref|XP_009588170.1|  PREDICTED: cytochrome P450 CYP736A12-like          255   6e-101   
ref|XP_003615678.1|  Cytochrome P450                                    327   8e-101   
ref|XP_009605506.1|  PREDICTED: cytochrome P450 CYP736A12-like          204   2e-100   
gb|KHG20290.1|  Cytochrome P450 protein                                 300   1e-99    
ref|XP_003615682.1|  Cytochrome P450                                    236   1e-99    
ref|XP_006365796.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    270   2e-99    
ref|XP_009629564.1|  PREDICTED: cytochrome P450 CYP736A12-like          244   2e-99    
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             321   1e-98    Populus trichocarpa [western balsam poplar]
ref|XP_004143571.1|  PREDICTED: cytochrome P450 71A1-like               231   5e-98    
gb|AJD25257.1|  cytochrome P450 CYP736A122                              245   1e-97    
ref|XP_007036499.1|  Cytochrome P450, putative                          319   2e-97    
gb|EYU31073.1|  hypothetical protein MIMGU_mgv1a004944mg                247   4e-97    
gb|KEH28165.1|  cytochrome P450 family 71 protein                       311   1e-95    
ref|XP_008374965.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    207   1e-95    
ref|XP_003627829.1|  Cytochrome P450                                    223   1e-94    
ref|XP_007159748.1|  hypothetical protein PHAVU_002G263800g             306   3e-94    
ref|XP_010041191.1|  PREDICTED: cytochrome P450 CYP736A12-like          306   5e-94    
ref|XP_010537436.1|  PREDICTED: cytochrome P450 CYP736A12-like          298   6e-94    
ref|XP_008793722.1|  PREDICTED: cytochrome P450 71A1-like               246   1e-93    
ref|XP_003630097.1|  Cytochrome P450                                    218   3e-93    
gb|KEH15707.1|  cytochrome P450 family 71 protein                       233   5e-93    
ref|XP_004169555.1|  PREDICTED: cytochrome P450 71A1-like               237   1e-92    
ref|XP_002273390.1|  PREDICTED: cytochrome P450 71A1-like               238   2e-92    Vitis vinifera
ref|XP_010086796.1|  Cytochrome P450 71A1                               236   4e-92    
gb|ACN40174.1|  unknown                                                 231   4e-92    Picea sitchensis
ref|XP_008386978.1|  PREDICTED: cytochrome P450 CYP736A12-like          299   4e-92    
ref|XP_006436412.1|  hypothetical protein CICLE_v10031266mg             226   1e-91    
ref|XP_006354707.1|  PREDICTED: cytochrome P450 71A1-like               223   2e-91    
ref|XP_010929928.1|  PREDICTED: cytochrome P450 71A1-like               235   3e-91    
gb|KDO48981.1|  hypothetical protein CISIN_1g010365mg                   224   6e-91    
ref|XP_011036442.1|  PREDICTED: cytochrome P450 71A1-like               231   8e-91    
ref|XP_007036494.1|  Cytochrome P450                                    209   9e-91    
gb|EAZ09259.1|  hypothetical protein OsI_31532                          243   9e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_002303241.1|  hypothetical protein POPTR_0003s06460g             232   1e-90    Populus trichocarpa [western balsam poplar]
ref|NP_001063285.1|  Os09g0441400                                       243   1e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  301   1e-90    Ricinus communis
gb|KDP40690.1|  hypothetical protein JCGZ_24689                         233   1e-90    
ref|XP_007037782.1|  Cytochrome P450 71A1                               238   2e-90    
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g             299   2e-90    
ref|XP_002462455.1|  hypothetical protein SORBIDRAFT_02g025850          240   4e-90    Sorghum bicolor [broomcorn]
ref|XP_010033730.1|  PREDICTED: cytochrome P450 71A1-like               233   5e-90    
emb|CAN77776.1|  hypothetical protein VITISV_021888                     228   5e-90    Vitis vinifera
ref|XP_010273844.1|  PREDICTED: cytochrome P450 71A1-like               236   6e-90    
ref|XP_006468115.1|  PREDICTED: flavonoid 3'-monooxygenase-like         222   6e-90    
ref|XP_006369135.1|  hypothetical protein POPTR_0001s16800g             231   8e-90    
ref|XP_002460274.1|  hypothetical protein SORBIDRAFT_02g025840          239   9e-90    Sorghum bicolor [broomcorn]
ref|XP_011079634.1|  PREDICTED: cytochrome P450 71A1-like               226   9e-90    
ref|XP_010933756.1|  PREDICTED: cytochrome P450 84A1-like               213   1e-89    
ref|XP_004956937.1|  PREDICTED: cytochrome P450 71A1-like               238   1e-89    
ref|XP_009375474.1|  PREDICTED: cytochrome P450 71A1-like               233   2e-89    
ref|XP_006426680.1|  hypothetical protein CICLE_v10025391mg             229   2e-89    
ref|XP_004956938.1|  PREDICTED: cytochrome P450 71A1-like               237   2e-89    
ref|XP_003520239.1|  PREDICTED: cytochrome P450 71D8-like               234   2e-89    
ref|XP_009341741.1|  PREDICTED: cytochrome P450 71A1-like               227   4e-89    
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                235   5e-89    
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             232   5e-89    
ref|XP_007024645.1|  Cytochrome P450 superfamily protein                226   6e-89    
gb|ADC34701.1|  flavonoid 3' hydroxylase                                236   6e-89    
gb|AGT17103.1|  flavonoid 3-monooxygenase                               236   7e-89    
ref|XP_011035728.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    229   7e-89    
ref|XP_008342571.1|  PREDICTED: cytochrome P450 71A1-like               225   8e-89    
ref|XP_007204846.1|  hypothetical protein PRUPE_ppa026438mg             232   9e-89    
ref|XP_004287841.1|  PREDICTED: cytochrome P450 84A1-like               216   1e-88    
emb|CDP12931.1|  unnamed protein product                                193   1e-88    
ref|XP_008241781.1|  PREDICTED: cytochrome P450 84A1                    213   1e-88    
dbj|BAD36162.1|  putative elicitor-inducible cytochrome P450            234   2e-88    
gb|EYU24083.1|  hypothetical protein MIMGU_mgv1a025005mg                218   2e-88    
ref|XP_011100951.1|  PREDICTED: cytochrome P450 84A1-like               213   2e-88    
ref|XP_011005615.1|  PREDICTED: cytochrome P450 71A1-like               236   2e-88    
ref|XP_011035730.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    227   2e-88    
ref|XP_008652774.1|  PREDICTED: cytochrome P450 71A1-like               235   3e-88    
ref|XP_007203643.1|  hypothetical protein PRUPE_ppa004260mg             211   3e-88    
gb|EYU21317.1|  hypothetical protein MIMGU_mgv1a004638mg                224   3e-88    
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               228   3e-88    
ref|XP_006465906.1|  PREDICTED: cytochrome P450 71A1-like               228   3e-88    
ref|XP_004235547.1|  PREDICTED: cytochrome P450 71A1-like               222   3e-88    
gb|KDO65002.1|  hypothetical protein CISIN_1g010388mg                   228   4e-88    
gb|AJD25214.1|  cytochrome P450 CYP92A73                                224   4e-88    
gb|EAZ09260.1|  hypothetical protein OsI_31533                          233   4e-88    
gb|AJD25152.1|  cytochrome P450 CYP71AP14                               226   5e-88    
ref|XP_010911323.1|  PREDICTED: cytochrome P450 71A1-like               230   5e-88    
ref|NP_001147572.1|  flavonoid 3-monooxygenase                          234   5e-88    
ref|XP_008796879.1|  PREDICTED: cytochrome P450 84A1-like               211   5e-88    
ref|XP_003551494.1|  PREDICTED: cytochrome P450 71D10-like              228   5e-88    
ref|XP_008449122.1|  PREDICTED: cytochrome P450 CYP736A12-like          221   6e-88    
gb|AAK62346.1|  elicitor-inducible cytochrome P450                      220   6e-88    
ref|XP_009607330.1|  PREDICTED: cytochrome P450 71A1-like               220   7e-88    
ref|XP_010689571.1|  PREDICTED: cytochrome P450 CYP736A12-like          226   8e-88    
ref|XP_011071968.1|  PREDICTED: cytochrome P450 71A1                    226   8e-88    
ref|XP_008228182.1|  PREDICTED: cytochrome P450 71A1-like               223   1e-87    
ref|XP_010102938.1|  Cytochrome P450 71A1                               227   1e-87    
ref|XP_008242249.1|  PREDICTED: flavonoid 3'-monooxygenase-like         228   1e-87    
ref|XP_006665048.1|  PREDICTED: cytochrome P450 71A1-like               234   1e-87    
ref|XP_002276558.2|  PREDICTED: cytochrome P450 71A1-like               230   2e-87    
ref|XP_010264863.1|  PREDICTED: cytochrome P450 71A1-like               231   2e-87    
ref|XP_009387345.1|  PREDICTED: cytochrome P450 71A1-like               222   2e-87    
gb|KDO48980.1|  hypothetical protein CISIN_1g010365mg                   212   2e-87    
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               228   2e-87    
ref|XP_006493371.1|  PREDICTED: cytochrome P450 71A1-like               230   2e-87    
ref|XP_006841358.1|  hypothetical protein AMTR_s00181p00020940          228   2e-87    
ref|XP_004511998.1|  PREDICTED: cytochrome P450 71D8-like               226   3e-87    
ref|XP_002313762.1|  cytochrome P450 family protein                     205   3e-87    
ref|XP_003578185.1|  PREDICTED: cytochrome P450 71A1-like               229   3e-87    
gb|EYU24031.1|  hypothetical protein MIMGU_mgv1a004909mg                291   4e-87    
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               223   4e-87    
gb|AJD25256.1|  cytochrome P450 CYP736A121                              291   4e-87    
ref|XP_004235548.1|  PREDICTED: cytochrome P450 71A1-like               218   4e-87    
gb|KHN32025.1|  Cytochrome P450 71A1                                    209   4e-87    
ref|XP_009378215.1|  PREDICTED: cytochrome P450 84A1-like               211   4e-87    
ref|XP_004303698.1|  PREDICTED: flavonoid 3'-monooxygenase-like         224   5e-87    
gb|ABR18406.1|  unknown                                                 237   5e-87    
ref|XP_009338655.1|  PREDICTED: cytochrome P450 84A1-like               211   5e-87    
ref|XP_003535169.1|  PREDICTED: cytochrome P450 71D8-like               231   5e-87    
ref|XP_010027084.1|  PREDICTED: cytochrome P450 71A1-like               230   5e-87    
ref|XP_006854384.1|  hypothetical protein AMTR_s00039p00175330          241   5e-87    
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like               230   5e-87    
gb|KHN48844.1|  Cytochrome P450 71D8                                    226   6e-87    
ref|XP_003535170.1|  PREDICTED: cytochrome P450 71D8-like               231   6e-87    
ref|XP_004134878.1|  PREDICTED: cytochrome P450 84A1-like               209   6e-87    
gb|ABG74350.1|  cytochrome P450                                         221   6e-87    
ref|NP_001148045.1|  flavonoid 3-monooxygenase                          227   6e-87    
ref|XP_003537212.1|  PREDICTED: cytochrome P450 71D8-like               231   6e-87    
ref|XP_010027092.1|  PREDICTED: cytochrome P450 71A1-like               230   7e-87    
gb|ACF84248.1|  unknown                                                 228   8e-87    
ref|XP_010045519.1|  PREDICTED: cytochrome P450 71A1-like               229   1e-86    
gb|KDP30978.1|  hypothetical protein JCGZ_11354                         233   1e-86    
ref|XP_007215252.1|  hypothetical protein PRUPE_ppa004436mg             222   1e-86    
ref|XP_011047458.1|  PREDICTED: cytochrome P450 84A1-like               203   1e-86    
gb|ABC69383.1|  CYP92A2v4                                               221   1e-86    
ref|XP_008239357.1|  PREDICTED: cytochrome P450 71A1-like               228   2e-86    
gb|ABA01477.1|  cytochrome P450 DDWF1                                   223   2e-86    
dbj|BAP15885.1|  cytochrome P450 71AP13                                 228   2e-86    
ref|XP_008783087.1|  PREDICTED: cytochrome P450 93A3                    246   2e-86    
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                   228   2e-86    
ref|XP_003535171.1|  PREDICTED: cytochrome P450 71D8-like               229   2e-86    
ref|XP_010695999.1|  PREDICTED: cytochrome P450 71A1-like               221   2e-86    
gb|ABR18060.1|  unknown                                                 236   3e-86    
ref|XP_004512097.1|  PREDICTED: cytochrome P450 84A1-like               216   3e-86    
ref|XP_009789924.1|  PREDICTED: cytochrome P450 84A1-like               216   3e-86    
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         226   3e-86    
ref|XP_004288989.1|  PREDICTED: flavonoid 3'-monooxygenase-like         224   3e-86    
ref|XP_003535173.1|  PREDICTED: cytochrome P450 71D8-like               229   3e-86    
ref|XP_003600328.1|  Cytochrome P450                                    222   4e-86    
ref|XP_003547756.2|  PREDICTED: flavonoid 3'-monooxygenase-like         219   4e-86    
gb|KHN08718.1|  Cytochrome P450 71D8                                    229   4e-86    
gb|AET01782.2|  cytochrome P450 family protein                          223   4e-86    
ref|XP_004303697.1|  PREDICTED: flavonoid 3'-monooxygenase-like         226   4e-86    
ref|XP_011071969.1|  PREDICTED: flavonoid 3'-monooxygenase-like         216   5e-86    
ref|XP_004144428.1|  PREDICTED: flavonoid 3'-monooxygenase-like         223   5e-86    
gb|ABC69381.1|  CYP92A2v2                                               220   5e-86    
ref|XP_006342921.1|  PREDICTED: cytochrome P450 71A1-like               213   5e-86    
ref|XP_006427642.1|  hypothetical protein CICLE_v10025377mg             228   6e-86    
emb|CBI21487.3|  unnamed protein product                                189   6e-86    
ref|XP_004305992.1|  PREDICTED: cytochrome P450 71D11-like              227   7e-86    
ref|XP_008391587.1|  PREDICTED: cytochrome P450 84A1-like               207   8e-86    
ref|XP_009771565.1|  PREDICTED: cytochrome P450 71A1-like               219   8e-86    
gb|ACU45738.1|  ferulate 5-hydroxylase                                  214   9e-86    
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like               220   9e-86    
ref|XP_010033459.1|  PREDICTED: cytochrome P450 84A1-like               215   1e-85    
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                233   1e-85    
gb|ABC69382.1|  CYP92A2v2                                               218   1e-85    
ref|XP_003528553.1|  PREDICTED: flavonoid 3'-monooxygenase              217   1e-85    
ref|XP_008372753.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    207   1e-85    
ref|XP_008440792.1|  PREDICTED: cytochrome P450 84A1-like               201   1e-85    
ref|XP_003627306.1|  Flavonoid 3',5'-hydroxylase                        224   1e-85    
gb|ABR16640.1|  unknown                                                 233   1e-85    
ref|XP_010526785.1|  PREDICTED: cytochrome P450 84A1                    207   1e-85    
gb|ACC63880.1|  coniferyl aldehyde 5-hydroxylase                        211   1e-85    
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    224   1e-85    
ref|XP_010045514.1|  PREDICTED: cytochrome P450 71A1-like               225   1e-85    
gb|AJD25204.1|  cytochrome P450 CYP84A60                                211   2e-85    
ref|XP_003611886.1|  Cytochrome P450                                    222   2e-85    
ref|XP_009384087.1|  PREDICTED: cytochrome P450 84A1-like               210   2e-85    
ref|XP_006829159.1|  hypothetical protein AMTR_s00001p00269980          219   2e-85    
dbj|BAI47545.1|  coniferaldehyde 5-hydroxylase                          213   2e-85    
ref|XP_008463992.1|  PREDICTED: cytochrome P450 71A1-like               239   2e-85    
ref|XP_010928984.1|  PREDICTED: cytochrome P450 93A3                    243   2e-85    
gb|KHG11872.1|  Cytochrome P450 protein                                 208   2e-85    
ref|XP_007157951.1|  hypothetical protein PHAVU_002G111900g             214   3e-85    
ref|XP_006425557.1|  hypothetical protein CICLE_v10025382mg             206   3e-85    
dbj|BAD36163.1|  putative elicitor-inducible cytochrome P450            219   3e-85    
ref|XP_010932407.1|  PREDICTED: cytochrome P450 71A1-like               223   3e-85    
ref|XP_002521317.1|  flavonoid 3-hydroxylase, putative                  217   3e-85    
ref|XP_009588689.1|  PREDICTED: cytochrome P450 84A1-like               213   3e-85    
gb|KHN39921.1|  Cytochrome P450 71D8                                    225   3e-85    
ref|XP_004152574.1|  PREDICTED: cytochrome P450 71A1-like               247   3e-85    
gb|EAZ09261.1|  hypothetical protein OsI_31534                          219   3e-85    
gb|ACN40653.1|  unknown                                                 241   3e-85    
ref|XP_006850107.1|  hypothetical protein AMTR_s00022p00225170          245   3e-85    
ref|XP_002516018.1|  flavonoid 3-hydroxylase, putative                  217   3e-85    
ref|XP_002310288.1|  cytochrome P450 family protein                     211   3e-85    
gb|KHN36162.1|  Cytochrome P450 71D8                                    216   3e-85    
ref|XP_010550444.1|  PREDICTED: cytochrome P450 84A1-like               209   3e-85    
ref|XP_006465908.1|  PREDICTED: cytochrome P450 71A1-like               206   3e-85    
ref|XP_004984305.1|  PREDICTED: cytochrome P450 71A1-like               219   4e-85    
ref|XP_010919382.1|  PREDICTED: cytochrome P450 84A1                    205   4e-85    
ref|XP_008460308.1|  PREDICTED: cytochrome P450 71A1-like               225   4e-85    
gb|AGR44939.1|  ferulate 5-hydroxylase protein                          205   4e-85    
gb|KHN42024.1|  Cytochrome P450 71D8                                    215   4e-85    
ref|XP_010919383.1|  PREDICTED: cytochrome P450 84A1-like               206   4e-85    
gb|AJD25205.1|  cytochrome P450 CYP84A61                                209   4e-85    
gb|AFK45297.1|  unknown                                                 233   4e-85    
gb|AGV54723.1|  flavonoid 3'-monooxygenase-like protein                 221   5e-85    
gb|ABS53040.1|  Cald5H                                                  209   5e-85    
ref|XP_003537216.1|  PREDICTED: cytochrome P450 71D8-like               224   5e-85    
ref|XP_004308347.1|  PREDICTED: cytochrome P450 71A1-like               286   5e-85    
ref|XP_002516270.1|  flavonoid 3-hydroxylase, putative                  213   6e-85    
ref|XP_009802012.1|  PREDICTED: cytochrome P450 CYP736A12-like          286   6e-85    
ref|XP_006466893.1|  PREDICTED: cytochrome P450 84A1-like               204   6e-85    
ref|XP_009795889.1|  PREDICTED: premnaspirodiene oxygenase-like         224   6e-85    
gb|KDO71086.1|  hypothetical protein CISIN_1g010226mg                   204   6e-85    
gb|AES71399.2|  cytochrome P450 family 71 protein                       231   7e-85    
ref|XP_007046764.1|  Ferulic acid 5-hydroxylase 1                       207   8e-85    
dbj|BAI47544.1|  coniferaldehyde 5-hydroxylase                          211   8e-85    
ref|XP_003627305.1|  Flavonoid 3',5'-hydroxylase                        222   1e-84    
ref|XP_004143568.1|  PREDICTED: cytochrome P450 71A1-like               285   1e-84    
gb|EYU31149.1|  hypothetical protein MIMGU_mgv1a004547mg                205   1e-84    
ref|XP_007135432.1|  hypothetical protein PHAVU_010G128900g             220   1e-84    
gb|AED99875.1|  cytochrome P450                                         214   1e-84    
ref|XP_004168558.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    221   1e-84    
ref|XP_003517257.1|  PREDICTED: cytochrome P450 71D8-like               212   1e-84    
ref|XP_011025901.1|  PREDICTED: cytochrome P450 84A1-like               209   1e-84    
ref|XP_008791650.1|  PREDICTED: cytochrome P450 84A1-like               208   2e-84    
ref|XP_004501854.1|  PREDICTED: cytochrome P450 71A1-like               231   2e-84    
ref|XP_007204134.1|  hypothetical protein PRUPE_ppa023335mg             228   2e-84    
ref|NP_001063284.1|  Os09g0441100                                       219   2e-84    
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg                235   2e-84    
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              218   2e-84    
ref|XP_008781238.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    214   2e-84    
ref|XP_003607058.1|  Ferulate 5-hydroxylase                             201   2e-84    
gb|ACN40859.1|  unknown                                                 240   2e-84    
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            230   2e-84    
ref|XP_003520242.1|  PREDICTED: cytochrome P450 71D8-like               222   3e-84    
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                229   3e-84    
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                230   3e-84    
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    229   3e-84    
ref|XP_011028697.1|  PREDICTED: cytochrome P450 84A1-like               209   3e-84    
ref|XP_008337913.1|  PREDICTED: cytochrome P450 84A1-like               204   3e-84    
ref|NP_001061964.2|  Os08g0456200                                       214   3e-84    
ref|XP_008239349.1|  PREDICTED: cytochrome P450 71A1-like               233   3e-84    
ref|XP_004162327.1|  PREDICTED: cytochrome P450 71A1-like               284   3e-84    
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         219   3e-84    
ref|XP_007199246.1|  hypothetical protein PRUPE_ppa022388mg             198   4e-84    
ref|XP_010027102.1|  PREDICTED: cytochrome P450 71A1-like               221   4e-84    
gb|EAZ07221.1|  hypothetical protein OsI_29466                          214   4e-84    
ref|XP_010263873.1|  PREDICTED: cytochrome P450 84A1-like               208   4e-84    
ref|XP_009145966.1|  PREDICTED: cytochrome P450 84A1                    204   4e-84    
ref|XP_007012628.1|  Cytochrome P450 superfamily protein isoform 1      222   4e-84    
emb|CDP19009.1|  unnamed protein product                                227   4e-84    
ref|XP_009378429.1|  PREDICTED: cytochrome P450 84A1-like               202   5e-84    
ref|XP_006383141.1|  cytochrome P450 family protein                     209   5e-84    
ref|XP_008236853.1|  PREDICTED: cytochrome P450 84A1-like               197   5e-84    
gb|ACN40389.1|  unknown                                                 234   5e-84    
ref|XP_002272644.1|  PREDICTED: cytochrome P450 84A1                    207   5e-84    
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               220   5e-84    
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g             221   5e-84    
gb|ABR16821.1|  unknown                                                 217   5e-84    
gb|ACC63881.1|  coniferyl aldehyde 5-hydroxylase                        209   6e-84    
ref|XP_006437054.1|  hypothetical protein CICLE_v10033669mg             247   6e-84    
ref|XP_006427644.1|  hypothetical protein CICLE_v10025378mg             220   6e-84    
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             229   6e-84    
ref|XP_004236280.2|  PREDICTED: uncharacterized protein LOC101247804    228   6e-84    
ref|XP_010271496.1|  PREDICTED: cytochrome P450 84A1-like               210   6e-84    
ref|XP_006344492.1|  PREDICTED: cytochrome P450 71A4-like               234   6e-84    
gb|EMT12959.1|  Flavonoid 3'-monooxygenase                              223   6e-84    
ref|XP_011039208.1|  PREDICTED: cytochrome P450 71A1-like               205   6e-84    
ref|XP_008242319.1|  PREDICTED: flavonoid 3'-monooxygenase-like         226   7e-84    
ref|XP_003600322.1|  Cytochrome P450                                    220   7e-84    
gb|ABB02161.1|  ferulate 5-hydroxylase                                  206   7e-84    
ref|NP_001062713.1|  Os09g0264400                                       215   7e-84    
ref|XP_006426677.1|  hypothetical protein CICLE_v10025396mg             205   7e-84    
ref|XP_006850110.1|  hypothetical protein AMTR_s00022p00225440          240   8e-84    
ref|XP_003612110.1|  Cytochrome P450                                    207   8e-84    
gb|ABB02162.1|  ferulate 5-hydroxylase                                  207   9e-84    



>ref|XP_009617817.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   442 bits (1136),  Expect(2) = 4e-173, Method: Compositional matrix adjust.
 Identities = 242/389 (62%), Positives = 304/389 (78%), Gaps = 2/389 (1%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             M S+ +A  SIF+  L +F   RR        RKLPPGPR LPIIGNLH LGTLPHR L 
Sbjct  1     MFSIYIAFFSIFIGFLLYFIHLRRKAVPENVHRKLPPGPRSLPIIGNLHILGTLPHRTLY  60

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
             +LSKKYGPIM+LKLG VP VVVSSP  AELILKTHDAVFASRPK  AV+ ++DG+KG+AF
Sbjct  61    DLSKKYGPIMFLKLGNVPTVVVSSPETAELILKTHDAVFASRPKLKAVEYVSDGAKGLAF  120

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
             APYGP W   +KF TQELLTA KIESF  +R+ E+   V+ ++ AA G E V+L  +VG 
Sbjct  121   APYGPQWCNARKFCTQELLTAEKIESFAGMRKEEIGVLVRRLKVAAVGGEVVELGEKVGE  180

Query  615   LIENVTYKMLFGT-SNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRAL  791
             LI N+TY+MLFG   N+D  DLK IVQE+V L GAFNIADY+PFL+PFD+QGLNK+L+  
Sbjct  181   LIANITYRMLFGDFRNSDRFDLKNIVQEMVRLAGAFNIADYVPFLEPFDIQGLNKQLKET  240

Query  792   GKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDLASIKALLFDMI  971
             GK+V K+   I+ EHEQDA++G +K +KD+VD+ML S +N   S+ +D A++KA+L DMI
Sbjct  241   GKAVQKVLDTIINEHEQDARDGTRKGSKDLVDVML-SHQNCPKSYSIDRATMKAILSDMI  299

Query  972   VGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKES  1151
             VG++DTS+ WIEW  AEI+++ RVM  LQEEL + VGL+RMVEE+DLP LEYLE+V+KE+
Sbjct  300   VGAIDTSHTWIEWVFAEIVKHSRVMNKLQEELISVVGLDRMVEEQDLPKLEYLELVLKET  359

Query  1152  FRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             FRLHPVATLLVPRES+ED+ +NG++IPK+
Sbjct  360   FRLHPVATLLVPRESMEDVVINGYYIPKR  388


 Score =   196 bits (498),  Expect(2) = 4e-173, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK+SRVM NCWA+GHDP IWSDNVEEF PERF+ K++D+RGH FHLLPFGYGRR C
Sbjct  382   GYYIPKRSRVMTNCWALGHDPKIWSDNVEEFVPERFIGKNIDLRGHAFHLLPFGYGRRSC  441

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+NLGLI VKLIV QL+HCFNW+LP  M P +LDMTE FGLA+P+ Q+L+ +P+YRL
Sbjct  442   PGMNLGLITVKLIVAQLVHCFNWDLPEGMLPGDLDMTEKFGLAAPRAQNLLVIPTYRL  499



>ref|XP_006350392.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=507

 Score =   403 bits (1036),  Expect(2) = 1e-161, Method: Compositional matrix adjust.
 Identities = 217/393 (55%), Positives = 286/393 (73%), Gaps = 5/393 (1%)
 Frame = +3

Query  72    IMSSVGLALLSIF--LATLWWFFRHRRAEESSksgrklppgp--rplpiiGNLHQLGTLP  239
             ++SS+ + +++ F  L  L ++F H R   S+         P  R LPIIGNLH LG+LP
Sbjct  1     MLSSIYVVVVAFFSFLIGLLFYFIHFRWTPSALEKLHRKLPPGPRGLPIIGNLHILGSLP  60

Query  240   HRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGS  419
             HR    LSK YGP+M+LKLG +P V++SSP  AELILKTHDA+FASRPK  A+  + DG+
Sbjct  61    HRTFYNLSKTYGPLMFLKLGNIPTVIISSPETAELILKTHDAIFASRPKLKAINYMVDGT  120

Query  420   KGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLT  599
             KG+AFAP GP WR N+KF TQELLTA KI     +R+ E+   V+ ++   G    VDL 
Sbjct  121   KGLAFAPSGPRWRNNRKFCTQELLTAEKIGYSAGMRKEEIGVLVEKVKGFGGELVVVDLG  180

Query  600   AEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKR  779
               +G LI N+TY+MLFG  N++  DLK IV+E+V L G FN+ADY+PFL+PFD+QGLNK+
Sbjct  181   ERIGDLIGNMTYRMLFGEGNSERFDLKNIVKEMVRLSGTFNVADYVPFLEPFDIQGLNKQ  240

Query  780   LRALGKSVDKLFLEIVKEHEQDAKNGVQKS-NKDIVDMMLASMKNPSSSHKLDLASIKAL  956
             L+  GK V ++F  I+ EHEQDA N   KS NKD+VD+ML+   NP+SS+ +D A++KA+
Sbjct  241   LKETGKRVQEIFDTIINEHEQDANNYTHKSKNKDLVDIMLSYQDNPNSSYSIDRATMKAI  300

Query  957   LFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEM  1136
             L DMIVG++DTS+ WIEW  AEI+++P VM  LQ+EL + VGL+RMVEE DLP LEYLE+
Sbjct  301   LSDMIVGAIDTSHTWIEWVFAEIIKHPTVMNKLQDELTSIVGLDRMVEEDDLPKLEYLEL  360

Query  1137  VIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             V+KE+FRLHPVA LLVPRES+ED+ +N  +IPK
Sbjct  361   VLKETFRLHPVAPLLVPRESIEDVVINECYIPK  393


 Score =   196 bits (498),  Expect(2) = 1e-161, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SRVMINCWA+GHDP IWSDNVE+F PERF+ K++++RGHDFHLLPFGYGRR CPG+N
Sbjct  392   PKGSRVMINCWALGHDPKIWSDNVEKFIPERFIGKNINLRGHDFHLLPFGYGRRSCPGIN  451

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             LGLI VKLIV QL+HCFNW+LP+ + P +LDMTE FGLA+P+ Q+L+ +P+YRLL
Sbjct  452   LGLITVKLIVAQLVHCFNWDLPDGILPDDLDMTEKFGLAAPRAQNLLVIPTYRLL  506



>ref|XP_004237368.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=502

 Score =   394 bits (1013),  Expect(2) = 5e-158, Method: Compositional matrix adjust.
 Identities = 218/385 (57%), Positives = 287/385 (75%), Gaps = 5/385 (1%)
 Frame = +3

Query  84    VGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELS  263
             V +A  S  ++ L++F   R   E     RKLPPGPR +PIIGNLH LGTLPHR L  LS
Sbjct  7     VVVAFFSFLISLLFYFIHFRWTPEK--LHRKLPPGPRGIPIIGNLHILGTLPHRTLYNLS  64

Query  264   KKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPY  443
             K YGPIM+LKLG +P V++SSP  AEL+L+THDA FASRPK  A+  ++DG+KG+AFA Y
Sbjct  65    KTYGPIMFLKLGNIPTVIISSPETAELVLRTHDAAFASRPKLKAIHYMSDGTKGLAFAAY  124

Query  444   GPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIE  623
             GP WR N+KF TQELLTA KI     +R+ E+   V  ++   G  E V+L  ++G LI 
Sbjct  125   GPQWRNNRKFCTQELLTAEKIGYSAGMRKEEIGVLVDEVKGFGG--ELVNLGKKIGDLIG  182

Query  624   NVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSV  803
             N+TY+MLFG  N++  DL+ IV+E+V L G FN+ADY+PFL+PFD+QGLNK+L+  GK V
Sbjct  183   NMTYRMLFGDGNSERFDLENIVKEMVRLAGIFNVADYVPFLEPFDIQGLNKQLKEAGKRV  242

Query  804   DKLFLEIVKEHEQDAKNGVQKS-NKDIVDMMLASMKNPSSSHKLDLASIKALLFDMIVGS  980
              ++F  I+ EHEQDA+N   KS NKD+VD+ML+   NP+SS+ +D A++KA+L DMIVG+
Sbjct  243   QEVFDTIINEHEQDARNYTHKSKNKDLVDIMLSYQDNPNSSYSIDRATMKAILSDMIVGA  302

Query  981   VDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRL  1160
             +DTS+ WIEW  AEI+++P VM  LQ+EL + VGL+RMVEE DL  LEYLE+V+KE+FRL
Sbjct  303   IDTSHTWIEWVFAEIIKHPTVMNKLQDELTSIVGLDRMVEEDDLLKLEYLELVLKETFRL  362

Query  1161  HPVATLLVPRESLEDIELNGHFIPK  1235
             HPVA LLVPRES+ED+ ++  +IPK
Sbjct  363   HPVAPLLVPRESIEDVVISECYIPK  387


 Score =   193 bits (490),  Expect(2) = 5e-158, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFM-SKSVDIRGHDFHLLPFGYGRRVCPGV  1407
             PK SRVMINCWA+GHDP+IWSDNVEEF PERF+  K  D+RGHDFHLLPFGYGRR CPG+
Sbjct  386   PKGSRVMINCWALGHDPNIWSDNVEEFIPERFIGKKKTDLRGHDFHLLPFGYGRRSCPGI  445

Query  1408  NLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             NLGLI VKLIV QL+HCFNW+LP+ + P +LDMTE FGLA+P+ Q L+ +P+YRLL
Sbjct  446   NLGLITVKLIVAQLVHCFNWDLPDGIFPVDLDMTEKFGLAAPRAQDLLVIPTYRLL  501



>ref|XP_009346975.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   367 bits (943),  Expect(2) = 8e-144, Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 276/386 (72%), Gaps = 7/386 (2%)
 Frame = +3

Query  96    LLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKKYG  275
             L+ +FL  LW   R   A  SS+  R LPPGP  LPIIGNLH LG LPHR+L  L+KKYG
Sbjct  9     LILVFLTFLWSLLRLINA--SSRQSRTLPPGPMALPIIGNLHMLGDLPHRSLQNLAKKYG  66

Query  276   PIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHW  455
             PIM ++LG +P +VVSSP  A+L LKTHD +FASRPK  A + +A G+K MAF+ YGP+W
Sbjct  67    PIMSMRLGSIPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFSEYGPYW  126

Query  456   RGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTY  635
             R  +K  T +LL  +KIESF  LRR E+   V+S++ AA   E VD + +VG L+E +TY
Sbjct  127   RHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITY  186

Query  636   KMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLF  815
             +M+ G  N+D  DLK I++E + L GAFNI+DY+PFL P D+QGL KR++ + K+VD+L 
Sbjct  187   RMVLGRKNDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDVQGLTKRMKRVSKTVDQLL  246

Query  816   LEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----SSSHKLDLASIKALLFDMIVGS  980
              +I+++HEQ +++     +KD VD++L+S+  P        + L+  + KA+L DMI G+
Sbjct  247   EKIIQDHEQGSRSEQGNHHKDFVDVLLSSIHQPLKPNDEEVYMLERTNAKAILLDMIAGA  306

Query  981   VDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRL  1160
              DTS   I WTLAE++R+P+VMK LQEEL++ +G++RMVEE DLP L+YL MV+KES RL
Sbjct  307   FDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKESLRL  366

Query  1161  HPVATLLVPRESLEDIELNGHFIPKK  1238
             HPVA LLVP +S+EDI ++G+ IPKK
Sbjct  367   HPVAPLLVPHQSMEDITVDGYHIPKK  392


 Score =   172 bits (437),  Expect(2) = 8e-144, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+ IN W IG DPS+WSDNVEEF+PERFM+ +VD+RGHDF L+PFG GRR C
Sbjct  386   GYHIPKKSRIFINIWTIGRDPSVWSDNVEEFYPERFMNSNVDLRGHDFQLIPFGSGRRGC  445

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+  +G L+HCFNWELP+ M P +LDMTE FGL+  K +HL+A+P+ RL
Sbjct  446   PAMQLGLTTVRFALGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRL  503



>ref|XP_009336569.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   364 bits (934),  Expect(2) = 4e-143, Method: Compositional matrix adjust.
 Identities = 205/393 (52%), Positives = 277/393 (70%), Gaps = 6/393 (2%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             MS   +A+L + L T  W    R    SS+ GRKLPPGP  LP+IGNLH LG LPHR+L 
Sbjct  1     MSPPEIAILILVLLTFLWSLL-RLINASSRQGRKLPPGPSALPVIGNLHMLGDLPHRSLQ  59

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              L+KKYGPIM + LG +P +VVSSP  A+L LKTHD +FASRPK  A + +A G+K MAF
Sbjct  60    NLAKKYGPIMSMHLGSIPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAF  119

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
               YGP+WR  +K  T +LL  +KIESF  LRR E+   V+S++ AA   E VD + +VG 
Sbjct  120   TEYGPYWRHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGE  179

Query  615   LIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALG  794
             L+E +TY+M+ G  N+D  DLK I++E + L GAFNI+DY+PFL P DLQGL KR++ + 
Sbjct  180   LVEGITYRMVLGRKNDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVS  239

Query  795   KSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----SSSHKLDLASIKALL  959
             K+VD+L  +I+++HE  ++    K +KD VD++L+S+  P        + L+  + KA+L
Sbjct  240   KTVDQLLEKIIQDHELVSRREQGKHHKDFVDVLLSSIHQPLNPNDEEVYMLERTNAKAIL  299

Query  960   FDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMV  1139
              DMI G+ DTS   I WTLAE++R+P+VMK LQEEL++ +G++RMVEE DLP L+YL MV
Sbjct  300   LDMIAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMV  359

Query  1140  IKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +KES RLHPVA LLVP +S+EDI ++G+ IPKK
Sbjct  360   VKESLRLHPVAPLLVPHQSMEDITVDGYHIPKK  392


 Score =   174 bits (441),  Expect(2) = 4e-143, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+ IN W IG DPS+WSDNVEEF+PERFM+ +VD+RGHDF L+PFG GRR C
Sbjct  386   GYHIPKKSRIFINIWTIGRDPSVWSDNVEEFYPERFMNSNVDLRGHDFQLIPFGSGRRGC  445

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L +G L+HCFNWELP+ M P +LDMTE FGL+  K +HL+A+P+ RL
Sbjct  446   PAMQLGLTTVRLALGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRL  503



>ref|XP_002275826.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=506

 Score =   358 bits (918),  Expect(2) = 6e-142, Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 254/349 (73%), Gaps = 7/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHRNL+ L++KYGPIM ++LG VP +VVSSP AAEL LKTHDAVFASRPK 
Sbjct  44    GNLHMLGNLPHRNLSRLARKYGPIMSMRLGYVPTIVVSSPEAAELFLKTHDAVFASRPKI  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + +  G KGMAF  YGP+WR  +K  T ELLT  KI+SF  +R+ E+   V+S++  
Sbjct  104   QASEYLCYGRKGMAFTEYGPYWRNARKLCTLELLTKVKIDSFAAMRKEELGVLVQSLKQM  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNN-DNHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A  RE V+++ +VG LIE++T++MLFG   +    DLK +VQE + L+GAFNIADY+PFL
Sbjct  164   AAAREVVNISKKVGELIEDMTHRMLFGRCKDYQRADLKALVQETLILVGAFNIADYVPFL  223

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
                DLQGL +R++A+  +VD +  +++ EH+QDA    Q ++KD VD+ML+ M    + H
Sbjct  224   GALDLQGLKRRMKAISGAVDHILEKVIDEHKQDASEN-QGNHKDFVDVMLSLMNEMKNFH  282

Query  927   K-----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
             +     ++  +IK +++D+I+G++DTS   IEW L+E+ R+PRVM+ LQEELEN +G+ R
Sbjct  283   QEPSYLIEQENIKGIVWDIIIGAIDTSATTIEWLLSELFRHPRVMRQLQEELENVIGMER  342

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL NL YL+MV+KE  RLHP   LL+P ES+EDI LNG++IPKK
Sbjct  343   MVEEVDLANLVYLDMVLKEGLRLHPAGPLLLPHESIEDITLNGYYIPKK  391


 Score =   176 bits (446),  Expect(2) = 6e-142, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PKKSR++IN WAIG DP+IWS+NVE+FFPERF+  ++D +G DF  +PFG GRR 
Sbjct  384   NGYYIPKKSRIIINAWAIGRDPNIWSNNVEDFFPERFIGSNIDFQGKDFQFIPFGSGRRK  443

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             CPG+ LGLINV+L++ QL+HCF+W+LPN M P ELDM+E FGLA P+  HL A+P+YRLL
Sbjct  444   CPGMQLGLINVRLVLAQLVHCFDWKLPNGMLPSELDMSEEFGLALPRATHLHALPTYRLL  503



>ref|XP_008374738.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=529

 Score =   361 bits (926),  Expect(2) = 9e-142, Method: Compositional matrix adjust.
 Identities = 206/394 (52%), Positives = 282/394 (72%), Gaps = 7/394 (2%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             MS   +A+L +   T  W   H     SS+  RKLPPGP PLPIIGNLH LG LPHR+L 
Sbjct  22    MSPSEIAILILVFLTFLWSLLHL-INASSRQSRKLPPGPTPLPIIGNLHMLGDLPHRSLQ  80

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              L+KKYGPIM ++LG +P +VVSSP AA+L LKTHD +FASRPK  A + +A GSK MAF
Sbjct  81    NLAKKYGPIMSMRLGFIPTIVVSSPKAAKLFLKTHDTIFASRPKLQAFEYMAYGSKVMAF  140

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
               YGP+WR  +K  T +LL  +KIE F  LRR E+   V+S++ AA G E VD + +VG 
Sbjct  141   IEYGPYWRHIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEGGEVVDFSEKVGE  200

Query  615   LIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALG  794
             L+E +TY+M+ G  N+D  DLK I++E + L GAFNI+DY+PFL P DLQGL KR++ + 
Sbjct  201   LVEGITYRMVLGRKNDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVS  260

Query  795   KSVDKLFLEIVKEHEQDAKNGVQKS-NKDIVDMMLASMKNP-----SSSHKLDLASIKAL  956
             K VD+L  +I+++HEQ +++ VQ + +KD VD++L+S+  P        + L+  ++KA+
Sbjct  261   KIVDQLLEKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNNEEVYMLERTNVKAI  320

Query  957   LFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEM  1136
             L DMIVG++DTS   I WTLAE++R+P+VMK LQEEL++ + ++RMVEE DLP L+YL  
Sbjct  321   LLDMIVGALDTSTTAIVWTLAELLRHPKVMKRLQEELKSVIRMDRMVEESDLPKLDYLST  380

Query  1137  VIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             V+K+S RLHP+A LLVP +S+EDI ++G+ IPKK
Sbjct  381   VVKDSLRLHPIAPLLVPHQSMEDITVDGYHIPKK  414


 Score =   172 bits (436),  Expect(2) = 9e-142, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV IN W IG DPS+WSDNVEEF+ ERFM+ +VD+RGHDF L+PFG GRR C
Sbjct  408   GYHIPKKSRVFINIWTIGRDPSVWSDNVEEFYNERFMNNNVDLRGHDFQLIPFGSGRRGC  467

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L++G L+HCFNWELP+ M P +LDMTE FGL+  K +HL+A+P+ RL
Sbjct  468   PAMQLGLTTVRLVLGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRL  525



>ref|XP_008240284.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=509

 Score =   366 bits (940),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/395 (51%), Positives = 274/395 (69%), Gaps = 9/395 (2%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             MS   +A+L +FL  L   F       SS+      P   P+   GNLH LG LPHR+L 
Sbjct  1     MSPTIIAILLVFLTFLCSLFHTIITASSSRPKLPPGPRALPII--GNLHMLGNLPHRSLQ  58

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              L+KKYGPIM ++LG +PA+VVSSP AAEL LKTHD +FASRPK  A + ++ G+KGMAF
Sbjct  59    HLAKKYGPIMSMRLGNIPAIVVSSPTAAELFLKTHDTIFASRPKVQASEYMSYGTKGMAF  118

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
               YGP+WR  +K  T +LL  +KIE    LRR E+  +++S++ AA   E VDL+ +VG 
Sbjct  119   TEYGPYWRHIRKLCTLQLLCPSKIEGSAPLRREEVGLFIQSLKKAAAAGEVVDLSEKVGG  178

Query  615   LIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALG  794
             L+E++TY+M+ G+ N+D  DLK  +QE + L GAFNI DY+PFL P DLQGL KR++ + 
Sbjct  179   LVEDITYRMVLGSKNDDMFDLKGTIQEALFLSGAFNIGDYVPFLSPLDLQGLAKRMKRIS  238

Query  795   KSVDKLFLEIVKEHEQDAKNG-VQ-KSNKDIVDMMLASMKNP-----SSSHKLDLASIKA  953
             K++D+LF +I+ EHEQ +K+G VQ  S+KD VD++L+ +  P        + ++  ++KA
Sbjct  239   KTIDQLFEKIIGEHEQVSKSGQVQGHSHKDFVDVLLSLIHQPLNPNDEKVYMMERTNVKA  298

Query  954   LLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLE  1133
             +L DMI G+ DTS   I WTLAE++R+PRVMK LQEEL++ +G++RMVEE DLP L YL 
Sbjct  299   ILLDMISGAFDTSATTIVWTLAELLRHPRVMKHLQEELQSVIGMDRMVEESDLPKLCYLS  358

Query  1134  MVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MV+KES RLHPVA LL+P ES+EDI + G  IPKK
Sbjct  359   MVVKESLRLHPVAPLLIPHESMEDITVEGFDIPKK  393


 Score =   166 bits (419),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+ IN WAIG DP +WS+NVEEF+ ERF+  ++D+RGHDF LLPFG GRR C
Sbjct  387   GFDIPKKSRIFINTWAIGRDPKVWSENVEEFYTERFIDGNIDLRGHDFQLLPFGSGRRGC  446

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V L +  L+HCFNWELP+ + P +LDMTE FGL+  K +HL A+P+YRL
Sbjct  447   PAMQLGLTTVCLALANLVHCFNWELPSGLKPKDLDMTEKFGLSLSKAKHLFAMPTYRL  504



>ref|XP_007209911.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
 gb|EMJ11110.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
Length=513

 Score =   358 bits (920),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 254/350 (73%), Gaps = 7/350 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  L+KKYGPIM ++LG  PA+VVSSP AAEL LKTHD +FASRPK 
Sbjct  48    GNLHMLGNLPHRSLQHLAKKYGPIMSMRLGNTPAIVVSSPTAAELFLKTHDTIFASRPKV  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G+KGMAF  YGP+WR  +K  T +LL  +KIE F  LRR E+  +++S++ A
Sbjct  108   QASEYMSYGTKGMAFTEYGPYWRHIRKLCTLQLLCPSKIEGFAPLRREEVGLFIQSLKKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VDL+ +VG L+E++TY+M+ G+ N+D  DLK  ++E + L GAFNI DY+PFL 
Sbjct  168   AAAGEMVDLSEKVGGLVEDITYRMVLGSKNDDMFDLKGTIEEALFLSGAFNIGDYMPFLS  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNG-VQK-SNKDIVDMMLASMKNP---  914
             P DLQGL KR++ + K++D+LF +I+ EHEQ +K+G VQ  S+KD VD++L+ +  P   
Sbjct  228   PLDLQGLAKRMKRISKTIDQLFEKIIGEHEQVSKSGQVQDHSHKDFVDVLLSLIHQPLNP  287

Query  915   --SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
                  + ++  ++KA+L DMI G+ DTS   I WTLAE++R+PRVMK LQ E+++ +G +
Sbjct  288   NDEQVYMMERTNVKAILLDMISGAFDTSATAIVWTLAELLRHPRVMKHLQGEIQSVIGTD  347

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             RMVEE DLP L YL MV+KES RLHPVA  L+P ES+EDI + G  +PKK
Sbjct  348   RMVEESDLPKLGYLSMVVKESLRLHPVAPFLIPHESMEDITVEGFDVPKK  397


 Score =   172 bits (437),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+ IN WAIG DP +WS+NVEEF+PERF+  ++D+RGHDF LLPFG GRR C
Sbjct  391   GFDVPKKSRIFINTWAIGRDPKVWSENVEEFYPERFIDGNIDLRGHDFQLLPFGSGRRGC  450

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGLI V+L +  L+HCFNWELP+ + P +LDMTE FGL+  K +HL A+P+YRL
Sbjct  451   PAMQLGLITVRLALANLVHCFNWELPSGLKPEDLDMTEKFGLSLSKAKHLFAMPTYRL  508



>ref|XP_008360900.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=504

 Score =   364 bits (935),  Expect(2) = 8e-141, Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 250/352 (71%), Gaps = 9/352 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  L+KKYGPIM ++LG    +VVSSP  AEL LKTHD +FASRPK 
Sbjct  40    GNLHMLGNLPHRSLQHLAKKYGPIMSMRLGSKTTIVVSSPKVAELFLKTHDTIFASRPKV  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              +   ++ G+KGM F+ YGP+WR  +K  T +LL  +KIE F  LRR E+   V+S++ A
Sbjct  100   QSSDYLSYGTKGMGFSEYGPYWRHIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKKA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
                 E VDL+ +VG LIE +TY+M+ G+ N+D  D+K I++EI+ L GA NI DY+PFL 
Sbjct  160   TEAGEVVDLSEKVGELIEGITYRMVLGSKNDDTFDVKGIIEEIMLLTGAVNIGDYVPFLS  219

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKN----GVQKSNKDIVDMMLASMKNP-  914
             PFD+QGLNKR++ L K++D+L  +I+ EHEQ +K+    G  +++KD V+M+L+ M  P 
Sbjct  220   PFDIQGLNKRMKTLSKTIDQLLEKIIGEHEQVSKSKQLQGRPQNHKDFVEMLLSLMNQPL  279

Query  915   ----SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVG  1082
                    + +D  ++KA+L DMI G+ DTS   I W LAE++R+PRVMKLLQ+EL+  +G
Sbjct  280   NPNDEQVYVVDRTNVKAILLDMISGAFDTSATAIVWNLAELLRHPRVMKLLQQELQTVIG  339

Query  1083  LNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             ++R VEE DLP L YL  VIKESFRLHPVA LL+P  S+EDI ++G+ IPKK
Sbjct  340   MDRTVEESDLPKLAYLNKVIKESFRLHPVAPLLIPHASMEDITVDGYHIPKK  391


 Score =   166 bits (419),  Expect(2) = 8e-141, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS + +N W IG DPS+WSDNVEEF+PERF    VD++GHDF LLPFG GRR C
Sbjct  385   GYHIPKKSTIFVNIWTIGRDPSVWSDNVEEFYPERFNDSDVDLKGHDFQLLPFGSGRRGC  444

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L +  L+HCFN++LP+ + P+ELDMTETFGL+  K +HL+ VP+YRL
Sbjct  445   PAMQLGLTTVRLALANLVHCFNFDLPSGLLPNELDMTETFGLSLSKTKHLLVVPTYRL  502



>sp|H2DH18.1|C7A12_PANGI RecName: Full=Cytochrome P450 CYP736A12 [Panax ginseng]
 gb|AEY75215.1| cytochrome P450 CYP736A12 [Panax ginseng]
Length=500

 Score =   355 bits (912),  Expect(2) = 2e-140, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 249/348 (72%), Gaps = 7/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPHR L  L+KKYGPIM ++LG VP +VVSSP AAEL LKTHD +FASRPK 
Sbjct  44    GSLHTLGALPHRTLQTLAKKYGPIMSMRLGSVPTIVVSSPQAAELFLKTHDNIFASRPKL  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G+ GM+F  YGPHWR  +KF   ELLT AKI SF  +RR E+   VKSI+ A
Sbjct  104   QAAEYMSYGTMGMSFTAYGPHWRNIRKFVVLELLTPAKINSFVGMRREELGTVVKSIKEA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E VDL+A+V  +IEN+TY++L G + +D +DLK I+ E ++L G FNIAD++PFL 
Sbjct  164   SAANEVVDLSAKVANIIENMTYRLLLGRTKDDRYDLKGIMNEALTLAGRFNIADFVPFLG  223

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
             P D+QGL ++ +  GK +DK+   I+ EHEQ++ NG   ++ D +D ML+    PS++H 
Sbjct  224   PLDIQGLTRQFKDTGKRLDKILEFIIDEHEQNSSNG--NASGDFIDDMLSLKNKPSNTHD  281

Query  930   -----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                  +D + IKA++ D+I  ++DTS   IEW L E++++PR MK  QEE++  VG++RM
Sbjct  282   ELSKVIDRSVIKAIMIDIISAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRM  341

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DLPNLEY+ MV+KE  RLHPVA LL P ES+EDI +NG+FIPK+
Sbjct  342   VEETDLPNLEYVYMVVKEGLRLHPVAPLLGPHESMEDITINGYFIPKQ  389


 Score =   173 bits (438),  Expect(2) = 2e-140, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK+SRV++N WA+G DP++WS+N EEF PERF   +VD+RG DF LLPFG GRR C
Sbjct  383   GYFIPKQSRVIVNSWALGRDPNVWSENAEEFLPERFEGSNVDVRGRDFQLLPFGSGRRGC  442

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGLI V+L+V +L+HCF+W LPN  +P  LDMTE FGL +P+V+HL+AVP YRL
Sbjct  443   PGMQLGLITVQLVVARLVHCFDWNLPNGTTPDNLDMTEKFGLTTPRVKHLLAVPKYRL  500



>gb|AAL66194.1|AF386512_1 cytochrome P450 [Pyrus communis]
Length=506

 Score =   367 bits (942),  Expect(2) = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/386 (53%), Positives = 274/386 (71%), Gaps = 7/386 (2%)
 Frame = +3

Query  96    LLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKKYG  275
             L+ +FL  LW   R      SS+  R LPPGP  LPIIGNLH LG LPHR+L  L+KKYG
Sbjct  9     LILVFLTFLWSLLR--LINVSSRQSRTLPPGPAALPIIGNLHMLGDLPHRSLQNLAKKYG  66

Query  276   PIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHW  455
             PIM ++LG VP +VVSSP  A+L LKTHD +FASRPK  A + +A G+K MAF  YGP+W
Sbjct  67    PIMSMRLGSVPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFTEYGPYW  126

Query  456   RGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTY  635
             R  +K  T +LL  +KIESF  LRR E+   V+S++ AA   E VD + +VG L+E +TY
Sbjct  127   RHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITY  186

Query  636   KMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLF  815
             +M+ G  N+D  DLK I++E + L GAFNI+DY+PFL P DLQGL KR++ + K+VD+LF
Sbjct  187   RMVLGRKNDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKTVDQLF  246

Query  816   LEIVKEHEQDAKNGVQKSNKDIVDMMLASM-----KNPSSSHKLDLASIKALLFDMIVGS  980
              +I+++HEQ +++     +KD VD++L+S+      N    + L+  + KA L DMI G+
Sbjct  247   EKIIQDHEQVSRSEQGNHHKDFVDVLLSSIHQTLKPNDEEVYMLERTNAKATLLDMIAGA  306

Query  981   VDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRL  1160
              DTS   I WTLAE++R+P+VMK LQEEL++ +G++RMVEE DLP L+YL MV+KESFRL
Sbjct  307   FDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKESFRL  366

Query  1161  HPVATLLVPRESLEDIELNGHFIPKK  1238
             HPVA LLVP +S+EDI ++G+  PKK
Sbjct  367   HPVAPLLVPHQSMEDITVDGYHTPKK  392


 Score =   161 bits (407),  Expect(2) = 4e-140, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+ IN W IG DP  W DN EEF+PERFM+++VD+RGHDF L+PFG GRR C
Sbjct  386   GYHTPKKSRIFINIWTIGRDPKSW-DNAEEFYPERFMNRNVDLRGHDFQLIPFGSGRRGC  444

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L +G L+HC NWELP+ M P +LDMTE FGL+  K +HL+A P+ RL
Sbjct  445   PAMQLGLTTVRLALGNLLHCSNWELPSGMLPKDLDMTEKFGLSLSKAKHLLATPTCRL  502



>dbj|BAD15331.1| cytochrome P450 [Panax ginseng]
Length=500

 Score =   357 bits (916),  Expect(2) = 5e-140, Method: Compositional matrix adjust.
 Identities = 184/348 (53%), Positives = 250/348 (72%), Gaps = 7/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPHR L  L+KKYGPIM ++LG VP +VVSSP AAEL LKTHD +FASRPK 
Sbjct  44    GSLHTLGALPHRTLQTLAKKYGPIMSMRLGSVPTIVVSSPQAAELFLKTHDNIFASRPKL  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G+KGM+F  YGPHWR  +KF   ELLT AKI SF  +RR E+   VKSI+ A
Sbjct  104   QAAEYMSYGTKGMSFTAYGPHWRNIRKFVVLELLTPAKINSFVGMRREELGMVVKSIKEA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E VDL+A+V  +IEN+TY++L G + +D +DLK I+ E ++L G FNIAD++PFL 
Sbjct  164   SAANEVVDLSAKVANIIENMTYRLLLGRTKDDRYDLKGIMNEALTLAGRFNIADFVPFLG  223

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
             P D+QGL ++ +  GK +DK+   I+ EHEQ++ NG   ++ D +D ML+    PS++H 
Sbjct  224   PLDIQGLTRQFKDTGKRLDKILEFIIDEHEQNSSNG--NASGDFIDDMLSLKNKPSNTHD  281

Query  930   -----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                  +D + IKA++ D+I  ++DTS   IEW L E++++PR MK  QEE++  VG++RM
Sbjct  282   ELSKVIDRSVIKAIMIDIISAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRM  341

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DLPNLEY+ MV+KE  RLHPVA LL P ES+EDI +NG+FIPK+
Sbjct  342   VEETDLPNLEYVYMVVKEGLRLHPVAPLLGPHESMEDITINGYFIPKQ  389


 Score =   170 bits (431),  Expect(2) = 5e-140, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK+SRV++N WA+G DP++WS++ +EF PERF   ++D+RG DF LLPFG GRR C
Sbjct  383   GYFIPKQSRVIVNSWALGRDPNVWSEDADEFLPERFEGSNIDVRGRDFQLLPFGSGRRGC  442

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGLI V+L+V +L+HCF+W LPN ++P  LDMTE FGL +P+V+HL+AVP YRL
Sbjct  443   PGMQLGLITVQLVVARLVHCFDWNLPNGITPDNLDMTEKFGLTTPRVKHLLAVPKYRL  500



>ref|XP_008374739.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=508

 Score =   354 bits (908),  Expect(2) = 6e-140, Method: Compositional matrix adjust.
 Identities = 202/387 (52%), Positives = 274/387 (71%), Gaps = 8/387 (2%)
 Frame = +3

Query  96    LLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKKYG  275
             L+ +FL  LW   R   A  SS+  RKLPPGP  LPIIGNLH LG LPHR+L  L+KKYG
Sbjct  9     LILVFLTFLWSLLRLINA--SSRQSRKLPPGPTALPIIGNLHMLGNLPHRSLQNLAKKYG  66

Query  276   PIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHW  455
             PIM ++LG +P +VVSSP  A+L LKTHD +FAS PK  A + +A G+K MAF  YGP+W
Sbjct  67    PIMSMRLGFIPTIVVSSPKTAKLFLKTHDNIFASXPKLQASEYMAYGTKAMAFTEYGPYW  126

Query  456   RGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTY  635
                +K  T +LL  +KIE F  LRR E+   V+S++ AA   E VD + +VG L+E +TY
Sbjct  127   XRIRKLYTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITY  186

Query  636   KMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLF  815
             +M+ G  N+D  DLK I++E + L GAFNI+DY+PFL P DLQGL KR++ + K VD+L 
Sbjct  187   RMVLGRKNDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKXVDQLL  246

Query  816   LEIVKEHEQDAKNGVQKS-NKDIVDMMLASMKNP-----SSSHKLDLASIKALLFDMIVG  977
              +I+++HEQ +++ VQ + +KD VD++L+S+  P        + L+  + KA+L DMI G
Sbjct  247   EKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNBEEVYMLERTNXKAILLDMIAG  306

Query  978   SVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFR  1157
             + DTS   I WTLAE++R+P+VMK LQEEL++ +G++RMVEE DLP L+YL MV+KES R
Sbjct  307   AXDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKESLR  366

Query  1158  LHPVATLLVPRESLEDIELNGHFIPKK  1238
             L PVA LLVP +S+EDI ++G+ IPKK
Sbjct  367   LXPVAPLLVPHQSMEDITVDGYHIPKK  393


 Score =   173 bits (438),  Expect(2) = 6e-140, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV IN W IG DPS+WSDNVEEF+PERFM+ +VD+RGHDF L+PFG GRR C
Sbjct  387   GYHIPKKSRVFINIWTIGRDPSVWSDNVEEFYPERFMNNNVDLRGHDFQLIPFGSGRRGC  446

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
               + LGL  V+L++G L+HCFNWELP+ M P +LDMTE FGL+  K +HL+A+P+ RL
Sbjct  447   XAMQLGLTTVRLVLGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRL  504



>ref|XP_009337234.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=504

 Score =   361 bits (927),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 251/352 (71%), Gaps = 9/352 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  L+KKYGPIM ++LG    +VVSSP  AEL LKTHD +FASRPK 
Sbjct  40    GNLHMLGNLPHRSLQHLAKKYGPIMSMRLGSKTTIVVSSPKVAELFLKTHDTIFASRPKV  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              +   ++ G+KGM F+ YGP+WR  +K  T +LL  +KIE F  LRR E+   V+ ++ A
Sbjct  100   QSSDYLSYGTKGMGFSEYGPYWRHIRKLCTLQLLCQSKIEGFAPLRREEVGLLVQWLKKA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VDL+ +VG LIE++TY+M+ G+ N+D  D+K I++E++ L GA NI DY+PFL 
Sbjct  160   AKAGEVVDLSEKVGELIEDITYRMVLGSKNDDTFDVKGIIEEVMLLTGAVNIGDYVPFLS  219

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKN----GVQKSNKDIVDMMLASMKNP-  914
             PFD+QGLNKR++ L K++D+L  +I+ EHEQ +K+    G  +++KD V+M+L+ M  P 
Sbjct  220   PFDIQGLNKRMKRLSKTIDQLLEKIIGEHEQVSKSEQLQGRPQNHKDFVEMLLSLMNQPL  279

Query  915   ----SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVG  1082
                    + +D  ++KA+L DMI G+ DTS   I W LAE++R+PRVMKLLQ+EL+  +G
Sbjct  280   NPNDEQVYVVDRTNVKAILLDMISGAFDTSATAIVWNLAELLRHPRVMKLLQQELQTVIG  339

Query  1083  LNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             ++R VEE DLP L YL  V+KESFRLHPVA LL+P  S+EDI ++G+ IPKK
Sbjct  340   MDRTVEESDLPKLAYLNKVVKESFRLHPVAPLLIPHASMEDITVDGYHIPKK  391


 Score =   165 bits (418),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS + +N W IG DPS+WSDNVEEF+PERF    VD++GHDF LLPFG GRR C
Sbjct  385   GYHIPKKSTIFVNIWTIGRDPSVWSDNVEEFYPERFNDSDVDLKGHDFQLLPFGSGRRGC  444

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L +  L+HCFN++LP+ + P+ELDMTETFGL+  K +HL+ VP+YRL
Sbjct  445   PAMQLGLTTVRLALANLVHCFNFDLPSGLLPNELDMTETFGLSLSKTKHLLVVPTYRL  502



>ref|XP_009337209.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   352 bits (904),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/395 (49%), Positives = 275/395 (70%), Gaps = 7/395 (2%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             MS     +L +   T  WF        SS+  + LPPGPR LPIIGNLH LG LPHR+L 
Sbjct  1     MSPSETTILILVFLTFLWFLLRILINASSRQSQILPPGPRALPIIGNLHMLGNLPHRSLQ  60

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              L+KKYGPIM ++LG    +VVSSP AAEL LKTHD +FASRP+  + K+++ G+K MAF
Sbjct  61    NLAKKYGPIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQSSKHMSYGTKAMAF  120

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
             + YGP+WR  +K  T +LL+ ++IE+F  LR+ E+   V+S++ AA   E VDL+ +V  
Sbjct  121   SEYGPYWRHVRKLCTLQLLSPSRIEAFAPLRKEEVGLLVQSLKVAAEAGEVVDLSEKVSD  180

Query  615   LIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALG  794
             L+  +TY+M+ G  NN+  DLK I++E++ L GAFNI+DY+PFL P DLQGL KR++ + 
Sbjct  181   LVVGITYRMVLGRKNNEMFDLKGIIEEVMFLSGAFNISDYVPFLIPLDLQGLTKRMKRIS  240

Query  795   KSVDKLFLEIVKEHEQDAKNGVQKSN--KDIVDMMLASMKNP-----SSSHKLDLASIKA  953
             K+VD+LF +I+++HEQ +++   + N  KD VD++L+ +  P        +  +  + KA
Sbjct  241   KTVDQLFEKIIQDHEQVSRSEQVQGNHHKDFVDVLLSLIHQPLNPNDEEVYMFERTNAKA  300

Query  954   LLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLE  1133
             +L DMI GS DTS   I WTLAE++R+P VMK LQ+EL++ VG++RMVEE DLP L+YL 
Sbjct  301   ILLDMISGSFDTSATAIVWTLAELLRHPEVMKRLQKELQSVVGVDRMVEESDLPKLDYLS  360

Query  1134  MVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MV+KE+ RLHPV  LL+P +S+ED+ ++G+ IPKK
Sbjct  361   MVVKETLRLHPVGPLLIPHQSMEDVIVDGYHIPKK  395


 Score =   173 bits (439),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV IN W IG DP++WSDNVEEF+PERFM+ +VD++GHDF L+PFG GRR C
Sbjct  389   GYHIPKKSRVFINIWTIGRDPNVWSDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRC  448

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L +G L+HCFNWELP  M P +LDMTE FGL+  K +HL+A+P++RL
Sbjct  449   PAMQLGLTTVRLALGNLVHCFNWELPTGMLPKDLDMTEKFGLSLSKAKHLLAMPTHRL  506



>ref|XP_009337201.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=519

 Score =   355 bits (911),  Expect(2) = 3e-139, Method: Compositional matrix adjust.
 Identities = 200/395 (51%), Positives = 273/395 (69%), Gaps = 7/395 (2%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             MS   +A+L +   T  W         SS+  +KLPPGPR LPIIGNLH LG LPHR+L 
Sbjct  14    MSPSEIAILILVFLTFLWSLLRILINASSRQSQKLPPGPRALPIIGNLHMLGNLPHRSLQ  73

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              L+KKYGPIM ++LG    +VVSSP AAEL LKTHD +FASRP+  A K ++ G+K MAF
Sbjct  74    NLAKKYGPIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQASKYMSYGTKAMAF  133

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
             + YG +WR  +K  T +LL  ++IE+F  LRR E+   V+S++ AA   + VDL+ +VG 
Sbjct  134   SEYGSYWRHVRKLCTLQLLCPSRIEAFAPLRREEVGLLVQSLKVAAEAGKVVDLSEKVGE  193

Query  615   LIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALG  794
             L+  +TYKM+ G  NND  DLK I++E + L GAFNI+DY+PFL P DLQGL KR++ + 
Sbjct  194   LVVGITYKMVLGRRNNDMFDLKGIIEETMFLTGAFNISDYVPFLIPLDLQGLTKRMKRIS  253

Query  795   KSVDKLFLEIVKEHEQDAKNGVQKSN--KDIVDMMLASMKNP-----SSSHKLDLASIKA  953
             K+VD+LF  I++EHEQ +++     N  KD VD++L+ +  P        +  +  + KA
Sbjct  254   KTVDQLFERIIQEHEQVSRSEQVHGNHHKDFVDVLLSLIHQPLNPNDKEVYMFERTNAKA  313

Query  954   LLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLE  1133
             +L DMI GS DTS   I WTLAE++R+P+VMK LQ+EL++ VG++RMVEE DLP L+YL 
Sbjct  314   ILLDMISGSFDTSATAIVWTLAELLRHPKVMKRLQKELQSVVGMDRMVEESDLPKLDYLS  373

Query  1134  MVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MV+KES RLHPV  LL+P +S+ED+ ++G+ IPKK
Sbjct  374   MVVKESLRLHPVGPLLIPHQSMEDVIVDGYHIPKK  408


 Score =   169 bits (429),  Expect(2) = 3e-139, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS + IN W IG DP++WSDNVEEF+PERFM+ +VD++GHDF L+PFG GRR C
Sbjct  402   GYHIPKKSIIFINIWTIGRDPNVWSDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRC  461

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L +G L+HCFNWELP  M P +LDMTE FGL+  K +HL+A+P++RL
Sbjct  462   PAMQLGLTTVRLALGNLVHCFNWELPTGMLPKDLDMTEKFGLSMSKAKHLLAMPTHRL  519



>ref|XP_007036492.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY20993.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=512

 Score =   348 bits (893),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 181/349 (52%), Positives = 247/349 (71%), Gaps = 7/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L+ L++KYG IM ++LG VP +VVSSP AAEL LKTHD +F SRPK 
Sbjct  49    GNLHMLGKLPHRTLHHLAQKYGSIMSIRLGYVPTIVVSSPQAAELFLKTHDTIFDSRPKV  108

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ G+KG+AFA YG +WR  +K+ T +LL+A+K+E F   RR E+ + VK ++ A
Sbjct  109   QGSEYLSYGTKGLAFAQYGSYWRTVRKWCTLQLLSASKVEFFAPKRRTELQSLVKLLKNA  168

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VDL+A+VG LIE++ Y+M+ G   +D  DLK ++ E + L+G FN+AD++PFL 
Sbjct  169   AAASEVVDLSAKVGELIEDIMYRMILGRCKDDKFDLKPLIHEGIRLLGTFNLADFVPFLA  228

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
             P DLQGL +R  ++ K+ DK   EI+ EHE+  K G QK ++D VD ML+ +  P     
Sbjct  229   PLDLQGLRQRFESVRKACDKFLEEIIDEHEKLNK-GQQKQHRDFVDFMLSYLNQPMNPND  287

Query  915   -SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                ++ +D  +IKA++ DMI  +++TS   IEW LAEI+R+PRV   LQ+ELE  VG+NR
Sbjct  288   EEQTYIIDRTNIKAIILDMIAAALETSAVVIEWALAEIIRHPRVKSRLQKELEAVVGMNR  347

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL NL YL+MVIKES RLHPVA LL+P ES+ED+ +NG+ IPKK
Sbjct  348   MVEEADLANLTYLDMVIKESLRLHPVAPLLIPHESMEDVTINGYHIPKK  396


 Score =   174 bits (440),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR++IN WAIG DP++WSDNVE+F PERF+  +VD+RGHDF L+PFG GRR C
Sbjct  390   GYHIPKKSRILINIWAIGRDPNVWSDNVEDFLPERFVGSNVDLRGHDFQLIPFGSGRRGC  449

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L + QL+HCF WELPN M P++L M+E FGL++P+ +HL+A P YRL
Sbjct  450   PGLQLGLTTVRLALAQLVHCFEWELPNGMLPNDLSMSEKFGLSAPRAEHLLARPVYRL  507



>ref|XP_010094782.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB56947.1| Cytochrome P450 71A1 [Morus notabilis]
Length=507

 Score =   349 bits (896),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 250/349 (72%), Gaps = 7/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLHQL TLPHR L  LSKKYGPIM L+LG+VPAVVVSSP AAEL LKT D  FASRP+ 
Sbjct  44    GNLHQLTTLPHRGLQSLSKKYGPIMSLRLGQVPAVVVSSPEAAELFLKTFDTTFASRPRV  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              + + ++ G+KGMAF  YGP+WR  +K  T +LL+A KIESF  LRR ++ + V+S+ A+
Sbjct  104   QSSEYMSYGTKGMAFTEYGPYWRNVRKLCTLQLLSALKIESFAALRREDVASVVESLRAS  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  RE VD++ ++G LI +++ +M+ G S  D + LK +V E + L GAFN++DY+P+L 
Sbjct  164   AAAREVVDISRKIGELIADMSCRMILGISLEDRNHLKELVHEAMFLSGAFNLSDYVPYLA  223

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
             P DLQG  +R++   +++D++  EI+ EHE+       +  KD VD++L+ +  P +   
Sbjct  224   PLDLQGYTRRMKKNSEAIDRVLEEIITEHERGTSEKGHR-QKDFVDVLLSLVNQPMNPQD  282

Query  930   L------DLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
             L      D  +IKA+L DM+  S DTS A IEWT +E++++PRVM  LQ ELE  VG+++
Sbjct  283   LEHLYIIDRTNIKAILLDMVAASFDTSAALIEWTFSELLKHPRVMNNLQRELERVVGMDK  342

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE+DL  L+YL+MV+KESFRLHPVA LLVPRES+EDI + G+FIPKK
Sbjct  343   MVEEQDLEKLDYLDMVVKESFRLHPVAPLLVPRESMEDITIEGYFIPKK  391


 Score =   172 bits (436),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N W IG DP++WS+NVEEF PERF+ K++D+RGHDF LLPFG GRR C
Sbjct  385   GYFIPKKSRIIVNAWTIGRDPNVWSENVEEFLPERFVDKNIDLRGHDFRLLPFGSGRRGC  444

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PGV+LGL+N++L++ QL+HCF+WELPN +   ++DM+E FGL+  +   L+A P+YRLL
Sbjct  445   PGVHLGLVNIRLVLAQLVHCFSWELPNGVETKDVDMSEKFGLSMGRANQLLAKPTYRLL  503



>ref|XP_009337257.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   351 bits (900),  Expect(2) = 4e-138, Method: Compositional matrix adjust.
 Identities = 197/388 (51%), Positives = 274/388 (71%), Gaps = 8/388 (2%)
 Frame = +3

Query  96    LLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKKYG  275
             L+ +FL  LW   R      SS+  +KLPPGPR LPIIGNLH LG LPHR+L  L+KKYG
Sbjct  9     LILVFLTFLWSLLR-ILINASSRQSQKLPPGPRALPIIGNLHMLGNLPHRSLQNLAKKYG  67

Query  276   PIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHW  455
             PIM ++LG    +VVSSP AAEL LKTHD +FASRP+  + K+++ G+K MAF+ YGP+W
Sbjct  68    PIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQSSKHMSHGTKAMAFSEYGPYW  127

Query  456   RGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTY  635
             R  +K +T +LL+ ++IE+   LRR E    V+S++ AA   E VDL+ +V  L+  +TY
Sbjct  128   RHVRKLSTLQLLSPSRIEASAPLRREEAGLLVQSLKVAAEAGEVVDLSEKVSELVVGITY  187

Query  636   KMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLF  815
             +M+ G  NND  DLK I++E++ L GAFNI DY+PFL P DLQGL KR++ + K+VD+LF
Sbjct  188   RMVLGRKNNDMFDLKGIIEEVMFLSGAFNIGDYVPFLIPLDLQGLTKRMKRISKTVDQLF  247

Query  816   LEIVKEHEQDAKNGVQKSN--KDIVDMMLASMKNP-----SSSHKLDLASIKALLFDMIV  974
              +I+++HEQ +++   + N  KD VD++L+ +  P        +  +  + KA+L DMI 
Sbjct  248   EKIIQDHEQVSRSEQVQGNHHKDFVDVLLSLIHQPLNPNDEEVYMFERTNAKAILLDMIS  307

Query  975   GSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESF  1154
             GS DTS   I WTLAE++R+P VMK LQ+EL++ VG++RMVEE DLP L+YL MV+KES 
Sbjct  308   GSFDTSAMAIVWTLAELLRHPEVMKRLQKELQSVVGMDRMVEESDLPKLDYLSMVVKESL  367

Query  1155  RLHPVATLLVPRESLEDIELNGHFIPKK  1238
             RLHPV  LL+P +S+ED+ ++G+ IPKK
Sbjct  368   RLHPVGPLLIPHQSMEDVIVDGYHIPKK  395


 Score =   171 bits (432),  Expect(2) = 4e-138, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV IN W IG DP++WSDNVEEF+PERFM+ +VD++GHDF L+PFG GRR C
Sbjct  389   GYHIPKKSRVFINIWTIGRDPNVWSDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRC  448

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L +G L+HCFNWELP  M P +LDMTE FGL+  K +HL+A+P++ L
Sbjct  449   PAMQLGLTTVRLALGNLVHCFNWELPTGMLPKDLDMTEKFGLSLSKAKHLLAMPTHHL  506



>ref|XP_009337244.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   347 bits (889),  Expect(2) = 3e-137, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 250/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GN H LG  PH +L  L+KKYGPIM ++LG VP +VVSSP AAEL LKTHD VF+SRPK 
Sbjct  59    GNFHMLGNHPHHSLQHLAKKYGPIMSIRLGLVPTIVVSSPQAAELFLKTHDTVFSSRPKL  118

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + I+ G+KG+AF  YGP+WR  +K  T +LL  +KIE F  LRR E+   V+S++ A
Sbjct  119   QASEYISYGAKGIAFTEYGPYWRHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKA  178

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E V+L+ +VG L+E++TY+M+ G+ ++D  D+K I++E++S++  FNI DY+PFL+
Sbjct  179   AEAGEVVNLSEKVGELVEDITYRMVLGSKSDDMFDIKTIIREVMSVLAFFNIGDYVPFLR  238

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKS---NKDIVDMMLASMKNP--  914
             P D+QGL KR + + K VD+LF +I+ EHEQ +K+   +    +KD VD+M++ +  P  
Sbjct  239   PLDIQGLTKRNKRISKIVDQLFEKIIWEHEQVSKSERAQGHHHHKDFVDVMVSLIHQPLN  298

Query  915   ---SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
                   ++++   +KA+L DMI GS DTS   I W LAE++R+PRVMK LQEEL+  +G 
Sbjct  299   PNDEQGYRIERTDVKAILLDMITGSFDTSATAIVWNLAELLRHPRVMKHLQEELQRVIGT  358

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +RMVEE DL  L YL  VIKESFRLHP+A  LVPRES++D+ ++G++IPKK
Sbjct  359   DRMVEESDLRKLSYLNAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKK  409


 Score =   172 bits (435),  Expect(2) = 3e-137, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS+++IN WAIG DP++WSDNV +F+PERF++ +VD+RGHDF LLPFG GRR C
Sbjct  403   GYYIPKKSKILINTWAIGRDPNVWSDNVGKFYPERFINSNVDLRGHDFQLLPFGSGRRGC  462

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PGV LGL  V+L++  ++HCFNW+LP+ + P +LDMTETFG    K QHL+A P+YRL
Sbjct  463   PGVQLGLTTVRLVLANIVHCFNWDLPSGLLPQDLDMTETFGSVPTKAQHLLATPTYRL  520



>ref|XP_003528941.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=981

 Score =   345 bits (884),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 245/350 (70%), Gaps = 8/350 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  L+K+YGPIM LKLG+V  +V+SSP  AEL LKTHD  FASRPK+
Sbjct  44    GNLHMLGKLPHRTLQSLAKQYGPIMSLKLGQVTTIVISSPETAELFLKTHDTTFASRPKS  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              + K I+ G KG+ F+ YGP+WR  +K  T +LL A+K+E F  LR  ++   VK +   
Sbjct  104   ISSKYISYGGKGLVFSEYGPYWRNMRKLCTVQLLIASKVEMFSPLRSQQLQELVKCLRKT  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  RE VDL+  VG LIEN+ ++M+FG S +D  D+K +  EIV+L G FN+ADY+P+L+
Sbjct  164   ASSREVVDLSDMVGDLIENINFQMIFGCSKDDRFDVKNLAHEIVNLAGTFNVADYMPWLR  223

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSN--KDIVDMMLASMKNP---  914
              FDLQGL +RL+ + KS D++  +I+K+HEQ + N  QKS   KD VD+ LA M  P   
Sbjct  224   VFDLQGLVRRLKKVSKSFDEVLEQIIKDHEQSSDNK-QKSQRLKDFVDIFLALMHQPLDP  282

Query  915   --SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
                  H LD  ++KA++  MIV ++DTS   IEW ++E++++PRVMK LQ+ELE+ VG+N
Sbjct  283   QDEHGHVLDRTNMKAIMMTMIVAAIDTSATAIEWAMSELLKHPRVMKKLQDELESVVGMN  342

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             R VEE D+  L YL++V+KE+ RL+PVA LLVPRE  E+I ++G+ I ++
Sbjct  343   RKVEESDMEKLPYLDLVVKETLRLYPVAPLLVPRECREEITIDGYCIKER  392


 Score =   171 bits (432),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    ++SR+++N WAIG DP +WSDN E F+PERF + +VD+RG+DF LLPFG GRR C
Sbjct  386   GYCIKERSRIIVNAWAIGRDPKVWSDNAEVFYPERFANSNVDMRGYDFRLLPFGSGRRGC  445

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  VK+++ QL+HCFNWELP  MSP +LDMTE FGL  P+  HL+AVP+YRL
Sbjct  446   PGIHLGLTTVKIVLAQLVHCFNWELPLGMSPDDLDMTEKFGLTIPRSNHLLAVPTYRL  503


 Score =   317 bits (812),  Expect(2) = 5e-125, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 245/351 (70%), Gaps = 11/351 (3%)
 Frame = +3

Query  210   GNLHQLG---TLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASR  380
             GNLH +G   TLPHR+L  LSK+YGPIM L+LG VP VVVSSP AAEL LKTHD VFA+R
Sbjct  516   GNLHMVGGAGTLPHRSLQSLSKRYGPIMSLQLGNVPTVVVSSPEAAELFLKTHDTVFANR  575

Query  381   PKNDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI  560
             PK +  +    G + +AFA YGP+WR  +K  T  LL+A+K+ESF  LR+ E+ A V+S+
Sbjct  576   PKFETAQYTY-GEESVAFAEYGPYWRNVRKVCTTHLLSASKVESFDGLRKREIGAMVESL  634

Query  561   EAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLP  740
             + AA  RE VD++  VG ++ ++  KM+ G + +D  DLK I+ E +S+ GAFN+ADY+P
Sbjct  635   KEAAMAREVVDVSERVGEVLRDMACKMVLGRNKDDRFDLKGILVETMSVSGAFNLADYVP  694

Query  741   FLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSS  920
             +L+ FDLQGL +R + + KS+DK+  E+++EH+       Q   KD +D++L+    P  
Sbjct  695   WLRLFDLQGLTRRSKKISKSLDKMLDEMIEEHQ--LAPPAQGHLKDFIDILLSLKDQPIH  752

Query  921   SHK-----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
              H      +D  SIK ++FDMI+G+ +TS   IEW ++E++R+PRVM+ LQ EL++ VG+
Sbjct  753   PHDKHAPIIDKRSIKGIVFDMIIGASETSSNVIEWAISELVRHPRVMENLQNELKDVVGI  812

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             N+MV+E DL  L YL+MV+KE+ RLHPV  LL P ES+EDI + G++I KK
Sbjct  813   NKMVDENDLAKLSYLDMVVKETLRLHPVVPLLAPHESMEDIVIEGYYIKKK  863


 Score =   160 bits (406),  Expect(2) = 5e-125, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSRV+IN WAIG DP +WS+N E F+PERFM+ ++D +G DF L+PFG GRR C
Sbjct  857   GYYIKKKSRVIINAWAIGRDPKVWSENAEVFYPERFMNSNIDFKGQDFQLIPFGSGRRSC  916

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ +GL  VKL++ QL+HCF WELP  + P ELDM E  GL+ P+ +HL+ +P+YRLL
Sbjct  917   PGIVMGLTIVKLVLTQLVHCFKWELPCGIGPDELDMNEKSGLSMPRARHLLVIPTYRLL  975



>ref|XP_009337218.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   347 bits (889),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 251/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GN H LG  PH +L  L+KKYGPIM ++LG VP +VVSSP AAEL LKTHD VF+SRPK 
Sbjct  59    GNFHMLGNHPHHSLQHLAKKYGPIMSIRLGLVPTIVVSSPQAAELFLKTHDTVFSSRPKL  118

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + I+ G+KG+AF  YGP+WR  +K  T +LL  +KIE F  LRR E+   V+S++ A
Sbjct  119   QASEYISYGAKGIAFTEYGPYWRHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKA  178

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E V+L+ +VG L+E++TY+M+ G+ ++D  D+K I++E++S++  FNI DY+PFL+
Sbjct  179   AEAGEVVNLSEKVGELVEDITYRMVLGSKSDDMFDIKTIIREVMSVLAFFNIGDYVPFLR  238

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKN-GVQ--KSNKDIVDMMLASMKNP--  914
             P D+QGL KR + + K VD+LF +I+ EHEQ +K+  VQ    +KD VD++L+ +  P  
Sbjct  239   PLDIQGLTKRNKRISKMVDQLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVLLSLIHQPLN  298

Query  915   ---SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
                   ++++   +KA+L DMI GS DTS   I W LAE++R+PRVMK LQEEL+  +G 
Sbjct  299   PNDEQGYRIERTDVKAILLDMITGSFDTSATAIVWNLAELLRHPRVMKHLQEELQRVIGT  358

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +RMVEE DL  L YL  VIKESFRLHP+A  LVPRES++D+ ++G++IPKK
Sbjct  359   DRMVEESDLRKLSYLNAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKK  409


 Score =   168 bits (426),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS+++IN WAIG DP++WSDNV +F+PERF++ +VD+RGHDF LLPFG GRR C
Sbjct  403   GYYIPKKSKILINTWAIGRDPNVWSDNVGKFYPERFINSNVDLRGHDFQLLPFGSGRRGC  462

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L +  ++HCFNW+LP+ + P +LDMTETFG    K QHL A+P+YRL
Sbjct  463   PGMQLGLTTVRLALANIVHCFNWDLPSGLLPQDLDMTETFGSVPTKAQHLFAMPTYRL  520



>ref|XP_004299223.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   343 bits (880),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 273/390 (70%), Gaps = 11/390 (3%)
 Frame = +3

Query  90    LALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKK  269
             +A+L + LA LW       +  S    +KLPPGPRPLPIIGNLH LG LPHR L  L+K+
Sbjct  7     IAILLVLLACLWSLI----SAFSKSKHQKLPPGPRPLPIIGNLHMLGNLPHRTLQNLAKQ  62

Query  270   YGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGP  449
             YG IM L+LG VP +V+SSP AAEL LKTHD  FASRPK  A + +A G+KG+AF+ YGP
Sbjct  63    YGDIMSLRLGNVPTIVISSPKAAELFLKTHDTNFASRPKIQASEYLAYGTKGLAFSEYGP  122

Query  450   HWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENV  629
             +WR  +K  T +L   AK+E+F  LR+ E+   V  ++ AA   E VD++ ++G + E++
Sbjct  123   YWRHVRKICTLQLFCPAKLEAFAPLRKEELGGLVGKLKRAAEEGEVVDVSEKIGEMNEDI  182

Query  630   TYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
             TY+M+ G   +D  DLK  V+E+  L+GAFNI+D++P L  FD+QGL KRL+ + K+ D+
Sbjct  183   TYRMVLGCKRDDKFDLKAFVEEMFFLVGAFNISDFIPSLSAFDIQGLTKRLKKVSKTADQ  242

Query  810   LFLEIVKEHEQDA--KNGVQKSNKDIVDMMLA---SMKNPSSS--HKLDLASIKALLFDM  968
             L  +I+ +HEQ A  K G Q  ++D VD++L+    + NP+    H LD  ++KA+L DM
Sbjct  243   LLDKIINDHEQAAETKGGKQGQHEDFVDVLLSFTNQLLNPNDEQVHFLDRENVKAILLDM  302

Query  969   IVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKE  1148
             I  + DTS   I W+LAE+MR+PR+MK LQEEL+  VG++RMVEE DLP L+YL +V+KE
Sbjct  303   ITAAFDTSATTIIWSLAELMRHPRIMKQLQEELQTVVGMDRMVEESDLPKLDYLNLVVKE  362

Query  1149  SFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             SFRLHPVA LLVP ES++DI ++G+ IPKK
Sbjct  363   SFRLHPVAPLLVPHESIKDITIDGYDIPKK  392


 Score =   172 bits (436),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N W+I  DP++WS+NVEEF+PERF + ++D+RGHD+ L+PFG GRR C
Sbjct  386   GYDIPKKSRLIVNFWSIARDPNVWSENVEEFYPERFTNSNIDLRGHDYQLIPFGTGRRGC  445

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGL  V+L++ QL+HCFNWELPN M P +L+MTE FGL+  K +HL+A P+YRL+
Sbjct  446   PGMQLGLTTVRLVLAQLVHCFNWELPNGMLPQDLNMTEKFGLSLSKAKHLLAKPTYRLM  504



>gb|KHN20714.1| Cytochrome P450 71D10 [Glycine soja]
Length=510

 Score =   343 bits (879),  Expect(2) = 6e-136, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 244/350 (70%), Gaps = 8/350 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  L+K+YGPIM LKLG+V  +V+SSP  AEL LKTHD  FASRPK+
Sbjct  44    GNLHMLGKLPHRTLQSLAKQYGPIMSLKLGQVTTIVISSPETAELFLKTHDTTFASRPKS  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              + K I+ G KG+ F+ YGP+WR  +K  T +LL A+K+E F  LR  ++   VK +   
Sbjct  104   ISSKYISYGGKGLVFSEYGPYWRNMRKLCTVQLLIASKVEMFSPLRSQQLQELVKCLRKT  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  RE VDL+  VG LIEN+ ++M+FG S +D  D+K +  EIV+L G FN+ADY+P+L+
Sbjct  164   ASSREVVDLSDMVGDLIENINFQMIFGCSKDDRFDVKNLAHEIVNLAGTFNVADYMPWLR  223

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKS--NKDIVDMMLASMKNP---  914
              FDLQ L +RL+ + KS D++  +I+K+HEQ + N  QKS   KD VD+ LA M  P   
Sbjct  224   VFDLQELVRRLKKVSKSFDEVLEQIIKDHEQSSDNK-QKSQRQKDFVDIFLALMHQPLDP  282

Query  915   --SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
                  H LD  ++KA++  MIV ++DTS   IEW ++E++++PRVMK LQ+ELE+ VG+N
Sbjct  283   QDEHGHVLDRTNMKAIMMTMIVAAIDTSATAIEWAMSELLKHPRVMKKLQDELESVVGMN  342

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             R VEE D+  L YL++V+KE+ RL+PVA LLVPRE  E+I ++G+ I ++
Sbjct  343   RKVEESDMEKLPYLDLVVKETLRLYPVAPLLVPRECREEITIDGYCIKER  392


 Score =   171 bits (433),  Expect(2) = 6e-136, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    ++SR+++N WAIG DP +WSDN E F+PERF + +VD+RG+DF LLPFG GRR C
Sbjct  386   GYCIKERSRIIVNAWAIGRDPKVWSDNAEVFYPERFANSNVDMRGYDFRLLPFGSGRRGC  445

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  VK+++ QL+HCFNWELP  MSP +LDMTE FGL  P+  HL+AVP+YRL
Sbjct  446   PGIHLGLTTVKIVLAQLVHCFNWELPLGMSPDDLDMTEKFGLTIPRSNHLLAVPTYRL  503



>gb|KDP20096.1| hypothetical protein JCGZ_05865 [Jatropha curcas]
Length=510

 Score =   350 bits (897),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/394 (51%), Positives = 276/394 (70%), Gaps = 12/394 (3%)
 Frame = +3

Query  90    LALLSIFLATLWWFFRHRRA-----EESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             LA++ + L +L +F    RA      E  ++ RKLPPGP PLPIIGNLH LG LPH+ L 
Sbjct  6     LAVVVVLLGSLAYFLPTLRATSSLPSEHRENDRKLPPGPSPLPIIGNLHMLGNLPHQTLY  65

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              L+K +GPIM L+LG V  +VVSS  AA+L LKTHDAVF SRPK  A + ++ G+KGMAF
Sbjct  66    NLAKLHGPIMSLRLGYVQTIVVSSANAAKLFLKTHDAVFGSRPKLRASRYMSYGTKGMAF  125

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
               YGP+WR  +K  T +LL+A+KIE F  +R+ E+  +V+S++ AA  R+ VD +  VG 
Sbjct  126   TEYGPYWRSVRKLCTVQLLSASKIEYFAPIRKEELGFYVESLKRAAAARKVVDFSVGVGD  185

Query  615   LIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALG  794
             +I+N+  +M+FG  NN   DLK +V+E + L GAFNIADY+PFL P DLQGL KR++A  
Sbjct  186   MIQNIACRMVFGEVNNHELDLKALVKEALLLAGAFNIADYIPFLGPIDLQGLTKRMKAFS  245

Query  795   KSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-SSSH-----KLDLASIKAL  956
             K++DK+   I+ EHE++A    +K   D +D++L+ M  P  +SH      +D   IKA+
Sbjct  246   KAMDKVLERIIDEHEKEA-YWEKKQKSDFIDVLLSLMNQPMVTSHDNALSTIDRTHIKAI  304

Query  957   LFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEM  1136
               DMI+GS DTS   IEWTL+E++R+P  MK LQ+EL++ VG++ MVEEK L  L YL+M
Sbjct  305   SIDMIIGSFDTSATTIEWTLSELLRHPHAMKCLQDELQSVVGMDNMVEEKHLSKLPYLDM  364

Query  1137  VIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VIKES RLHP+A LLVPRE++ED+ ++G++IPKK
Sbjct  365   VIKESLRLHPIAPLLVPREAMEDVMVDGYYIPKK  398


 Score =   163 bits (412),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DP  WSD  E+F PERF+  ++D+RG DF L+PFG GRR C
Sbjct  392   GYYIPKKSRVIVNAWAIGRDPDAWSDT-EKFLPERFIDMNIDLRGQDFQLIPFGSGRRGC  450

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  +K+I+ QL+HCF+WELPN + P ELDM E FGL+ P+  HL+ VP YRL
Sbjct  451   PGIQLGLTIIKIIIAQLVHCFDWELPNGLLPGELDMNEKFGLSLPRANHLLVVPKYRL  508



>ref|XP_003530005.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
 gb|KHN20713.1| Cytochrome P450 71A1 [Glycine soja]
Length=503

 Score =   343 bits (881),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 176/344 (51%), Positives = 241/344 (70%), Gaps = 1/344 (0%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LP+R L  L+KKYGPIM +KLG++P +VVSSP  AEL LKTHD VFASRPK 
Sbjct  45    GNLHMLGKLPNRTLQALAKKYGPIMSIKLGQIPTIVVSSPETAELFLKTHDTVFASRPKT  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K ++ G++G+ F  YGP+WR  +K  T ELL+A+K+E    LRR E+   VKS+E A
Sbjct  105   QASKYMSYGTRGIVFTEYGPYWRNVRKVCTTELLSASKVEMLAPLRRQELGILVKSLEKA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   + V+++ +VG LI N+  KM+ G S +D  DLK +  + + L+G FN+ADY+P+  
Sbjct  165   AASHDVVNVSDKVGELISNIVCKMILGRSRDDRFDLKGLTHDYLHLLGLFNVADYVPWAG  224

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQK-SNKDIVDMMLASMKNPSSSH  926
              FDLQGL ++ +   K+ D++F EI+K+HE  + N  +   +KD VD++L+ M  PS  H
Sbjct  225   VFDLQGLKRQFKQTSKAFDQVFEEIIKDHEHPSDNNKENVHSKDFVDILLSLMHQPSEHH  284

Query  927   KLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEK  1106
              +D  +IKA+L DMI G+ DTS   +EW ++E++R+PRVMK LQ+EL   VG +R VEE 
Sbjct  285   VIDRINIKAILLDMIAGAYDTSAIGVEWAMSELLRHPRVMKKLQDELNIVVGTDRPVEES  344

Query  1107  DLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             DL  L YL MV+KE+ RL+PV  LLVPRESLEDI +NG++I KK
Sbjct  345   DLAKLPYLNMVVKETLRLYPVGPLLVPRESLEDITINGYYIKKK  388


 Score =   167 bits (424),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR++IN WAIG DP +WSDNVE F+PERF++ ++D+RG +F L+PFG GRR C
Sbjct  382   GYYIKKKSRILINAWAIGRDPKVWSDNVEMFYPERFLNSNIDMRGQNFQLIPFGSGRRGC  441

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LG+    L++ QL+HCFNWELP  MSP ++DMTE FGL+ P+ +HL+AVP++RL
Sbjct  442   PGIQLGITTFSLVLAQLVHCFNWELPFGMSPDDIDMTENFGLSLPRSKHLLAVPTHRL  499



>ref|XP_008393300.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=523

 Score =   342 bits (877),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/396 (48%), Positives = 269/396 (68%), Gaps = 8/396 (2%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             M    +++L +FL  LW+              RK  PGP  LPIIGN H LG  PH +L 
Sbjct  14    MLPSAISILLLFLTFLWYLIHILTTAFQRPKHRKQLPGPWALPIIGNFHMLGNHPHHSLQ  73

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              L+KKYGPIM ++LG VP +VVSSP AAEL LKTHD VF SRPK  A + I+ G +G+AF
Sbjct  74    HLAKKYGPIMSIRLGLVPTIVVSSPKAAELFLKTHDTVFCSRPKLQAAEYISYGIRGIAF  133

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
               YGP+WR  +K  T +LL  +KIE F  LRR E+   V+S++ AA   E V+L+ +VG 
Sbjct  134   TEYGPYWRHIRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAAEAGEVVNLSEKVGE  193

Query  615   LIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALG  794
             L+E++TY+M+ G+ ++D  D+K I+++++S++  FNI DY+PFL+P D+QGL KR + + 
Sbjct  194   LVEDITYRMVLGSKSDDMFDIKTIIRDVMSVLALFNIGDYVPFLRPLDIQGLTKRNKRIS  253

Query  795   KSVDKLFLEIVKEHEQDAKN-GVQ--KSNKDIVDMMLASMKNP-----SSSHKLDLASIK  950
             K VD+LF +I+ EHEQ +K+  VQ    +KD VD++L+ +  P        ++++   +K
Sbjct  254   KIVDQLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVVLSLIHQPLNPNDEQGYRIERTDVK  313

Query  951   ALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYL  1130
             A+L DMI GS DTS   I W LAE++R+PRV+K LQEEL+  +G +RMVEE DL  L YL
Sbjct  314   AILLDMITGSFDTSATAIVWNLAELLRHPRVLKHLQEELQRVIGTDRMVEESDLRMLSYL  373

Query  1131  EMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
               VIKESFRLHP+A  LVPRES++D+ ++G++IPKK
Sbjct  374   NAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKK  409


 Score =   167 bits (422),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS+++IN WAIG DP++WSDNV EF+PERF++ +VD+RGHDF LLPFG GRR C
Sbjct  403   GYYIPKKSKILINTWAIGRDPNVWSDNVGEFYPERFINSNVDLRGHDFQLLPFGSGRRGC  462

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L +  ++HCFNW+LP+ + P +LDMTETFG    K Q L+A+P+YRL
Sbjct  463   PGMQLGLTTVRLALANIVHCFNWDLPSGLLPQDLDMTETFGSVPTKAQPLLAMPTYRL  520



>ref|XP_002275714.2| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   335 bits (860),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 239/348 (69%), Gaps = 7/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG LPHRNL  L+KKYGPIMY++LG VP V+VSS  A +L LKTHD VFASRPK 
Sbjct  44    GCLHMLGNLPHRNLTRLAKKYGPIMYMRLGCVPTVIVSSAQATKLFLKTHDVVFASRPKL  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A +++  G+KG+AF+ YGP+WR  +K  T ELL  AKI SF  +R+ E+   V+S++  
Sbjct  104   QAFEHLTYGTKGIAFSEYGPYWRNVRKLCTVELLNTAKINSFASVRKEEVGMLVQSLKEM  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VD++ +V +++E+++Y+M+FG + +   DLK +V+E   L G FN+ DY PFL 
Sbjct  164   AAAGEVVDISTKVAQVVEDISYRMVFGRNKDGMIDLKTLVREGTRLAGTFNLGDYFPFLG  223

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS----  917
             P DLQGL +R +A+ K+ D++  +I+    QD   G   ++ + +D+ML+ M N S    
Sbjct  224   PLDLQGLVQRFKAINKAADEVLEKIIDRRIQDG--GKDHNHSNFIDIMLSLMSNFSNLRS  281

Query  918   -SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              SS+ +D  ++KA+L DM+VG +D+S   IEW  +E++R+PRVM+ LQ EL+N V ++RM
Sbjct  282   ESSYIIDRTNVKAILLDMLVGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMDRM  341

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             V+E DL NL YL MV+KE  RLHP+   LVP  S EDI + GHFIPK+
Sbjct  342   VDESDLENLVYLNMVVKEVLRLHPIGPFLVPHASTEDITIEGHFIPKR  389


 Score =   173 bits (438),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK+S ++IN WAIG DP+ WSDNV+EF PERF++ ++D++G DF L+PFG GRR C
Sbjct  383   GHFIPKRSTILINTWAIGRDPNFWSDNVDEFLPERFINSNIDLQGRDFELIPFGSGRRGC  442

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGL  V+L++ QL+HCFNWELPN MS  +LDM+E FGL  P+V HL A+P+YRLL
Sbjct  443   PGIQLGLRTVRLVLAQLLHCFNWELPNDMSSDDLDMSEKFGLTMPRVNHLYAIPTYRLL  501



>ref|XP_010663579.1| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   329 bits (843),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 168/349 (48%), Positives = 250/349 (72%), Gaps = 8/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L+ LG+LPHRNL+ L+KKYGPIM+++LG VP +VVSSP AA+L++KTHD VFASRPK 
Sbjct  43    GSLYMLGSLPHRNLSRLAKKYGPIMFMRLGCVPTIVVSSPEAAKLVMKTHDVVFASRPKL  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G+KG+AF  YGP+WR  +K     L ++AKI SF  +R+ E+   VKS++  
Sbjct  103   QAYEYLSYGAKGIAFTEYGPYWRHVRKLCALHLFSSAKINSFASVRKAEVGLLVKSVKEM  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VD++A+V  ++E++ Y+M+FG + +   DLK +++E   L G FN+ADY+PFL 
Sbjct  163   ASAGEVVDISAKVAGVVEDMAYRMVFGHNKDRIFDLKTLIREATRLAGTFNLADYVPFLG  222

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQD-AKNGVQKSNKDIVDMMLASMKNPSSS-  923
             P DLQGL + LR   +++D++  +I+ +H QD +K+ V   N   +D++L+ M   ++  
Sbjct  223   PLDLQGLTQLLRTNNEAIDEVLDKIIDKHIQDVSKDEVNHMN--FIDVVLSLMNKSNNFE  280

Query  924   ----HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                 + +D  + KA++ D++VG +D+S   IEW ++E++R+PRVM+ LQEEL+N VG+ R
Sbjct  281   DDPLYAIDRQNAKAIILDILVGGIDSSITSIEWVISELLRHPRVMRRLQEELKNVVGMCR  340

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL NL YL MV+KE+ RLHP+   LVPRES+EDI +NGH+IPKK
Sbjct  341   MVEESDLENLGYLNMVVKETLRLHPIGPFLVPRESIEDIVINGHYIPKK  389


 Score =   177 bits (449),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR++IN W IG DP++WS+NVEEFFPERF+  ++D++GHDF L PFG GRR C
Sbjct  383   GHYIPKKSRILINTWTIGRDPNVWSNNVEEFFPERFVENNIDLQGHDFELTPFGSGRRGC  442

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGLI V+L+V QL+HCFNW+LPN   P EL+M E FGL  P+V HL+A P+YRLL
Sbjct  443   PGIQLGLITVQLVVSQLVHCFNWKLPNDTPPSELNMKEKFGLTMPRVDHLLATPTYRLL  501



>ref|XP_010045641.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=506

 Score =   333 bits (854),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 237/346 (68%), Gaps = 4/346 (1%)
 Frame = +3

Query  213   NLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKND  392
             NLH LG LPHR+L  LS +YGPIM L+LG VPAVVVSSP AA L L THDA+FASRP+  
Sbjct  48    NLHLLGDLPHRSLCSLSARYGPIMSLRLGLVPAVVVSSPEAAGLFLGTHDAIFASRPRIP  107

Query  393   AVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAA  572
               +     +KG+ F  YGP+WR  +K  T  LL+AA++ SF  +RR E+ + V S+  +A
Sbjct  108   EAELEFYTTKGLVFTEYGPYWRSVRKLCTTHLLSAARVRSFEGMRREEVGSLVASLRESA  167

Query  573   GGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKP  752
                EAVDL+A+V R +E++  +M+ G S +  HDLK I+QE   + G FN+ADY+PFL+P
Sbjct  168   AAHEAVDLSAQVERAMEDMACRMILGRSTDGEHDLKGIIQENARVAGVFNLADYVPFLRP  227

Query  753   FDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP----SS  920
              DLQG +++ +A+ +SVDKL  +I+ +H QD  +   +  +D +D++L+ M  P      
Sbjct  228   LDLQGSSRQFKAVRRSVDKLLEKIIDDHVQDTAHYDSEHQQDFIDILLSMMNQPIGPREE  287

Query  921   SHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVE  1100
              + +D  +IKA++ DMI GS +T+   I+W  +E+MRNP+ M  LQEELE  VGL RMVE
Sbjct  288   KYIIDRTNIKAIILDMISGSFETASTSIDWAFSELMRNPQTMAHLQEELETIVGLTRMVE  347

Query  1101  EKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             E DLP L YL+MV+KES RLHPV  LLVPRES+ED  +N  FIPKK
Sbjct  348   ESDLPKLNYLDMVVKESMRLHPVVPLLVPRESMEDAVINECFIPKK  393


 Score =   171 bits (434),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSR+++N WAIG DPS+WS+N E+F PERF+   +D++GH F LLPFG GRR CPG+ 
Sbjct  391   PKKSRIIVNIWAIGRDPSVWSENTEKFVPERFVDNGIDVKGHHFELLPFGSGRRGCPGIQ  450

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             LGL+ VKL++ QL+HCF WE+P  M P ++DM+E FGL+ P+  HL+AVP+YRLL
Sbjct  451   LGLLQVKLVLAQLVHCFKWEIPEDMVPSDIDMSERFGLSVPRANHLLAVPTYRLL  505



>ref|XP_010047217.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=531

 Score =   343 bits (881),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 193/406 (48%), Positives = 267/406 (66%), Gaps = 15/406 (4%)
 Frame = +3

Query  42    AVKYENIVSLIMSSVGLALLSI-FLATLWWFFRHRRAEESSksgrklppgprplpiiGNL  218
             A K E    L M +  L +LS   L  L++FFRH R  +  K     PP P      GNL
Sbjct  19    APKQETAFHLQMETSPLLVLSTTLLIALYFFFRHLRCRQPHKLPPGPPPLPVI----GNL  74

Query  219   HQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAV  398
             HQLG LPHR L+ L+K YGPIM+L+LG  P VVVSSP AAEL+LKT+D +F+SRP  DA+
Sbjct  75    HQLGNLPHRCLHSLAKSYGPIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDAM  134

Query  399   KNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGG  578
             ++++ G+KGMAFA  G +WRG +K    +LL+ AK+ESF  +RR E+   V+ + A A  
Sbjct  135   RHLSYGNKGMAFAESGAYWRGMRKLCKLQLLSPAKVESFAPMRREELGRVVRRVRAVATE  194

Query  579   REAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFD  758
              EAVD++AEVG+LI ++  +M+ G S  D  +LK ++ E ++L+GAFN+ADY+P L   D
Sbjct  195   HEAVDVSAEVGQLIADLACRMILGCSTRDKFNLKPVIHEGLNLVGAFNLADYVPLLGALD  254

Query  759   LQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS-----  923
             LQG+ +R +A+ ++VDK+  +I++EHE+D      K   D +D +LA M +P +      
Sbjct  255   LQGITRRAKAVNRAVDKVLEDIIREHEEDTTG---KYEGDFIDTLLAGMGHPINGSPQDE  311

Query  924   --HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
               H LD  +IKAL  DMI  S ++S   IEW ++E++R+P  MK LQ ELE  VGL R V
Sbjct  312   PVHVLDRTNIKALALDMIAASYESSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTV  371

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DLP L Y++MV+KESFRL+P   LL+P ES E IE+ G++IPK
Sbjct  372   EEADLPKLNYMDMVVKESFRLYPPGPLLIPHESTEGIEMGGYYIPK  417


 Score =   161 bits (407),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK +RV++N WA+G D   W+++ EEF PERF    VD++G DF L+PFG GRR C
Sbjct  412   GYYIPKGTRVIVNAWALGRDAGTWAEDPEEFRPERFADGGVDVKGRDFQLIPFGSGRRGC  471

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG++LGL+NV+L++ QL+HCF+WELP   SP ELDM+E FGLA P+ +HL+  PSYRLL
Sbjct  472   PGMHLGLVNVRLVLAQLVHCFDWELPAGTSPKELDMSEDFGLAMPRAKHLILRPSYRLL  530



>ref|XP_003534174.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=977

 Score =   334 bits (856),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 249/350 (71%), Gaps = 8/350 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  L+KKYGPIM +KLG+VP +VVSSP  AEL LKTHD VFASRPK 
Sbjct  514   GNLHMLGKLPHRSLQALAKKYGPIMSIKLGQVPTIVVSSPETAELFLKTHDTVFASRPKT  573

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G+KG+ F+ YGP+WR  +KF T +LL+A+K++ F  LRR E+  +VKS+E A
Sbjct  574   QASEYMSYGTKGLVFSEYGPYWRNMRKFCTTQLLSASKVDMFAPLRREELGLFVKSLEKA  633

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  R+ V+++ +VG L+ N+ YKM+ G + +D  DLK +  E + L G FN+ADY+P+ +
Sbjct  634   ASSRDVVNISEQVGELMSNIVYKMILGRNKDDRFDLKGLTHEALHLSGVFNMADYVPWAR  693

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKS---NKDIVDMMLASMKNPSS  920
              FDLQGL ++ +   K+ D++  + +K+HE D  +  +KS   ++D V ++L+ M  P  
Sbjct  694   AFDLQGLKRKFKKSKKAFDQVLEQTIKDHE-DPTDSDKKSVHNSEDFVAILLSLMHQPMD  752

Query  921   SHK----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
              H+    +D  ++KA++ DMI GS DTS + IEW + E++R+PRVMK LQ+EL + VG+N
Sbjct  753   QHEQKHVIDRTNVKAIILDMIGGSFDTSTSAIEWAMTELLRHPRVMKTLQDELNSVVGIN  812

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             + VEE DL  L YL MV+KE+ RL+PV  LLVPRESLE+I +NG++I KK
Sbjct  813   KKVEESDLAKLPYLNMVVKETLRLYPVVPLLVPRESLENITINGYYIEKK  862


 Score =   170 bits (430),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR++IN WAIG DP +W +N E F+PERFM+ +VDIRGHDF L+PFG GRR C
Sbjct  856   GYYIEKKSRILINAWAIGRDPKVWCNNAEMFYPERFMNNNVDIRGHDFQLIPFGSGRRGC  915

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGL +V LI+ QL+HCFNWELP  +SP +LDMTE FG+  P+ + L+A+P+YRLL
Sbjct  916   PGIQLGLTSVGLILAQLVHCFNWELPLGISPDDLDMTEKFGITIPRCKPLLAIPTYRLL  974


 Score =   333 bits (855),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 246/352 (70%), Gaps = 9/352 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L   ++KYGPIM LKLG+V A+VVSSP  AEL LKTHD VFASRPK 
Sbjct  40    GNLHMLGKLPHRTLQTFARKYGPIMSLKLGQVQAIVVSSPETAELFLKTHDTVFASRPKI  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G+KG+ F+ Y  +WR  +K  T +LL+A+K++ F  LRR E+   VKS+  +
Sbjct  100   QASEYLSHGTKGLVFSEYSAYWRKVRKVCTLQLLSASKVDMFAPLRRQELGVLVKSLRNS  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  RE VDL+  +G L+EN+ YKM+ G + +   +LK +V ++++L+GAFN+ADY+P+L 
Sbjct  160   AASREVVDLSEVLGELMENIVYKMVLGRARDHRFELKGLVHQVMNLVGAFNLADYMPWLG  219

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNG--VQKS---NKDIVDMMLASMKNP  914
              FD QG+ +RL+   K +D+   +I+++HE +  +   VQK+   NKD VD++L+ M  P
Sbjct  220   AFDPQGITRRLKKASKEIDQFLEQIIQDHEHNQYDNYKVQKAPHNNKDFVDILLSLMNQP  279

Query  915   ----SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVG  1082
                    + +D  +IKA++ DMI+ + DTS   +EW ++E++R+  VMK LQ+ELEN VG
Sbjct  280   IDLQGHQNVIDRTNIKAIILDMIMAAFDTSSTTVEWAMSELLRHQSVMKRLQDELENVVG  339

Query  1083  LNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +NR VEE DL  L YL MV+KE+ RLHPVA LLVPRES ED+ ++G+FI KK
Sbjct  340   MNRHVEEIDLEKLAYLNMVVKETLRLHPVAPLLVPRESREDVTIDGYFIKKK  391


 Score =   148 bits (374),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +1

Query  1189  ESRWKISS*TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHL  1368
             ESR  ++   G    KKSR+++N WAIG DP +W  N   F P+RF + +VDIRG DF +
Sbjct  376   ESREDVTI-DGYFIKKKSRIIVNAWAIGRDPKVWH-NPLMFDPKRFENCNVDIRGSDFRV  433

Query  1369  LPFGYGRRVCPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHL  1548
             +PFG GRR CPG+++GL  VKL++ QL+HCFNW LP  MSP ELDM E FGL +P+ +HL
Sbjct  434   IPFGSGRRGCPGIHMGLTTVKLVLAQLVHCFNWVLPLDMSPDELDMNEIFGLTTPRSKHL  493

Query  1549  VAVPSYRL  1572
             +A P YRL
Sbjct  494   LATPVYRL  501



>gb|KHN32022.1| Cytochrome P450 71A1 [Glycine soja]
Length=511

 Score =   333 bits (854),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 249/350 (71%), Gaps = 8/350 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  L+KKYGPIM +KLG+VP +VVSSP  AEL LKTHD VFASRPK 
Sbjct  48    GNLHMLGKLPHRSLQALAKKYGPIMSIKLGQVPTIVVSSPETAELFLKTHDTVFASRPKT  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G+KG+ F+ YGP+WR  +KF T +LL+A+K++ F  LRR E+  +VKS+E A
Sbjct  108   QASEYMSYGTKGLVFSEYGPYWRNMRKFCTTQLLSASKVDMFAPLRREELGLFVKSLEKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  R+ V+++ +VG L+ N+ YKM+ G + +D  DLK +  E + L G FN+ADY+P+ +
Sbjct  168   ASSRDVVNISEQVGELMSNIVYKMILGRNKDDRFDLKGLTHEALHLSGVFNMADYVPWAR  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKS---NKDIVDMMLASMKNPSS  920
              FDLQGL ++ +   K+ D++  + +K+HE D  +  +KS   ++D V ++L+ M  P  
Sbjct  228   AFDLQGLKRKFKKSKKAFDQVLEQTIKDHE-DPTDSDKKSVHNSEDFVAILLSLMHQPMD  286

Query  921   SHK----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
              H+    +D  ++KA++ DMI GS DTS + IEW + E++R+PRVMK LQ+EL + VG+N
Sbjct  287   QHEQKHVIDRTNVKAIILDMIGGSFDTSTSAIEWAMTELLRHPRVMKTLQDELNSVVGIN  346

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             + VEE DL  L YL MV+KE+ RL+PV  LLVPRESLE+I +NG++I KK
Sbjct  347   KKVEESDLAKLPYLNMVVKETLRLYPVLPLLVPRESLENITINGYYIEKK  396


 Score =   170 bits (430),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR++IN WAIG DP +W +N E F+PERFM+ +VDIRGHDF L+PFG GRR C
Sbjct  390   GYYIEKKSRILINAWAIGRDPKVWCNNAEMFYPERFMNNNVDIRGHDFQLIPFGSGRRGC  449

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGL +V LI+ QL+HCFNWELP  +SP +LDMTE FG+  P+ + L+A+P+YRLL
Sbjct  450   PGIQLGLTSVGLILAQLVHCFNWELPLGISPDDLDMTEKFGITIPRCKPLLAIPTYRLL  508



>gb|KCW79058.1| hypothetical protein EUGRSUZ_C00484 [Eucalyptus grandis]
Length=502

 Score =   341 bits (875),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/389 (48%), Positives = 260/389 (67%), Gaps = 14/389 (4%)
 Frame = +3

Query  90    LALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKK  269
             L L +  L  L++FFRH R  +  K     PP P      GNLHQLG LPHR L+ L+K 
Sbjct  7     LVLSTTLLIALYFFFRHLRCRQPHKLPPGPPPLPVI----GNLHQLGNLPHRCLHSLAKS  62

Query  270   YGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGP  449
             YGPIM+L+LG  P VVVSSP AAEL+LKT+D +F+SRP  DA+++++ G+KGMAFA  G 
Sbjct  63    YGPIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDAMRHLSYGNKGMAFAESGA  122

Query  450   HWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENV  629
             +WRG +K    +LL+ AK+ESF  +RR E+   V+ + A A   EAVD++AEVG+LI ++
Sbjct  123   YWRGMRKLCKLQLLSPAKVESFAPMRREELGRVVRRVRAVATEHEAVDVSAEVGQLIADL  182

Query  630   TYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
               +M+ G S  D  +LK ++ E ++L+GAFN+ADY+P L   DLQG+ +R +A+ ++VDK
Sbjct  183   ACRMILGCSTRDKFNLKPVIHEGLNLVGAFNLADYVPLLGALDLQGITRRAKAVNRAVDK  242

Query  810   LFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS-------HKLDLASIKALLFDM  968
             +  +I++EHE+D      K   D +D +LA M +P +        H LD  +IKAL  DM
Sbjct  243   VLEDIIREHEEDTTG---KYEGDFIDTLLAGMGHPINGSPQDEPVHVLDRTNIKALALDM  299

Query  969   IVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKE  1148
             I  S ++S   IEW ++E++R+P  MK LQ ELE  VGL R VEE DLP L Y++MV+KE
Sbjct  300   IAASYESSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLPKLNYMDMVVKE  359

Query  1149  SFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             SFRL+P   LL+P ES E IE+ G++IPK
Sbjct  360   SFRLYPPGPLLIPHESTEGIEMGGYYIPK  388


 Score =   161 bits (407),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK +RV++N WA+G D   W+++ EEF PERF    VD++G DF L+PFG GRR C
Sbjct  383   GYYIPKGTRVIVNAWALGRDAGTWAEDPEEFRPERFADGGVDVKGRDFQLIPFGSGRRGC  442

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG++LGL+NV+L++ QL+HCF+WELP   SP ELDM+E FGLA P+ +HL+  PSYRLL
Sbjct  443   PGMHLGLVNVRLVLAQLVHCFDWELPAGTSPKELDMSEDFGLAMPRAKHLILRPSYRLL  501



>ref|XP_003534173.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=978

 Score =   338 bits (867),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 243/348 (70%), Gaps = 5/348 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  L+K YGPIM++KLG+VP VVVSSP  AEL LKTHD +FASRPK 
Sbjct  44    GNLHMLGKLPHRSLQALAKNYGPIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKT  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ GSKG+AF+ YGP+WR  KK  T +LL+A+K+E F  LRR E+  +VKS+E A
Sbjct  104   LASEYMSYGSKGLAFSEYGPYWRNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  R+ V+L+ +VG LI N+  +M+ G S +D  DLK + +E++ L G FNIADY+P+  
Sbjct  164   AASRDVVNLSEQVGELISNIVCRMILGRSKDDRFDLKGLAREVLRLTGVFNIADYVPWTG  223

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQ-DAKNGVQKSNKDIVDMMLASMKNPSSSH  926
               DLQGL  +++ + K+ D++F +I+K+HE   A N     ++D VD++L+ M    +  
Sbjct  224   FLDLQGLKGKMKKMSKAFDEVFEQIIKDHEDPSASNKNSVHSEDFVDILLSHMHQAVNQQ  283

Query  927   K----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
             +    +   +IKA++ DMI GS DTS   +EW ++E++RNP  MK LQEEL N VG N++
Sbjct  284   EQKYVIGRTNIKAIILDMIAGSFDTSAVAVEWAMSELLRNPSDMKKLQEELNNVVGENKL  343

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L YL MV+KE+ RL+P   LLVPRESLEDI +NG+ I KK
Sbjct  344   VEESDLSKLPYLNMVVKETLRLYPAGPLLVPRESLEDITINGYHIKKK  391


 Score =   163 bits (413),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KK+R+++N WAIG DP +WSDN + F PERF++ +VDIRGHDF LLPFG GRR C
Sbjct  385   GYHIKKKTRILVNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGC  444

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL    L++ QL+HCFNWELP  +SP +LDM+E FGL+ P+ + L+A+P+YRL
Sbjct  445   PGIQLGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSEIFGLSLPRSKPLLAIPTYRL  502


 Score =   331 bits (849),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 240/348 (69%), Gaps = 5/348 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  L+K YGPIM++KLG+VP VVVSSP  AEL LKTHD +FASRPK 
Sbjct  515   GNLHMLGKLPHRSLQALAKNYGPIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKT  574

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ GSKG+AF+ YGP+WR  KK  T +LL+A+K+E F  LRR E+  +VKS+E A
Sbjct  575   LASEYMSYGSKGLAFSEYGPYWRNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKA  634

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  R+ V+L+ +VG LI N+  +M+ G S +D  DLK + +E++ L G FNIADY+P+  
Sbjct  635   AASRDVVNLSEQVGELISNIVCRMILGRSKDDRFDLKGLAREVLRLAGVFNIADYVPWTG  694

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQ-DAKNGVQKSNKDIVDMMLA----SMKNP  914
               DLQGL  +++ + K  D++F +I+K+HE   A N     ++D VD++L+    +M   
Sbjct  695   FLDLQGLKGKIKKMSKVFDEVFEQIIKDHEDPSASNKKSVHSEDFVDILLSHMHQAMNQQ  754

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                +     +IKA++ DMI  S DTS   +EW ++E++RNP  MK LQEEL N VG +++
Sbjct  755   EQKYVTGRTNIKAIILDMIAASFDTSTVAVEWAMSELLRNPSDMKKLQEELNNVVGEDKL  814

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L YL MV+KE+ RL+P   LL+PRESLEDI +NG+ I KK
Sbjct  815   VEESDLSKLPYLNMVVKETLRLYPAGPLLLPRESLEDITINGYHIKKK  862


 Score =   163 bits (413),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KK+R+++N WAIG DP +WSDN + F PERF++ +VDIRGHDF LLPFG GRR C
Sbjct  856   GYHIKKKTRILVNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGC  915

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL    L++ QL+HCFNWELP  +SP +LDM+E FGL+ P+ + L+A+P+YRL
Sbjct  916   PGIQLGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSERFGLSLPRSKPLLAIPTYRL  973



>ref|XP_008385725.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=510

 Score =   339 bits (869),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/396 (48%), Positives = 265/396 (67%), Gaps = 8/396 (2%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             M  + +++  +FL  LW+              RK  PGP  LPIIGN H LG  PH  L 
Sbjct  1     MLPLAISIFLLFLTFLWYLIHILTTAFHRPKHRKQLPGPWALPIIGNFHMLGNHPHHTLQ  60

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              L+K+YGPIM ++LG VP +VVSSP AAEL LKTHD VF+SRPK  A + I+ G+KG+AF
Sbjct  61    HLAKQYGPIMSMRLGLVPTIVVSSPKAAELFLKTHDTVFSSRPKLQASEYISYGAKGIAF  120

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
               YGP+WR  +K  T +LL  +KIE F  LRR E+   V+S++ A    E V+L+ +VG 
Sbjct  121   TEYGPYWRHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAXEAGEVVNLSEKVGE  180

Query  615   LIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALG  794
             L+E++TY+M+ G+ ++D  D K I+++++S++  FNI DY+PFL+P D+QGL KR + + 
Sbjct  181   LVEDITYRMVLGSKSDDMFDJKTIIRDVMSVLALFNIGDYVPFLRPLDIQGLTKRNKRIS  240

Query  795   KSVDKLFLEIVKEHEQDAKN-GVQ--KSNKDIVDMMLASMKNP-----SSSHKLDLASIK  950
             K VD+LF +I+ EHEQ +K+  VQ    +KD VD+ L+ +  P        + ++   +K
Sbjct  241   KIVDQLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVXLSLIHQPLNPNDEQGYXIERTDVK  300

Query  951   ALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYL  1130
             A+L DMI GS DTS   I W LAE++R+PRV K LQEEL+  +G +RMVEE DL  L YL
Sbjct  301   AILLDMITGSFDTSATAIVWNLAELLRHPRVXKXLQEELQRVIGTDRMVEESDLRXLSYL  360

Query  1131  EMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
               VIKESFRLHP+A  LVPRES++D+ ++G++IPKK
Sbjct  361   NAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKK  396


 Score =   162 bits (411),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS+++IN WAIG DP++WSDN   F+PERF++ +VD+RGHDF LLPFG GRR C
Sbjct  390   GYYIPKKSKILINTWAIGRDPNVWSDNXGXFYPERFINSNVDLRGHDFQLLPFGSGRRGC  449

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L +  ++HCFNW+LP+ + P +LDMTETFG    K Q L+A+P+YRL
Sbjct  450   PGMQLGLTTVRLALANIVHCFNWDLPSGLLPQDLDMTETFGSVPTKAQPLLAMPTYRL  507



>ref|XP_007152786.1| hypothetical protein PHAVU_004G159500g [Phaseolus vulgaris]
 gb|ESW24780.1| hypothetical protein PHAVU_004G159500g [Phaseolus vulgaris]
Length=511

 Score =   326 bits (836),  Expect(2) = 3e-131, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 237/347 (68%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPHR L  L+  YGPIM LKLG+VP +V+SSP   EL LKTHD  FASRPK+
Sbjct  47    GHLHMLGKLPHRTLQSLAAFYGPIMSLKLGQVPTIVISSPEIVELFLKTHDITFASRPKS  106

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              +   I+ G KG+ F+ YGP+WR  +K  T +LL A+K+E F  LR  ++   V+ ++  
Sbjct  107   ISSNYISYGGKGLVFSEYGPYWRNMRKLCTVQLLIASKVEMFSPLRSEQLAECVRFLQKT  166

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  RE +DL+   G +IENVT+KM+F  S +D  D+K +V+E++ L G FN+ADYLP+L+
Sbjct  167   ASSREVIDLSDTAGNIIENVTFKMIFDCSKDDRFDVKNLVREVLDLAGTFNVADYLPWLR  226

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
              FDLQGL +RL+ + KS D +  +I+++HEQ + +  +K  KD VD+ LA M  P   H 
Sbjct  227   MFDLQGLVRRLKKVSKSFDVVLEQIIRDHEQYS-DKEEKGQKDFVDIFLALMHQPLDPHD  285

Query  930   -----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                  ++   IKA++  MI+  +DTS   +EW ++E++++PRVMK LQ+ELE+ VG+ R 
Sbjct  286   EHGPVVERTHIKAVVMTMIIAGIDTSSTSVEWAMSELLKHPRVMKKLQDELESVVGMKRK  345

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE D+  L YL++V+KE+ RL+PV  LLVPRE  ED+ ++G+FI K
Sbjct  346   VEETDMEKLLYLDLVVKETLRLYPVVPLLVPRECREDVTIDGYFIKK  392


 Score =   172 bits (435),  Expect(2) = 3e-131, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K SRV++N WA+G DP +WSDN E F+PERF + +VDI+G DF L+PFG GRR CPG++L
Sbjct  392   KNSRVIVNAWAVGRDPKVWSDNAEMFYPERFTNNNVDIKGFDFRLIPFGSGRRGCPGIHL  451

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL  VK+++ QL+HCFNWELP+ MSP ELDMTE FGL  P+ +HL+AVP+YRL
Sbjct  452   GLTTVKIVLSQLVHCFNWELPSGMSPDELDMTEKFGLTMPRSKHLLAVPTYRL  504



>gb|KHF97324.1| Cytochrome P450 [Gossypium arboreum]
 gb|KHG09556.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   328 bits (842),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 192/406 (47%), Positives = 268/406 (66%), Gaps = 6/406 (1%)
 Frame = +3

Query  39    IAVKYENIVSLIMSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNL  218
             +A+ Y + +   MSS  L LL I L TL  F     +   +K+GRKLPPGP PLPI+GN+
Sbjct  1     MAISYCDWLPSQMSSSTLTLLFILLGTLCSFIYFFSSPNRNKNGRKLPPGPAPLPIVGNI  60

Query  219   HQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAV  398
             H LG LPH++L+ L+KKYGPIM + LGKVP +VVSSP AAEL LK HD VFASRPK  + 
Sbjct  61    HMLGNLPHQSLHYLAKKYGPIMSIMLGKVPTIVVSSPEAAELFLKVHDVVFASRPKVQSA  120

Query  399   KNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGG  578
             K  A G K MAF  YG +WR  +K++    L+A+K++ F  +R+ E+   V+S+   A  
Sbjct  121   KYFAYGGKAMAFTQYGSYWRTVRKWSILHFLSASKVQCFASIRKAEVGLLVESVRKVAAA  180

Query  579   REAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFD  758
              E ++L+  V +++E +  K+LFG S +D  D K +V E + L G FN++DY+PFL P D
Sbjct  181   GETINLSQAVAKVLEGMMSKVLFGRSMDDKIDFKPLVNEAMHLAGVFNLSDYVPFLAPLD  240

Query  759   LQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDL  938
             LQG  +RL+ +   + + F +++ E++Q      QK  ++   +M++ +  P + +  D 
Sbjct  241   LQGYTRRLKKVSSGLHEFFDKMIDEYQQGINMDDQKPYRNFFQVMVSLLDTPINPNDEDQ  300

Query  939   A------SIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVE  1100
                    +IKA++ DM+  S DT+   IEWT +E++R+PRVM  LQ+ELE+ VG NRMVE
Sbjct  301   PYIVGRENIKAIMVDMVAASFDTTTTAIEWTFSELLRHPRVMVALQKELESVVGRNRMVE  360

Query  1101  EKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             E DLP L YL+MVIKESFRLHPVA LLVP ES ED+ +NG+FIPKK
Sbjct  361   ESDLPKLAYLDMVIKESFRLHPVAPLLVPHESTEDVTINGYFIPKK  406


 Score =   168 bits (426),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N W++G +P IWS N EEFFPERF  + +D+RGHDF L+PFG GRR C
Sbjct  400   GYFIPKKSRLLVNTWSMGRNPKIWSSNAEEFFPERFKDRKIDLRGHDFELIPFGTGRRGC  459

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ L LI+++LI+ Q  HCF+WELP+ M P+ELDMTE FGL  P+  HL+A P+YRL+
Sbjct  460   PGMQLALISMRLILAQSAHCFDWELPDGMLPNELDMTEKFGLTLPRANHLLAKPTYRLI  518



>gb|KHG07950.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   329 bits (844),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/406 (47%), Positives = 268/406 (66%), Gaps = 6/406 (1%)
 Frame = +3

Query  39    IAVKYENIVSLIMSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNL  218
             +A+ Y + +   MSS  L LL I L TL  F     +   +K+GRKLPPGP PLPI+GN+
Sbjct  1     MAISYCDWLPSQMSSSTLTLLFILLGTLCSFIYFFSSPNRNKNGRKLPPGPAPLPIVGNI  60

Query  219   HQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAV  398
             H LG LPH++L+ L+KKYGPIM + LGKVP +VVSSP AAEL LK HD VFASRPK  + 
Sbjct  61    HMLGNLPHQSLHYLAKKYGPIMSIMLGKVPTIVVSSPEAAELFLKVHDVVFASRPKVQSA  120

Query  399   KNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGG  578
             K  A G K MAF  YG +WR  +K++    L+A+K++ F  +R+ E+   V+S+   A  
Sbjct  121   KYFAYGGKAMAFTQYGSYWRTVRKWSILHFLSASKVQCFASIRKAEVGLLVESVRKVAAA  180

Query  579   REAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFD  758
              E ++L+  V +++E +  K+LFG S +D  D K +V E + L G FN++DY+PFL P D
Sbjct  181   GETINLSQAVAKVLEGMMSKVLFGRSMDDKIDFKPLVNEAMHLAGVFNLSDYVPFLAPLD  240

Query  759   LQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDL  938
             LQG  +RL+ +   + + F +++ E++Q      QK  ++   +M++ +  P + +  D 
Sbjct  241   LQGYTRRLKKVSSGLHEFFDKMIDEYQQGINMDDQKPYRNFFQVMVSLLDTPINPNDEDQ  300

Query  939   A------SIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVE  1100
                    +IKA++ DM+  S DT+   IEWT +E++R+PRVM  LQ+ELE+ VG NRMVE
Sbjct  301   PYIVGRENIKAIMVDMVAASFDTTTTAIEWTFSELLRHPRVMVALQKELESVVGRNRMVE  360

Query  1101  EKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             E DLP L YL+MVIKESFRLHPVA LLVP ES ED+ +NG+FIPKK
Sbjct  361   ESDLPKLAYLDMVIKESFRLHPVAPLLVPHESTEDVTINGYFIPKK  406


 Score =   165 bits (418),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N W++G +P IWS N EEFFPERF  + +D+RGHDF L+PFG GRR C
Sbjct  400   GYFIPKKSRLLVNTWSMGRNPKIWSSNAEEFFPERFKDRKIDLRGHDFELIPFGTGRRGC  459

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ L LI+++LI+ QL HCF+WELP+ M P+ELDM+E FGL+ P+  HL+A  +YRL+
Sbjct  460   PGMQLVLISMRLILAQLAHCFDWELPDGMLPNELDMSEKFGLSLPRANHLLAKSTYRLI  518



>ref|XP_010036876.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=531

 Score =   333 bits (855),  Expect(2) = 7e-130, Method: Compositional matrix adjust.
 Identities = 195/406 (48%), Positives = 266/406 (66%), Gaps = 15/406 (4%)
 Frame = +3

Query  42    AVKYENIVSLIMSSVGLALLSI-FLATLWWFFRHRRAEESSksgrklppgprplpiiGNL  218
             A K E    L M +  L +LS   L TL++FFRH R  +S K     PP P      GNL
Sbjct  19    APKQETAFHLQMETSPLPILSTALLITLYFFFRHLRCRQSHKLPPGPPPLPVI----GNL  74

Query  219   HQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAV  398
             HQLG LPHR L+ L+K YGPIM+L+LG  P VVVSSP AAEL+LKT+D +F+SRP  DA+
Sbjct  75    HQLGNLPHRRLHSLAKSYGPIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDAL  134

Query  399   KNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGG  578
              +++ G+KGMAFA  G +WRG +K  T +LL+ AK+ESF  +RR E+   V+ +  AA  
Sbjct  135   HHLSYGNKGMAFAESGAYWRGMRKLCTLQLLSPAKVESFAPMRREELGRVVRRVRVAAAA  194

Query  579   REAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFD  758
              EAVD++AEVG+LI ++  +M+ G S  D  +LK  + E ++L GAFN+ADY+P L   D
Sbjct  195   HEAVDVSAEVGQLIGDLACRMILGCSTRDKFNLKPGIHEALNLAGAFNLADYVPLLGALD  254

Query  759   LQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS-----  923
             LQG+ +R +A+ + VDK+  +I++EHE+D      K   D +D +LA M +P +      
Sbjct  255   LQGITRRAKAVNRVVDKVLEDIIREHEEDTTG---KYEGDFIDALLAGMGHPINGSPQDE  311

Query  924   --HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
               H L   +IKAL  DMI  S ++S A IEW ++E++R+P  +K LQ ELE  VGL R V
Sbjct  312   PVHVLGRTNIKALALDMIAASYESSSAAIEWAMSELIRHPHALKRLQRELEAAVGLGRTV  371

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DLP L Y++MV+KESFRL+P   LL+P ES E IE+ G++IPK
Sbjct  372   EEADLPKLNYMDMVVKESFRLYPPGPLLIPHESTEGIEMGGYYIPK  417


 Score =   160 bits (405),  Expect(2) = 7e-130, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK +RV++N WA+G D   W+++ EEF PERF +  VD++G DF L+PFG GRR C
Sbjct  412   GYYIPKGTRVIVNAWALGRDADTWAEDPEEFRPERFANSGVDVKGRDFQLIPFGSGRRGC  471

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG++LGL+NV+L++ QL+HCF+WELP   SP ELDM+E FGL+ P+ +HL+  PSYRLL
Sbjct  472   PGMHLGLVNVRLVLAQLVHCFDWELPAGTSPSELDMSEDFGLSMPRAKHLILRPSYRLL  530



>gb|KHN32024.1| Cytochrome P450 71A1 [Glycine soja]
Length=459

 Score =   330 bits (845),  Expect(2) = 8e-130, Method: Compositional matrix adjust.
 Identities = 173/343 (50%), Positives = 239/343 (70%), Gaps = 5/343 (1%)
 Frame = +3

Query  225   LGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKN  404
             LG LPHR+L  L+K YGPIM++KLG+VP VVVSSP  AEL LKTHD +FASRPK  A + 
Sbjct  2     LGKLPHRSLQALAKNYGPIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKTLASEY  61

Query  405   IADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGRE  584
             ++ GSKG+AF+ YGP+WR  KK  T +LL+A+K+E F  LRR E+  +VKS+E AA  R+
Sbjct  62    MSYGSKGLAFSEYGPYWRNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKAAASRD  121

Query  585   AVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQ  764
              V+L+ +VG LI N+  +M+ G S +D  DLK + +E++ L G FNIADY+P+    DLQ
Sbjct  122   VVNLSEQVGELISNIVCRMILGRSKDDRFDLKGLAREVLRLTGVFNIADYVPWTGFLDLQ  181

Query  765   GLNKRLRALGKSVDKLFLEIVKEHEQ-DAKNGVQKSNKDIVDMMLASMKNPSSSHK----  929
             GL  +++ + K+ D++F +I+K+HE   A N     ++D VD++L+ M    +  +    
Sbjct  182   GLKGKMKKMSKAFDEVFEQIIKDHEDPSASNKNSVHSEDFVDILLSHMHQAVNQQEQKYV  241

Query  930   LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKD  1109
             +   +IKA++ DMI GS DTS   +EW ++E++RNP  MK LQEEL N VG N++VEE D
Sbjct  242   IGRTNIKAIILDMIAGSFDTSAVAVEWAMSELLRNPSDMKKLQEELNNVVGENKLVEESD  301

Query  1110  LPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             L  L YL MV+KE+ RL+P   LLVPRESLEDI +NG+ I KK
Sbjct  302   LSKLPYLNMVVKETLRLYPAGPLLVPRESLEDITINGYHIKKK  344


 Score =   164 bits (414),  Expect(2) = 8e-130, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KK+R+++N WAIG DP +WSDN + F PERF++ +VDIRGHDF LLPFG GRR C
Sbjct  338   GYHIKKKTRILVNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGC  397

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL    L++ QL+HCFNWELP  +SP +LDM+E FGL+ P+ + L+A+P+YRL
Sbjct  398   PGIQLGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSERFGLSLPRSKPLLAIPTYRL  455



>ref|XP_007036495.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20996.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=535

 Score =   332 bits (852),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 249/354 (70%), Gaps = 11/354 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPH NL+ L+K+YGPIM L+LG VP +VVSSP AAEL LKTHD VFASRPK 
Sbjct  66    GNLHLLGKLPHLNLHHLAKRYGPIMLLRLGYVPTIVVSSPQAAELFLKTHDVVFASRPKV  125

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G KGM F  YG +WR  +K+ T  LL+ +K+E F  LR+ E+ + V++++ A
Sbjct  126   QACEYLSYGGKGMGFTEYGSYWRTVRKWCTLHLLSGSKVEYFAPLRKAELGSMVETVKKA  185

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNN---DNHDLKLIVQEIVSLIGAFNIADYLP  740
             A   E VD++ +VG +IE++ YKM+FG  +N   DN +LKL+++EI  L GAFN++D++P
Sbjct  186   AAAGETVDISGKVGEVIEDIMYKMIFGRPSNSEDDNINLKLLIKEISRLAGAFNLSDFVP  245

Query  741   FLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGV--QKSNKDIVDMMLASMKNP  914
              L P DLQGL ++ + + K +DK   +I+ EHEQ   +    QK +++ V +M++ +  P
Sbjct  246   CLAPLDLQGLAQKQKRISKILDKFLEKIIDEHEQAVGSNPEEQKPHRNFVHVMVSLLNKP  305

Query  915   SSSHK------LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENK  1076
              + H       +D  +IKA++ +MI   +++S A IEW L+E++++PRVM  LQ+ELE  
Sbjct  306   MNPHDEEQEYIIDRTNIKAIMLEMIAAGLESSAAAIEWALSELLKHPRVMFSLQQELETV  365

Query  1077  VGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VG +RMVEE DLP L YL++V+KES RLHPV  LL+P ES+EDI ++G+FIPKK
Sbjct  366   VGRSRMVEESDLPQLTYLDVVVKESLRLHPVGPLLIPHESMEDITIDGYFIPKK  419


 Score =   158 bits (399),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N W++G DP +WS+N EEFFPERF+  ++D+RG DF L+PFG GRR C
Sbjct  413   GYFIPKKSRIIVNAWSMGRDPDVWSNNAEEFFPERFIDSNIDLRGQDFQLIPFGSGRRGC  472

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGLI ++L++ Q +HCF+WELP+ M P +LDM+E FGL+  +   L+   +YRLL
Sbjct  473   PGMQLGLITIRLVLAQFVHCFDWELPDGMLPVQLDMSENFGLSMSRANPLLVKATYRLL  531



>ref|XP_002511968.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF50637.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=501

 Score =   329 bits (844),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 250/349 (72%), Gaps = 7/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH+LG LPH+ L+ L+KKYGPIM ++LG VP +++SSP AAEL LKT+D  FASRP  
Sbjct  40    GNLHKLGDLPHQALHHLAKKYGPIMSMRLGLVPTIIISSPQAAELFLKTYDTNFASRPNI  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A   ++ G KG+ F+ YG +WR  +K  T +LL+A+KI++F  +R+ E    V  ++ A
Sbjct  100   QASHYLSYGRKGLVFSEYGSYWRSTRKLCTLQLLSASKIQAFAPMRKEEYGLMVGKLKKA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS-NNDNHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A  RE V+L+  V  LI+N++ +M+FG S NN +  LK +V+E + L+GAFNI D++PFL
Sbjct  160   AAAREVVNLSVSVSDLIQNMSCRMVFGVSTNNGDFRLKSVVEETLRLVGAFNIGDFVPFL  219

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
               FDLQG+ KR +A  ++ DK+  +I+ EHE++A +   K  +D VD +L+ +     SH
Sbjct  220   GAFDLQGVKKRSKACNEAFDKIMEKIIDEHEKEA-HWENKQQRDFVDALLSVVNQSMISH  278

Query  927   -----KLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                  ++D ++IKA+L D+IV +VDTS   IEWTLAE++R+P+ MK LQ+EL+N VGL++
Sbjct  279   DGAESEIDRSNIKAILIDIIVAAVDTSATAIEWTLAELIRHPQAMKTLQDELQNVVGLDK  338

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEEKDL  L YL+MVIKES RLHPVA LLVP ES+++I ++G+ IPK+
Sbjct  339   MVEEKDLSKLTYLDMVIKESSRLHPVAPLLVPHESIDEITIDGYHIPKR  387


 Score =   161 bits (408),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK+SR+++N WAIG D ++WSDNV+EF PERF+  +VD+ GHDF L+PFG GRR C
Sbjct  381   GYHIPKRSRILVNIWAIGRDSNVWSDNVDEFLPERFIGTNVDLHGHDFRLIPFGSGRRGC  440

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPN-KMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V++ + QL+HCFNW+LP+  +SP ELDM+E FGL   +  HL  VP YRL
Sbjct  441   PGIHLGLTTVRMAIAQLVHCFNWKLPDGDVSPSELDMSEQFGLTVSRASHLFLVPEYRL  499



>gb|KCW48536.1| hypothetical protein EUGRSUZ_K02211 [Eucalyptus grandis]
Length=502

 Score =   329 bits (844),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/395 (48%), Positives = 262/395 (66%), Gaps = 15/395 (4%)
 Frame = +3

Query  75    MSSVGLALLSI-FLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNL  251
             M +  L +LS   L TL++FFRH R  +S K     PP P      GNLHQLG LPHR L
Sbjct  1     METSPLPILSTALLITLYFFFRHLRCRQSHKLPPGPPPLPVI----GNLHQLGNLPHRRL  56

Query  252   NELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMA  431
             + L+K YGPIM+L+LG  P VVVSSP AAEL+LKT+D +F+SRP  DA+ +++ G+KGMA
Sbjct  57    HSLAKSYGPIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDALHHLSYGNKGMA  116

Query  432   FAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVG  611
             FA  G +WRG +K  T +LL+ AK+ESF  +RR E+   V+ +  AA   EAVD++AEVG
Sbjct  117   FAESGAYWRGMRKLCTLQLLSPAKVESFAPMRREELGRVVRRVRVAAAAHEAVDVSAEVG  176

Query  612   RLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRAL  791
             +LI ++  +M+ G S  D  +LK  + E ++L GAFN+ADY+P L   DLQG+ +R +A+
Sbjct  177   QLIGDLACRMILGCSTRDKFNLKPGIHEALNLAGAFNLADYVPLLGALDLQGITRRAKAV  236

Query  792   GKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS-------HKLDLASIK  950
              + VDK+  +I++EHE+D      K   D +D +LA M +P +        H L   +IK
Sbjct  237   NRVVDKVLEDIIREHEEDTTG---KYEGDFIDALLAGMGHPINGSPQDEPVHVLGRTNIK  293

Query  951   ALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYL  1130
             AL  DMI  S ++S A IEW ++E++R+P  +K LQ ELE  VGL R VEE DLP L Y+
Sbjct  294   ALALDMIAASYESSSAAIEWAMSELIRHPHALKRLQRELEAAVGLGRTVEEADLPKLNYM  353

Query  1131  EMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             +MV+KESFRL+P   LL+P ES E IE+ G++IPK
Sbjct  354   DMVVKESFRLYPPGPLLIPHESTEGIEMGGYYIPK  388


 Score =   160 bits (405),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK +RV++N WA+G D   W+++ EEF PERF +  VD++G DF L+PFG GRR C
Sbjct  383   GYYIPKGTRVIVNAWALGRDADTWAEDPEEFRPERFANSGVDVKGRDFQLIPFGSGRRGC  442

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG++LGL+NV+L++ QL+HCF+WELP   SP ELDM+E FGL+ P+ +HL+  PSYRLL
Sbjct  443   PGMHLGLVNVRLVLAQLVHCFDWELPAGTSPSELDMSEDFGLSMPRAKHLILRPSYRLL  501



>ref|XP_004490596.1| PREDICTED: uncharacterized protein LOC101501242 [Cicer arietinum]
Length=965

 Score =   326 bits (836),  Expect(2) = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/349 (51%), Positives = 246/349 (70%), Gaps = 8/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LGTLPHR+L+ LS KYGPIM L+LG+VP ++VSS  AAEL LKTHD VFASRPK 
Sbjct  501   GNLHLLGTLPHRSLHSLSIKYGPIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKI  560

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K I+  SKG+AF+ YGP+WR  +K  T +LL+ +K+E FG +R+ E+   VKS+E A
Sbjct  561   QASKLISYDSKGLAFSEYGPYWRSVRKLCTLKLLSPSKVEMFGPIRKEELGVLVKSLEKA  620

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E V+++  VG LIE +  K++ G S  +  DLK ++QE ++LIG+FN+ADY+P+L 
Sbjct  621   SMVGEVVNVSEVVGNLIEEIMCKIILGRSKYEQFDLKKLIQEALALIGSFNMADYVPWLG  680

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNK-DIVDMMLASMKNP---S  917
              FDLQGL +  + + KS+D++   I+ EHEQ  K  + K+++ D V+++L+ M  P    
Sbjct  681   AFDLQGLTRACKRVSKSLDEVLEVIITEHEQATK--IDKTHREDFVNILLSIMHQPIEFE  738

Query  918   SSHKL--DLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
             + H L  D  +IKA+L DMIV  +DTS   IEW L+E++R+PRVMK LQ+E+ N+VG  R
Sbjct  739   NEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNLQDEITNEVGNKR  798

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL  L YL+MV+ E+ RL+PV  LL+PRE  E   ++G+FI KK
Sbjct  799   MVEENDLNKLNYLDMVVNETLRLYPVGPLLIPRECRESRTIDGYFIKKK  847


 Score =   162 bits (411),  Expect(2) = 2e-128, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             KK+RVMIN WAIG D ++WS+N +EF+PERF+ K ++ +G +F  +PFG GRR CPG+ L
Sbjct  846   KKTRVMINAWAIGRDLNVWSENADEFYPERFIDKKMNYQGQEFDSIPFGSGRRRCPGIQL  905

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL+ VKL++ QL+HCFNW+LP  MSP  L+M E FGL  P+ QHL A+PSYRL
Sbjct  906   GLVTVKLVIAQLVHCFNWKLPYNMSPSNLNMEEKFGLTMPRAQHLYAIPSYRL  958


 Score =   330 bits (846),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 246/349 (70%), Gaps = 8/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL+ LGTLPHR+L+ LS KYGPIM L+LG+VP ++VSS  AAEL LKTHD VFASRPK 
Sbjct  50    GNLNLLGTLPHRSLHSLSIKYGPIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKI  109

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + I+ GSKG+ FA YGP+WR  +K  T +LL+ +K+E FG +R+ E+   VKS+E A
Sbjct  110   QGTELISYGSKGLGFAEYGPYWRSMRKLCTLKLLSPSKVEMFGPIRKEELGVLVKSLEKA  169

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E V+++   G LIE+V YKM+ G S  +  DLK +VQE ++LIG FN+ADY+P+L 
Sbjct  170   SMVGEVVNVSEVAGNLIEDVIYKMILGKSKYEQFDLKKLVQEAMALIGTFNMADYVPWLG  229

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNK-DIVDMMLASMKNP---S  917
              FDLQGL +  + + KS+D++   I+ EHEQ  K  + K+++ D V+++L+ M  P    
Sbjct  230   AFDLQGLTRAFKRVSKSLDEVLEVIITEHEQATK--IDKTHREDFVNILLSIMHQPIEFE  287

Query  918   SSHKL--DLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
             + H L  D  +IKA+L DMIV  +DTS   IEW L+E++R+PRVMK LQ+E+ N+VG  R
Sbjct  288   NEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEWALSELIRHPRVMKNLQDEITNEVGNKR  347

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL  L YL+MV+ E+ RL+PV  LL+PRE  E I ++G+FI +K
Sbjct  348   MVEENDLNKLNYLDMVVNETLRLYPVGPLLIPRECRESITIDGYFIKEK  396


 Score =   132 bits (333),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 20/113 (18%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             +K+RVMIN WAIG DP++WS+N                    F  +PFG GRR CPG+ L
Sbjct  395   EKTRVMINVWAIGRDPNVWSEN--------------------FDSIPFGSGRRRCPGIQL  434

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL+ VKL++ QL+HCFNWELP  MSP  L+M E FGL+ P+ QHL A+PSYRL
Sbjct  435   GLVTVKLVIAQLVHCFNWELPYNMSPSNLNMEEKFGLSMPRAQHLYAIPSYRL  487



>gb|KHG22812.1| Cytochrome P450 [Gossypium arboreum]
Length=493

 Score =   316 bits (810),  Expect(2) = 2e-128, Method: Compositional matrix adjust.
 Identities = 172/347 (50%), Positives = 241/347 (69%), Gaps = 13/347 (4%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  L+KK+GPIM ++LG VP VVVSSP  AE+ LKTHD VFASRPK 
Sbjct  45    GNLHILGMLPHRSLYHLAKKHGPIMSIRLGSVPTVVVSSPPVAEMFLKTHDVVFASRPKV  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
               +++I +G KG+AF  +GP+WR  +KF  Q+L  A+KIESF   R+  +  +++ ++ A
Sbjct  105   QVLQSIYNGKKGIAFTEHGPYWRSVRKFCNQQLFNASKIESFAPSRKEVLAHFIEFLKEA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNN-DNHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A  +E V+++ +VG L E +  KM+ G+    +  +LK +++E+ +L GAFN+AD++PFL
Sbjct  165   AVEKEVVNISKKVGDLNEKMNLKMILGSVKKYEEFNLKELIEELTNLAGAFNLADFVPFL  224

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMK---NPS  917
               FDLQGL  R R LG+ +D+    I+ +H+Q  ++       D V  ML  +    NP 
Sbjct  225   GAFDLQGLKSRTRTLGEKLDEALETIINDHQQQKQD-------DFVGTMLTELNKQMNPD  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
                 +D  SIKA+  DMIVGS+DTS A +EW L+E++R+PRVM   Q+ELE+ +G  RMV
Sbjct  278   GD-IMDRNSIKAITIDMIVGSLDTSAATLEWALSELIRHPRVMLKFQQELESVIG-KRMV  335

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DLP LEYL+MV++E+ RLHPVA LLVPRES+EDI ++G +IPKK
Sbjct  336   EENDLPKLEYLDMVVRETLRLHPVAPLLVPRESMEDIVIDGCYIPKK  382


 Score =   172 bits (436),  Expect(2) = 2e-128, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DP++WS+NVE+FFPERF++ ++++ GHDF L+PFG GRRVC
Sbjct  376   GCYIPKKSRVLVNVWAIGRDPNVWSNNVEDFFPERFINSNIELHGHDFELIPFGSGRRVC  435

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG  LGLI VKLI+ QL+HCF+WELP  MSP+ELDMTE FG + P+  +L A P YR+
Sbjct  436   PGKKLGLITVKLILAQLVHCFDWELPTGMSPNELDMTENFGSSLPRKTNLCAKPIYRM  493



>emb|CAN69565.1| hypothetical protein VITISV_033534 [Vitis vinifera]
Length=501

 Score =   312 bits (799),  Expect(2) = 7e-128, Method: Compositional matrix adjust.
 Identities = 162/348 (47%), Positives = 240/348 (69%), Gaps = 7/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPHR+L+ L+KKYG IM+++LG VP +VVSSP AA+L LKTHDAVFASR K 
Sbjct  43    GSLHLLGNLPHRSLSRLAKKYGSIMFMRLGSVPTIVVSSPQAAKLFLKTHDAVFASRAKL  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
               V+ +  G+KG+AF+ YG + R  +K    +L + AKI SF  +R   +  +V+S++  
Sbjct  103   QGVEYLTYGTKGIAFSEYGLYLRNVRKLCALKLFSTAKINSFASMRXEAIGLFVQSLKEM  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A     VD++  V  +IE++ Y+M+FG   ++  DLK ++ E  SL G FNIADYLPFL 
Sbjct  163   AAAGNVVDISTRVAEVIEDMAYRMVFGHDKDEMIDLKTLIGEATSLAGTFNIADYLPFLG  222

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS--  923
              FDLQGL +R +A  +++D++  +I+ +H +DA++GV   N   +D+ML+ M   +    
Sbjct  223   SFDLQGLTRRFQAASEAIDEVLEKIIDKHTKDARDGVNHMN--FMDIMLSLMSKSNDFKD  280

Query  924   ---HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                + +D  ++KA++FD++VG +D+S   ++W LAE++R+PRVMK +QEEL+N VG+ R 
Sbjct  281   EPLYAIDRTNVKAIIFDILVGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRT  340

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL +L Y+ MV+KE+ RLHPV   L+PRES+E   +N H+IPKK
Sbjct  341   VEESDLKSLIYMNMVLKEALRLHPVGPFLIPRESVEHSTINEHYIPKK  388


 Score =   175 bits (443),  Expect(2) = 7e-128, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKK+R++IN WAIG DP  WS+N EEFFPERF+  ++D+ GHDF L+PFG GRR CPG+ 
Sbjct  386   PKKARILINTWAIGRDPBAWSNNAEEFFPERFIDNNIDLYGHDFELIPFGSGRRRCPGIQ  445

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGLI V+LI+ QL+HCF+WELPN MSP +L+M E FGL  P+  HL+A P+YRL
Sbjct  446   LGLITVQLILAQLVHCFDWELPNDMSPSDLNMREKFGLTMPRANHLIAKPTYRL  499



>ref|XP_007160365.1| hypothetical protein PHAVU_002G315400g [Phaseolus vulgaris]
 gb|ESW32359.1| hypothetical protein PHAVU_002G315400g [Phaseolus vulgaris]
Length=517

 Score =   325 bits (834),  Expect(2) = 8e-128, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 245/348 (70%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  L+++YGPIM L+LG+VP VVVSS  AA+  LK HDAVFASRP  
Sbjct  51    GNLHMLGKLPHRTLQALAQQYGPIMSLRLGQVPIVVVSSSEAAQHFLKPHDAVFASRPIL  110

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K    GSKG+AF+ YGP+WR  +K  T +LL+A+K+ESF  LR+ E+   VK +E  
Sbjct  111   EASKYFGYGSKGLAFSEYGPYWRHMRKVCTLQLLSASKVESFAPLRKREVELAVKLVEER  170

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E +DL+  V  ++E++ YKM+ G S +D  DLK ++Q  +++ GAFNI DY+P+L+
Sbjct  171   AARGEVLDLSRVVHDVVEDIVYKMVLGCSKHDEFDLKGLIQNGMNIAGAFNITDYVPWLR  230

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
             P DLQGLN+  + +  ++D++  +I+KEHEQ +    +K +KD +D++L+    P     
Sbjct  231   PLDLQGLNRSYKKISAALDQVLEKIIKEHEQGSDVQNEKHHKDFIDILLSLKHQPIDPQD  290

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               SH +D  +IKA+L DMI G+ +TS   +EWTL+E++R+PRVMK LQ+EL+N VG N++
Sbjct  291   EQSHVIDETNIKAILLDMIAGAFETSATVVEWTLSELLRHPRVMKKLQDELDNLVGRNKL  350

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L+YL++VIKE+ RL+P    LVPRES ED+ + G+F+ KK
Sbjct  351   VEENDLAKLKYLDIVIKETLRLYPPGP-LVPRESTEDVIVEGYFLEKK  397


 Score =   161 bits (408),  Expect(2) = 8e-128, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR++IN WA+G D +IWSDN E F+PERF++ ++D RG+D   +PFG+GRR C
Sbjct  391   GYFLEKKSRIIINLWAMGRDCNIWSDNAEVFYPERFINNNLDFRGYDLQYIPFGFGRRGC  450

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG++LGL  VKL+V QL+HCF+WELP  M+P ELDM E FGL  P+V+HL AVP  R L
Sbjct  451   PGIHLGLATVKLVVAQLVHCFSWELPEGMTPDELDMNERFGLTIPRVKHLFAVPRNRFL  509



>ref|XP_007036496.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY20997.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=514

 Score =   328 bits (840),  Expect(2) = 1e-127, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 248/354 (70%), Gaps = 11/354 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPH NL+ L+K+YG IM L+LG VP +VVSSP AAEL LKTHD VFASRPK 
Sbjct  45    GNLHLLGKLPHLNLHHLAKRYGHIMLLRLGYVPTIVVSSPQAAELFLKTHDVVFASRPKV  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G KGM F  YG +WR  +K+ T  LL+ +K+E F  LR+ E+ + V++++ A
Sbjct  105   QACEYLSYGGKGMGFTEYGSYWRTVRKWCTLHLLSGSKVEYFAPLRKAELGSMVETVKKA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNN---DNHDLKLIVQEIVSLIGAFNIADYLP  740
             A   E VD++ +VG +IE++ YKM+FG  +N   DN +LKL+++EI  L GAFN++D++P
Sbjct  165   AAAGETVDISGKVGEVIEDIMYKMIFGRPSNSEDDNINLKLLIKEISRLAGAFNLSDFVP  224

Query  741   FLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGV--QKSNKDIVDMMLASMKNP  914
              L P DLQGL ++ + + K +DK   +I+ EHEQ   +    QK +++ V +M++ +  P
Sbjct  225   CLAPLDLQGLAQKQKRISKILDKFLEKIIDEHEQAVGSNPEEQKPHRNFVHVMVSLLNKP  284

Query  915   SSSHK------LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENK  1076
              + H       +D  +IKA++ +MI   +++S A IEW L+E++++PRVM  LQ+ELE  
Sbjct  285   MNPHDEEQEYIIDRTNIKAIMLEMIAAGLESSAAAIEWALSELLKHPRVMFSLQQELETV  344

Query  1077  VGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VG +RMVEE DLP L YL++V+KES RLHPV  LL+P ES+EDI ++G+FIPKK
Sbjct  345   VGRSRMVEESDLPQLTYLDVVVKESLRLHPVGPLLIPHESMEDITIDGYFIPKK  398


 Score =   158 bits (399),  Expect(2) = 1e-127, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N W++G DP +WS+N EEFFPERF+  ++D+RG DF L+PFG GRR C
Sbjct  392   GYFIPKKSRIIVNAWSMGRDPDVWSNNAEEFFPERFIDSNIDLRGQDFQLIPFGSGRRGC  451

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGLI ++L++ Q +HCF+WELP+ M P +LDM+E FGL+  +   L+   +YRLL
Sbjct  452   PGMQLGLITIRLVLAQFVHCFDWELPDGMLPVQLDMSENFGLSMSRANPLLVKATYRLL  510



>ref|XP_004490599.1| PREDICTED: uncharacterized protein LOC101502297 [Cicer arietinum]
Length=983

 Score =   319 bits (818),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/349 (50%), Positives = 243/349 (70%), Gaps = 8/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL+ LGTLPHR+L+ LS KYGPIM L+LG+VP ++VSS  AAEL LKTHD VFASRPK 
Sbjct  519   GNLNLLGTLPHRSLHSLSIKYGPIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKI  578

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + I+  SK +AF+ YGP+WR  +K  T +LL+ +K+E F  +R+ E+   VKS+E A
Sbjct  579   QGTELISYDSKALAFSEYGPYWRSVRKLCTLKLLSPSKVEMFRPIRKEELGVLVKSLEKA  638

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E V+++  VG LIE +  K++ G S  +  DLK +VQE ++LIG+FN+ADY+P+L 
Sbjct  639   SMVGEVVNVSEVVGNLIEEIMCKIILGRSKYEQFDLKKLVQEALALIGSFNMADYVPWLG  698

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNK-DIVDMMLASMKNP----  914
              FDLQGL +  + + KS+D++   I+ EHEQ  K  + K+++ D V+++L+ M  P    
Sbjct  699   AFDLQGLTRAFKRVSKSLDEVLEVIITEHEQATK--IDKTHREDFVNILLSIMHQPIDFE  756

Query  915   -SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                +H +D  +IKA L DMIV  +DTS   IEW L+E++R+PRVMK LQ+E+ N+VG  R
Sbjct  757   NEHNHIIDRTNIKAFLLDMIVAGIDTSSTVIEWALSELIRHPRVMKNLQDEITNEVGNKR  816

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL  L YL+MV+ E+ RL+PV  LL+PRE  E I ++G+FI KK
Sbjct  817   MVEENDLNKLNYLDMVVNETLRLYPVGPLLLPRECRESITIDGYFIKKK  865


 Score =   166 bits (421),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KK+RVMIN WAIG DP++WS+N +EF+PERF+ K ++ +G +F  +PFG GRR C
Sbjct  859   GYFIKKKTRVMINAWAIGRDPNVWSENADEFYPERFIDKKMNYQGQEFDSIPFGSGRRRC  918

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGL+ VKL++ QL+HCFNW+LP  MSP  L+M E FGL  P+ QHL A+PSYRL+
Sbjct  919   PGIQLGLVTVKLVIAQLVHCFNWKLPYNMSPSNLNMEEKFGLTMPRAQHLYAIPSYRLV  977


 Score =   322 bits (825),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 168/348 (48%), Positives = 243/348 (70%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH+LG LPHR+L  LSKKYGPIM L+ G++P +V+SS  AAEL LKTHD  FASRPK+
Sbjct  48    GNLHKLGNLPHRSLQLLSKKYGPIMSLQFGQIPFIVISSSKAAELFLKTHDIYFASRPKS  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ GSKGMA + YGP+WR  +K  T  LL+A K+E FG +R+ E+   VKS+E A
Sbjct  108   QGSEIMSYGSKGMAISEYGPYWRSVRKLCTLNLLSALKVEMFGPIRKEELGVLVKSLEKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E V+++  V  LIE++ YKM+ G S  +  DLK ++QE + L G+FN+ADY+P+L 
Sbjct  168   SLVGEVVNVSEAVENLIEDIMYKMILGRSKYEQFDLKGLIQEAMVLFGSFNVADYVPWLS  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASM-----KNP  914
              FD+QGL +  + + KS+D++   I+ EHE+ + N  +  ++D +D++L+ M     K  
Sbjct  228   AFDIQGLTRACKKMSKSLDEVLEVIITEHEE-STNVEKTRHEDFIDILLSIMHHNIDKEN  286

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               SH +D  +IKA+L D+I+G++DTS   I WT +E++R+P+VMK LQ E+E +VG  RM
Sbjct  287   EQSHAIDRTNIKAILLDVILGAIDTSANVIGWTFSELLRHPKVMKNLQNEIEKEVGNKRM  346

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEEKDL   +YL+MVI ES RL+PV  LL+PRE  E + ++G+FI +K
Sbjct  347   VEEKDLKKFKYLDMVIDESLRLYPVGPLLLPRECRESVTIDGYFIKEK  394


 Score =   162 bits (410),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    +K+R+++N WAIG DP++WS+N EEF+PERF+ K+++ +G DF  +PFG GRR C
Sbjct  388   GYFIKEKTRLIVNAWAIGRDPNVWSENAEEFYPERFVDKTMNYQGQDFECIPFGSGRRRC  447

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL+ V+ ++ QL+HCFNWELP+ ++P  L+M E FGL+ P+ QHL A+PSYRL
Sbjct  448   PGIHLGLVTVRFVIAQLVHCFNWELPSNITPSNLNMEEKFGLSIPRAQHLHAIPSYRL  505



>ref|XP_002275691.1| PREDICTED: cytochrome P450 CYP736A12 isoform X1 [Vitis vinifera]
Length=501

 Score =   309 bits (791),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 239/348 (69%), Gaps = 7/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPHR+L+ L+KKYG IM+++LG VP +VVSSP AA+L LKTHDAVFASR K 
Sbjct  43    GSLHLLGNLPHRSLSRLAKKYGSIMFMRLGSVPTIVVSSPQAAKLFLKTHDAVFASRAKL  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
               V+ +  G+KG+AF+ YG + R  +K    +L + AKI SF  +R   +  +V+S++  
Sbjct  103   QGVEYLTYGTKGIAFSEYGLYLRNVRKLCALKLFSTAKINSFASMRGEAIGLFVQSLKEM  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A     VD++  V  +IE++ Y+M+FG   ++  DLK ++ E  SL G FNIADYLPFL 
Sbjct  163   AAAGNVVDISTRVAEVIEDMAYRMVFGHDKDEMIDLKTLIGEATSLAGTFNIADYLPFLG  222

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS--  923
              FDLQGL +R +A  +++D++  +I+ +H +DA++GV   N   +D+ML+ M   +    
Sbjct  223   SFDLQGLTRRFQAASEAIDEVLEKIIDKHTKDARDGVNHMN--FMDIMLSLMSKSNDFKD  280

Query  924   ---HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                + +D  ++KA++ D++VG +D+S   ++W LAE++R+PRVMK +QEEL+N VG+ R 
Sbjct  281   EPLYAIDRTNVKAIILDILVGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRT  340

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL +L Y+ MV+KE+ RLHPV   L+PRES+E   +N H+IPKK
Sbjct  341   VEESDLKSLIYMNMVLKEALRLHPVGPFLIPRESVEHSTINEHYIPKK  388


 Score =   175 bits (444),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKK+R++IN WAIG DP+ WS+N EEFFPERF+  ++D+ GHDF L+PFG GRR CPG+ 
Sbjct  386   PKKARILINTWAIGRDPNAWSNNAEEFFPERFIDNNIDLYGHDFELIPFGSGRRRCPGIQ  445

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGLI V+LI+ QL+HCF+WELPN MSP +L+M E FGL  P+  HL+A P+YRL
Sbjct  446   LGLITVQLILAQLVHCFDWELPNDMSPSDLNMREKFGLTMPRANHLIAKPTYRL  499



>emb|CAN69566.1| hypothetical protein VITISV_033535 [Vitis vinifera]
Length=1390

 Score =   328 bits (842),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 166/348 (48%), Positives = 237/348 (68%), Gaps = 9/348 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG LPHRNL  L+KKYGPIMY++LG VP V+VSS  A +L LKTHD VFASRPK 
Sbjct  44    GCLHMLGNLPHRNLTRLAKKYGPIMYMRLGCVPTVIVSSAQATKLFLKTHDVVFASRPKL  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A +++  G+KG+AF+ YGP+WR  +K  T ELL  AKI SF  +R+ E+   V+S++  
Sbjct  104   QAFEHLTYGTKGIAFSEYGPYWRNVRKLCTVELLNTAKINSFASVRKEEVGMLVQSLKEM  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VD++ +V +++E+++Y+M+FG + +   DLK +V+E   L G FN+ DY PFL 
Sbjct  164   AAAGEVVDISTKVAQVVEDISYRMVFGRNKDGMIDLKTLVREGTRLAGTFNLGDYFPFLG  223

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS----  917
             P DL    +R +A+ K+ D++  +I+  H QD   G   ++ + +D+ML+ M N S    
Sbjct  224   PLDLSV--QRFKAINKAADEVLEKIIDRHIQDG--GKDHNHSNFIDIMLSLMSNFSNLRS  279

Query  918   -SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              SS+ +D  ++KA++ DM+VG +D+S   IEW  +E++R+PRVM+ LQ EL+N V ++RM
Sbjct  280   ESSYIIDRTNVKAIVLDMLVGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMDRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             V+E DL NL YL MV+KE  RLHP+   LVP  S EDI + GHFIPK+
Sbjct  340   VDESDLENLVYLNMVVKEVLRLHPIGPFLVPHASAEDITIEGHFIPKR  387


 Score =   155 bits (393),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK+S ++IN WAIG DP+IWSDNV+EF PERF++ ++D++G DF L+PFG GRR CPG+ 
Sbjct  385   PKRSTILINTWAIGRDPNIWSDNVDEFLPERFINSNIDLQGRDFELIPFGSGRRGCPGIQ  444

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPK-VQHLVAVPS  1563
             LGL  V+L++ QL+HCFNWELPN MS  +LDM+E FGL  P+ +  L A+ S
Sbjct  445   LGLRTVRLVLAQLLHCFNWELPNDMSSDDLDMSEKFGLTMPRHLTRLFAIKS  496



>ref|XP_007152789.1| hypothetical protein PHAVU_004G159800g [Phaseolus vulgaris]
 gb|ESW24783.1| hypothetical protein PHAVU_004G159800g [Phaseolus vulgaris]
Length=499

 Score =   340 bits (873),  Expect(2) = 7e-127, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 250/347 (72%), Gaps = 4/347 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  L+ KYGPIM LKLG++PA+VVSSP  AEL LKTHD VFASRPK 
Sbjct  41    GNLHMLGKLPHRTLQSLATKYGPIMSLKLGQIPAIVVSSPETAELFLKTHDTVFASRPKI  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ GSKG+AF+ Y  +WR  +K  T +LL+A+++E F  +RR E+   VKS++ +
Sbjct  101   QASEFLSHGSKGLAFSEYSAYWRNMRKVCTVQLLSASRVEMFAPMRREELGVLVKSLKHS  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VDL+  +G L+E + +KM+ G + +D  DLK ++QE ++LIGAFN+ADY+P+L+
Sbjct  161   AASGEVVDLSELLGELMEKMVFKMVLGCAKDDRLDLKNLIQEALNLIGAFNLADYIPWLR  220

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
              FDLQGL KRL+   KS+DK F +I+++ + +  +  +K N D V+++L+ +  P+  H 
Sbjct  221   VFDLQGLTKRLKKASKSLDKGFEQIIQDKKSNPYDKDKKCNMDFVEVLLSLIHQPNEVHN  280

Query  930   ----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
                 +D  +IKA++ D+I G+++TS   +EW ++E++R+P VMK LQ ELE+ VG+NR V
Sbjct  281   NQNVIDRTNIKAIILDIIAGALETSSTMLEWAMSELLRHPSVMKRLQHELEHVVGMNRHV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL NL YL MV+KE+ RLHPVA LLVPRE  ED+ ++G+FI KK
Sbjct  341   EENDLENLSYLNMVVKETLRLHPVAPLLVPRECREDVIIDGYFIKKK  387


 Score =   143 bits (361),  Expect(2) = 7e-127, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR+++N WAIG DP +W +N   F P RF + ++DIRG DF +LPFG GRR C
Sbjct  381   GYFIKKKSRIIVNAWAIGRDPKVW-NNAAIFDPTRFENDNIDIRGKDFRILPFGSGRRGC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  + L++ QL+HCF+W LP  MS HELDM E FGL+ P+  HL+  P YRL
Sbjct  440   PGIHLGLTTLSLVLAQLVHCFDWVLPLGMSSHELDMQEIFGLSIPRKNHLLTRPVYRL  497



>ref|XP_003525259.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=468

 Score =   315 bits (807),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 242/348 (70%), Gaps = 11/348 (3%)
 Frame = +3

Query  225   LGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKN  404
             LG LPHR L  L+ +YGPIM L+LG+VP VVVSS  AAE  LK HDAVFASRP+ +A K 
Sbjct  2     LGKLPHRTLEALAHRYGPIMSLRLGQVPHVVVSSSEAAEDFLKAHDAVFASRPRLEASKY  61

Query  405   IADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGRE  584
                GSKG+AF+ YGP+WR  +K  T  LLTA+K++SF  LR+ E+   VKS++ +A  +E
Sbjct  62    FGYGSKGLAFSEYGPYWRYMRKVCTLRLLTASKVDSFAPLRKRELELAVKSLQESAAAKE  121

Query  585   A---VDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPF  755
                 VDL+  V  ++E + YKM+ G+S +D  DLK ++Q  ++L GAFN++DY+P+L+ F
Sbjct  122   GEVVVDLSEVVHNVVEEIVYKMVLGSSKHDEFDLKGLIQNAMNLTGAFNLSDYVPWLRAF  181

Query  756   DLQGLNKRLRALGKSVDKLFLEIVKEHEQ--DAKNGVQKSNKDIVDMMLASMKNP-----  914
             DLQGLN+  + + K++D++  +I+KEHE   D +N     ++D +D++L+ M  P     
Sbjct  182   DLQGLNRSYKRISKALDEVMEKIIKEHEHGSDVQNEQHHRHRDFIDILLSLMHQPIDPYD  241

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               +H +D  +IKA+L DMI G+ +TS   +EWT +E++R+PRVMK LQ+EL+N VG ++M
Sbjct  242   EQNHIIDKTNIKAILLDMIAGAFETSATVVEWTFSELLRHPRVMKNLQDELDNVVGRDKM  301

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L YL++VIKE+ RL+P    LVPRES ED  + G+F+ KK
Sbjct  302   VEENDLAKLSYLDIVIKETLRLYPPGP-LVPRESTEDAMVQGYFLKKK  348


 Score =   167 bits (424),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR++IN WA+G D  IWSDN E F+PERF++K++D RG D   +PFG+GRR C
Sbjct  342   GYFLKKKSRIIINIWAMGRDSKIWSDNAEVFYPERFINKNLDFRGLDLQYIPFGFGRRGC  401

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG++LGL  VK++V QL+HCF+WELP  M+P ELDM+E FGL+ P+V+HL+AVP YRL 
Sbjct  402   PGIHLGLATVKIVVAQLVHCFSWELPGGMTPGELDMSEKFGLSIPRVKHLIAVPKYRLF  460



>gb|KEH27058.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   310 bits (794),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 235/348 (68%), Gaps = 5/348 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR+L  LS+KYGPIM  KLG+V  +VVSSP  AEL LKTHD++F+SRPK 
Sbjct  48    GNLHMLGKLPHRSLQLLSQKYGPIMSFKLGQVQTIVVSSPQIAELFLKTHDSIFSSRPKA  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A   +  G KG+ F  YG +WR  +K  T +LL ++K+E F  LR+ E+   VKS+  +
Sbjct  108   FAADYMTYGKKGIIFTEYGDYWRNMRKLCTIQLLHSSKVEMFAPLRKEEVGLLVKSLRKS  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E V+++  V  LIEN+T KM+ G S +D  DLK IV + + L G FN++DYLP+L+
Sbjct  168   ATLHEVVNVSKVVAELIENITCKMILGRSKDDRFDLKGIVHKAMLLTGKFNLSDYLPWLR  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHE-QDAKNGVQKSNKDIVDMMLA----SMKNP  914
             PFDLQG+ ++++   K  D+L  +I+KE E Q  +     +NKD VD++L+    S+ + 
Sbjct  228   PFDLQGIERQIKKTWKQYDELLEQIIKERENQSIEEQKGHNNKDFVDILLSLMNQSIDSK  287

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              + + +D  +IKA+L DMI  ++DT+   I+W L++++++P  MK LQ+ELEN VG+NR 
Sbjct  288   DNKYDIDRTNIKAILIDMISAALDTTSVVIDWVLSQLLKHPYAMKKLQQELENVVGMNRQ  347

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE  L  L YL MV+KE+ RL PV  LLVP E LED+ ++G++I KK
Sbjct  348   VEETHLAKLPYLTMVVKETLRLCPVGPLLVPHECLEDVVVDGYYIKKK  395


 Score =   172 bits (436),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KK+R++IN W IG D ++WSDN E F+PERF    VDIRGHDF L+PFG+GRR C
Sbjct  389   GYYIKKKTRILINAWTIGRDTNVWSDNAETFYPERFEDSDVDIRGHDFQLIPFGFGRRSC  448

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ +GL +VKL+V QLMHCFNWELP+ MS  ELDM+E F L+ P+ Q L+A+P+YRL+
Sbjct  449   PGIQMGLTSVKLVVAQLMHCFNWELPDAMSKDELDMSEKFELSMPRCQPLLAMPTYRLV  507



>ref|XP_004301062.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   327 bits (839),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 248/351 (71%), Gaps = 10/351 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  L+K+YG IM L+LG VPA+V+SSP AAE  LKTHD  FASRPK 
Sbjct  49    GNLHMLGNLPHRTLQNLAKQYGDIMSLRLGNVPAIVISSPKAAEPFLKTHDTNFASRPKI  108

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A +     +KGMAF+ YGP+WR  +K  T +L   AK+E+F  LR+ E+   V  ++ A
Sbjct  109   QATEYFY-CTKGMAFSEYGPYWRHVRKICTLQLFCPAKLETFAPLRKEELGGLVGKLKRA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VD++ ++G + E++TY+M+ G   +D  DLK IV+EI  L+GAFNI+D++P L 
Sbjct  168   AEEGEVVDVSEKIGEMNEDITYRMVLGCKRDDRFDLKAIVEEIFFLVGAFNISDFIPSLS  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKN---GVQKSNKDIVDMMLASMK---N  911
              FD+Q + KRL+ + K+ D+L+ +I+ +HEQ A+    G Q  ++D VD++L+  K   N
Sbjct  228   AFDIQRI-KRLKKVSKTADQLWDKIIDDHEQAAETKGGGKQGQHEDFVDVLLSFTKQLLN  286

Query  912   PSSS--HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
             P+    H LD  ++KA+L DMI  + DTS   I W+LAE+MR+PR+MK LQEEL+  VG+
Sbjct  287   PNDEQVHFLDRENVKAILLDMITAAFDTSATTIIWSLAELMRHPRIMKRLQEELQTVVGM  346

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +RMVEE DLPNL+YL++V+KESFRLHPVA LL P ES++DI ++G+ +PKK
Sbjct  347   DRMVEESDLPNLDYLDLVVKESFRLHPVAPLLDPHESIKDITIDGYDVPKK  397


 Score =   155 bits (391),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N W+I  DP++WS+NVEEF PERF + +V  +GH + L+PFG GRR C
Sbjct  391   GYDVPKKSRLIVNFWSIARDPNVWSENVEEFCPERFTNINVYRQGHHYQLIPFGTGRRGC  450

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGL  V++++ QL+HCFNWELPN M P +LDMTE FGL+    +HL+A P++RL+
Sbjct  451   PGMQLGLTTVRIVLAQLVHCFNWELPNGMLPLDLDMTEKFGLSMSMAKHLLAKPTFRLM  509



>ref|XP_010036875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW48537.1| hypothetical protein EUGRSUZ_K02212 [Eucalyptus grandis]
Length=504

 Score =   319 bits (818),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 238/351 (68%), Gaps = 11/351 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLHQL  LPHR L+ L+K YGPIM+L+LG  P VV+SSP  AEL+LKTHD VF  RPK 
Sbjct  44    GNLHQLLDLPHRRLHRLAKTYGPIMFLRLGSKPTVVISSPETAELVLKTHDDVFLGRPKG  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                 ++  G +GMAF   G +WR  +K     LL+ AK+ES+   R+ E+   V+ + AA
Sbjct  104   RVTHHLTYGDRGMAFTEGGEYWRSARKLCALRLLSPAKVESYAPARKEELGGMVERVRAA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFG---TSNNDNHDLKLIVQEIVSLIGAFNIADYLP  740
             A   + VD++AEVG L+ N++ +++ G   +S  D  DLK ++ E++SL G+FN+ADY+P
Sbjct  164   AAAHKVVDVSAEVGELMGNLSCRLILGYCSSSGEDEFDLKKLIHEVLSLAGSFNLADYVP  223

Query  741   FLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSS  920
              L PFDLQGL +R + + +++DK+   ++KEH+QD      K   D +D +L+  ++P +
Sbjct  224   LLGPFDLQGLARRAKVVHQAIDKVLEGVIKEHQQDTTG---KYKGDFLDTILSVTQHPMT  280

Query  921   SHK-----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
               +     LD  ++KA++ D+I GS ++S   I+W  +E+MR+P VMK LQ+EL   VG+
Sbjct  281   DSQDKPDMLDRTNVKAIVLDLISGSYESSSTIIDWAFSELMRSPHVMKKLQQELRAIVGM  340

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             NRMVEE DLP L YL+MVIKE+FRL+P   LL+P ES EDIE++GH+IPK+
Sbjct  341   NRMVEESDLPKLNYLDMVIKETFRLYPPGPLLIPHESTEDIEIDGHYIPKR  391


 Score =   162 bits (411),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK++RV++N WA+G D   W D+VEEF PERF + SVD++G DF L+PFG GRR C
Sbjct  385   GHYIPKRTRVIVNAWALGRDIDAWGDDVEEFKPERFANSSVDVKGRDFQLIPFGSGRRSC  444

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+NL LIN +L + Q++HCF+WELP+ MSP +LDMTE  GL+  K +HL  VP+YRLL
Sbjct  445   PGMNLALINTRLFLAQMVHCFDWELPDGMSPSDLDMTEEVGLSLSKAKHLSLVPTYRLL  503



>ref|XP_010045642.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW83846.1| hypothetical protein EUGRSUZ_B00716 [Eucalyptus grandis]
Length=508

 Score =   312 bits (799),  Expect(2) = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 232/349 (66%), Gaps = 9/349 (3%)
 Frame = +3

Query  213   NLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKND  392
             +LH LG LPHR L   S +YGPIM ++LG VP VVVSSP AA L L THDAVFASRP++ 
Sbjct  49    SLHLLGDLPHRGLRCFSARYGPIMSIRLGLVPTVVVSSPEAARLFLGTHDAVFASRPRSP  108

Query  393   AVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRR---GEMVAWVKSIE  563
               +     +KG+ F  YGP+WR  +K     LL+ A++ SF  +RR   GE+VA ++  E
Sbjct  109   EAELDFYTTKGLVFTEYGPYWRSVRKLCNTHLLSGARVRSFEGVRREEAGELVASLR--E  166

Query  564   AAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPF  743
             AAA  + AVDL+A V R +E +  +M+ G S +  HDLK I+QE   + GAFN+AD++PF
Sbjct  167   AAAACKAAVDLSARVARTMEEMACRMILGRSTDGEHDLKGIIQEAARVAGAFNLADFVPF  226

Query  744   LKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP---  914
             L+P DLQG  +R +A+ +SVDKL  +I+ +H +DA     +  +D +D++L+ M  P   
Sbjct  227   LRPLDLQGSTRRFKAVRRSVDKLLEKIIDDHVRDAAYYDSEHQEDFIDILLSMMNQPIDP  286

Query  915   -SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                 + +D  +IKA++ DMI GS +TS   I+W  +E+MRNP+ M  LQEELE  VGL R
Sbjct  287   REEKYIIDRTNIKAIILDMISGSFETSSTSIDWAFSELMRNPQAMARLQEELETVVGLTR  346

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL  L YL+MV KES RLHPV  LLVPRES+ED  +N  FIPKK
Sbjct  347   MVEESDLSKLNYLDMVAKESMRLHPVIPLLVPRESMEDAIINERFIPKK  395


 Score =   169 bits (429),  Expect(2) = 3e-126, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKS++++N WAIG DPS+WS+N EEF PERF    +D++GH F LLPFG GRR CPG+ 
Sbjct  393   PKKSQIIVNIWAIGRDPSVWSENAEEFVPERFADNGIDVKGHHFELLPFGSGRRGCPGIQ  452

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             LGLI VK ++ QL HCF WELP  M P ++DM+E FGL+ P+  HL AVP+YRLL
Sbjct  453   LGLIQVKFVLAQLAHCFKWELPKGMVPSDIDMSERFGLSVPRANHLFAVPTYRLL  507



>ref|XP_002280620.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=498

 Score =   314 bits (805),  Expect(2) = 5e-126, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 237/347 (68%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPH++L  L+KKYGPIMY++   VP +VVSSP AAE  LKT+D VFA RP +
Sbjct  42    GNLHMLGELPHQDLLRLAKKYGPIMYMRFALVPTIVVSSPQAAEQFLKTNDLVFAGRPPH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  + ++   KG++F  YGP+WR  +K  T  LL+  +I SF  LRR E+   +KS++ A
Sbjct  102   EGSRIVSYDRKGISFTDYGPYWRNMRKLCTLGLLSNLRISSFQPLRREELDLLIKSLKEA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVDL+A++  L  +++ +M+FG      + D    K ++QE + L GA NI DY+
Sbjct  162   ALARTAVDLSAKISSLSADMSCRMIFGKKYMDKDIDERGFKAVIQEGMQLAGAPNIGDYI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+ P DLQGL +R++A+ K  D  F +I+ +H  + K   Q   KD++D+ML  M +  
Sbjct  222   PFVAPLDLQGLARRMKAISKVFDAFFEKIIDDHIHEPKEEGQP--KDLIDVMLGYMGSKE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  +++ ++IKAL+ DM+ GS+DTS   IEW LAE+++NPR+MK +QEELE  VG+ R V
Sbjct  280   NEFQIERSNIKALVLDMLAGSMDTSATAIEWALAELLKNPRIMKKVQEELEKVVGMERKV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL +LEYL+MV+KE+ RLHPVA LL+P ESLED  +NG  IP+K
Sbjct  340   EESDLESLEYLDMVVKETLRLHPVAPLLIPHESLEDCTVNGFHIPQK  386


 Score =   166 bits (421),  Expect(2) = 5e-126, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   P+KSRVM+N +AIG DP++W+D  E+F PERF+  S+D+RG DF L+PFG GRR 
Sbjct  379   NGFHIPQKSRVMVNTYAIGRDPNVWTD-AEKFLPERFIGSSIDLRGRDFQLIPFGSGRRG  437

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+L++ QL+HCF+WELPN M P ELDMTE FGL  P+ +H++AVP+YRL
Sbjct  438   CPGMQLGLTVVRLVLAQLVHCFDWELPNGMMPSELDMTEEFGLTVPRAKHILAVPTYRL  496



>gb|KHG22550.1| Cytochrome P450 [Gossypium arboreum]
 gb|KHG28510.1| Cytochrome P450 [Gossypium arboreum]
Length=497

 Score =   307 bits (787),  Expect(2) = 6e-126, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 236/346 (68%), Gaps = 10/346 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPH++L  L+KKYGP+M ++LG VP VVVSSP  AE+ LKTHDAVFASRP+ 
Sbjct  48    GNLHMLGMLPHQSLYHLAKKYGPMMSIRLGVVPTVVVSSPQVAEIFLKTHDAVFASRPRL  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
               ++ I +G +G+AF   G +WR  +K     + TA+KIESF   R+  +  +++S++ A
Sbjct  108   QVLELIYNGKRGIAFTELGSYWRSVRKICNMTIFTASKIESFASTRKEVLAHFIESLKEA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFG-TSNNDNHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A  +E V+++ +VG L E +T +M+ G        +LK ++ E+  + GAFN+AD +PFL
Sbjct  168   ASAKEVVNISKKVGALNEEMTLRMVLGNVKKYQGFNLKELIDELTHIAGAFNLADVVPFL  227

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
               FDLQG+  R + LG+ +DK    I+ +HEQ  ++       D V  +L  +  P ++ 
Sbjct  228   GAFDLQGIKARTKKLGEKLDKALEMIIDDHEQHKQD-------DFVGTLLKELNQPMNND  280

Query  927   K--LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVE  1100
                +D  SIKA+  DM+VG++DTS A +EW L+E++R+PRVM  LQ+ELE+ VG  RMVE
Sbjct  281   GDIMDRNSIKAITIDMMVGALDTSAATLEWALSELLRHPRVMLKLQQELESIVGNKRMVE  340

Query  1101  EKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             E DLP LEYL+MV+KE FRLHPVA LLVPRES+EDI ++G +IPK+
Sbjct  341   ENDLPKLEYLDMVVKEIFRLHPVAPLLVPRESVEDIIIDGCYIPKQ  386


 Score =   173 bits (438),  Expect(2) = 6e-126, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK+SRV++N WA+G DP+IWS+N EEFFPERF+  ++D+ GHDF L+PFG GRR+C
Sbjct  380   GCYIPKQSRVLVNIWAMGRDPNIWSNNAEEFFPERFIDSNIDLHGHDFELIPFGAGRRLC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG  LGLI VKLI+ QL+HCFNWELP+ MSP+ELDMTE FG++ P+  +L   P+YR+
Sbjct  440   PGKKLGLITVKLILAQLVHCFNWELPSGMSPNELDMTENFGVSLPRKINLCVKPTYRM  497



>gb|KHN20715.1| Cytochrome P450 71A1 [Glycine soja]
Length=500

 Score =   318 bits (814),  Expect(2) = 6e-126, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 246/351 (70%), Gaps = 11/351 (3%)
 Frame = +3

Query  210   GNLHQLG---TLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASR  380
             GNLH +G   TLPHR+L  LSK+YGPIM L+LG VP VVVSSP AAEL LKTHD VFA+R
Sbjct  35    GNLHMVGGAGTLPHRSLQSLSKRYGPIMSLQLGNVPTVVVSSPEAAELFLKTHDTVFANR  94

Query  381   PKNDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI  560
             PK +  +    G++ +AFA YGP+WR  +K  T  LL+A+K+ESF  LR+ E+ A V+S+
Sbjct  95    PKFETAQYTY-GAESVAFAEYGPYWRNVRKVCTTHLLSASKVESFDGLRKREIGAMVESL  153

Query  561   EAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLP  740
             + AA  RE VD++  VG ++ ++  KM+ G + +D  DLK I+ E +S+ GAFN+ADY+P
Sbjct  154   KEAAMAREVVDVSERVGEVLRDMACKMVLGRNKDDRFDLKGILVETMSVSGAFNLADYVP  213

Query  741   FLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSS  920
             +L+ FDLQGL +R + + KS+DK+  E+++EH+       Q   KD +D++L+    P  
Sbjct  214   WLRLFDLQGLTRRSKKISKSLDKMLDEMIEEHQLAPP--AQGHLKDFIDILLSLKDQPIH  271

Query  921   SHK-----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
              H      +D  SIK ++FDMI+G+ +TS   IEW ++E++R+PRVM+ LQ EL++ VG+
Sbjct  272   PHDKHAPIIDKRSIKGIVFDMIIGASETSSNVIEWAISELVRHPRVMENLQNELKDVVGI  331

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             N+MV+E DL  L YL+MV+KE+ RLHPV  LL P ES+EDI + G++I KK
Sbjct  332   NKMVDENDLAKLSYLDMVVKETLRLHPVVPLLAPHESMEDIVIEGYYIKKK  382


 Score =   162 bits (411),  Expect(2) = 6e-126, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSRV+IN WAIG DP +WS+N E F+PERFM+ ++D +G DF L+PFG GRR C
Sbjct  376   GYYIKKKSRVIINAWAIGRDPKVWSENAEVFYPERFMNSNIDFKGQDFQLIPFGSGRRSC  435

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ +GL  VKL++ QL+HCF WELP  + P ELDM E  GL+ P+ +HL+ +P+YRLL
Sbjct  436   PGIVMGLTTVKLVLTQLVHCFKWELPCGIGPDELDMNEKSGLSMPRARHLLVIPTYRLL  494



>gb|AFK79030.1| cytochrome P450 CYP736A53 [Bupleurum chinense]
Length=498

 Score =   315 bits (808),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/349 (51%), Positives = 235/349 (67%), Gaps = 8/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L  LG LPHR   EL+KKYGPIM L+LG V  +VVSSP AA+L LKTHD+VFA RPK 
Sbjct  41    GSLLHLGKLPHRTFQELAKKYGPIMSLRLGYVSTIVVSSPEAAKLFLKTHDSVFADRPKL  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +AV++++ G  G+ F   G  WR  +KF  QELL  AK+ S+  +RR E+   V+ I+  
Sbjct  101   EAVEHLSFGDNGITFT-NGTFWRHVRKFVVQELLAPAKVNSYEGMRREELGVVVEEIKKD  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VD++A+VG +IEN+TY+ LFG S +D  DLK I+ E   L G FNI D++PFL+
Sbjct  160   AAAGEVVDVSAKVGDMIENMTYRYLFGRSKDDRFDLKGIMTEASFLAGQFNIVDFVPFLR  219

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
             PFDLQGL +R +   K +D++   I+ EHEQ+  N   K N D+VD M+   +N SS + 
Sbjct  220   PFDLQGLARRYKQKSKQLDEMLELIIDEHEQNL-NDSHKGNPDVVDEMILLSRNDSSKNH  278

Query  930   ------LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                   LD  SIK+++ D+I  S++TS   I+W L E+M++P  MK  QEEL + VGL+R
Sbjct  279   HELAKLLDRPSIKSIVIDIITASINTSSISIDWILTELMKHPTAMKKCQEELTSVVGLDR  338

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEEKDLP LEYL MVIKE  RL+P+A LL P E+ EDI +NG+ I KK
Sbjct  339   MVEEKDLPKLEYLYMVIKEGLRLYPIAPLLGPHEAKEDIMINGYHIHKK  387


 Score =   164 bits (416),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             KKSR+++N WAIG DP +WSDN EEF PERF    +D+RG DF LLPFG GRR CPG+ L
Sbjct  386   KKSRIIVNVWAIGRDPKVWSDNAEEFIPERFADSKIDLRGRDFELLPFGSGRRGCPGIQL  445

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             G++NV+L++ QL+HCF WELP   +P +LDMTE FGL  P+++HL  VP  R+
Sbjct  446   GVLNVQLVLAQLLHCFEWELPAGKAPEDLDMTELFGLTIPRIEHLQLVPKIRI  498



>ref|XP_006380460.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
 gb|ERP58257.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
Length=497

 Score =   321 bits (822),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 171/347 (49%), Positives = 240/347 (69%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH +L++L+KKYGPIMY++LG VP VVVSSP AAELILKTHD VFA+RP N
Sbjct  42    GSLHLLGKFPHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTHDLVFANRPPN  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I    KG+ FAPYG +WR  +K  T ELL+  KI SF   R+ E+   +  I+ A
Sbjct  102   EAAKHITYEQKGLTFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSN----NDNHDLKLIVQEIVSLIGAFNIADYL  737
             +  R AVDL+A+V  L  +++ +M+FG  +     D    + +  E + +  +FN+ DY+
Sbjct  162   SRDRVAVDLSAKVSSLNADISCRMIFGKKDLEKEFDERGFEPLTHEGIRIAASFNLGDYI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL KR++A+GK  D  F +I+ EH Q      +   KD +D+ML  + +  
Sbjct  222   PPIAPLDLQGLTKRMKAIGKVFDDFFEKIIDEHIQFKD---ENRTKDFLDVMLDFLGSEE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++   +IKA++ DM+VGS+DT  A IEWTL+E++++PRVMK +Q+ELE K+G++RMV
Sbjct  279   TEYRIGRGNIKAIILDMLVGSMDTPAAAIEWTLSELIKHPRVMKKVQKELEEKIGMDRMV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL MVIKE+FRLHPVA LLVP ES+ED  ++G  IP+K
Sbjct  339   EESDLEGLEYLHMVIKEAFRLHPVAPLLVPHESMEDCTIDGFLIPQK  385


 Score =   157 bits (397),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+K+RV++N WAIG D S W+D   +F PERF   ++D+RG DF LL FG GRR C
Sbjct  379   GFLIPQKTRVLVNVWAIGRDQSAWTD-ANKFIPERFAGSNIDVRGRDFQLLTFGAGRRSC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V+ IV QL+HCF+WELPN M P ELDMTE FGL +P+  HL A P+YRL
Sbjct  438   PGMHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRL  495



>ref|XP_002310014.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90464.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   318 bits (816),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 239/347 (69%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH +L++L+KKYGPIMY++LG VP VVVSSP AAELILKT+D VFASRP+N
Sbjct  42    GSLHLLGKFPHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRN  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   K ++FAPYG +WR  +K  T ELL+  KI SF   R+ E+   +  I+ A
Sbjct  102   EAAKHISYEQKNLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +  R AVDL A+V  L  +++ +M+FG        D    K +  E++ L  +FN+ DY+
Sbjct  162   SRERVAVDLGAKVSSLSADISCRMVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL KR++A+GK  D  F +I+ EH Q      +   KD VD+ML  + +  
Sbjct  222   PPIAPLDLQGLTKRMKAVGKVFDDFFEKIIDEHIQFKD---ENRTKDFVDVMLDFLGSEE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + + +   +IKA++ DM+VGS+DTS   IEWTL+E++R+PRVMK +Q+ELE K+G++RMV
Sbjct  279   TEYSIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL MVIKE+FRLHPVA LL P ES+ED  ++G  IP+K
Sbjct  339   EESDLEGLEYLHMVIKEAFRLHPVAPLLGPHESMEDCTIDGFLIPQK  385


 Score =   159 bits (403),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+K+RV++N WAIG D S W+D   +F PERF   ++D+RG DF LLPFG GRR C
Sbjct  379   GFLIPQKTRVIVNVWAIGRDQSAWTD-ANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V+ IV QL+HCF+WELPN M P ELDMTE FGL +P+  HL A P+YRL
Sbjct  438   PGMHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRL  495



>ref|XP_002310015.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90465.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   320 bits (821),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 241/347 (69%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L++L+KKYGPIMY++LG VP VVVSSP AAELILKT+D VFA+RP N
Sbjct  42    GSLHLLGKFPHQDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTNDLVFANRPPN  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I    K ++FAPYG +WR  +K  T ELL+  KI SF   R+ E+   +  I+ A
Sbjct  102   EAAKHITYEQKNLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +  R AVDL+A+V  L  +++ +M+FG        D    K +  E + L  +FN+ DY+
Sbjct  162   SRERVAVDLSAKVSSLSADISCRMVFGKKYLEKEFDEKGFKPLTHEAMRLTASFNLGDYI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL KR++A+GK  D  F +I+ EH Q      +   KD VD+ML  + +  
Sbjct  222   PPIAPLDLQGLTKRMKAVGKVFDDFFEKIIDEHIQIKD---ENRTKDFVDVMLDFLGSEE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++   +IKA++ DM+VGS+DTS A IEWTL+E++++PRVMK +Q+ELE K+G++RMV
Sbjct  279   TEYRIGRDNIKAIILDMLVGSMDTSAAAIEWTLSELIKHPRVMKKVQKELEEKIGMDRMV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL MVIKE+FRLHPVA LLVP ES+ED  ++G  IP+K
Sbjct  339   EESDLEGLEYLHMVIKEAFRLHPVAPLLVPHESMEDCTIDGFLIPQK  385


 Score =   157 bits (397),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+K+RV++N WAIG D S W+D   +F PERF   ++D+RG DF LLPFG GRR C
Sbjct  379   GFLIPQKTRVIVNVWAIGRDQSAWTD-ANKFIPERFAGSNIDVRGRDFQLLPFGSGRRSC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V+ IV QL+HCF WELPN M P ELDMTE F L +P+  HL A P+YRL
Sbjct  438   PGMHLGLTMVRQIVAQLVHCFEWELPNNMLPEELDMTEAFSLVTPRANHLCATPTYRL  495



>ref|XP_006380462.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
 gb|ERP58259.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
Length=497

 Score =   317 bits (813),  Expect(2) = 9e-125, Method: Compositional matrix adjust.
 Identities = 172/347 (50%), Positives = 239/347 (69%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPH +L++L+KKYGPIMY++LG VP VVVSSP AAELILKT+D VFASRP+N
Sbjct  42    GSLHLLGKLPHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRN  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   K ++FAPYG +WR  +K  T ELL+  KI  F   R+ E+   +  I+ A
Sbjct  102   EAAKHISYEQKNLSFAPYGSYWRNVRKMCTLELLSNHKINFFMSTRKEELDLLIDYIKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +  R AVDL A+V  L  +++ +M+FG        D    K +  E++ L  +FN+ DY+
Sbjct  162   SRDRVAVDLGAKVSSLSADISCRMVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL KR++ +GK  D  F +I+ EH Q      +   KD VD+ML  + +  
Sbjct  222   PPIAPLDLQGLTKRMKVVGKVFDDFFEKIIDEHIQFKD---ENRTKDFVDVMLDFLGSEE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++   +IKA++ DM+VGS+DTS   IEWTL+E++R+PRVMK +Q+ELE K+G++RMV
Sbjct  279   TEYRIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL MVIKE+FRLHPVA LL P ES+ED  ++G  IP+K
Sbjct  339   EESDLEGLEYLHMVIKEAFRLHPVAPLLGPHESMEDCTIDGFLIPQK  385


 Score =   159 bits (403),  Expect(2) = 9e-125, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+K+RV++N WAIG D S W+D   +F PERF   ++D+RG DF LLPFG GRR C
Sbjct  379   GFLIPQKTRVIVNVWAIGRDQSAWTD-ANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V+ IV QL+HCF+WELPN M P ELDMTE FGL +P+  HL A P+YRL
Sbjct  438   PGMHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRL  495



>ref|XP_007152783.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 ref|XP_007152784.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 gb|ESW24777.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 gb|ESW24778.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
Length=511

 Score =   306 bits (783),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 237/347 (68%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPH  L  L+  YGPIM LKLG+VP +V+SSP  AEL LKTHD  FA R K+
Sbjct  47    GHLHMLGKLPHHTLQSLAAFYGPIMSLKLGQVPTIVISSPEIAELFLKTHDITFAFRSKS  106

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              +  +I+ G KG+ F+  GP+WR  +K  T +LL A+K+E F  LR  ++  +V+ ++  
Sbjct  107   ISSNSISYGGKGLIFSENGPYWRIMRKLCTVQLLIASKVEMFSPLRNEQLAEFVRFLQKI  166

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  RE +DL+   G +IENVT+KM+FG S +D  D+K +V+E++ L+G FN+ADYLP+L+
Sbjct  167   ASSREVIDLSDTAGNIIENVTFKMIFGCSKDDRFDVKNLVRELLDLVGTFNVADYLPWLR  226

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
              FDLQGL +RL+ + KS D +  +I+++HEQ +     K  KD VD++LA +  P   H 
Sbjct  227   MFDLQGLVRRLKKVSKSFDVVLEQIIRDHEQYSDKE-DKGQKDFVDILLALIHQPMDPHD  285

Query  930   -----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                  ++   IKA++  MI+  ++TS   +EW ++E++++PRVMK +Q+ELE+ VG+ R 
Sbjct  286   EHGPVVERTHIKAVVMTMIITGINTSSITVEWAMSELLKHPRVMKKVQDELESVVGMKRK  345

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE D+  L YL++V+KE+ RL+PV  LLVPRE  ED+ ++G+FI K
Sbjct  346   VEETDMEKLPYLDLVVKETLRLYPVVPLLVPRECREDVTIDGYFIKK  392


 Score =   170 bits (430),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SR+++N WA+G DP +WSDN E F+PERF + +VDI+G DF L+PFG GRR C
Sbjct  387   GYFIKKNSRLIVNAWALGRDPKVWSDNAEMFYPERFTNNNVDIKGFDFRLIPFGSGRRGC  446

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  VK+++ QL+HCFNWELP+ MSP ELDMTE FGL  P+ +HL+AVP+YRL
Sbjct  447   PGIHLGLATVKIVLAQLVHCFNWELPSGMSPDELDMTEKFGLTMPRSKHLLAVPTYRL  504



>ref|XP_003615666.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98624.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AFK39835.1| unknown [Medicago truncatula]
Length=511

 Score =   314 bits (805),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/348 (49%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  LSKKYGPIM L+LG+VP +++SS  AAE  LKTHD VFASRPK 
Sbjct  48    GNLHILGKLPHRTLQSLSKKYGPIMSLQLGQVPTIIISSSKAAESFLKTHDIVFASRPKV  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                  ++ GSKGMAF+ YGP+WR  +KF T +L +A+K+E FG +R+ ++   V S+E A
Sbjct  108   QGSDLMSYGSKGMAFSEYGPYWRSVRKFCTLKLFSASKVEMFGPIRKEKLDVLVISLEKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E V+++  V  LIE++ YKM+FG S  +  D+  +V E ++L+GAFN+ADY+P+L 
Sbjct  168   ALEGEVVNVSEVVENLIEDIVYKMMFGRSKYEQFDMNKLVLEAMALMGAFNLADYVPWLG  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
              FDLQGL +  +   K++D++   I+ EHEQ   N  +  N+D VD++L+ M        
Sbjct  228   VFDLQGLTRACKKTSKALDEVLEMIITEHEQ-TTNTDKTRNEDFVDILLSIMHQTIDVEG  286

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               +  +D  +IKA+L DMI  SV TS   IEW L+E++R+ RVMK+LQ+E++N+VG  RM
Sbjct  287   EQNLVIDRTNIKAILLDMIAASVHTSATTIEWALSELLRHSRVMKILQDEIQNEVGNKRM  346

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEEKDL    YL+MV+ E+ RL+PV  LL+PRE  E I ++G+FI KK
Sbjct  347   VEEKDLKKFNYLDMVVDETLRLYPVGPLLIPRECRESITIDGYFITKK  394


 Score =   162 bits (409),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KK+RV++N WAIG D ++WS+N +EF+PERF+ K ++ +GH+F  +PFG GRR C
Sbjct  388   GYFITKKTRVIVNAWAIGRDCNVWSENADEFYPERFIDKKMNYQGHEFESIPFGSGRRRC  447

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGLI VKL++ Q +HCFNWELP+ +SP  L+M E FGL+ P+ QHL A+PSYRL
Sbjct  448   PGIQLGLIIVKLVIAQFVHCFNWELPHNISPSNLNMEEKFGLSIPRAQHLQAIPSYRL  505



>ref|XP_007152790.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
 gb|ESW24784.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
Length=507

 Score =   332 bits (851),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 245/347 (71%), Gaps = 4/347 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHRNL  L+ KYGPIM LKLG+VPA+VVSSP  AE  LKTHD VFASRPK 
Sbjct  49    GNLHMLGKLPHRNLQSLATKYGPIMSLKLGQVPAIVVSSPETAEPFLKTHDTVFASRPKI  108

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ GSKG+AF+ Y  +WR  +K  T +LL+ +++E F  +RR E+   VKS++ +
Sbjct  109   QASEFLSHGSKGLAFSEYSAYWRNMRKVCTVQLLSVSRVEMFAPMRREELGVLVKSLKRS  168

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VDL+  V  ++E + ++M+ G   +D  DLK ++QE+++L+GAFN+ADY+P+L 
Sbjct  169   AASGEVVDLSELVAEVVEKMVFRMMLGRVKDDRLDLKKLIQEVMNLVGAFNLADYMPWLG  228

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
              FD QG+ KRL+   K  D++  +I+++HE+++ +   K N D V+++++ M   +  H 
Sbjct  229   FFDPQGITKRLKKASKLFDEVLEQIIQDHERNSYDKDNKRNMDFVEILVSLMHQSNDVHN  288

Query  930   ----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
                 +D  ++KA++ D+I  ++DTSY  IEW ++E++R+P VMK LQ ELE+ VG+NR V
Sbjct  289   NENIIDRTNVKAIILDIITAALDTSYTTIEWAMSELLRHPSVMKRLQHELEHVVGMNRHV  348

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL NL YL MV+KE+ RLHPVA LLVPRE  ED+ ++G+FI KK
Sbjct  349   EENDLENLSYLNMVVKETLRLHPVAPLLVPRECREDVIIDGYFIKKK  395


 Score =   140 bits (354),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR+++N WAIG DP +W +N   F P RF + ++DIRG DF +LPFG GRR C
Sbjct  389   GYFIKKKSRIIVNAWAIGRDPKVW-NNAAIFNPTRFENDNIDIRGKDFRILPFGSGRRGC  447

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL    LI+ QL+HCF+W LP  MS  ELDM E FGL +P+ +HL+  P YRL
Sbjct  448   PGIHLGLTTFSLILAQLVHCFDWVLPLGMSCDELDMQEIFGLTTPRKKHLLVRPVYRL  505



>ref|XP_010541895.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=512

 Score =   327 bits (838),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 261/377 (69%), Gaps = 7/377 (2%)
 Frame = +3

Query  129   FFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvp  308
              FR     ESS++ +KLPPGPR +PI+G+LH LG LPH+ L  L+KKYGPIM ++LG V 
Sbjct  23    LFRAFSPSESSRNFKKLPPGPRGMPIVGHLHMLGKLPHQTLAHLAKKYGPIMSIRLGSVR  82

Query  309   avvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRGNKKFATQEL  488
              +VVSSP AAEL LKTHD +FASRPK  A + ++ G+K MA  PYGP+WR  +K     L
Sbjct  83    TIVVSSPRAAELFLKTHDNIFASRPKAQAPEIMSYGTKAMALQPYGPYWRNVRKLCVVHL  142

Query  489   LTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN  668
             L+A+KIE F  +R  E+   +  ++ AA   E V+++  +  L+EN+ Y+++ G   ND+
Sbjct  143   LSASKIEQFKPVRTEEIGLLMNHLKMAAEKNEVVNVSKILVELLENLLYRLILGRGKNDD  202

Query  669   HDLKL--IVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQ  842
              D+KL  +V+EIVSL GAFNI+DYLP L P DLQGL +R+R L KS+D +   I++EHEQ
Sbjct  203   DDVKLKELVEEIVSLTGAFNISDYLPLLAPLDLQGLARRMRHLSKSMDIILENIIEEHEQ  262

Query  843   DAKNGVQKSNKDIVDMMLASMKNPSS-----SHKLDLASIKALLFDMIVGSVDTSYAWIE  1007
               ++   K +KD VD++L+ +  P +     S  +    +K++L DM+  +++TS   IE
Sbjct  263   QNRDHKSKDHKDFVDVLLSLLNQPMNEQDEHSEIIGRTHVKSILLDMVAAALETSATAIE  322

Query  1008  WTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVP  1187
             W  +EI++N R+MK LQ+EL+N VG++RMV E DL  L YL+MVIKE FRLHPVA LL+P
Sbjct  323   WIFSEILKNTRIMKKLQDELKNIVGMDRMVNETDLSKLTYLDMVIKEGFRLHPVAPLLIP  382

Query  1188  RESLEDIELNGHFIPKK  1238
              ES+ED+ L+G +IPKK
Sbjct  383   HESVEDVVLDGFYIPKK  399


 Score =   145 bits (366),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N W+IG D  +W DN EEF PERF +  +DI G DF L+PFG GRR C
Sbjct  393   GFYIPKKSRVLVNVWSIGRDRDVWGDNNEEFNPERFENDDIDINGLDFRLIPFGSGRRRC  452

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ +GL+N++L++ QL+HCF+W LP  M   ELDM E FGL   +  ++ A P YRL
Sbjct  453   PGMQMGLLNLRLVIAQLVHCFDWVLPVGMVREELDMNEKFGLTVGRANNVFATPIYRL  510



>ref|XP_004236729.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=501

 Score =   306 bits (784),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 223/344 (65%), Gaps = 4/344 (1%)
 Frame = +3

Query  219   HQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAV  398
             H LG  PH++LN L+KKYGPIMYLKLG V  ++ SSP  AE  LKT+D  FASRP ++A 
Sbjct  45    HLLGKNPHQDLNNLAKKYGPIMYLKLGFVDNIIASSPHVAEQFLKTYDQNFASRPPHEAA  104

Query  399   KNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGG  578
             K I+   K + F  YGP+WR  +K  T ELL+  KI SF  +RR E+   +++++  +  
Sbjct  105   KYISYDQKNLTFGTYGPYWRNMRKLCTLELLSTLKINSFQSMRREELNLLIETLKKKSHE  164

Query  579   REAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYLPFL  746
             +  VDL+  V RL  +++ +M+FG    D        K +V E + L  A N+ D+ PFL
Sbjct  165   KIVVDLSEIVTRLSVDISCRMIFGKKYKDEEFGCKGFKSVVNEGLQLAAAPNLGDFFPFL  224

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
                DLQGL +R++A+ K  D    +I+ EHE+  K G  ++NKD VD ML  MK+  +  
Sbjct  225   GKLDLQGLTRRMKAVSKVFDNFLEKIIDEHEESDKKGQHQNNKDFVDTMLNIMKSGETEF  284

Query  927   KLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEK  1106
             + D   +KA+L DM++ S+DTS   I+W L+E++R P +MK LQ+E E K+G+ RMVEE 
Sbjct  285   QFDRGHVKAILLDMLIASMDTSATTIDWILSELLRQPNIMKKLQKEFEEKIGMKRMVEEL  344

Query  1107  DLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             DL  LEYL MVIKES RLHPVA LL+P +S+ED  ++G+FIPKK
Sbjct  345   DLEKLEYLNMVIKESLRLHPVAPLLLPHQSIEDCTIDGYFIPKK  388


 Score =   166 bits (419),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N +AIG DP +W +N +EF PERF+  S+D+RGHDF LLPFG GRR C
Sbjct  382   GYFIPKKSRILVNTYAIGRDPKVWPNNPDEFIPERFVGSSIDLRGHDFELLPFGSGRRRC  441

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGLI ++LIV QL+HCF+WELPN M P++LDM E FGL   + +H++A+P+YRL
Sbjct  442   PGLQLGLIIIRLIVAQLVHCFDWELPNGMLPNDLDMGEEFGLVVSRAKHVMAIPNYRL  499



>ref|XP_007152787.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
 gb|ESW24781.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
Length=499

 Score =   326 bits (836),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 240/347 (69%), Gaps = 4/347 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  L+ KYGPIM L LG+VPA+VVSSP  AEL LKTHD VFASRPK 
Sbjct  41    GNLHMLGKLPHRTLQSLATKYGPIMSLNLGQVPAIVVSSPETAELFLKTHDTVFASRPKI  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ GSKG+ F+ Y  +WR  +K  T +LL+A+K+E FG LRR E+   V+S++ +
Sbjct  101   QVSETLSHGSKGLVFSEYSAYWRNVRKVCTVQLLSASKVEMFGPLRREELGVLVESLKNS  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VDL+  V  ++E + ++M+ G   +D  +LK ++QE ++L+GAFN+ADY+P+L 
Sbjct  161   AASGEVVDLSELVAEVVEKMVFRMVLGRVKDDKLELKRLIQEALNLVGAFNLADYMPWLG  220

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
              FD QG+ KRL+   KS+D+   +I+++HE ++    +K N D V+++L+ M  P   H 
Sbjct  221   LFDFQGITKRLKKTSKSIDERLEQIIQDHENNSYEKEKKYNIDFVEILLSLMHQPDDVHN  280

Query  930   ----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
                 +D  +IKA++ DMI G+++TS   +EW ++E++R+P VMK LQ ELE+ VG+N+ V
Sbjct  281   HQNVIDRTNIKAIILDMIAGALETSSTTLEWAMSELLRHPSVMKRLQHELEHVVGMNKHV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  L YL MV+KE+ RLHPV  LLVPRE  ED+ ++G+ I KK
Sbjct  341   EENDLQKLSYLNMVVKETLRLHPVGPLLVPRECREDVIIDGYLIKKK  387


 Score =   145 bits (367),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR+++N WAIG DP++W DN E F P RF + +VDIRG DF +LPFG GRR C
Sbjct  381   GYLIKKKSRIIVNAWAIGRDPNVW-DNAEIFDPTRFENDNVDIRGKDFRILPFGSGRRGC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V L++ QL+HCF+W LP  MS  ELDM E FGL+ P+  HL+  P YRL
Sbjct  440   PGIHLGLTTVSLVLAQLVHCFDWMLPLGMSCDELDMQEIFGLSIPRKNHLLTRPVYRL  497



>ref|XP_011013422.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=493

 Score =   313 bits (803),  Expect(2) = 5e-123, Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 234/347 (67%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PHR L++L++KYGPIM+L+LG VP +VVSSP AAEL LKTHD VFA RP +
Sbjct  38    GSLHMLGKFPHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A +  + G KGM FA YGP+WR  +K  T ELL++ KI SF   R  E+   +K I+ A
Sbjct  98    EAARYFSYGQKGMTFAQYGPYWRNMRKMCTIELLSSLKITSFKSTRMEELDLLIKYIQEA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVDL+A+V  L  +++ +M+FG      + D    K ++QE++ L  A ++ DY+
Sbjct  158   ARERVAVDLSAKVSSLNADMSCRMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYI  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR++A+ K +D    +I+ EH Q  + G    NKD VD+ML+ MK+  
Sbjct  218   PQIAALDLQGLTKRMKAISKVLDVYLNKIIDEHAQYQEKG---KNKDFVDVMLSFMKSEE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + H +D   +KA++ DM+ GS+DTS   I+W  +E+++NPRVMK LQ+ELE  VG  RMV
Sbjct  275   NEHLVDQGCMKAIMLDMLAGSMDTSATVIDWAFSELIKNPRVMKKLQKELEEAVGKQRMV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV+KE+ RLHP   L++P E++ED  +NG  IPKK
Sbjct  335   EESDLERLEYLDMVVKETLRLHPAGPLMIPHEAMEDCIVNGFHIPKK  381


 Score =   157 bits (397),  Expect(2) = 5e-123, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS V+IN WAIG DP  W+D  E+F+PERF+   +D+RG +F L+PFG GRR C
Sbjct  375   GFHIPKKSHVIINVWAIGRDPKAWTD-AEKFYPERFVGSDIDVRGRNFQLIPFGTGRRSC  433

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN + P E+DMTE FGL   + +HLVA+P+YRL
Sbjct  434   PGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVMCRSKHLVAIPTYRL  491



>ref|XP_007212357.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
 gb|EMJ13556.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
Length=497

 Score =   306 bits (785),  Expect(2) = 6e-123, Method: Compositional matrix adjust.
 Identities = 177/395 (45%), Positives = 254/395 (64%), Gaps = 21/395 (5%)
 Frame = +3

Query  72    IMSSVGL-ALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRN  248
             I +S+GL AL+ I  A  WW  + +R     +               G+LH LG  P+++
Sbjct  4     IWASIGLLALVHILQA--WWKNKKKRLPPGPRGFPIF----------GSLHLLGEFPNKD  51

Query  249   LNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGM  428
             L+ L++KYG IMY++LG +P +V+SSP AAEL LKTHD VFASRP ++  K+I+ G K +
Sbjct  52    LHRLARKYGDIMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFGQKNL  111

Query  429   AFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGRE-AVDLTAE  605
              F+ YG +WR  +K  T ELL+  KI SF  +RR E+   V+SI AAA  R  AVDL+ +
Sbjct  112   IFSEYGVYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANKRGVAVDLSDK  171

Query  606   VGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLN  773
             V  L  +++ +M+ G    D        K +V+E + L  A N+ DY+PF+ P DLQG  
Sbjct  172   VSSLSVDMSCRMVLGKKYRDEEFDERGFKSVVREGIQLASAPNLGDYIPFIAPLDLQGFT  231

Query  774   KRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDLASIKA  953
             KR++++ K+ D LF +I++EH Q       +  KD VD+M+  M +  S ++++   IKA
Sbjct  232   KRMKSVNKAFDNLFEKIIEEHLQPNDG---ERTKDFVDVMVGFMGSEESEYRIERPHIKA  288

Query  954   LLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLE  1133
             ++ DM+V S+DTS   IEW L+E+MR+P+ MK +Q+ELEN VGL++MVEE DL  L+YL 
Sbjct  289   IMLDMLVASMDTSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLN  348

Query  1134  MVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MV+KE+FRLHPVA LLVP  S+ED  +NG+ IPKK
Sbjct  349   MVVKETFRLHPVAPLLVPHASIEDCTVNGYHIPKK  383


 Score =   164 bits (414),  Expect(2) = 6e-123, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PKKSRV+IN WAIG DP+ W+D  E+F PERF   SVD+RG+ F L+PFG GRR 
Sbjct  376   NGYHIPKKSRVLINVWAIGRDPNAWTD-AEKFIPERFEGSSVDVRGNHFQLIPFGSGRRR  434

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+L++ QL+HCF+WELPN M P  LDMTE FGL  P+ +HL+A+PSYRL
Sbjct  435   CPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPDGLDMTEEFGLTVPRAKHLLAIPSYRL  493



>ref|XP_008227118.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   308 bits (788),  Expect(2) = 7e-123, Method: Compositional matrix adjust.
 Identities = 166/348 (48%), Positives = 236/348 (68%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L+ L++KYG IMY++LG +  +V+SSP AAEL LKTHD VFASRP +
Sbjct  39    GSLHLLGEFPHKDLHRLARKYGHIMYMRLGLMHTIVISSPEAAELFLKTHDLVFASRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             ++ K+I+ G K + F+ YG +WR  +K  T ELL+  KI SF  +RR E+   V+SI AA
Sbjct  99    ESSKHISFGQKNLIFSEYGVYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAA  158

Query  570   AGGRE-AVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADY  734
             A  R  AVDL+ +V  L  +++ +M+ G    D        K +V+E + L  A N+ DY
Sbjct  159   ANNRGVAVDLSDKVSSLSVDMSCRMVLGKKYKDEEFDERGFKSVVREGIQLASAPNLGDY  218

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +PF+ P DLQG  KR++++ K+ D LF +I++EH    K    +  KD VD+M+  M + 
Sbjct  219   IPFIAPLDLQGFTKRMKSVNKAFDNLFEKIIEEH---LKPNDGERTKDFVDVMVGFMGSE  275

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++   IKA++ DM+V S+DTS   IEW L+E+MR+P+ MK +Q+ELEN VGL++M
Sbjct  276   ESEYRIERPHIKAIMLDMLVASMDTSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKM  335

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L+YL MV+KE+FRLHPVA LLVP  S ED  +NG+ IPKK
Sbjct  336   VEESDLGKLDYLNMVVKETFRLHPVAPLLVPHASTEDCTVNGYHIPKK  383


 Score =   162 bits (411),  Expect(2) = 7e-123, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV+IN WA G DP+ W+D  E+F PERF   SVD+ G+ F L+PFG GRR C
Sbjct  377   GYHIPKKSRVLINVWATGRDPNAWTD-AEKFIPERFEGSSVDVTGNHFQLIPFGSGRRRC  435

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN M P ELDMTE FGL  P+ +HL+A+PSYRL
Sbjct  436   PGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRL  493



>gb|KCW83844.1| hypothetical protein EUGRSUZ_B00712 [Eucalyptus grandis]
Length=436

 Score =   298 bits (764),  Expect(2) = 9e-123, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 219/323 (68%), Gaps = 4/323 (1%)
 Frame = +3

Query  282   MYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRG  461
             M L+LG VPAVVVSSP AA L L THDA+FASRP+    +     +KG+ F  YGP+WR 
Sbjct  1     MSLRLGLVPAVVVSSPEAAGLFLGTHDAIFASRPRIPEAELEFYTTKGLVFTEYGPYWRS  60

Query  462   NKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKM  641
              +K  T  LL+AA++ SF  +RR E+ + V S+  +A   EAVDL+A+V R +E++  +M
Sbjct  61    VRKLCTTHLLSAARVRSFEGMRREEVGSLVASLRESAAAHEAVDLSAQVERAMEDMACRM  120

Query  642   LFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLE  821
             + G S +  HDLK I+QE   + G FN+ADY+PFL+P DLQG +++ +A+ +SVDKL  +
Sbjct  121   ILGRSTDGEHDLKGIIQENARVAGVFNLADYVPFLRPLDLQGSSRQFKAVRRSVDKLLEK  180

Query  822   IVKEHEQDAKNGVQKSNKDIVDMMLASMKNP----SSSHKLDLASIKALLFDMIVGSVDT  989
             I+ +H QD  +   +  +D +D++L+ M  P       + +D  +IKA++ DMI GS +T
Sbjct  181   IIDDHVQDTAHYDSEHQQDFIDILLSMMNQPIGPREEKYIIDRTNIKAIILDMISGSFET  240

Query  990   SYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPV  1169
             +   I+W  +E+MRNP+ M  LQEELE  VGL RMVEE DLP L YL+MV+KES RLHPV
Sbjct  241   ASTSIDWAFSELMRNPQTMAHLQEELETIVGLTRMVEESDLPKLNYLDMVVKESMRLHPV  300

Query  1170  ATLLVPRESLEDIELNGHFIPKK  1238
               LLVPRES+ED  +N  FIPKK
Sbjct  301   VPLLVPRESMEDAVINECFIPKK  323


 Score =   171 bits (434),  Expect(2) = 9e-123, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSR+++N WAIG DPS+WS+N E+F PERF+   +D++GH F LLPFG GRR CPG+ 
Sbjct  321   PKKSRIIVNIWAIGRDPSVWSENTEKFVPERFVDNGIDVKGHHFELLPFGSGRRGCPGIQ  380

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             LGL+ VKL++ QL+HCF WE+P  M P ++DM+E FGL+ P+  HL+AVP+YRLL
Sbjct  381   LGLLQVKLVLAQLVHCFKWEIPEDMVPSDIDMSERFGLSVPRANHLLAVPTYRLL  435



>ref|XP_004304846.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=499

 Score =   307 bits (787),  Expect(2) = 9e-123, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 236/347 (68%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL  LG  PH +L+ LS+K+G IMYL+LG VP +VVSSP AAEL LKTHD  FA+RP +
Sbjct  42    GNLLMLGEFPHVDLHRLSQKHGDIMYLRLGLVPTIVVSSPQAAELFLKTHDHSFATRPPH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+ G + +++A YGP+WR  +K  T ELL+  KI S   +R+ E+  ++  I+ A
Sbjct  102   EAAKHISYGQRNLSYAEYGPYWRTIRKMCTLELLSNHKINSLKPMRKEELDLFMNFIQEA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
                R AVDL+A+V  L  ++T +++FG    D        +  + E + L G  N  DYL
Sbjct  162   CRDRAAVDLSAKVSSLNTDMTCRLVFGKKYMDKEFDEKGFQAWIVEGMHLAGTPNFGDYL  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL PFDLQGL KR++A+ K  D  F +I+ EH +   +  Q+  KD VD+ML  M +  
Sbjct  222   PFLAPFDLQGLTKRMKAVRKVFDDFFEKIIDEHIKSQDD--QERTKDFVDVMLCFMGSKE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S +K++ ++IKA++ DM+ G++DTS   IEWTL+E+MR+PRVMK +Q+ELE+ VG++RMV
Sbjct  280   SEYKIERSNIKAIILDMVAGAMDTSATAIEWTLSELMRHPRVMKKVQKELEDVVGMDRMV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +E DL  LEYL MV+KE+ RLHPVA LL+P  ++ED  +NG  IPKK
Sbjct  340   DESDLEKLEYLNMVVKENLRLHPVAPLLIPHAAIEDCTVNGFHIPKK  386


 Score =   162 bits (411),  Expect(2) = 9e-123, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRVM+N WA+G DPS W+D  ++F PERF+  ++D+RG DF LLPFG GRR C
Sbjct  380   GFHIPKKSRVMVNVWAVGRDPSAWTDP-DKFIPERFVGSNIDLRGRDFQLLPFGSGRRGC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V L+V QL+HCF+WELP+ + P ELDMTE FGL  P+ +HL+A+PSYRL
Sbjct  439   PGMHLGLTVVHLVVAQLVHCFDWELPDNILPTELDMTEEFGLTVPRAKHLLAIPSYRL  496



>ref|XP_002310007.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90457.2| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   314 bits (804),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 238/347 (69%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L++L+ KYGPIMY++LG VP VVVSSP AAELILKTHD VFA+RP N
Sbjct  42    GSLHLLGKFPHQDLHQLANKYGPIMYMRLGLVPTVVVSSPRAAELILKTHDLVFANRPPN  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   K ++FAPYG +WR  +K  T ELL+  KI SF   R+ E+   +  I+ A
Sbjct  102   EAAKHISYEQKSLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSSRKEELDLLIDYIKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +  R AVDL+A+V  L  +++ +M+FG        D+   K ++ E + L  +FN  DY+
Sbjct  162   SRERVAVDLSAKVSSLSADISCRMVFGKKYMEKEFDDKGFKPVIHEGMRLAASFNFGDYI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL KR++A+GK  D    +I+ EH Q      +   KD VD+ML  + +  
Sbjct  222   PPIAPLDLQGLTKRMKAVGKVFDDFLEKIIDEHIQFKD---ENRTKDFVDVMLDFLGSEE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + + +   +IKA++ DM+VGS+DTS   IEWTL+E++++PRVMK +Q+ELE K+G++R V
Sbjct  279   TEYSIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIKHPRVMKKVQKELEEKIGMDRTV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL MVIKE+FRLHPVA LL+P ES+ED  ++G  IP+K
Sbjct  339   EESDLEGLEYLHMVIKEAFRLHPVAPLLIPHESMEDCTIDGFLIPQK  385


 Score =   156 bits (394),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+K+RV++N WAIG D S W+D   +F PERF   ++D+RG DF LLPFG GRR C
Sbjct  379   GFLIPQKTRVIVNVWAIGRDQSAWTD-ANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYR  1569
             PG++LGL  V  IV QL+HCF+WELPN M P ELDMTE FGL +P+  HL A P+YR
Sbjct  438   PGMHLGLTMVLQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYR  494



>ref|XP_011025622.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Populus euphratica]
Length=493

 Score =   312 bits (800),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 234/347 (67%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PHR L++L++KYGPIM+L+LG VP +VVSSP AAEL LKTHD VFA RP +
Sbjct  38    GSLHMLGKFPHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + I+ G KGM FA YGP+WR  +K  T ELL++ KI SF   R  E+   +K  + A
Sbjct  98    EAARYISYGQKGMTFAQYGPYWRNMRKMCTIELLSSLKITSFKSTRMEELDLLIKYTQEA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +  R AVDL+A+V  L  +++ +M+FG      + D    K ++QE++ L  A ++ DY+
Sbjct  158   SRERVAVDLSAKVSSLNADMSCRMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYI  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR++A+ K +D    +I+ EH Q  + G    NKD VD+ML+ MK+  
Sbjct  218   PQIAALDLQGLTKRMKAISKVLDVYLNKIIDEHAQYQEKG---KNKDFVDVMLSFMKSEE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + H +D   +KA++ DM+ GS+DTS   I+W  +E+++NPRVMK LQ+ELE  VG  RMV
Sbjct  275   NEHLVDQGCMKAIMLDMLAGSMDTSATVIDWAFSELIKNPRVMKKLQKELEEVVGKQRMV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV+KE+ RLHP   L++P E++ED  +NG  IPKK
Sbjct  335   EESDLERLEYLDMVVKETLRLHPAGPLMIPHEAMEDCIVNGFHIPKK  381


 Score =   157 bits (397),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS V+IN WAIG DP  W+D  E+F+PERF+   +D+RG +F L+PFG GRR C
Sbjct  375   GFHIPKKSHVIINVWAIGRDPKAWTD-AEKFYPERFVGSDIDVRGRNFQLIPFGTGRRSC  433

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN + P E+DMTE FGL   + +HLVA+P+YRL
Sbjct  434   PGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVMCRSKHLVAIPTYRL  491



>ref|XP_010030392.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54382.1| hypothetical protein EUGRSUZ_I00333 [Eucalyptus grandis]
Length=499

 Score =   306 bits (783),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 228/347 (66%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL  LG  PH +L++L+KKYGP+MYL+LG VP ++VSSP  AE  LKTHD +FASRP +
Sbjct  41    GNLPLLGKNPHHDLHKLAKKYGPLMYLRLGFVPTILVSSPEVAEQFLKTHDLIFASRPPH  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   + +AFAPYGP+WR  +K  T ELL+ AKI SF  +RR E+   V  ++ A
Sbjct  101   EAAKHISYEQRSLAFAPYGPYWRNIRKMCTLELLSNAKIYSFRSMRRDEVSLLVNFLKDA  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +    A+DL+A++  L  +++  M+FG        D    K +VQE++ L    NI DY+
Sbjct  161   SHDHMAIDLSAKISSLSADMSCLMVFGKKYMDREFDERGFKAVVQEVMVLTATPNIGDYV  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL  FDLQGL KR++A+ +  D  F +I+ EH +  K   Q   KD VD+ML  M    
Sbjct  221   PFLASFDLQGLTKRMKAVSRVFDAFFEKIIDEHLETKKEEGQ--TKDFVDVMLGIMGLNE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
               + +D   IKA++ DM+ GS+DTS   IEW +AE++++PR MK L+EELE   GLNR+V
Sbjct  279   GEYHIDRPHIKAIILDMLAGSMDTSATAIEWAMAELIKHPRAMKKLREELEKAAGLNRVV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  L+YL MVIKE+ RLHPVA LL+P E+ ED  +NG  IP K
Sbjct  339   EESDLEGLDYLHMVIKETMRLHPVAPLLLPHEATEDCTVNGFHIPYK  385


 Score =   163 bits (413),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSD-NVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
             G   P KSRV++N W+IG DP +W+  + EEF PERF+  SVD++G DF LLPFG GRR 
Sbjct  379   GFHIPYKSRVIVNVWSIGRDPKVWTTHDPEEFVPERFLGSSVDVKGRDFQLLPFGTGRRG  438

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+ +V QL+HCF+WELP+ MSP ELDMTE FGLA+P+ +HLV  P YRL
Sbjct  439   CPGMQLGLTVVRFVVAQLVHCFDWELPSGMSPSELDMTEKFGLATPRAKHLVVTPRYRL  497



>dbj|BAP15886.1| cytochrome P450 71AU50 [Prunus mume]
Length=497

 Score =   301 bits (772),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 237/348 (68%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P+++L+ L++KYG IMY++LG +P +V+SSP AAEL LKTHD VFASRP +
Sbjct  39    GSLHLLGEFPNKDLHRLARKYGDIMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K+I+ G K + F+ YG +WR  +K  T ELL+  KI SF  +RR E+   V+SI AA
Sbjct  99    EGSKHISFGQKNLIFSEYGAYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAA  158

Query  570   AGGRE-AVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADY  734
             A  R  AVDL+ +V  L  +++ +M+ G    D        K +V+E + L  A N+ DY
Sbjct  159   ANNRGVAVDLSDKVSSLSVDMSCRMVLGKKYRDEEFDERGFKSVVREAIQLASAPNLGDY  218

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             + F+ P DLQG  KR++++ K+ D LF +I++EH Q   +G  +   D VD+M+  M + 
Sbjct  219   IRFIAPLDLQGFTKRMKSVNKAFDNLFEKIIEEHLQ-PNDG--ERTMDFVDVMVGFMGSE  275

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++   IKA++ DM+V S+DTS   IEW L+E+MR+P+ MK +Q+ELEN VGL++M
Sbjct  276   ESEYRIERPHIKAIMLDMLVASMDTSATTIEWALSELMRHPKAMKKVQKELENVVGLDKM  335

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L+YL MV+KE+FRLHPVA LL+P  S+ED  +NG+ IPKK
Sbjct  336   VEESDLEKLDYLNMVVKETFRLHPVAPLLIPHASIEDCTVNGYHIPKK  383


 Score =   167 bits (423),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PKKSRV+IN WAIG DP+ W+D  E+F PERF   SVD+RG+ F L+PFG GRR 
Sbjct  376   NGYHIPKKSRVLINVWAIGRDPNAWTD-AEKFIPERFEGSSVDVRGNHFQLIPFGSGRRR  434

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+L++ QL+HCF+WELPN M P ELDMTE FGL  P+ +HL+A+PSYRL
Sbjct  435   CPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRL  493



>ref|XP_010111002.1| Cytochrome P450 71D10 [Morus notabilis]
 gb|EXC29388.1| Cytochrome P450 71D10 [Morus notabilis]
Length=473

 Score =   309 bits (791),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 251/393 (64%), Gaps = 48/393 (12%)
 Frame = +3

Query  81    SVGLALLSIFLATLWWFFRHRRA---EESSksgrklppgprplpiiGNLHQLGTLPHRNL  251
             ++ LA+L + LATL  F    RA     S+    KLPPGP PLPIIGNLHQL TLPHR L
Sbjct  4     TIPLAILLVILATLILFIIFPRAATKSHSNHGRGKLPPGPTPLPIIGNLHQLTTLPHRGL  63

Query  252   NELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMA  431
               LSKKYGPIM L+LG+V AVVVSSP AAEL LKTHD  FASRPK  A + ++ G+KGMA
Sbjct  64    QSLSKKYGPIMSLRLGQVQAVVVSSPEAAELFLKTHDTAFASRPKVQASEYMSYGTKGMA  123

Query  432   FAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVG  611
             F  YGP+WR  +K  T +LL+A+KIESF   R  E+ A V+S+  AA  RE VD++ +  
Sbjct  124   FTEYGPYWRNVRKLCTLQLLSASKIESFTASRGEEVAALVESLRGAAAARELVDVSRK--  181

Query  612   RLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRAL  791
                                                  IADY+P+L P DLQG  +R++ +
Sbjct  182   -------------------------------------IADYVPYLAPLDLQGYTRRMKKV  204

Query  792   GKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMK---NPSSSHK--LDLASIKAL  956
              K +DK+  +I+  HEQ A       +KD VD++L+ +    NP   H   +D  +IKA+
Sbjct  205   SKGIDKVLEKIIMAHEQGASEE-GHHHKDFVDVLLSLVNQPMNPQDQHVYIIDRTNIKAI  263

Query  957   LFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEM  1136
             L DM+V + DTS   IEWTL+E+++NPRV + LQEE+E   G+++MVEE+DL  L+YL+M
Sbjct  264   LLDMVVAAFDTSATSIEWTLSEVLKNPRVTQNLQEEVERVTGMDKMVEERDLEKLDYLDM  323

Query  1137  VIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             V+KESFRLHPVA LLVPRES+EDI + G+FIPK
Sbjct  324   VVKESFRLHPVAPLLVPRESMEDITVEGYFIPK  356


 Score =   160 bits (404),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+++N W IG DP++WS+NVEEFFPERF++  +D+RG+DF LLPFG GRR C
Sbjct  351   GYFIPKNSRIIVNTWTIGRDPNVWSENVEEFFPERFINSKIDLRGYDFRLLPFGSGRRGC  410

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG +LG++ ++L++ QL+HCF+W+LP+ +   ++DM+E FGL+  +  HL+A P+YRL
Sbjct  411   PGAHLGIVTIQLVLAQLVHCFSWDLPSGVETKDIDMSEKFGLSMGRENHLLAKPTYRL  468



>ref|XP_008227094.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   301 bits (771),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 235/348 (68%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P+++L+ L++KYG IMY++LG +P +V+SSP AAEL LKTHD VFASRP +
Sbjct  39    GSLHLLGEFPNKDLHRLARKYGDIMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K+I+ G K + F+ YG +WR  +K  T ELL+  KI SF  +RR E+   V+SI AA
Sbjct  99    EGSKHISFGQKNLIFSEYGAYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAA  158

Query  570   AGGRE-AVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADY  734
             A  R  AVDL+ +V  L  +++ +M+ G    D        K +V+E++ L  A N+ DY
Sbjct  159   ANNRGVAVDLSDKVSSLSVDMSCRMVLGKKYRDEEFDERGFKSVVRELIQLASAPNLGDY  218

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             + F+ P DLQG  KR++++ K+ D LF +I++EH Q       +   D VD+M+  M + 
Sbjct  219   IRFIAPLDLQGFTKRMKSVNKAFDNLFEKIIEEHLQPNDG---ERTMDFVDVMVGFMGSE  275

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++    KA++ DM+V S+DTS   IEW L+E+MR+P+ MK +Q+ELEN VGL++M
Sbjct  276   ESEYRIERPHTKAIMLDMLVASMDTSATTIEWALSELMRHPKAMKKVQKELENVVGLDKM  335

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L+YL MV+KE+FRLHPVA LLVP  S+ED  +NG+ IPKK
Sbjct  336   VEESDLEKLDYLNMVVKETFRLHPVAPLLVPHASIEDCTVNGYHIPKK  383


 Score =   167 bits (423),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PKKSRV+IN WAIG DP+ W+D  E+F PERF   SVD+RG+ F L+PFG GRR 
Sbjct  376   NGYHIPKKSRVLINVWAIGRDPNAWTD-AEKFIPERFEGSSVDVRGNHFQLIPFGSGRRR  434

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+L++ QL+HCF+WELPN M P ELDMTE FGL  P+ +HL+A+PSYRL
Sbjct  435   CPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRL  493



>ref|XP_008234579.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=498

 Score =   303 bits (777),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 229/347 (66%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG  PHR+L+ L++K+G IMYL+LG  P VV SSP AAEL LKTHD VFASRP  
Sbjct  42    GNLHMLGEFPHRDLHRLAQKHGDIMYLRLGLAPVVVASSPQAAELFLKTHDLVFASRPPL  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A ++I+ G + ++F  YG +WR  +K  T ELL++ KI SF  +R+ E+    K I+ A
Sbjct  102   QAAEHISYGQRNLSFGAYGSYWRTMRKMCTLELLSSHKINSFKPMRKEELSILTKFIQEA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R  VDL+ +V  L  +++  M+FG        D    K ++QE + L    N  D++
Sbjct  162   ACDRVTVDLSGKVASLTADMSCLMVFGKKYMDKEFDERGFKAVIQEGMHLAATPNFGDFI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+ P DLQGL KR++ + K  D  F +I+ EH Q      Q+  KD VD+ML  M +  
Sbjct  222   PFIAPLDLQGLTKRMKGVSKVFDAFFEKIIDEHIQSKD---QERTKDFVDVMLGFMGSEE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++ ++IKA++ DM+ G++DT+   IEWTL+E++++PRVMK +Q+ELEN VG+ R V
Sbjct  279   SEYRIERSNIKAIILDMLAGAMDTTATAIEWTLSELIKHPRVMKKVQKELENVVGMEREV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV+KE+ RLHPVA LL+P  ++ED  ++G  IP+K
Sbjct  339   EESDLEKLEYLDMVVKETMRLHPVAPLLLPHAAIEDCNVSGFHIPRK  385


 Score =   165 bits (417),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
             +G   P+KSRVMIN +AIG DPSIW+D  E+F PERF   ++D RG DF  +PFG GRR 
Sbjct  378   SGFHIPRKSRVMINIFAIGRDPSIWTD-AEKFIPERFDGSNIDFRGRDFQFIPFGSGRRG  436

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LG+  V+L+V QL+HCF+WELPN M P ELDMTE FGL  P+ +HL+AVP+YRL
Sbjct  437   CPGMQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAKHLLAVPTYRL  495



>ref|XP_007048087.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92244.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   306 bits (783),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 236/359 (66%), Gaps = 20/359 (6%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL  +G  PHR+L +L++KYGPIM+L+ G +P +VVSSP AAE  LKT+D VFASRP +
Sbjct  42    GNLLMIGDKPHRDLQQLAQKYGPIMHLRFGSMPVIVVSSPEAAEQFLKTYDLVFASRPPH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K I    + ++F+PYG +WR  +K  T ELL+  KI SF  +R+ E+  ++  I+ A
Sbjct  102   EGSKYICYNQQNISFSPYGSYWRNMRKMCTLELLSNLKINSFRSMRKEELHLFIDCIQEA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS-NNDNHD---LKLIVQEIVSLIGAFNIADYL  737
             A  R AVDLTA V  L  N++ +M+ G   NND+ D    + I++E + +  AFNIADY+
Sbjct  162   ASARVAVDLTATVSSLSTNISCRMVLGKKYNNDDFDEKGFEAIIREGMQIGAAFNIADYI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P  K  DLQGL KR++A+ K  D  F +++ EH Q      +   KD VD+ML  M +  
Sbjct  222   PLFKALDLQGLKKRMKAVAKVFDDFFEKVIDEHVQSKD---ENRTKDFVDVMLGFMGSEE  278

Query  918   SSHKLDLASIKA-------------LLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQ  1058
             S ++++  +IKA             LL DM+V ++DTS   IEWTL+E++++PRV+K +Q
Sbjct  279   SEYRVERDTIKAIILALSNYICFSRLLQDMLVAAMDTSATAIEWTLSELIKHPRVIKKVQ  338

Query  1059  EELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             +ELEN VG+ R+VEE DL  LEYL+MV+KESFR+HPVA LLVP  S+ED  +NG  IPK
Sbjct  339   KELENVVGMERLVEESDLEKLEYLDMVVKESFRIHPVAPLLVPHASVEDCTVNGFHIPK  397


 Score =   162 bits (410),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SRV IN WAIG DP+IW+D  E+F PERF+   +D+RG DF L+PFG GRR C
Sbjct  392   GFHIPKNSRVFINAWAIGRDPNIWTD-AEKFIPERFVGSDIDLRGRDFQLIPFGSGRRGC  450

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGLI V+L+V QL+HCF+WELP+ M   ELDMTE FGL SP+ +HL+A+P++RL
Sbjct  451   PGMPLGLIMVRLVVAQLVHCFDWELPDGMLATELDMTEEFGLVSPRAKHLLAMPTWRL  508



>ref|XP_003615667.1| Cytochrome P450 [Medicago truncatula]
Length=959

 Score =   305 bits (782),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 234/348 (67%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  LSK+YGPIM L+LG+VP +V+SS   AE  LKTHD VFASRPK 
Sbjct  498   GNLHMLGKLPHRTLQSLSKRYGPIMSLQLGQVPTIVISSSKGAESFLKTHDIVFASRPKI  557

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ GSKG+ F+ YGP+WR  +KF T +LL+A+K+E  G +R+ E+   V +++ A
Sbjct  558   QGSELMSYGSKGLPFSEYGPYWRSMRKFCTLKLLSASKVEKSGPIRKEELGVLVNTLKKA  617

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E V+++  V  LIE++ YKM+ G    +  DLK ++++ ++L+GAFN+ADY+P+L 
Sbjct  618   SLVGEVVNVSEIVENLIEDIVYKMILGRGKYEQFDLKKMIKDGLTLMGAFNLADYVPWLG  677

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
              FDLQGL +  +   K++D++   I+ EHEQ          KD VD +L+ M        
Sbjct  678   IFDLQGLTQACKKTSKALDEVLEMIITEHEQTTNT---DDPKDFVDTVLSIMHQTIDVEG  734

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                  +D   IKA+L DMI  S+DTS   IEW L+E++R+PRVMK+LQ+E++N+VG  RM
Sbjct  735   GQDLVIDRTIIKAILLDMIGASIDTSSNVIEWALSELLRHPRVMKILQDEIQNEVGNKRM  794

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEEKDL N  YL+MV+ E+ RL+PVA LL+PRE  E+I ++ + I +K
Sbjct  795   VEEKDLKNFNYLDMVVDETLRLYPVAPLLIPRECRENITIDDYSIKEK  842


 Score =   161 bits (408),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  1225  SYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPG  1404
             S  +K+RV++N WAIG DP +WS+N EEF+PERF+ K ++  G +F  +PFG GRR CPG
Sbjct  838   SIKEKTRVIVNAWAIGRDPDVWSENAEEFYPERFIEKKMNYLGQEFESIPFGSGRRRCPG  897

Query  1405  VNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             + LG+I VKL++ Q +HCFNWELP+ +SP  L+M E FGL  P+ QHL A+PSYRL
Sbjct  898   IQLGMITVKLVIAQFVHCFNWELPHNISPSNLNMEEKFGLTIPRAQHLHAIPSYRL  953


 Score =   310 bits (794),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/348 (49%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  LSKKYGPIM L+LG+VP +V+SS  AAE  LKTHD VFA+RPK 
Sbjct  48    GNLHILGKLPHRTLQSLSKKYGPIMSLQLGQVPTIVISSSKAAESFLKTHDIVFANRPKL  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + I+ G KG+AF+ Y P+WR  KK  T +LL+A+K+E  G +R  E+   V +++ A
Sbjct  108   IGAEIISYGCKGLAFSKYDPYWRSVKKLCTLKLLSASKVEKSGPIRTEELGILVNTLKKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E V+++  V  +IE++ YKM+ G    +  DLK +VQE ++LIGAFN+ADY+P+L 
Sbjct  168   SLVGEVVNVSEIVENVIEDIVYKMILGRGKYEQFDLKKLVQEGLALIGAFNLADYVPWLG  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
              FDLQGL K  + + K++D+    I+ EHEQ A N  +  +KD VD++L+ M        
Sbjct  228   IFDLQGLTKSCKKVSKAIDEQLEVILTEHEQ-AANVNKTHHKDFVDILLSIMHQTIDVEG  286

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               +  +D  +IKA+L DMIV ++DTS   IEW L+E++R+PRVMK LQ+E++N+VG  R 
Sbjct  287   EQNLVIDRTNIKAILLDMIVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKRK  346

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +EEKD+  L YL+MV+ E+ RL+PVA LLVPRES E   ++G+FI +K
Sbjct  347   IEEKDMKKLNYLDMVVDETLRLYPVAPLLVPRESRESTIIDGYFIKEK  394


 Score =   121 bits (304),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 72/113 (64%), Gaps = 20/113 (18%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             +K+R+++N WAIG DP++WS+N                    F  +PFG  RR CPG+ L
Sbjct  393   EKTRLIVNAWAIGRDPNVWSEN--------------------FESIPFGSSRRRCPGIQL  432

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GLI +KL++ Q +HCFNWELP+ +S   L+M E FGL  P+ QHL A+PSYRL
Sbjct  433   GLITIKLVIAQFVHCFNWELPHNISSSSLNMEEKFGLTIPRTQHLHAIPSYRL  485



>ref|XP_004512940.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=504

 Score =   298 bits (763),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 238/349 (68%), Gaps = 11/349 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG+LPHR+L  LSKKYGPIM L+LG VP ++V+SP  AEL LKTH++ FASRPK 
Sbjct  46    GSLHILGSLPHRSLQTLSKKYGPIMSLRLGLVPTILVTSPELAELFLKTHESNFASRPKI  105

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K I+ G KG+ F+ YGP+WR  +K  T +LL+  K+ESF  LR+ E+   V+ ++  
Sbjct  106   EASKYISYGYKGLIFSQYGPYWRNMRKVCTLQLLSTTKVESFAPLRKNEVERMVELVKKK  165

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
                 E V+++  V  ++E + YKM+ G + +D  DLK +++EI +L G  N  DY+P+ +
Sbjct  166   ERVGEVVNISEIVEGVLEEIVYKMVLGCNKDDMFDLKGLIKEITTLGGKVNFGDYVPWFR  225

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQ--DAKNGVQKSNKDIVDMMLASMKNPS--  917
               DLQGL +  +   K++DK+  +I+ E EQ  +A+NG   S+KD + ++L+ M  P+  
Sbjct  226   ILDLQGLRRSFKRTSKAIDKMLEKIINEKEQSFNAQNG---SHKDFIVILLSMMDQPTDP  282

Query  918   ---SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
                 +H +D  +IKA++ DMI  + DTS   I W L+E++RNP+VMK +Q+EL N VG+ 
Sbjct  283   NDEQNHIIDRTNIKAIILDMISAAFDTSTTVILWVLSELLRNPKVMKKIQDELNNVVGVK  342

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             ++VEE DL  L+YL+MVIKESFRLHPV   L+ RES++DI +NG+ I K
Sbjct  343   KLVEEIDLVKLKYLDMVIKESFRLHPVIP-LIARESIKDIIINGYHIEK  390


 Score =   169 bits (428),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SR++IN WAIG DP IWSDNV+ F+PERF+  ++DI+G++F +LPFG GRR C
Sbjct  385   GYHIEKNSRILINTWAIGRDPKIWSDNVDVFYPERFIDNNIDIKGYNFEILPFGSGRRGC  444

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
              G+NLGL++VK I+ QL+HCFNWELP  MS  ELDMTE FGL   +  HL AVP YRLL
Sbjct  445   SGMNLGLVSVKFIIAQLVHCFNWELPKGMSIEELDMTEQFGLTVTRATHLFAVPKYRLL  503



>ref|XP_007208656.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
 gb|EMJ09855.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
Length=498

 Score =   304 bits (778),  Expect(2) = 9e-122, Method: Compositional matrix adjust.
 Identities = 159/347 (46%), Positives = 228/347 (66%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG  PHR+L+ L++K+G IMY++LG  P VV SSP AAEL LKTHD VFASRP  
Sbjct  42    GNLHMLGEFPHRDLHRLAQKHGDIMYMRLGLAPVVVASSPQAAELFLKTHDLVFASRPPL  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A ++I+ G + ++F  YG +WR  +K  T ELL++ K  SF  +R+ E+    K I+ A
Sbjct  102   QAAEHISYGQRNLSFGAYGSYWRTMRKMCTLELLSSHKTNSFKPMRKEELALLTKFIQEA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R  VDL+ +V  L  +++  M+FG        D    K ++QE + L    N  D++
Sbjct  162   ASDRVTVDLSGKVASLTADMSCLMVFGKKYMDKEFDERGFKAVIQEGMHLAATPNFGDFI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+ P DLQGL KR++ + K  D  F +I+ EH Q      Q+  KD VD+ML  M +  
Sbjct  222   PFIAPLDLQGLTKRMKGVSKVFDAFFEKIIDEHIQSTD---QERTKDFVDVMLGFMGSEE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++ ++IKA++ DM+ G++DT+   IEWTL+E++++PRVMK +Q+ELEN VG+ R V
Sbjct  279   SEYRIERSNIKAIILDMLAGAMDTTATAIEWTLSELIKHPRVMKKVQKELENVVGMEREV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV+KE+ RLHPVA LL+P  ++ED  +NG  IP+K
Sbjct  339   EESDLEKLEYLDMVVKETMRLHPVAPLLLPHAAIEDCNVNGFHIPRK  385


 Score =   163 bits (412),  Expect(2) = 9e-122, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSRV+IN +AIG DPSIW+D  E+F PERF   ++D RG DF  +PFG GRR C
Sbjct  379   GFHIPRKSRVIINIFAIGRDPSIWTD-AEKFIPERFDGSNIDFRGRDFQFIPFGSGRRGC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LG+  V+L+V QL+HCF+WELPN M P ELDMTE FGL  P+ +HL+AVP+YRL
Sbjct  438   PGMQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAKHLLAVPTYRL  495



>gb|AES98625.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   305 bits (781),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 234/348 (67%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  LSK+YGPIM L+LG+VP +V+SS   AE  LKTHD VFASRPK 
Sbjct  47    GNLHMLGKLPHRTLQSLSKRYGPIMSLQLGQVPTIVISSSKGAESFLKTHDIVFASRPKI  106

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ GSKG+ F+ YGP+WR  +KF T +LL+A+K+E  G +R+ E+   V +++ A
Sbjct  107   QGSELMSYGSKGLPFSEYGPYWRSMRKFCTLKLLSASKVEKSGPIRKEELGVLVNTLKKA  166

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E V+++  V  LIE++ YKM+ G    +  DLK ++++ ++L+GAFN+ADY+P+L 
Sbjct  167   SLVGEVVNVSEIVENLIEDIVYKMILGRGKYEQFDLKKMIKDGLTLMGAFNLADYVPWLG  226

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
              FDLQGL +  +   K++D++   I+ EHEQ          KD VD +L+ M        
Sbjct  227   IFDLQGLTQACKKTSKALDEVLEMIITEHEQTTNT---DDPKDFVDTVLSIMHQTIDVEG  283

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                  +D   IKA+L DMI  S+DTS   IEW L+E++R+PRVMK+LQ+E++N+VG  RM
Sbjct  284   GQDLVIDRTIIKAILLDMIGASIDTSSNVIEWALSELLRHPRVMKILQDEIQNEVGNKRM  343

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEEKDL N  YL+MV+ E+ RL+PVA LL+PRE  E+I ++ + I +K
Sbjct  344   VEEKDLKNFNYLDMVVDETLRLYPVAPLLIPRECRENITIDDYSIKEK  391


 Score =   161 bits (407),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  1225  SYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPG  1404
             S  +K+RV++N WAIG DP +WS+N EEF+PERF+ K ++  G +F  +PFG GRR CPG
Sbjct  387   SIKEKTRVIVNAWAIGRDPDVWSENAEEFYPERFIEKKMNYLGQEFESIPFGSGRRRCPG  446

Query  1405  VNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             + LG+I VKL++ Q +HCFNWELP+ +SP  L+M E FGL  P+ QHL A+PSYRL
Sbjct  447   IQLGMITVKLVIAQFVHCFNWELPHNISPSNLNMEEKFGLTIPRAQHLHAIPSYRL  502



>ref|XP_002310011.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
 gb|EEE90461.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
Length=493

 Score =   310 bits (793),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 235/347 (68%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PHR  ++L++KYGPIM+L+LG VP +VVSSP AAEL LKTHD VFA RP +
Sbjct  38    GSLHLLGKFPHRAFHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             ++ + I+ G K + F+ YG +WR  +K  T ELL++ KI SF   R  E+   +K I+ A
Sbjct  98    ESARYISYGQKSVTFSQYGSYWRNMRKMCTVELLSSLKITSFKSTRMEELDLLIKYIQEA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVDL+A+V  L  +++ +M+FG      + D    K ++QE++ L  A N+ DY+
Sbjct  158   AQERVAVDLSAKVSSLSADMSCRMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPNLGDYI  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR++A+ K +D    +I+ EH Q  + G    NKD VD+ML+ MK+  
Sbjct  218   PQIGALDLQGLTKRMKAISKVLDLFVSKIIDEHAQYQEKG---KNKDFVDVMLSCMKSEE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + + +D   +KA++ DM+ GS+DTS   I+W  +E+++NPRVMK +Q+ELE  VG  RMV
Sbjct  275   NEYLVDQGCMKAIMLDMLAGSMDTSSTVIDWAFSELIKNPRVMKKVQKELEEVVGKQRMV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL +LEYL+MV+KE+FRLHPV  LL+P E++ED  +NG  IPKK
Sbjct  335   EESDLESLEYLDMVVKETFRLHPVGPLLIPHEAMEDCIVNGFHIPKK  381


 Score =   156 bits (395),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS V+IN WAIG DP  W+D  E F+PERF+   +D+RG +F L+PFG GRR C
Sbjct  375   GFHIPKKSHVIINVWAIGRDPKAWTD-AENFYPERFVGSDIDVRGRNFQLIPFGAGRRSC  433

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN + P E+DMTE FGL   + +HLVA+P+YRL
Sbjct  434   PGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVICRSKHLVAIPTYRL  491



>ref|XP_009372714.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   305 bits (781),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 238/348 (68%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P+R+L++LS+KYG IMYL+LG VP VVVSSP AAEL LKTHD VFASRP +
Sbjct  43    GSLHLLGKFPNRDLHQLSRKYGDIMYLRLGLVPTVVVSSPRAAELFLKTHDLVFASRPPH  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI-EA  566
             +  K+I+ G + ++FA YG +WR  +K  T ELL+  KI SF  +RR E+   ++S+ E 
Sbjct  103   EGSKHISFGQRNLSFAEYGSYWRDIRKMCTLELLSNHKINSFKSMRREEVALLIQSVQED  162

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGTSNN----DNHDLKLIVQEIVSLIGAFNIADY  734
             A  GR A+DL+ +V  L  ++T +M+FG        D      +++E + L    N+ DY
Sbjct  163   ANNGRVAIDLSDKVSSLSVDMTCQMVFGKKYKYEEFDERGFTAVMKEALKLSAGPNLGDY  222

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +P + P DLQG  K+++A+ K+ D+ F +I+ EH Q      ++  KD VD+M+  M + 
Sbjct  223   IPCIAPLDLQGFTKKMKAINKAFDEFFEKIINEHLQSKD---EERTKDFVDVMVDFMGSE  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++  +IKA++ DM  GS+DT+   +EW L+E+MR+P+VMK +Q+ELEN VGLNRM
Sbjct  280   DSDYRIEHTNIKAIMLDMFAGSMDTTSTTVEWALSELMRHPQVMKTVQKELENVVGLNRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L+YL+MV+KE+ RLHPVA LLVP  ++ED  ++G+ +PKK
Sbjct  340   VEESDLEKLDYLDMVVKETLRLHPVAPLLVPHAAIEDCIVDGYHVPKK  387


 Score =   160 bits (406),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV+IN WAIG DPS W D  E+F PERF   SVD+RG+ F L+PFG GRR C
Sbjct  381   GYHVPKKSRVIINAWAIGRDPSAWED-AEKFVPERFEGNSVDVRGNHFQLIPFGSGRRRC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  VK ++ QL+HCF+WELP+ M P++LDMTE FG+   + +HL+A+PSYRL
Sbjct  440   PGIQLGLTVVKFVLAQLVHCFDWELPDNMLPNDLDMTEGFGITVSRAKHLLAIPSYRL  497



>gb|KDP35215.1| hypothetical protein JCGZ_09374 [Jatropha curcas]
Length=499

 Score =   305 bits (781),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 237/346 (68%), Gaps = 7/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG  PHR L++L++KYGPI +L+LG V  +VVSSP AAE  LKT+D VFASRP +
Sbjct  44    GNLHLLGKFPHRALHQLAQKYGPITHLRLGLVTTIVVSSPNAAESFLKTNDIVFASRPPH  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             ++ K I+   K ++FA YGP+WR  +K  T ELL+  KI SF  +R+ E+   +K I+ A
Sbjct  104   ESAKYISYQQKNLSFASYGPYWRNVRKMCTLELLSNHKINSFKFIRKEELDLLIKYIKEA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             +  REAVDL+A+V  L  +++ +M+FG    D+       K+++QE + L  A N+ DY+
Sbjct  164   SFQREAVDLSAKVASLSADMSCRMVFGKKYMDDEFDARGFKVVIQEGMKLAAAPNLGDYI  223

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR++A+ K  D  F +I+ EH Q      +   KD VD+ML  + +  
Sbjct  224   PQIAWLDLQGLTKRMKAVSKVFDGFFEKIIDEHIQFKD---ESRTKDFVDVMLEFVGSEV  280

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S + +    IKA++ DM+ GS+DTS A IEW L+E++++PR+MK +Q+ELE KVGLN+MV
Sbjct  281   SEYHIGRDHIKAIILDMLAGSMDTSAAVIEWALSELLKHPRIMKKVQKELELKVGLNKMV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NLEYLEMVIKE+FRLHPVA LL+P ++ +D  ++G+ IPK
Sbjct  341   EESDLENLEYLEMVIKETFRLHPVAPLLIPHQATQDTIVDGYLIPK  386


 Score =   160 bits (405),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK S ++IN WAIG DPS W+D  E F PERF   +VD RG DF LLPFG GRR C
Sbjct  381   GYLIPKNSHIVINTWAIGRDPSAWTDP-ERFLPERFAGNNVDFRGRDFQLLPFGSGRRGC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LG+  V+L++ QL+HCF+WELPN M P+ELDM+E F L +P+ +HL+A+P+YRLL
Sbjct  440   PGIQLGVTVVRLVLAQLVHCFDWELPNDMLPNELDMSEEFSLVTPRAKHLLALPTYRLL  498



>ref|XP_006428071.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
 ref|XP_006464323.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41311.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
Length=498

 Score =   303 bits (776),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/382 (46%), Positives = 254/382 (66%), Gaps = 7/382 (2%)
 Frame = +3

Query  102   SIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKKYGPI  281
             S+ L T+++F +    + S+K+ +KLPPGP+  PI G LH LG  PHR L++L+++YGPI
Sbjct  7     SLALVTIFFFLQAFSWKTSTKTNKKLPPGPKGFPIFGCLHLLGQFPHRALHKLAERYGPI  66

Query  282   MYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRG  461
             M+L+LG  P +VVSSP AAEL LKTHD +FASRP   A K+I+   KG+A +PYG +WR 
Sbjct  67    MHLRLGLTPTIVVSSPQAAELFLKTHDLIFASRPPLKAAKHISYEQKGLALSPYGSYWRT  126

Query  462   NKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKM  641
              +K  T ELL++ KI SF  +R+ E+   + SI+ AA  R  VDL+ +V  +  ++T +M
Sbjct  127   IRKICTLELLSSFKINSFQAMRKEELDLLIASIKEAACARCVVDLSTKVSAMSADMTCRM  186

Query  642   LFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
             +FG   +D+       K ++QE + L    N+ DY+P +   DLQGL KR++++ K  D 
Sbjct  187   VFGKKYSDDEFDERGFKTVIQEGMELAAKPNLGDYIPQIAGLDLQGLTKRMKSVAKVFDG  246

Query  810   LFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDLASIKALLFDMIVGSVDT  989
                +I+ EH Q      +   KD VD+ML+   +  + HK++   IKA++ DM+  ++DT
Sbjct  247   FLEKIIDEHVQSKD---ENRTKDFVDVMLSFEGSEETEHKIEREHIKAIILDMLSAAMDT  303

Query  990   SYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPV  1169
             S   +EW L+E++++P+VMK LQ+ELE  VGL RMVEE DL NLEYL+MV+KE+ RLHPV
Sbjct  304   SATAVEWALSELIKHPKVMKKLQKELEKIVGLCRMVEESDLENLEYLDMVVKETLRLHPV  363

Query  1170  ATLLVPRESLEDIELNGHFIPK  1235
             A LL+P ES ED  +NG +IPK
Sbjct  364   APLLIPHESTEDCTVNGFYIPK  385


 Score =   161 bits (408),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SRV++N WAIG D   WSD  E FFPERF+  S+D+RGHDF LLPFG GRR C
Sbjct  380   GFYIPKNSRVIVNVWAIGRDTESWSDP-EIFFPERFVGSSIDLRGHDFQLLPFGSGRRGC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  VK ++ QL+HCF+WELP  M P ELD+TE F L +PK +HL+A+PSYRL
Sbjct  439   PGMQLGLTIVKQVIAQLVHCFDWELPGGMLPTELDLTEEFSLVTPKAKHLLAIPSYRL  496



>ref|XP_010099912.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB80841.1| Cytochrome P450 71A1 [Morus notabilis]
Length=500

 Score =   304 bits (779),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 239/347 (69%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH +L +L+K+YGPIM+++LG +P V+VSSP AAEL LKTHD VFA+RP +
Sbjct  43    GSLHLLGKFPHHDLQKLAKQYGPIMHMRLGLIPTVIVSSPEAAELFLKTHDLVFATRPPH  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   + ++FAPYG +WR  +K  T ELL++ KI +F ++R+ E+   +KSI  A
Sbjct  103   EAAKHISWEQRNLSFAPYGSYWRDIRKMCTLELLSSHKISTFSEMRKEEIGLSIKSIREA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A +  L  ++T +M+FG   +D        K +VQE + L    N+ DY+
Sbjct  163   ALDHVAVDLSARITCLNADMTCRMVFGKKYSDEEFDERGFKAVVQEGMHLAATPNLGDYI  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+ P DLQG  KR++ + +  D+ F +I+ EH Q +K+   K+ KD VD+ML+ M +  
Sbjct  223   PFIAPLDLQGFTKRMKKVRRVFDEFFEKIIDEHIQ-SKDDAGKT-KDFVDVMLSFMGSKE  280

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM+ GS+DTS    EW ++E+++NPRV+K +Q+ELE  VG++R V
Sbjct  281   SEYRIERTNIKAIILDMVAGSMDTSSTATEWAISELIKNPRVLKKVQKELETVVGMDRTV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV+KE+ RLHPVA LL+P  ++ED  +NG  IP K
Sbjct  341   EESDLERLEYLDMVVKETLRLHPVAPLLIPHAAMEDCIVNGFHIPNK  387


 Score =   160 bits (405),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P KSRVMIN +AIG DP+ W+D  E+FFPERF+  SVD+RG DF L+PFG GRR C
Sbjct  381   GFHIPNKSRVMINVYAIGRDPNSWTDP-EKFFPERFVGSSVDLRGRDFQLIPFGSGRRGC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+HCF+WELPN M P ELDM E FGL +P+  HL+A+P+ RL
Sbjct  440   PGMQLGLTVVRLLVAQLVHCFDWELPNGMLPAELDMEEEFGLTTPRANHLMAIPTCRL  497



>ref|XP_003615665.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003615670.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98623.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES98628.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score =   311 bits (797),  Expect(2) = 7e-121, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 237/348 (68%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  LSKKYG IM L+LG+VP +V+SS  AAE  LKTHD  FASRPK 
Sbjct  46    GNLHMLGKLPHRTLQSLSKKYGSIMSLQLGQVPTIVISSSKAAESFLKTHDINFASRPKT  105

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + I  GSKG+AF+ YGP+WR  KK  T +LL+A+K+E FG +R+ E+   VKS+E  
Sbjct  106   QASQLIFYGSKGLAFSEYGPYWRSVKKLCTLKLLSASKVEMFGPIRKKELDVLVKSLEKV  165

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
                 E V+++  V  LIE++ YKM+ G    +  DLK +VQE ++++GAFN+ADY+ +L 
Sbjct  166   VLVGEVVNVSEIVENLIEDIVYKMILGRGKYEQFDLKKLVQEGMAMLGAFNLADYVSWLG  225

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
             PFDLQG  +  +  GK++D++   I+ EHEQ + N  +  ++D +D++L+ +        
Sbjct  226   PFDLQGFTRTCKKTGKALDEVLEMIITEHEQ-STNVDKVRHEDFIDILLSIVHQTVDPEN  284

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               S  +D  +IKA+L DMIV  +DT+   IEW L+E+ R+PRVMK LQ+E++N+VG  RM
Sbjct  285   EQSGVIDRTNIKAILLDMIVAGIDTATTTIEWALSELFRHPRVMKKLQDEIQNEVGNKRM  344

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L YL+MV+ E+ RL+PV  LL+PRE  E I ++G+FI +K
Sbjct  345   VEENDLKKLNYLDMVVDETLRLYPVGPLLLPRECRESITIDGYFIKEK  392


 Score =   152 bits (385),  Expect(2) = 7e-121, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             +K+RV++N WAIG D +IW +N +EF+PERF  K ++ +G  F  +PFG GRR CPG+ L
Sbjct  391   EKTRVIVNAWAIGRDSNIWLENADEFYPERFSDKKMNYQGQQFESIPFGSGRRRCPGIQL  450

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL+ V+ +V QL+HCFNWELP+ +SP  L+M E FG+  P+ QHL A+PSYRL
Sbjct  451   GLVTVRFVVAQLVHCFNWELPHNISPSNLNMEEKFGVTIPRAQHLHAIPSYRL  503



>ref|XP_002310008.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
 gb|EEE90458.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
Length=493

 Score =   307 bits (787),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 234/347 (67%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PHR L++L++KYGPIM+L+LG VP +VVSSP AAEL LKTHD VFA RP +
Sbjct  38    GSLHLLGKFPHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             ++ + I+ G KGMAFA YG +WR  +K  T ELL++ KI SF  +R  E+   +K I+ A
Sbjct  98    ESARYISYGQKGMAFAQYGSYWRNIRKMCTVELLSSLKITSFKPMRMEELDLLIKYIQEA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVDL+A+V  L  +++ +M+FG      + D    K ++QE++ L  A ++ DY+
Sbjct  158   AQERVAVDLSAKVSSLSADMSCRMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYI  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR++A+ K +D    +I+ EH Q  + G    NKD VD+ML+ MK+  
Sbjct  218   PQIAALDLQGLTKRMKAISKVLDVFLDKIIDEHVQYQEKG---KNKDFVDVMLSFMKSEE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + + +D   +KA + DM+VGS+DTS   I+W  +E+++NPRVMK LQ+ELE  VG  RMV
Sbjct  275   NEYLVDQGCMKATMLDMLVGSMDTSATVIDWAFSELIKNPRVMKKLQKELEEVVGKQRMV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV+KE+ RLHP   L++P E+ ED  +N   IPKK
Sbjct  335   EESDLERLEYLDMVVKETLRLHPAGPLMIPHEATEDCVVNDFHIPKK  381


 Score =   155 bits (391),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKS V+IN WAIG DP  W+D  E+F+PERF+   +D+RG DF L+PFG GRR CPG+ 
Sbjct  379   PKKSHVIINVWAIGRDPKAWTD-AEKFYPERFVGSDIDVRGRDFQLIPFGTGRRSCPGMQ  437

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  V+L++ Q++HCF+WELPN + P E+DM+E FGL   + +HLV++P+YRL
Sbjct  438   LGLTMVRLVLAQMVHCFDWELPNGILPSEVDMSEEFGLVLCRSKHLVSIPTYRL  491



>ref|XP_003615674.1| Cytochrome P450 [Medicago truncatula]
Length=574

 Score =   320 bits (821),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 243/348 (70%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LGTLPHR L  LSK+YGPIM L+LG+VPA+V+SS  AAE  +KTHD VFA+RP+ 
Sbjct  48    GNLHILGTLPHRTLQSLSKQYGPIMSLQLGQVPAIVISSSKAAESFVKTHDIVFANRPEL  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ G KG+AF+ Y  +WR  +K  T +LL+A+K+E FG +R+ ++   VKS+E A
Sbjct  108   VGAQIMSYGCKGLAFSKYDSYWRSVRKLCTSKLLSASKVEMFGPIRKEKLDVLVKSLEKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E V+++  V  +IE++ YKM+ G S  D+ DLK +VQ++++LIGAFN+ADY+P+L 
Sbjct  168   ALEGEVVNVSEAVENVIEDIVYKMVLGRSKYDHIDLKRLVQDVMALIGAFNMADYVPWLG  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKN-----P  914
              FDLQGL +  +   K++D++   I+ EHEQ   N  +  ++D VD++L           
Sbjct  228   TFDLQGLTRACKRTNKALDEVLEMIISEHEQ-TTNTDKTRHEDFVDILLTFKHQNIDHGS  286

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               +H +D  +IKA+L DM+V S  TS   IEW L+E++R+PRVMK LQ+E++N+VG  RM
Sbjct  287   EQNHVIDRTNIKAILLDMVVASFSTSATTIEWALSELLRHPRVMKNLQDEIQNEVGNKRM  346

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEEKDL N  YL+MV+ E+ RLHPV+  L+PRE  E+I ++G+F+ +K
Sbjct  347   VEEKDLKNFNYLDMVVDETLRLHPVSPFLLPRECRENITIDGYFVKEK  394


 Score =   142 bits (357),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    +K+RV++N + I  DP++WS+N EEF PERF++K ++  G +F  +PFG+GRR C
Sbjct  388   GYFVKEKTRVIVNAFTIARDPNVWSENAEEFCPERFINKKLNYEGQEFESIPFGFGRRRC  447

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ L L  V+L + QL+HCFNW+LP  +SP  L+M E FG +  + QHL A+PSYRL
Sbjct  448   PGIQLALRTVRLSIAQLVHCFNWKLPYNISPSNLNMDEKFGQSIHRAQHLHAIPSYRL  505



>ref|XP_007211842.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
 gb|EMJ13041.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
Length=497

 Score =   300 bits (768),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 162/347 (47%), Positives = 234/347 (67%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P+++L+ L++KYG IMY++LG +  +V+SSP AAEL LKTHD VFASRP +
Sbjct  39    GSLHLLGEFPNKDLHRLARKYGDIMYMRLGLMSTIVISSPEAAELFLKTHDLVFASRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K+I+ G K ++F+ YG +WR  +K  T ELL+  KI SF  +RR E+   V+SI AA
Sbjct  99    EGSKHISFGQKNLSFSEYGVYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAA  158

Query  570   AGG-REAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADY  734
             A     AVDL+ +V  L  +++ +M+ G    D        K +V+E + L  A N+ DY
Sbjct  159   ANNIGVAVDLSDKVSSLSVDMSCRMVLGKKYRDEEFDERGFKSVVREGIQLASAPNLGDY  218

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +PF+ P DLQG  KR++++ K+ D LF + ++EH Q       +  KD VD+M+  M + 
Sbjct  219   IPFIAPLDLQGFTKRMKSVNKAFDNLFEKSIEEHLQPNDG---ERTKDFVDVMVGFMGSE  275

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++   IKA++ DM+V S+DTS   IEW L+E+MR+P+ MK +Q+ELEN VGL++M
Sbjct  276   ESEYRIERPHIKAIMLDMLVASMDTSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKM  335

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  L+YL MV+KE+FRLHPVA LLVP  S+ED  +NG+ IPK
Sbjct  336   VEESDLEKLDYLNMVVKETFRLHPVAPLLVPHASIEDCTVNGYHIPK  382


 Score =   162 bits (409),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PK SRV+IN WAIG DP+ W+D  E+F PERF   SVD+RG+ F L+PFG GRR 
Sbjct  376   NGYHIPKNSRVLINVWAIGRDPNAWTDP-EKFIPERFEGSSVDVRGNHFQLIPFGSGRRR  434

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+L++ QL+HCF+WELPN M P ELDMTE FG   P+ +HL+A+PSYRL
Sbjct  435   CPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPDELDMTEEFGFTVPRAKHLLAIPSYRL  493



>ref|XP_007214404.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
 gb|EMJ15603.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
Length=496

 Score =   298 bits (764),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 240/349 (69%), Gaps = 9/349 (3%)
 Frame = +3

Query  210   GNLHQL-GTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPK  386
             G+LH L G  P+++L+ L++KYG IMY++LG +P +VVSSP AA+L LKTHD VFASRP 
Sbjct  39    GSLHLLSGEFPNKDLHRLAQKYGDIMYMRLGLMPTIVVSSPQAAKLFLKTHDLVFASRPP  98

Query  387   NDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI-E  563
             ++  K+I+ G + ++FA YGP+WR  +K  T ELL+  KI SF  +RR E+   V+SI +
Sbjct  99    HEGAKHISFGQRNLSFAEYGPYWRDMRKMCTLELLSNHKINSFKSMRREEVALCVESIRD  158

Query  564   AAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIAD  731
             AA  GR AVDL+  V  L  +++ +M+ G    D        + +++E + L GA N+AD
Sbjct  159   AAYKGRVAVDLSDIVSSLSVDMSCRMVLGKKYRDEDFDARGFRSVIKEGIQLAGASNLAD  218

Query  732   YLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKN  911
             Y+PF+ P DLQG  KR++++ K+ D  F +I++EH Q + +G  +  KD VD+M+  M +
Sbjct  219   YIPFIAPLDLQGFTKRMKSVNKAFDVFFEKIIEEHLQ-SNDG--ERTKDFVDVMVGFMGS  275

Query  912   PSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
               S ++++   IKA++ DM+V S+DTS   ++W L+E+MR+P+ MK +Q+ELE+ VGL R
Sbjct  276   VESEYQIERPHIKAIIMDMLVASMDTSSTTVDWALSELMRHPKAMKEVQKELEDVVGLER  335

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL  L+YL MV+KE+ RLHPVA LLVP  + ED  +NG+ IPKK
Sbjct  336   MVEESDLEKLDYLSMVVKETLRLHPVAPLLVPHAATEDCIVNGYHIPKK  384


 Score =   163 bits (413),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV+IN WAIG DPS W+D  EEF PERF    VD+RG+ F L+PFG GRR C
Sbjct  378   GYHIPKKSRVIINAWAIGRDPSAWTD-AEEFIPERFEGSDVDVRGNHFQLIPFGSGRRRC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN M P ELDM+E+FG+   +V+ L+A+PSYRL
Sbjct  437   PGIQLGLTVVQLMLAQLVHCFDWELPNNMLPEELDMSESFGITVERVKRLIAIPSYRL  494



>gb|AES98632.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=512

 Score =   319 bits (818),  Expect(2) = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 243/348 (70%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LGTLPHR L  LSK+YGPIM L+LG+VPA+V+SS  AAE  +KTHD VFA+RP+ 
Sbjct  48    GNLHILGTLPHRTLQSLSKQYGPIMSLQLGQVPAIVISSSKAAESFVKTHDIVFANRPEL  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ G KG+AF+ Y  +WR  +K  T +LL+A+K+E FG +R+ ++   VKS+E A
Sbjct  108   VGAQIMSYGCKGLAFSKYDSYWRSVRKLCTSKLLSASKVEMFGPIRKEKLDVLVKSLEKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E V+++  V  +IE++ YKM+ G S  D+ DLK +VQ++++LIGAFN+ADY+P+L 
Sbjct  168   ALEGEVVNVSEAVENVIEDIVYKMVLGRSKYDHIDLKRLVQDVMALIGAFNMADYVPWLG  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKN-----P  914
              FDLQGL +  +   K++D++   I+ EHEQ   N  +  ++D VD++L           
Sbjct  228   TFDLQGLTRACKRTNKALDEVLEMIISEHEQ-TTNTDKTRHEDFVDILLTFKHQNIDHGS  286

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               +H +D  +IKA+L DM+V S  TS   IEW L+E++R+PRVMK LQ+E++N+VG  RM
Sbjct  287   EQNHVIDRTNIKAILLDMVVASFSTSATTIEWALSELLRHPRVMKNLQDEIQNEVGNKRM  346

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEEKDL N  YL+MV+ E+ RLHPV+  L+PRE  E+I ++G+F+ +K
Sbjct  347   VEEKDLKNFNYLDMVVDETLRLHPVSPFLLPRECRENITIDGYFVKEK  394


 Score =   141 bits (356),  Expect(2) = 5e-120, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    +K+RV++N + I  DP++WS+N EEF PERF++K ++  G +F  +PFG+GRR C
Sbjct  388   GYFVKEKTRVIVNAFTIARDPNVWSENAEEFCPERFINKKLNYEGQEFESIPFGFGRRRC  447

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ L L  V+L + QL+HCFNW+LP  +SP  L+M E FG +  + QHL A+PSYRL
Sbjct  448   PGIQLALRTVRLSIAQLVHCFNWKLPYNISPSNLNMDEKFGQSIHRAQHLHAIPSYRL  505



>ref|XP_008364815.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=499

 Score =   306 bits (784),  Expect(2) = 9e-120, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 238/348 (68%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P+R+L++LS+KYG IMYL+LG VP VVVSSP AAEL LKTHD VFASRP +
Sbjct  43    GSLHLLGKFPNRDLHQLSRKYGDIMYLRLGLVPTVVVSSPRAAELFLKTHDLVFASRPPH  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K+I+ G + ++FA YG +WR  +K  T ELL+  KI SF  +RR E+   ++S+E  
Sbjct  103   EGSKHISFGQRNLSFAEYGSYWRDIRKMCTLELLSNHKINSFKSMRREEVALLIQSVEED  162

Query  570   AG-GREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADY  734
             A  GR A+DL+ +V  L  ++T +M+FG    D          +++E + L    N+ DY
Sbjct  163   ANXGRVAIDLSVKVSSLSVDMTCRMVFGKKYKDEEFDERGFTAVMKEGLKLSAGPNLGDY  222

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +P + P DLQG  K+++A+ K+ D+ F +I+  H Q      ++  KD VD+M+A M + 
Sbjct  223   IPCIAPLDLQGFTKKMKAINKAFDEFFEKIIDXHLQSKD---EERTKDFVDVMVAFMGSE  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++  +IKA++ DM  GS+DT+   +EW L+E+MR+P+VMK +Q+ELEN VGLNRM
Sbjct  280   DSDYRIERTNIKAIMLDMFAGSMDTTSTTVEWALSELMRHPQVMKKVQKELENVVGLNRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  LEYL+MV+KE+ RLHPVA LLVP  ++ED  ++G+ +PKK
Sbjct  340   VEESDLEKLEYLDMVVKETLRLHPVAPLLVPHAAIEDCIVDGYHVPKK  387


 Score =   154 bits (388),  Expect(2) = 9e-120, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS V+IN WAIG D S W D  E+F PERF   +VD+RG+ F L+PFG GRR C
Sbjct  381   GYHVPKKSLVIINAWAIGRDQSAWED-AEKFVPERFEGNNVDVRGNHFQLIPFGSGRRRC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+ ++ QL+HCF+WELP+ M P++LDMTE FGL   + +HL+A+PSYRL
Sbjct  440   PGIQLGLTVVQFVLAQLVHCFDWELPDNMLPNDLDMTEDFGLTVSRAKHLLAIPSYRL  497



>ref|XP_002276487.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=494

 Score =   304 bits (778),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 231/347 (67%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GN+H LG+LPHR L  LSKKYGPIMY++LG VPA+VVSSP AAE  LKTHD VFA+RP +
Sbjct  38    GNMHMLGSLPHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  +++    KG++F+ YGP+WR  +K  T ELLT+ KI SF  +RR E+   +KS E A
Sbjct  98    ECSRHMLYDGKGISFSGYGPYWRSMRKLCTLELLTSRKINSFKPMRREEVGLLIKSFEEA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVD++A+V  L  +++ +M+FG      + D    K ++QE + L    NI DY+
Sbjct  158   ARAGAAVDVSAKVALLSADMSCRMVFGKKYMDKDLDERGFKAVIQEAMQLAATPNIGDYI  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P L   DLQGL +R++A GK  D  F +I+ EH    K   +   KD+VD+ML  M +  
Sbjct  218   PCLLGLDLQGLTRRIKATGKVFDDFFEKIIDEHIHKPKE--EGQTKDLVDVMLDLMGSEE  275

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + + +  A+IKA+  DM+  S+DTS   IEW L+E++++P +MK +  ELE  VG+ RMV
Sbjct  276   TEYNIQRANIKAISLDMMAASMDTSATMIEWALSELIKHPPMMKKVINELEKVVGMERMV  335

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL +LEYL MV+KE+ RLHPVA LL+P ES+ED  ++G  IP+K
Sbjct  336   EESDLESLEYLNMVVKETLRLHPVAPLLIPHESMEDCTVDGFHIPQK  382


 Score =   155 bits (393),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSRV++N WAIG DP+ W+D  ++F PERFM   +D RG  F  +PFG GRR C
Sbjct  376   GFHIPQKSRVIVNVWAIGRDPNAWTD-ADKFLPERFMESDIDFRGQHFQFIPFGSGRRGC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELP+ M P ELDMTE FGL  P+ +HLVA+P+ RL
Sbjct  435   PGMQLGLTVVRLVLAQLVHCFDWELPDNMLPSELDMTEEFGLTLPRAKHLVAIPTCRL  492



>ref|XP_006363549.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
 ref|XP_006363550.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=499

 Score =   301 bits (770),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 224/346 (65%), Gaps = 6/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH +G   H++L++++KKYGPIM ++ G VP +V SSP AAE  LK HD +FASRP N
Sbjct  43    GNLHMIGKNVHQDLHKIAKKYGPIMSMRFGFVPVIVASSPHAAEQFLKNHDLIFASRPNN  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K IA   + + F  YGP+WR  +K  T ELL+  KI SF  +R+ E+  +V  I  A
Sbjct  103   IAAKFIAYDQRNLTFGKYGPYWRNMRKLCTLELLSTLKINSFQAMRKQEVTNFVTFINGA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A     +D++A++  L  N+T  M+FG    D+       K ++QE + L    NI ++ 
Sbjct  163   ASSGVEIDISAKLATLNTNMTCLMVFGKKYMDDEFDERGFKYVIQETLVLTATPNIGEFF  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL  FDLQG+ +R++ L K  D+ F  I+ EH QD+K   +K  KDIVD M+  M++  
Sbjct  223   PFLNVFDLQGVVRRMKELSKIFDEFFERIIDEHVQDSKK--EKQTKDIVDTMMNIMQSGE  280

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S  + D   +KA+L DM++ S+DTS   I+W   E++R+P+V+K LQ+ELE  VG+NRMV
Sbjct  281   SEFEFDRRHVKAILLDMLIASMDTSSTAIDWIFTELLRHPKVIKKLQKELEQIVGMNRMV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL  LEYL+MVIKE FRLHPVA LL+P ES+ED  ++G  IPK
Sbjct  341   EESDLEKLEYLDMVIKEGFRLHPVAPLLIPHESIEDCTIDGFDIPK  386


 Score =   158 bits (399),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+++N WAIG DP IWS+  E+F PERF+  ++D+RG++F LLPFG GRR C
Sbjct  381   GFDIPKGSRLLVNTWAIGRDPEIWSEP-EKFMPERFVGSNIDLRGNNFQLLPFGSGRRSC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ Q++HCF+W+LPN M P++LDMTE FGL   + QHL+ +P+YRL
Sbjct  440   PGLQLGLTTVRLVLAQMVHCFDWKLPNGMMPNDLDMTEKFGLVMTRAQHLMVIPTYRL  497



>ref|XP_008227122.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=496

 Score =   297 bits (761),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 240/349 (69%), Gaps = 9/349 (3%)
 Frame = +3

Query  210   GNLHQL-GTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPK  386
             G+LH L G  P+++L+ L++KYG +MY++LG +P +VVSSP AA+L LKTHD VFASRP 
Sbjct  39    GSLHLLSGEFPNKDLHRLAQKYGDVMYMRLGLMPTIVVSSPQAAKLFLKTHDLVFASRPP  98

Query  387   NDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI-E  563
             ++  K+I+ G + ++FA YGP+WR  +K  T ELL+  KI SF  +RR E+   V+SI +
Sbjct  99    HEGAKHISFGQRNLSFAEYGPYWRDMRKMCTLELLSNHKINSFKSMRREEVALCVESIRD  158

Query  564   AAAGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIAD  731
             AA  G  AVDL+  V  L  +++ +M+ G      + D    + +++E + L GA N+AD
Sbjct  159   AAYKGHVAVDLSDIVSSLSVDMSCRMVLGKKYRDEDFDTRGFRSVIKEGLQLAGASNLAD  218

Query  732   YLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKN  911
             Y+PF+ P DLQG  KR++++ K+ D  F +I++EH Q + +G  +  KD VD+M+  M +
Sbjct  219   YIPFIAPLDLQGFTKRMKSVNKAFDTFFEKIIEEHLQ-SNDG--ERTKDFVDVMVGFMGS  275

Query  912   PSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
               S ++++   IKA++ DM+V S+DTS   ++W L+E+MR+P+ MK +Q+ELE+ VGL R
Sbjct  276   EESEYQIERPHIKAIIMDMLVASMDTSSTTVDWALSELMRHPKAMKQVQKELEDVVGLER  335

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE DL  L+YL MV+KE+ RLHPVA LLVP  + ED  +NG+ IPKK
Sbjct  336   MVEESDLEKLDYLSMVVKETLRLHPVAPLLVPHAATEDCTVNGYHIPKK  384


 Score =   161 bits (408),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV+IN WAIG DPS W+D  EEF PERF    VD+RG+ F L+PFG GRR C
Sbjct  378   GYHIPKKSRVIINAWAIGRDPSAWTD-AEEFIPERFEGSDVDVRGNHFQLIPFGSGRRRC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN M P ELDM+E FG+   + + L+A+PSYRL
Sbjct  437   PGIQLGLTVVQLMLAQLVHCFDWELPNNMLPEELDMSEVFGITVARAKRLIAIPSYRL  494



>emb|CBI21489.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   301 bits (770),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/372 (45%), Positives = 237/372 (64%), Gaps = 31/372 (8%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPH++L  L+KKYGPIMY++   VP +VVSSP AAE  LKT+D VFA RP +
Sbjct  70    GNLHMLGELPHQDLLRLAKKYGPIMYMRFALVPTIVVSSPQAAEQFLKTNDLVFAGRPPH  129

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  + ++   KG++F  YGP+WR  +K  T  LL+  +I SF  LRR E+   +KS++ A
Sbjct  130   EGSRIVSYDRKGISFTDYGPYWRNMRKLCTLGLLSNLRISSFQPLRREELDLLIKSLKEA  189

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVDL+A++  L  +++ +M+FG      + D    K ++QE + L GA NI DY+
Sbjct  190   ALARTAVDLSAKISSLSADMSCRMIFGKKYMDKDIDERGFKAVIQEGMQLAGAPNIGDYI  249

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+ P DLQGL +R++A+ K  D  F +I+ +H  + K   Q   KD++D+ML  M +  
Sbjct  250   PFVAPLDLQGLARRMKAISKVFDAFFEKIIDDHIHEPKEEGQP--KDLIDVMLGYMGSKE  307

Query  918   SSHKLDLASIKALLF-------------------------DMIVGSVDTSYAWIEWTLAE  1022
             +  +++ ++IKAL+                          DM+ GS+DTS   IEW LAE
Sbjct  308   NEFQIERSNIKALVLVSIHTLIIHISKPSSSQYICCLNFQDMLAGSMDTSATAIEWALAE  367

Query  1023  IMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLE  1202
             +++NPR+MK +QEELE  VG+ R VEE DL +LEYL+MV+KE+ RLHPVA LL+P ESLE
Sbjct  368   LLKNPRIMKKVQEELEKVVGMERKVEESDLESLEYLDMVVKETLRLHPVAPLLIPHESLE  427

Query  1203  DIELNGHFIPKK  1238
             D  +NG  IP+K
Sbjct  428   DCTVNGFHIPQK  439


 Score =   157 bits (398),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSRVM+N +AIG DP++W+D  E+F PERF+  S+D+RG DF L+PFG GRR C
Sbjct  433   GFHIPQKSRVMVNTYAIGRDPNVWTD-AEKFLPERFIGSSIDLRGRDFQLIPFGSGRRGC  491

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGL  V+L++ QL+HCF+WELPN M P ELDMTE FGL  P+ +H++A  S R L
Sbjct  492   PGMQLGLTVVRLVLAQLVHCFDWELPNGMMPSELDMTEEFGLTVPRAKHILAYISQRQL  550



>ref|XP_007221131.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
 gb|EMJ22330.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
Length=494

 Score =   300 bits (769),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 159/348 (46%), Positives = 235/348 (68%), Gaps = 9/348 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P+++L+ L++KYG IMY++LG +  +VVSSP AAEL LKTHD VFASRP +
Sbjct  39    GSLHLLGKFPNKDLHRLAQKYGDIMYMRLGLMHTIVVSSPQAAELFLKTHDLVFASRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  ++I+ G + + F+ YG +WR  +K  T ELL+  KI SF  +RR  +   V+SI A 
Sbjct  99    EGAEHISFG-QSLVFSEYGAYWRDMRKMCTLELLSNHKINSFKSMRRDAIALCVESIRAT  157

Query  570   A-GGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADY  734
             A  GR AVDL+  V  L E ++ +M+ G    D       ++ +++E + LI A N+ DY
Sbjct  158   ADNGRVAVDLSDNVSSLSEVISCRMVLGKMYRDEEFDARGIRSVIKEGIQLIVAANLGDY  217

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +PF+ PFDLQG  K+++++ K++D  F +++ EH Q  +    +  KD VD+M+A M + 
Sbjct  218   IPFIAPFDLQGFTKQMKSVNKALDTFFEKVIDEHIQSNEG---ERTKDFVDVMVAFMGSE  274

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++   IKA++FDM+VGS+DT    +EW L+E+MRNP+ MK +Q+ELE+ VGL RM
Sbjct  275   QSEYRIERPHIKAIIFDMLVGSIDTLSVTVEWALSELMRNPKAMKKVQKELEDVVGLGRM  334

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  L+YL MV+KE+ RLHPV  LL+P  + ED  +NG+ IPKK
Sbjct  335   VEESDLGKLDYLSMVVKETMRLHPVGPLLIPHAATEDCTVNGYHIPKK  382


 Score =   158 bits (399),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PKKS V+IN WAIG DPS W D  EEF PERF    VD+RG+ F L+PFG GRR 
Sbjct  375   NGYHIPKKSHVIINAWAIGRDPSAWID-AEEFIPERFDGSDVDVRGNHFQLIPFGSGRRR  433

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ L LI V+L++ QL+HCF+WELPN M P ELDMTE FG+   + + L+A+PSYRL
Sbjct  434   CPGIQLALIVVQLMLAQLVHCFDWELPNDMLPEELDMTEVFGITVARAKRLIAIPSYRL  492



>ref|XP_008346790.1| PREDICTED: cytochrome P450 CYP736A12-like isoform X1 [Malus domestica]
Length=399

 Score =   290 bits (741),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 143/284 (50%), Positives = 203/284 (71%), Gaps = 6/284 (2%)
 Frame = +3

Query  405   IADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGRE  584
             +A G+K MA   YGP+WR  +K  T +LL  +KIE F  LRR E+   V+S++ AA   E
Sbjct  1     MAYGTKAMALTEYGPYWRRIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEAGE  60

Query  585   AVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQ  764
              VD + +VG L+E +TY+M+ G  N+D  DLK I++E + L GAFNI+DY+PFL P DLQ
Sbjct  61    VVDFSEKVGELVEGITYRMVLGRKNDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQ  120

Query  765   GLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKS-NKDIVDMMLASMKNP-----SSSH  926
             GL KR++ + K VD+L  +I+K+HEQ +++ VQ + +KD VD++L+S+  P        +
Sbjct  121   GLTKRMKRVSKXVDQLLEKIIKDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNDEEVY  180

Query  927   KLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEK  1106
              L+  + KA+L DMI G+ DTS   I WTLAE++R+P+VMK LQEEL++ +G++RMVEE 
Sbjct  181   MLERTNAKAILLDMIAGAFDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRMVEES  240

Query  1107  DLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             DLP L+YL MV+KES RL+PVA LLVP +S+EDI ++G+ IPKK
Sbjct  241   DLPKLDYLSMVVKESLRLNPVAPLLVPHQSMEDITVDGYHIPKK  284


 Score =   166 bits (421),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV  N W IG DPS+WSDNVEEF+PE FM+ +VD+RGHDF L+PFG GRR C
Sbjct  278   GYHIPKKSRVFXNIWTIGRDPSVWSDNVEEFYPEXFMNNNVDLRGHDFQLIPFGSGRRGC  337

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+ ++G L+HCFNWELP+ M P +LDMTE FGL+  K +HL+A+ + RL
Sbjct  338   PAMQLGLTTVRXVLGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMXTCRL  395



>ref|XP_002310005.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
 gb|EEE90455.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
Length=500

 Score =   309 bits (792),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 233/347 (67%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PHR L++L++KYGPIM+L+LG VP +VVSSP AAEL LKTHD VFA RP +
Sbjct  38    GSLHLLGKFPHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + I+ G KGMAFA YG +WR  +K  T ELL++ KI SF  +R  E+   +K I+ A
Sbjct  98    EAARYISYGQKGMAFAQYGSYWRNMRKMCTVELLSSLKITSFKPMRMEELDLLIKYIQEA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVD++A+V  L  +++ +M+FG      + D    K ++QE++ L  A ++ DY+
Sbjct  158   AQERVAVDMSAKVSSLSADMSCRMVFGKKYVDEDLDERGFKSVMQEVMHLTAAPHLGDYI  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR+ A+ K  D    +I+ EH Q  + G    NKD VD+ML+ MK+  
Sbjct  218   PQIAALDLQGLTKRMNAISKVFDVFLDKIIDEHVQYQEKG---KNKDFVDVMLSLMKSEE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + + +D   +KA + DM+VGS+DTS   I+W  +E+++NPRVMK LQ+E+E  VG  RMV
Sbjct  275   NEYLVDQGCMKATMLDMLVGSMDTSATVIDWAFSELIKNPRVMKKLQKEIEEVVGKQRMV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV+KE+ RLHP   L++P E+ ED  +NG  IPKK
Sbjct  335   EESDLERLEYLDMVVKETLRLHPAGPLMIPHEATEDCVVNGFHIPKK  381


 Score =   146 bits (369),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS V+IN WAIG DP  W+D  E+F+PERF+   +D+RG DF L+PFG GRR C
Sbjct  375   GFHIPKKSHVIINVWAIGRDPKAWTD-AEKFYPERFVGSDIDVRGRDFQLIPFGTGRRSC  433

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAV  1557
             PG+ LGL  V+L++ QL+HCF+WELPN + P E+DMTE FGL   + +HL+ +
Sbjct  434   PGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVLCRSKHLIKI  486



>emb|CBI15434.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score =   303 bits (776),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 159/350 (45%), Positives = 226/350 (65%), Gaps = 33/350 (9%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG LPHRNL  L+KKYGPIMY++LG VP V+VSS  A +L LKTHD VFASRPK 
Sbjct  571   GCLHMLGNLPHRNLTRLAKKYGPIMYMRLGCVPTVIVSSAQATKLFLKTHDVVFASRPKL  630

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAW--VKSIE  563
              A +++  G+KG+AF+ YGP+WR  +K                         W  V+S++
Sbjct  631   QAFEHLTYGTKGIAFSEYGPYWRNVRKL------------------------WMLVQSLK  666

Query  564   AAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPF  743
               A   E VD++ +V +++E+++Y+M+FG + +   DLK +V+E   L G FN+ DY PF
Sbjct  667   EMAAAGEVVDISTKVAQVVEDISYRMVFGRNKDGMIDLKTLVREGTRLAGTFNLGDYFPF  726

Query  744   LKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS--  917
             L P DLQGL +R +A+ K+ D++  +I+    QD   G   ++ + +D+ML+ M N S  
Sbjct  727   LGPLDLQGLVQRFKAINKAADEVLEKIIDRRIQDG--GKDHNHSNFIDIMLSLMSNFSNL  784

Query  918   ---SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
                SS+ +D  ++KA+L DM+VG +D+S   IEW  +E++R+PRVM+ LQ EL+N V ++
Sbjct  785   RSESSYIIDRTNVKAILLDMLVGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMD  844

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             RMV+E DL NL YL MV+KE  RLHP+   LVP  S EDI + GHFIPK+
Sbjct  845   RMVDESDLENLVYLNMVVKEVLRLHPIGPFLVPHASTEDITIEGHFIPKR  894


 Score =   152 bits (384),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK+S ++IN WAIG DP+ WSDNV+EF PERF++ ++D++G DF L+PFG GRR C
Sbjct  888   GHFIPKRSTILINTWAIGRDPNFWSDNVDEFLPERFINSNIDLQGRDFELIPFGSGRRGC  947

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPK  1536
             PG+ LGL  V+L++ QL+HCFNWELPN MS  +LDM+E FGL  P+
Sbjct  948   PGIQLGLRTVRLVLAQLLHCFNWELPNDMSSDDLDMSEKFGLTMPR  993


 Score =   186 bits (472),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 139/206 (67%), Gaps = 8/206 (4%)
 Frame = +3

Query  642   LFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLE  821
             +FG +     DLK +++E   L G FN+ADY+PFL P DLQG  + LR   +++D+   +
Sbjct  43    VFGRNKVQIIDLKTLIREFTRLAGTFNLADYVPFLGPLDLQGPTQLLRTNSEAIDEFLEK  102

Query  822   IVKEHEQD-AKNGVQKSNKDIVDMMLASMKNPS-----SSHKLDLASIKALLFDMIVGSV  983
             I+ +H QD +K+ V   N   +D++L+ M   +     S + +D  ++KA++ D + G  
Sbjct  103   IIDKHIQDVSKDEVNHMN--FIDVVLSLMNKSNNYEDESLYAIDRKNVKAIILDALAGGT  160

Query  984   DTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLH  1163
             DTS   IEW L+E++R+PRVM+ LQEEL+N VG+ RMVEE DL NL+YL MV+KE+ RLH
Sbjct  161   DTSITSIEWILSELLRHPRVMRQLQEELKNVVGMRRMVEESDLENLDYLNMVVKETLRLH  220

Query  1164  PVATLLVPRESLEDIELNGHFIPKKI  1241
             P   LL+P ES+EDI +NG++IPKK+
Sbjct  221   PTTPLLIPHESMEDIVINGYYIPKKL  246


 Score = 38.9 bits (89),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVE  1305
             G   PKK R++IN W I  DP++WS+N E
Sbjct  239   GYYIPKKLRILINAWTIRRDPNVWSNNHE  267


 Score =   130 bits (328),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 111/177 (63%), Gaps = 9/177 (5%)
 Frame = +3

Query  525   RRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVS  704
             +  + +    +I+   G    VD++  V  +IE++ Y+M+FG   ++  DLK ++ E  S
Sbjct  340   KSAQFICIQCNIQVQPG--NVVDISTRVAEVIEDMAYRMVFGHDKDEMIDLKTLIGEATS  397

Query  705   LIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIV  884
             L G FNIADYLPFL  FDLQGL +R +A  +++D++  +I+ +H +DA++GV   N   +
Sbjct  398   LAGTFNIADYLPFLGSFDLQGLTRRFQAASEAIDEVLEKIIDKHTKDARDGVNHMN--FM  455

Query  885   DMMLASMKNPSSS-----HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPR  1040
             D+ML+ M   +       + +D  ++KA++ D++VG +D+S   ++W LAE++R+PR
Sbjct  456   DIMLSLMSKSNDFKDEPLYAIDRTNVKAIILDILVGGIDSSLISVDWALAELLRHPR  512



>ref|XP_003531375.1| PREDICTED: cytochrome P450 750A1-like isoform X1 [Glycine max]
Length=498

 Score =   300 bits (768),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 236/348 (68%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH+LG  PHR L++L++KYGPIM+L+LG VP +V+SSP AAEL LKTHD VFASRP +
Sbjct  37    GSLHKLGANPHRGLHQLAQKYGPIMHLRLGFVPTIVISSPQAAELFLKTHDLVFASRPPH  96

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI-EA  566
             +A+K IA   + + FA YG +WR  +K  T ELL+  KI SF  +R  E+   +K + EA
Sbjct  97    EAIKYIAWEQRNLGFAEYGSYWRNMRKMCTLELLSQTKINSFRIVREEELDLSIKLLREA  156

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADY  734
             +  G  AVD++A+V R+  +V  +M+ G      + D    K +VQE++ L+   NI DY
Sbjct  157   SNDGAAAVDISAKVARISADVACRMVLGKKYMDQDLDEKGFKAVVQEVMHLLATPNIGDY  216

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +P++   DLQGL KR++A+ K  D+ F +I+ EH Q  K G     KD VD+ML  + + 
Sbjct  217   IPYIGKLDLQGLIKRMKAVRKIFDEFFDKIIDEHIQSDK-GQDNKVKDFVDVMLGFVGSE  275

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                ++++  +IKA+L DM++GS+DTS   IEWTL+E+++NPRVMK +Q ELE  VG+ R 
Sbjct  276   EYEYRIERPNIKAILLDMLLGSMDTSATVIEWTLSELLKNPRVMKKVQMELETVVGMQRK  335

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             V+E DL  LEYL+MVIKE+ RLHPVA LL+P +S ED  +   FIP+K
Sbjct  336   VKESDLDKLEYLDMVIKENMRLHPVAPLLIPHQSREDCMVGDFFIPRK  383


 Score =   155 bits (391),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             P+KSRV+IN WAI  D S+WS+  E+F+PERF   ++D+RGHDF  +PFG GRR CPG+ 
Sbjct  381   PRKSRVVINAWAIMRDSSVWSE-AEKFWPERFEGSNIDVRGHDFQFIPFGSGRRACPGMQ  439

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             +GL  V+L V QL+HCF+W+LP+ M P  LDMTE FGL  P+  HL+AVP+YRL
Sbjct  440   MGLTMVRLTVAQLVHCFHWKLPSDMLPDHLDMTEEFGLTMPRANHLLAVPTYRL  493



>ref|XP_008346791.1| PREDICTED: cytochrome P450 CYP736A12-like isoform X2 [Malus domestica]
Length=399

 Score =   288 bits (737),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 142/284 (50%), Positives = 203/284 (71%), Gaps = 6/284 (2%)
 Frame = +3

Query  405   IADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGRE  584
             +A G+K MA   YGP+WR  +K  T +LL  +KIE F  LRR E+   V+S++ AA   E
Sbjct  1     MAYGTKAMALTEYGPYWRRIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEAGE  60

Query  585   AVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQ  764
              VD + +VG L+E +TY+M+ G  N+D  DLK I++E + L GAFNI+DY+PFL P DLQ
Sbjct  61    VVDFSEKVGELVEGITYRMVLGRKNDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQ  120

Query  765   GLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKS-NKDIVDMMLASMKNP-----SSSH  926
             GL KR++ + K VD+L  +I+++HEQ +++ VQ + +KD VD++L+S+  P        +
Sbjct  121   GLTKRMKRVSKXVDQLLEKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNDEEVY  180

Query  927   KLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEK  1106
              L+  + KA+L DMI G+ DTS   I WTLAE++R+P+VMK LQEEL++ +G++RMVEE 
Sbjct  181   MLERTNAKAILLDMIAGAFDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRMVEES  240

Query  1107  DLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             DLP L+YL MV+KES RL+PVA LLVP +S+EDI ++G+ IPKK
Sbjct  241   DLPKLDYLSMVVKESLRLNPVAPLLVPHQSMEDITVDGYHIPKK  284


 Score =   166 bits (421),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV  N W IG DPS+WSDNVEEF+PE FM+ +VD+RGHDF L+PFG GRR C
Sbjct  278   GYHIPKKSRVFXNIWTIGRDPSVWSDNVEEFYPEXFMNNNVDLRGHDFQLIPFGSGRRGC  337

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+ ++G L+HCFNWELP+ M P +LDMTE FGL+  K +HL+A+ + RL
Sbjct  338   PAMQLGLTTVRXVLGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMXTCRL  395



>ref|XP_008347028.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008356594.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   296 bits (759),  Expect(2) = 5e-118, Method: Compositional matrix adjust.
 Identities = 159/347 (46%), Positives = 227/347 (65%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG  PHR+L+ L++K+G IMYL+LG  P ++ SSP AAEL LKTHD  FASRP  
Sbjct  41    GNLHMLGEFPHRDLHRLAQKHGDIMYLRLGLAPVIIASSPQAAELFLKTHDLNFASRPPL  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+ G + ++F  YG +WR  +K  T ELL+A KI SF   R+ E+   +  I+ A
Sbjct  101   EAAKHISWGQRNLSFGEYGSYWRTMRKMCTLELLSAHKINSFKSTRKEELALLINFIQEA  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A  R  V+L+A+V  L  +++  M+FG    D        K +VQE + L    N  DY+
Sbjct  161   ARDRVTVNLSAKVSSLSADISCLMVFGKKYKDKELDEKGFKAVVQEGMHLAATPNFGDYI  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL P DLQGL KR++ + K  D  F +I+ EH Q      ++  KD VD+ML  M +  
Sbjct  221   PFLAPLDLQGLTKRMKVVHKVFDDFFEKIIDEHLQSTS---EERPKDFVDVMLGFMGSVE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++ ++IKA++ DM+ GS+DT+    EWTL+E++++P+VMK +Q+E+EN VG+ RMV
Sbjct  278   SEYRIERSNIKAIMLDMLSGSMDTTATSTEWTLSELLKHPQVMKKVQKEIENVVGMERMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+ V+KE+ RLHPVA LL+P  ++ED  +NG  IP K
Sbjct  338   EESDLEKLEYLDKVVKETMRLHPVAPLLLPHAAIEDCNVNGFHIPGK  384


 Score =   157 bits (398),  Expect(2) = 5e-118, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P KSR+MIN WAIG +PS+W+D  ++F PERF   ++D RG DF  +PFG GRR C
Sbjct  378   GFHIPGKSRIMINIWAIGRNPSVWTD-ADKFIPERFDGSNIDFRGRDFQFIPFGSGRRGC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LG+  V L+V QL+HCF+WELPN M P ELDMTE FGL  P+  HL+A+P+YRL
Sbjct  437   PGMQLGITMVLLLVAQLVHCFDWELPNNMLPTELDMTEEFGLTVPRANHLLALPTYRL  494



>ref|XP_003531374.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
Length=493

 Score =   295 bits (756),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 228/347 (66%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH+LG  PHR+L++L++KYGP+M+L+LG VP +VVSSP +AEL LKTHD VFASRP+ 
Sbjct  37    GSLHKLGPNPHRDLHKLAQKYGPVMHLRLGFVPTIVVSSPKSAELFLKTHDLVFASRPRF  96

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + I+ G + + FA YG +WR  +K  T ELL+ +KI SF  +R  E+   +K +  A
Sbjct  97    VADQYISWGQRNLGFAEYGSYWRNMRKMCTLELLSQSKINSFRRMREEELDLLIKLVREA  156

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+ +V  LI +++ +M+ G    D        K ++QE + L+   N+ DY+
Sbjct  157   ANDGAAVDLSVKVATLIADMSCRMILGKKYMDQDMCGRGFKAVIQEAMRLLATPNVGDYI  216

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQGL KR + L +  D  F +++ EH +  K   +   KD VD+ML  +    
Sbjct  217   PYIGAIDLQGLTKRFKVLYEIFDDFFEKVIDEHMESEKG--EDKTKDFVDVMLGFLGTEE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++ ++IKA+L DM+ GS+DTS   IEWTL+E+++NPRVMK LQ ELE  VG+ R V
Sbjct  275   SEYRIERSNIKAILLDMLAGSMDTSATAIEWTLSELLKNPRVMKKLQMELETVVGMKRKV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
              E DL  L+YLEMV+KES RLHPV  LL+P +S ED  +   FIPKK
Sbjct  335   GESDLDKLKYLEMVVKESMRLHPVVPLLIPHQSTEDCIVGDFFIPKK  381


 Score =   157 bits (397),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSRV+IN WAI  DPS W +  E+F+PERF   ++D+RG DF L+PFG GRR CPG+ 
Sbjct  379   PKKSRVIINAWAIMRDPSAWVE-AEKFWPERFEGSNIDVRGRDFELIPFGSGRRACPGLQ  437

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGLI V+  V QL+HCF+W+LPN M P +LDMTE FGL  P+  HL A+P+YRL
Sbjct  438   LGLITVRQTVAQLVHCFDWKLPNNMFPDDLDMTEAFGLTMPRANHLHAIPTYRL  491



>gb|KHN29102.1| Cytochrome P450 71A1 [Glycine soja]
Length=493

 Score =   295 bits (756),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 228/347 (66%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH+LG  PHR+L++L++KYGP+M+L+LG VP +VVSSP +AEL LKTHD VFASRP+ 
Sbjct  37    GSLHKLGPNPHRDLHKLAQKYGPVMHLRLGFVPTIVVSSPKSAELFLKTHDLVFASRPRF  96

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + I+ G + + FA YG +WR  +K  T ELL+ +KI SF  +R  E+   +K +  A
Sbjct  97    VADQYISWGQRNLGFAEYGSYWRNMRKMCTLELLSQSKINSFRRMREEELDLLIKLVREA  156

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+ +V  LI +++ +M+ G    D        K ++QE + L+   N+ DY+
Sbjct  157   ANDGAAVDLSVKVATLIADMSCRMILGKKYMDQDMCGRGFKAVIQEAMRLLATPNVGDYI  216

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQGL KR + L +  D  F +++ EH +  K   +   KD VD+ML  +    
Sbjct  217   PYIGAIDLQGLTKRFKVLYEIFDDFFEKVIDEHMESEKG--EDKTKDFVDVMLGFLGTEE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++ ++IKA+L DM+ GS+DTS   IEWTL+E+++NPRVMK LQ ELE  VG+ R V
Sbjct  275   SEYRIERSNIKAILLDMLAGSMDTSATVIEWTLSELLKNPRVMKKLQMELETVVGMKRKV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
              E DL  L+YLEMV+KES RLHPV  LL+P +S ED  +   FIPKK
Sbjct  335   GESDLDKLKYLEMVVKESMRLHPVVPLLIPHQSTEDCIVGDFFIPKK  381


 Score =   157 bits (396),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSRV+IN WAI  DPS W +  E+F+PERF   ++D+RG DF L+PFG GRR CPG+ 
Sbjct  379   PKKSRVIINAWAIMRDPSAWVE-AEKFWPERFEGSNIDVRGRDFELIPFGSGRRACPGLQ  437

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGLI V+  V QL+HCF+W+LPN M P +LDMTE FGL  P+  HL A+P+YRL
Sbjct  438   LGLITVRQTVAQLVHCFDWKLPNNMFPDDLDMTEAFGLTMPRANHLHAIPTYRL  491



>ref|XP_010027781.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54384.1| hypothetical protein EUGRSUZ_I00335 [Eucalyptus grandis]
Length=500

 Score =   296 bits (759),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/347 (47%), Positives = 226/347 (65%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL  LG  PH +L++L++KYGP+MYL+LG V  +VVSSP  AE  LKTHD VFASRP +
Sbjct  42    GNLPLLGQNPHHDLHKLAQKYGPLMYLRLGFVHTIVVSSPELAEQFLKTHDLVFASRPPH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   + +AFAPYGP+WR  +K  T ELL+ AKI SF  +RR E+   V  ++ A
Sbjct  102   EASKHISYEQRSLAFAPYGPYWRNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    A+DLT+++  L  +++ +M+FG        D    K ++QE + L    NI DY+
Sbjct  162   AHDHTAIDLTSKIFSLSADMSCRMVFGKKYMDKEFDERGFKAVIQEGMVLGATPNIGDYV  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P+L  FDLQGL KR++A+ K  D  F +I+ EH +  K   +  +KD VD+ML  M    
Sbjct  222   PYLARFDLQGLTKRMKAVSKVFDAFFEKIIDEHMKSMKE--EGESKDFVDVMLGFMGLNE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
               + +D   IKA++ DM+ GS+DTS   I+W + E++R+P  MK +Q+ELE  VG+NR V
Sbjct  280   GEYHIDRPHIKAIILDMLSGSMDTSATAIDWAMTELVRHPSAMKRVQDELEKAVGMNRAV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  L YL+MVIKE+ RLHPVA LL+P E+ ED  +NG  IP K
Sbjct  340   EESDLEGLHYLDMVIKETMRLHPVAPLLLPHEATEDCTVNGFHIPLK  386


 Score =   155 bits (393),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSD-NVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
             G   P KSRV++N W+IG DP +W+  + EEF PERF+  S+D++G DF LLPFG GRR 
Sbjct  380   GFHIPLKSRVIVNVWSIGRDPKVWTTHDPEEFIPERFLGSSMDVKGRDFQLLPFGAGRRG  439

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+ ++ QL+HCF+W+LP  +SP ELDMTE FGL +P+ +HLV +P YRL
Sbjct  440   CPGMQLGLTIVRFVLAQLVHCFDWDLPAGISPSELDMTEEFGLTAPRAKHLVVMPRYRL  498



>ref|XP_010027875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54512.1| hypothetical protein EUGRSUZ_I00454 [Eucalyptus grandis]
Length=500

 Score =   295 bits (754),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 227/347 (65%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL  LG  P+ +L++L++KYGP+MYL+LG V  +VVSSP  AE  LKTHD VFASRP +
Sbjct  42    GNLPLLGQNPNHDLHKLAQKYGPLMYLRLGFVHTIVVSSPEVAEQFLKTHDLVFASRPPH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   + +AFAPYGP+WR  +K  T ELL+ AKI SF  +RR E+   V  ++ A
Sbjct  102   EASKHISYEQRSLAFAPYGPYWRNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    A+DL++++  L  +++ +M+FG        D    K ++QE + L    NI DY+
Sbjct  162   AHDHTAIDLSSKISSLSADMSCRMVFGKKYMDKEFDERGFKAVIQEFMVLGATPNIGDYV  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P+L  FDLQGL KR++A+ K  D  F +I+ EH +  K   +  +KD VD+ML  M    
Sbjct  222   PYLARFDLQGLTKRMKAVSKVFDAFFEKIIDEHMKSKKE--EGESKDFVDVMLGFMGLNE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
               + +D   IKA++ DM++GS+DTS   I+W + E++R+P  MK +Q+ELE  VG+NR V
Sbjct  280   GEYHIDRPHIKAIILDMLLGSMDTSATAIDWAMTELVRHPSAMKKVQDELEKAVGMNRAV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  L YL+MVIKE+ RLHPVA LL+P E+ ED  +NG  +P K
Sbjct  340   EESDLEGLHYLDMVIKETMRLHPVAPLLLPHEATEDCTVNGFHMPLK  386


 Score =   157 bits (396),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSD-NVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
             G   P KSRV++N W+IG DP +W+  N EEF PERF+  S+D++G DF LLPFG GRR 
Sbjct  380   GFHMPLKSRVIVNVWSIGRDPKVWTTHNPEEFIPERFLGLSMDVKGRDFQLLPFGAGRRG  439

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+ ++ QL+HCF+W+LP  +SP ELDMTE FGL +P+ +HLV +P YRL
Sbjct  440   CPGMQLGLTVVRFVLAQLVHCFDWDLPAGISPSELDMTEEFGLTTPRAKHLVVMPQYRL  498



>ref|XP_007213194.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
 gb|EMJ14393.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
Length=494

 Score =   291 bits (746),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 157/347 (45%), Positives = 233/347 (67%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPHR+L+ L++KYG IM+++LG VP +VVSSP AAEL LKTHD VFA+RP +
Sbjct  38    GSLHLLGDLPHRDLHRLAQKYGDIMHMRLGLVPTIVVSSPQAAELFLKTHDLVFATRPPH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI-EA  566
             +  K+++ G + ++F  YG +WR  +K  T ELL+  KI SF  +R+ E+  +++SI EA
Sbjct  98    EGAKHLSFGQRNLSFVEYGSYWRDIRKMCTLELLSNHKINSFKSMRKEEVALFIESIQEA  157

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADY  734
             A  G  A+DL+  V  L  +++ +M+ G    D        K +++E + L  A N+ DY
Sbjct  158   ANNGHVAIDLSDRVSSLSVDMSCRMVLGKKYRDEELDERGFKSLIKEGMQLAAAPNLGDY  217

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +P +   DLQG  KR++A+ K+ D  F +I+ EH Q      +   KD VD+M+  M + 
Sbjct  218   IPCIAQLDLQGFTKRMKAINKAFDNFFEKIIDEHLQSKD---EYRTKDFVDVMVGIMGSA  274

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++ ++IKA++ DM+V S+DTS   IEW L+E+MR+P VMK +++ELE+ VGL RM
Sbjct  275   ESQYRIERSNIKAIILDMLVASMDTSSTTIEWVLSELMRHPHVMKKVRKELEDVVGLERM  334

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  LEYL++V+KE+ RLHPVA LL+P  ++ED  +NG  IPK
Sbjct  335   VEESDLEKLEYLDIVVKETLRLHPVAPLLIPHAAIEDCTVNGFHIPK  381


 Score =   160 bits (405),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PK SRV+IN W+IG DPS W+D  E+F PERF+  ++D+RG+ F L+PFG GRR 
Sbjct  375   NGFHIPKASRVIINVWSIGRDPSAWTD-AEKFIPERFVGSNIDVRGNHFELIPFGSGRRR  433

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ L L  V+L+V QL+HCF+WELPN M P+ELDM+E FGL  P+ +HL+A+PSYRL
Sbjct  434   CPGIQLRLTMVQLMVAQLVHCFDWELPNSMLPNELDMSEEFGLTVPRAKHLLAIPSYRL  492



>ref|XP_003532846.1| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=500

 Score =   301 bits (772),  Expect(2) = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 231/346 (67%), Gaps = 5/346 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH+LG+ PHR+L+EL++KYGP+MYL+LG VPA++VSSP AAEL LKTHD VFA RP +
Sbjct  39    GNLHKLGSNPHRDLHELAQKYGPVMYLRLGFVPAIIVSSPQAAELFLKTHDLVFAGRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K +A   K +AF  YG +WR  +K  T ELL+  KI SF  +R  E+   +K++  A
Sbjct  99    EAAKYMAWEQKNLAFGEYGSYWRNVRKMCTLELLSQTKINSFRPMREEELDLLIKNLRGA  158

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +     VDL+A+V  L  +++ +M+ G      + D    K ++QE++ L  A NI DY+
Sbjct  159   SNDGAVVDLSAKVATLSADMSCRMILGKKYMDQDLDQKGFKAVMQEVLHLAAAPNIGDYI  218

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQGL +R++ L +  D+ F +I+ EH Q  K  V K  KD VD ML  +    
Sbjct  219   PYIGKLDLQGLIRRMKTLRRIFDEFFDKIIDEHIQSDKGEVNKG-KDFVDAMLDFVGTEE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA+L DM+VGS+DTS   IEWT++E+++NPRVMK LQ ELE  VG+ R V
Sbjct  278   SEYRIERPNIKAILLDMLVGSIDTSATAIEWTISELLKNPRVMKKLQRELETVVGMKRKV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
              E DL  L+YLEMV+KE  RLHPVA LL+P  S ED  +  +FIPK
Sbjct  338   GESDLDKLKYLEMVVKEGLRLHPVAPLLLPHHSREDCMVGEYFIPK  383


 Score =   149 bits (377),  Expect(2) = 4e-117, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SRV++N W I  DPS W D  E+F+PERF   ++D+RG DF  LPFG GRRVCPG+ 
Sbjct  382   PKNSRVIVNAWTIMRDPSAW-DEAEKFWPERFEGSNIDVRGKDFRFLPFGSGRRVCPGLQ  440

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSY  1566
             LGL  V L V QL+HCF+W+LPN M P ELDMTE FGL+ P+  HL+ +P+Y
Sbjct  441   LGLNTVLLTVAQLVHCFDWKLPNNMLPCELDMTEEFGLSMPRANHLLVIPTY  492



>ref|XP_006428066.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
 gb|ESR41306.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
Length=498

 Score =   283 bits (725),  Expect(2) = 6e-117, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 219/347 (63%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG  P R L++L+K YGPIM+L+LG +  +VVSSP AAE  LKTHD +FASRP  
Sbjct  43    GCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPL  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K ++   K  A APYG +WR  +K  TQ LL+ AKI  F   R+ ++   ++  + A
Sbjct  103   QATKYMSYQQKNFAMAPYGSYWRKIRKICTQNLLSNAKINYFQPTRKEDLDLLIEYFKEA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A  R  VD++A++  L  N+T +M+ G   +DN       + +++E   L+G  N+ DY+
Sbjct  163   AHARCVVDISAKLSALSTNMTCRMVLGKKRSDNEFDSGGFETVIREGFELVGKPNLGDYI  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR +A+ K  D    +I+ EH Q      +   +D VD+ML+   +  
Sbjct  223   PQIAGLDLQGLTKRSKAVAKVFDAFMEKIIDEHIQSKD---ENRTEDFVDVMLSFEGSED  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  K+D   IKA++ DM+ G++DTS   +EW L+E++++P VMK LQ ELEN VGL RMV
Sbjct  280   TEKKIDREHIKAVVMDMLAGAIDTSPTVVEWALSELIKHPTVMKKLQRELENIVGLKRMV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL NLEYL+MV++E+ RLHPV  L+ P ES+ED  +NG  IPKK
Sbjct  340   EESDLENLEYLDMVVRETLRLHPVTPLMAPHESMEDCTVNGFHIPKK  386


 Score =   167 bits (422),  Expect(2) = 6e-117, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DP  W+D  E FFPERF+  SVD+ GHDF LLPFG GRR C
Sbjct  380   GFHIPKKSRVIVNAWAIGRDPEAWTDP-ETFFPERFVGSSVDVLGHDFQLLPFGSGRRGC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ L L  VK +  QL+HCF+WELP  M P ELDMTE FGL +P+ +HL+AVPSYRL
Sbjct  439   PGIQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTPRAKHLLAVPSYRL  496



>ref|XP_010663583.1| PREDICTED: cytochrome P450 CYP736A12 isoform X2 [Vitis vinifera]
Length=472

 Score =   275 bits (703),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 152/349 (44%), Positives = 225/349 (64%), Gaps = 38/349 (11%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPHR+L+ L+KKYG IM+++LG VP +VVSSP AA+L LKTHDAVFASR K 
Sbjct  43    GSLHLLGNLPHRSLSRLAKKYGSIMFMRLGSVPTIVVSSPQAAKLFLKTHDAVFASRAKL  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVA-WVKSIEA  566
               V+ +  G+KG+AF+                               GE +  +V+S++ 
Sbjct  103   QGVEYLTYGTKGIAFS------------------------------EGEAIGLFVQSLKE  132

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFL  746
              A     VD++  V  +IE++ Y+M+FG   ++  DLK ++ E  SL G FNIADYLPFL
Sbjct  133   MAAAGNVVDISTRVAEVIEDMAYRMVFGHDKDEMIDLKTLIGEATSLAGTFNIADYLPFL  192

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS-  923
               FDLQGL +R +A  +++D++  +I+ +H +DA++GV   N   +D+ML+ M   +   
Sbjct  193   GSFDLQGLTRRFQAASEAIDEVLEKIIDKHTKDARDGVNHMN--FMDIMLSLMSKSNDFK  250

Query  924   ----HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                 + +D  ++KA++ D++VG +D+S   ++W LAE++R+PRVMK +QEEL+N VG+ R
Sbjct  251   DEPLYAIDRTNVKAIILDILVGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGR  310

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
              VEE DL +L Y+ MV+KE+ RLHPV   L+PRES+E   +N H+IPKK
Sbjct  311   TVEESDLKSLIYMNMVLKEALRLHPVGPFLIPRESVEHSTINEHYIPKK  359


 Score =   175 bits (443),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKK+R++IN WAIG DP+ WS+N EEFFPERF+  ++D+ GHDF L+PFG GRR CPG+ 
Sbjct  357   PKKARILINTWAIGRDPNAWSNNAEEFFPERFIDNNIDLYGHDFELIPFGSGRRRCPGIQ  416

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGLI V+LI+ QL+HCF+WELPN MSP +L+M E FGL  P+  HL+A P+YRL
Sbjct  417   LGLITVQLILAQLVHCFDWELPNDMSPSDLNMREKFGLTMPRANHLIAKPTYRL  470



>ref|XP_007211074.1| hypothetical protein PRUPE_ppa017688mg [Prunus persica]
 gb|EMJ12273.1| hypothetical protein PRUPE_ppa017688mg [Prunus persica]
Length=462

 Score =   311 bits (798),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/372 (46%), Positives = 243/372 (65%), Gaps = 21/372 (6%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFF---RHRRAEESSksgrklppgprplpiiGNLHQLGTLPHR  245
             M++   A+L +FL  LW      RHR+      +   +          GNLH LG LPHR
Sbjct  1     MTASARAILLLFLTFLWSLILRPRHRKLPPGPWALPVI----------GNLHMLGNLPHR  50

Query  246   NLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKG  425
             +L +L+KKYGPIM ++LG    +VVSSP AAEL LK+HD +FASRPK  +   +  GSK 
Sbjct  51    SLRDLAKKYGPIMSMRLGTKTTIVVSSPEAAELFLKSHDTIFASRPKVQSSDYLLYGSKD  110

Query  426   MAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAE  605
             MAF+ YGP+WR  +K  T +LL  +KIE+F  LRR E+ + V+S++ AA   + VDL+ +
Sbjct  111   MAFSEYGPYWRHIRKLCTLQLLCPSKIETFAPLRREEVGSLVESLKKAAAEGQVVDLSEK  170

Query  606   VGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLR  785
             VG L+E++T +M+ G+  +D  D+K I++E+V L+GA NI+D LPFL PFD QGL KR+ 
Sbjct  171   VGELLEDITNRMVLGSKTDDTCDMKGIIEELVLLMGAVNISDCLPFLSPFDFQGLTKRMT  230

Query  786   ALGKSVDKLFLEIVKEHEQDAKNGVQKS---NKDIVDMMLASMKNP-----SSSHKLDLA  941
              L K +D+L  +I+ EH++ +K+G       +KD VD+ML+ M  P        + +D  
Sbjct  231   RLSKRIDQLLEKIIGEHQEVSKSGQAHQGHRHKDFVDVMLSLMHQPLNPNDEQVYMIDRT  290

Query  942   SIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNL  1121
             ++KA++ DMI G+ DTS   I WTLAE++R+PRVMK LQ+EL++ +G ++MVEE D   L
Sbjct  291   NVKAIILDMISGAFDTSTTAIVWTLAELLRHPRVMKHLQQELQSVIGTDQMVEESDFSKL  350

Query  1122  EYLEMVIKESFR  1157
              YL MV+KESFR
Sbjct  351   GYLNMVLKESFR  362


 Score =   138 bits (347),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  1273  HDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNLGLINVKLIVGQLM  1452
              DP++WS+NVEEF+PERF+  +VD+RG+DF LLPFG GRR CP + LGL  V+L++  L+
Sbjct  362   RDPNVWSENVEEFYPERFIDGNVDLRGYDFQLLPFGSGRRGCPAMQLGLTTVRLVLANLV  421

Query  1453  HCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             H FNW+LP+ + P ++DMTETFGL+  K +HL+ +P YRL
Sbjct  422   HFFNWDLPSGLKPEDVDMTETFGLSLTKTEHLLVMPIYRL  461



>ref|XP_007159747.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
 gb|ESW31741.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
Length=497

 Score =   300 bits (769),  Expect(2) = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 230/347 (66%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH+LG  PHRNL++L+ KYGP+M+L+LG +P VVVSSP AAEL LKTHD VFASRP+ 
Sbjct  37    GSLHKLGANPHRNLHQLALKYGPVMFLRLGFMPTVVVSSPQAAELFLKTHDLVFASRPRY  96

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K ++ G + +AFA YG +WR  +K  T ELL+  KI SF  +R  E+   +K +  A
Sbjct  97    QAEKYVSWGQRNLAFAEYGSYWRNMRKLCTLELLSQTKINSFRSMREEELDLLIKLLREA  156

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A     VDL+A++  L  +++ +M+ G      + D    K ++QE + L+   N+ DY+
Sbjct  157   ANAGATVDLSAKLSTLSADMSCRMVLGKKYMDQDLDEKGFKAVMQEAMRLLATPNMGDYI  216

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQG+ KRL+A  K  D  F +I+ EH +  K   +   KD VD+ML       
Sbjct  217   PYIAALDLQGITKRLKANHKIFDHFFDKIIDEHMESDKG--EDKTKDFVDVMLGFYGTQE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++ ++IKA+L DM+ GS+DTS   IEWTL+E+++NPRVMK LQ ELE+ VG+ + V
Sbjct  275   SEYRIERSNIKAILTDMLAGSMDTSATAIEWTLSELLKNPRVMKKLQMELESVVGMEKKV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MVIKES RLHPVA LL+P +S ED  +   FIPKK
Sbjct  335   EESDLEKLEYLDMVIKESLRLHPVAPLLIPHQSTEDCMVGDFFIPKK  381


 Score =   148 bits (373),  Expect(2) = 3e-116, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSR+++N WAI  DP  W +  E+F+PERF   ++D+RG +F L+PFG GRR CPG+ 
Sbjct  379   PKKSRLIVNAWAIMRDPDAWIE-AEKFWPERFEGSNIDVRGREFELIPFGSGRRGCPGIQ  437

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  ++  V QL+HCF+W+LPN M P ELDM + FGL  P+  HL+A+P+YRL
Sbjct  438   LGLTVIRHTVAQLVHCFDWKLPNDMMPDELDMADEFGLTMPRANHLLAIPTYRL  491



>ref|XP_006346716.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   293 bits (751),  Expect(2) = 5e-116, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 223/346 (64%), Gaps = 6/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH +G   H++L++++KKYGPIM +K G +P +V SSP  AE  LK HD VFASRP N
Sbjct  43    GNLHMIGKNIHQDLHKIAKKYGPIMSMKFGVIPIIVASSPHVAEQFLKKHDLVFASRPNN  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A++ +A   + + F  YGP+WR  +K  T ELL+  KI SF D+R+ ++  +V  I  A
Sbjct  103   RAMQIVAYNQRNLTFGKYGPYWRNMRKLCTLELLSPLKINSFQDMRKQQVTNFVTFINRA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A     VD++A +  L  N++  M+FG    D+       K ++QE + + G  NI ++ 
Sbjct  163   ASSHVEVDISANLALLSANMSCLMIFGKEYMDDEFDERGFKDVIQEALIIAGTPNIGEFF  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL  FDLQGL  R++ L K  D+    ++ EH Q++K   +K  KDIVD M+  M++  
Sbjct  223   PFLDKFDLQGLIPRMKKLAKVFDEFLERVIDEHVQNSKE--EKQTKDIVDTMMNIMQSGE  280

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L D+++ S+DTS   I+W  +E++R+P +MK LQ+ELE  VG+NRMV
Sbjct  281   AEFEFDRRHVKAILLDLLIASIDTSATSIDWIFSELLRHPNIMKKLQKELEQVVGMNRMV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL  LEYL M+IKE FRLHP+A LL+PRES+ED  ++G  IP+
Sbjct  341   EESDLGKLEYLNMIIKEGFRLHPIAPLLIPRESMEDCIIDGFNIPR  386


 Score =   154 bits (389),  Expect(2) = 5e-116, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G + P+ SR+++N WAIG D  +W +  E+F PERF+   +D+RGHDF LLPF  GRR C
Sbjct  381   GFNIPRGSRILVNTWAIGRDSEVWPEP-EKFMPERFVGSDIDLRGHDFQLLPFSSGRRRC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+W+LPN M P++LDMTE F L   + QHL+A+P+YRL
Sbjct  440   PGLQLGLTVVRLVIAQLVHCFDWKLPNDMMPNDLDMTEKFSLVVSRAQHLMAIPTYRL  497



>ref|XP_006428070.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
 ref|XP_006493870.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41310.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
Length=498

 Score =   283 bits (723),  Expect(2) = 5e-116, Method: Compositional matrix adjust.
 Identities = 157/347 (45%), Positives = 221/347 (64%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG  P R L++L+K YGPIM+L+LG +  +VVSSP AAE  LKTHD +FASRP  
Sbjct  43    GCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPL  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K ++   K  A APYG +WR  +K  TQ LL+ AKI  F  +R+ E+   ++  + A
Sbjct  103   QASKYMSYQQKNFAMAPYGSYWRKVRKICTQNLLSNAKINYFQPIRKEELDLLIEYFKEA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
                R  VD++A++  L  N+T +M+ G   +D+       + +VQE + L+G  N+ DY+
Sbjct  163   VRARCVVDISAKLSALSANMTCRMVLGKKCSDDEFDERGFENVVQEGMELVGKPNLGDYI  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR +A+ K+ D    +I+ EH Q      +   +D VD+ML+   +  
Sbjct  223   PQITGLDLQGLTKRSKAVAKAYDAFLEKIIDEHVQSKD---ENRTEDFVDVMLSFEGSED  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  K++   IKA+L DM+ G++DTS   +EW L+E++++P VMK LQ ELEN VGL RMV
Sbjct  280   TEKKIEREHIKAILLDMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV+KE+ RLHPVA L+ P ES+ED  +NG  IPKK
Sbjct  340   EESDLEILEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKK  386


 Score =   164 bits (416),  Expect(2) = 5e-116, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DP  W+D  E+FFPERF+  SVD+RG DF LLPFG GRR C
Sbjct  380   GFHIPKKSRVIVNAWAIGRDPKAWNDP-EKFFPERFIGSSVDVRGRDFQLLPFGSGRRAC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ L L  VK +  QL+HCF+WELP  M P ELDMTE FGL + + +HL+AVPSYRL
Sbjct  439   PGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRL  496



>ref|XP_011100886.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=520

 Score =   291 bits (744),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/347 (47%), Positives = 237/347 (68%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH+NL  L++K+GPIM L+LG VP VVVSSPA AEL+LKTHD VFA+RP+N
Sbjct  63    GHLHLLGKNPHQNLYHLAQKHGPIMGLRLGFVPTVVVSSPAGAELVLKTHDLVFANRPRN  122

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K I    K +AF  YGP+WR  +K  T ELL+  +I  FG +R+ E+   V S++ A
Sbjct  123   EASKYIMYEQKDLAFGQYGPYWRNMRKLCTLELLSNRRINEFGAMRKVELELLVSSLKRA  182

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND---NHD--LKLIVQEIVSLIGAFNIADY  734
             A  RE VDL+A V  LI +VT  M+F     D   +H+   K ++ E +   G FN+ADY
Sbjct  183   AEMREIVDLSARVSGLIGDVTCLMVFRRKYADKDLDHEKGFKTLIMEALEFAGKFNLADY  242

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              P++  FDLQG+N+++++L K+ D+   +++ +H ++ +   +K  KD VD M+  M++ 
Sbjct  243   FPYVGFFDLQGMNRKMKSLSKTFDRFLEKLIDDHVKNKQK--KKQTKDFVDTMMEIMESG  300

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
             ++  + D   +KA+L D+++  +DTS + IEW LAE++R+PRVMK LQ+ELE  VG+++M
Sbjct  301   NAEFQFDRRHVKAVLLDILIAGIDTSTSAIEWALAELIRHPRVMKKLQKELETVVGMDQM  360

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE  L  LEYL+ V+KE+ RLHPV  LL+P ES+ED  ++G+ IPK
Sbjct  361   VEESHLHGLEYLDFVVKETLRLHPVGPLLIPHESMEDCVIDGYHIPK  407


 Score =   156 bits (395),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR ++N WAIG DP++W D  E F PERF+  ++D+RG DF LLPFG GRR C
Sbjct  402   GYHIPKGSRAIVNVWAIGRDPNVWPDP-EVFKPERFIGSNIDLRGRDFQLLPFGSGRRSC  460

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             PG+ LGL  V+L++ QL+HCF+W+LPN M P +LDM+E FGL   + +HLVA+PSYRLL
Sbjct  461   PGLQLGLTMVQLVLSQLVHCFDWQLPNGMQPSDLDMSEHFGLTVARAKHLVAIPSYRLL  519



>gb|ACM89789.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89832.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   298 bits (762),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/347 (47%), Positives = 230/347 (66%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GN+H LG+LPHR L  LSKKYGPIMY++LG VPA+VVSSP AAE  LKTHD VFA+RP +
Sbjct  39    GNMHMLGSLPHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  +++    KG++F+ YGP+WR  +K    ELL++ KI SF  +RR E+   +KS E A
Sbjct  99    ECSRHMLHDGKGISFSGYGPYWRSMRKLCILELLSSHKINSFKPMRREEVGLLIKSFEEA  158

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVD++A+V  L  +++ +M+FG      + D    K +++E++ L    NI DY+
Sbjct  159   ARAGAAVDVSAKVALLSADMSCRMVFGKKYMDKDLDERGFKAVIKEVMQLAATPNIGDYI  218

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P L   DLQGL +R++A  K  D  F +I+ EH    K   Q   KD+VD+ML  M +  
Sbjct  219   PCLLGLDLQGLTRRIKATAKVFDDFFEKIIDEHIHKPKEEGQ--TKDLVDVMLDLMGSEE  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + + +  A+IKA+  DM+  S+DTS   IEW L+E++++P +MK ++ ELE  VG+ RMV
Sbjct  277   TEYNIQRANIKAISLDMMAASMDTSATTIEWALSELIKHPPMMKKVRNELEKVVGMERMV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL +LEYL MV+KE+ RLHPV  LL+P ES+ED  ++G  IP+K
Sbjct  337   EESDLESLEYLNMVVKETLRLHPVVPLLIPHESIEDCTVDGFHIPQK  383


 Score =   149 bits (376),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSRV++N WAIG DP+ W+D  ++F PERFM   +D RG  F  +PFG GRR C
Sbjct  377   GFHIPQKSRVIVNVWAIGRDPNAWTD-ADKFLPERFMESDIDFRGQHFQFIPFGSGRRGC  435

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYR  1569
             PG+ LGL  V+L++ QL+HCF+WELP+ M   ELDM E FGL  P+ +HLVA+P+ R
Sbjct  436   PGMQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNEEFGLTLPRAKHLVAIPTCR  492



>ref|XP_006493867.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Citrus sinensis]
 ref|XP_006493868.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Citrus sinensis]
Length=498

 Score =   280 bits (715),  Expect(2) = 9e-116, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 218/347 (63%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG  P R L++L+K YGPIM+L+LG +  +VVSSP AAE  LKTHD +FASRP  
Sbjct  43    GCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPL  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K ++   K  A APYG +WR  +K  TQ LL+ AKI  F   R+ ++   ++  + A
Sbjct  103   QATKYMSYQQKNFAMAPYGSYWRKIRKICTQNLLSNAKINYFQPTRKEDLDLLIEYFKEA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A  R  VD++A++  L  N+T +M+ G   +DN       + +++E   L+G  N+ DY+
Sbjct  163   AHARCVVDISAKLSALSTNMTCRMVLGKKRSDNEFDSGGFETVIREGFELVGKPNLGDYI  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL KR +A+ K  D    +I+ EH Q      +   +D VD+ML+   +  
Sbjct  223   PQIAGLDLQGLTKRSKAVAKVFDAFMEKIIDEHIQSKD---ENRTEDFVDVMLSFEGSED  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  K+D   IKA++ DM+ G++DTS   +EW L+E++++P VMK LQ ELEN VGL RMV
Sbjct  280   TEKKIDREHIKAVVMDMLAGAIDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MV++E+ RLHPV  L+ P ES+ED  +NG  IPKK
Sbjct  340   EESDLEILEYLDMVVRETLRLHPVTPLMAPHESMEDCTVNGFHIPKK  386


 Score =   167 bits (422),  Expect(2) = 9e-116, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DP  W+D  E FFPERF+  SVD+ GHDF LLPFG GRR C
Sbjct  380   GFHIPKKSRVIVNAWAIGRDPEAWTDP-ETFFPERFVGSSVDVLGHDFQLLPFGSGRRGC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ L L  VK +  QL+HCF+WELP  M P ELDMTE FGL +P+ +HL+AVPSYRL
Sbjct  439   PGIQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTPRAKHLLAVPSYRL  496



>emb|CDP18035.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   282 bits (722),  Expect(2) = 9e-116, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 226/346 (65%), Gaps = 6/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH + ++LSK++GPIM+L+ G V  ++VSSP AAE  LKT+D VFASRP +
Sbjct  42    GHLHLLGKNPHHDFHKLSKQHGPIMHLRFGFVSNIIVSSPHAAEQFLKTYDLVFASRPPH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K I+ G + ++F  YGP+WR  +K  T  LL+  KI SF  +R  E+   ++S++ A
Sbjct  102   EAAKYISFGQRNLSFGQYGPYWRNMRKLCTLNLLSNLKINSFQSMRMQELELLLESLKQA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A   + VD++AEV  L  N++  M+ G    D        K +++E + L    N+ DY 
Sbjct  162   ARNCDVVDISAEVAALNANMSCLMVLGKKYADKEFDERGFKAVIKEGMQLSATPNLGDYY  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P+L   D+QGL +R++A+GK  D+ F +I+ EHEQ A     +   D V  MLA MK+  
Sbjct  222   PYLGVLDIQGLTRRMKAIGKVFDEFFEKIIDEHEQYANQ--TRHVDDFVYTMLALMKSGE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA+L DM+ GS+DTS   +EW +AE+++N RVMK +Q+EL+ KVGL+RMV
Sbjct  280   TEFQFDRRHIKAVLLDMLAGSMDTSATVVEWIMAELLKNSRVMKKVQQELDEKVGLDRMV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL YL+MV+KE+ RLHPVA LL+P  ++ED  ++G  IPK
Sbjct  340   EESDLDNLRYLDMVVKEALRLHPVAPLLIPHAAIEDCTVDGFHIPK  385


 Score =   164 bits (416),  Expect(2) = 9e-116, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SRV+IN WAIG DP+ WSD  + F PERF   S+DIRGHDF LLPFG GRR C
Sbjct  380   GFHIPKDSRVIINVWAIGRDPNAWSDP-DMFIPERFSGNSIDIRGHDFQLLPFGSGRRGC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+HCF WELPN M P ELDMTE FGL   + +HL+AVP+YRL
Sbjct  439   PGIQLGLTVVRLLVAQLVHCFTWELPNGMLPSELDMTEEFGLVVTRAKHLMAVPTYRL  496



>gb|ACM89788.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89833.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   297 bits (760),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/347 (46%), Positives = 230/347 (66%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GN+H LG+LPHR L  LSKKYGPIMY++LG VPA+VVSSP AAE  LKTHD VFA+RP +
Sbjct  39    GNMHMLGSLPHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  +++    KG++F+ YGP+WR  +K    ELL++ KI SF  +RR E+   +KS E A
Sbjct  99    ECSRHMLYDGKGISFSGYGPYWRSMRKLCILELLSSHKINSFKPMRREEVGLLIKSFEEA  158

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVD++A+V  L  +++ +M+FG      + D    K +++E++ L    NI DY+
Sbjct  159   ARAGAAVDVSAKVALLSADMSCRMVFGKKYMDKDLDERGFKAVIKEVMQLAATPNIGDYI  218

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P L   DLQGL +R++A  K  D  F +I+ EH    K   +   KD+VD+ML  M +  
Sbjct  219   PCLLGLDLQGLTRRIKATAKVFDDFFEKIIDEHIHKPKE--EGQTKDLVDVMLDLMGSEE  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + + +  A+IKA+  DM+  S+DTS   IEW L+E++++P +MK ++ ELE  VG+ RMV
Sbjct  277   TEYNIQRANIKAISLDMMAASMDTSATTIEWALSELIKHPPMMKKVRNELEKVVGMERMV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL +LEYL MV+KE+ RLHPV  LL+P ES+ED  ++G  IP+K
Sbjct  337   EESDLESLEYLNMVVKETLRLHPVVPLLIPHESIEDCTVDGFHIPQK  383


 Score =   149 bits (376),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSRV++N WAIG DP+ W+D  ++F PERFM   +D RG  F  +PFG GRR C
Sbjct  377   GFHIPQKSRVIVNVWAIGRDPNAWTD-ADKFLPERFMESDIDFRGQHFQFIPFGSGRRGC  435

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYR  1569
             PG+ LGL  V+L++ QL+HCF+WELP+ M   ELDM E FGL  P+ +HLVA+P+ R
Sbjct  436   PGMQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNEEFGLTLPRAKHLVAIPTCR  492



>gb|AFK79031.1| cytochrome P450 CYP736A54 [Bupleurum chinense]
Length=497

 Score =   288 bits (737),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/346 (46%), Positives = 224/346 (65%), Gaps = 7/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L +L++K+GPIM ++ G VP ++VSSP AA+  LKTHD  FA RP  
Sbjct  41    GHLHMLGKNPHQDLQKLAEKHGPIMSMRFGFVPNIIVSSPEAAKQFLKTHDLNFAGRPSL  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K I+   + ++F+ YGP+WR  +K  T ELL+  KI SF  +R+ E+   V  IE A
Sbjct  101   EAAKYISYEQRNLSFSTYGPYWRNMRKLCTLELLSNLKINSFQAMRKKEIANVVDIIEQA  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVD++  +  +  +++ +M+FG    D        K ++Q  + +  AFN+ DY 
Sbjct  161   AQERVAVDISQRISSMNSDISCQMVFGKKFEDKEFDERGFKGVIQVGMQMAVAFNLGDYF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P+L   DLQGLNKR++A+ K  D+   +I+ +H+Q  + G     KD VD ML  MK+  
Sbjct  221   PYLGALDLQGLNKRMKAIAKVWDQFLEKILDDHDQSKEPG---QTKDFVDTMLDIMKSGE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S  + D + +KA L DM   S DTS   IEWTL+E++R+PRVM  +Q+ELE  VG+NRMV
Sbjct  278   SEFEFDRSHVKATLMDMFAASADTSSTTIEWTLSELLRHPRVMNKVQKELEQVVGMNRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL +LEYL MVIKE+ RLHPVA LL+P  ++ED  ++G FIPK
Sbjct  338   EESDLESLEYLGMVIKETMRLHPVAPLLLPHLAIEDCTVDGFFIPK  383


 Score =   157 bits (397),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SRV++N WAIG D ++WSD  E+F PERF+  ++D+RG DF LLPFG GRR C
Sbjct  378   GFFIPKNSRVVVNVWAIGRDSNVWSD-AEKFLPERFIGSNIDLRGRDFELLPFGSGRRGC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+HCF+W+LPN M P ELDMTE FGL   + +HL+A+P+ RL
Sbjct  437   PGMQLGLTVVRLVVAQLLHCFDWDLPNGMQPSELDMTEEFGLLVGRAKHLMAIPTCRL  494



>ref|XP_008440668.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   285 bits (730),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 228/347 (66%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG LPHRNL++LS+KYGPIM +KLG VP ++VSSP AA+L LKTHD +FASRP +
Sbjct  44    GCLHLLGKLPHRNLHKLSQKYGPIMSMKLGLVPTIIVSSPQAAKLFLKTHDLIFASRPSS  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K+I+   + + FAPYGP+WR  +K  T ELL+  KI SF  +R+ E+   ++  + A
Sbjct  104   QASKHISYQQQNLVFAPYGPYWRNMRKMCTLELLSNHKINSFMPIRKHELGLLIEYFKEA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  +  V+L+A+V  L  ++   M FG      + D    K ++QE + L  A N+ D++
Sbjct  164   AHNKTVVNLSAKVTSLTTDIICLMAFGKKYGDEDFDERGFKAVIQEGMQLAAAPNLGDFI  223

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQG  ++++++ K  D+   +I+ EH   A+ G  K  +D VD+ML  + +  
Sbjct  224   PAIAWLDLQGFTRKMKSVHKVYDEFLEKIINEHLV-ARGG--KKTRDFVDVMLDLIDSQQ  280

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++D ++IKA++ DM+  ++DTS   I W ++E++R P VMK +Q EL+  VGL+RMV
Sbjct  281   TEYQIDRSTIKAIMLDMLAAAMDTSSTTIGWAMSELIRQPDVMKKMQSELQKVVGLDRMV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL +LEYLEMV+KE  RL+P   LL+P ESLED  +NG  IPKK
Sbjct  341   EESDLVSLEYLEMVVKEIMRLYPAGPLLIPHESLEDCTVNGFHIPKK  387


 Score =   160 bits (404),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N WAIG DPS+W+D   +FFPERF+   +D++G DF L+PFG GRR C
Sbjct  381   GFHIPKKSRLIVNAWAIGRDPSVWNDP-HKFFPERFIGSQIDLKGKDFELIPFGAGRRGC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN M P ELDMTE FGL  P+ Q L+ +P++RL
Sbjct  440   PGMQLGLTMVRLLLAQLVHCFDWELPNGMLPSELDMTEEFGLTCPRAQDLMVIPTFRL  497



>ref|XP_003524281.2| PREDICTED: cytochrome P450 71A1-like isoform X1 [Glycine max]
 ref|XP_006580303.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Glycine max]
 ref|XP_006580304.1| PREDICTED: cytochrome P450 71A1-like isoform X3 [Glycine max]
Length=497

 Score =   293 bits (751),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/347 (47%), Positives = 228/347 (66%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH+LG  PHR+L++L++KYGP+M+L+LG VP +VVSSP AAEL LKTHD VFASRP  
Sbjct  38    GSLHKLGPNPHRDLHQLAQKYGPVMHLRLGFVPTIVVSSPQAAELFLKTHDLVFASRPPL  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K I+   + ++FA YG +WR  +K  T ELL+  KI SF  +R  E+   VK +  A
Sbjct  98    EAAKYISWEQRNLSFAEYGSYWRNVRKMCTLELLSHTKINSFRSMREEELDLMVKLLREA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A     VDL+A+V  L  +++ +M+ G      + D    K ++QE + L    N+ DY+
Sbjct  158   AKDGAVVDLSAKVSTLSADMSCRMVLGKKYMDRDLDEKGFKAVMQEGMHLAATPNMGDYI  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQGL KR++ +GK  D  F +I+ EH Q  K   +   KD VD+ML  +    
Sbjct  218   PYIAALDLQGLTKRMKVVGKIFDDFFEKIIDEHLQSEKG--EDRTKDFVDVMLDFVGTEE  275

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA+L DM+ GS+DTS   IEWTL+E+++NPRVMK +Q ELE  VG+ R V
Sbjct  276   SEYRIERPNIKAILLDMLAGSMDTSATAIEWTLSELLKNPRVMKKVQMELETVVGMKRKV  335

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  L YL+MV+KES RLHPVA LL+P +S ED  +   FIPKK
Sbjct  336   EESDLDKLVYLDMVVKESMRLHPVAPLLIPHQSTEDCMVGDLFIPKK  382


 Score =   151 bits (382),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSRV++N WAI  DPS W D  E+F+PERF   S+D+RG DF L+PFG GRR CPG+ 
Sbjct  380   PKKSRVIVNAWAIMRDPSAW-DEAEKFWPERFEGSSIDVRGRDFELIPFGSGRRGCPGLQ  438

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  V+L V Q++HCF+W+LP  + P +LDM E FGL  P+  HL A+P+YRL
Sbjct  439   LGLTVVRLTVAQIVHCFDWKLPKDILPDDLDMKEEFGLTMPRANHLHAIPTYRL  492



>ref|XP_010099909.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB80838.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=498

 Score =   277 bits (708),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 232/351 (66%), Gaps = 15/351 (4%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G++H LG   H +L++L+KKYGPIM+++LG +P ++VSSP AAEL LKTHD VFASRP  
Sbjct  43    GSMHLLGKFLHHDLHKLAKKYGPIMHMRLGLIPTIIVSSPEAAELFLKTHDLVFASRPHI  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K +    + + FAPYG +WR  +K  T ELL + KI SF  +R+ E+   + +I+ A
Sbjct  103   EAAKYMFWEYRDLVFAPYGSYWRYMRKMCTLELLNSVKISSFKAIRKEEIGQLIDTIQKA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R +VDL+A+V  L  +++ +M+FG        D    K+++QE + L    N+ D++
Sbjct  163   ARERVSVDLSAKVTTLNADMSCRMVFGKKYLDKEFDERGFKVVIQEAMHLAAIPNLGDFI  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEH----EQDAKNGVQKSNKDIVDMMLASM  905
             PF+ P DLQG  KR++ + K  D  F +I+++H    ++D+K       KD VD+ML+ M
Sbjct  223   PFIAPLDLQGYTKRMKVVAKVFDDFFEKIIEDHILSKDEDSK------TKDFVDVMLSLM  276

Query  906   KNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
             ++  S ++++  +IKA++ DM+V S+DTS + IEW ++E+++ PRV+  +Q+ELE  VG+
Sbjct  277   ESADSEYRIERPNIKAVMLDMLVASMDTSASAIEWAISELIKQPRVLMKVQKELETVVGM  336

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
              RMVEE DL  LEYL+MV+KE+ RLHPV  L     ++E+  +NG  IPKK
Sbjct  337   ERMVEETDLEMLEYLDMVVKETLRLHPVVPLF-HHAAMEECTINGFHIPKK  386


 Score =   167 bits (423),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DP+ W+D  E+F PERF+  S+D++G DF L+PFG GRR C
Sbjct  380   GFHIPKKSRVIVNAWAIGRDPNAWNDP-EKFIPERFLGSSIDLKGRDFQLIPFGAGRRHC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGLI VKL+V QL+HCF+WELPN + P ELDMTE FGL +P+  HL+A+P+YRL
Sbjct  439   PGLQLGLIVVKLVVAQLVHCFDWELPNGVIPTELDMTEEFGLTTPRANHLLAIPTYRL  496



>ref|XP_010537441.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=509

 Score =   301 bits (771),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 190/396 (48%), Positives = 268/396 (68%), Gaps = 8/396 (2%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             MSS+ L L+ + LA   + FR    +ESS+   KLPPGPR +PIIG+LH LG LPH+ L 
Sbjct  1     MSSLALVLILLVLACFSFLFRAFSRQESSEKFGKLPPGPRGIPIIGHLHMLGKLPHQTLA  60

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
              LSKKYGPIM ++LG V  +VVSSP AAEL LKTHD VFASR K+ A + ++ G+K +  
Sbjct  61    RLSKKYGPIMSIRLGSVQTIVVSSPRAAELFLKTHDNVFASRAKDQAAEIMSYGTKAIIL  120

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
              PY P+WR  +K     LL+ +K+E F  +   E+   +  ++ AA  +E V+++  +  
Sbjct  121   QPYSPYWRDVRKLCVVHLLSTSKMEQFKPIIPEEIGLMMSHLKNAAEKKEVVNVSEILAE  180

Query  615   LIENVTYKMLFGTSNNDNHDLKLI--VQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRA  788
             L EN+ Y+M+ G S N++  +KL   V+E++SL GAFNI+DYLPFL PFDLQGL +R++ 
Sbjct  181   LFENIVYRMILGYSKNNDGGMKLKEHVEEMMSLAGAFNISDYLPFLAPFDLQGLARRMKE  240

Query  789   LGKSVDKLFLEIVKEHEQDAKNGVQKSN-KDIVDMMLASMK---NP--SSSHKLDLASIK  950
             L KS+D +  +I++EHE   +    K + KD VD++L+ M    NP   +S  +    +K
Sbjct  241   LSKSMDIILEKIIEEHEHQNEEHKSKDHHKDFVDVLLSLMNQSMNPLDKNSDIIGRIHVK  300

Query  951   ALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYL  1130
             A+L D++V +V+TS   IEWT +EI++N RVMK LQEELE  +G++R V+E DLP LEYL
Sbjct  301   AILVDLVVAAVETSAIVIEWTFSEILKNSRVMKKLQEELETIIGMDRKVQESDLPELEYL  360

Query  1131  EMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +MV KE FRLHPV   LVP ES+ED+ ++G +IP+K
Sbjct  361   DMVTKEGFRLHPVGPFLVPHESMEDVVVDGFYIPRK  396


 Score =   143 bits (360),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSRV++N W+IG DP +W  N EEF+PERF +  +DIRG DF L+PFG GRR C
Sbjct  390   GFYIPRKSRVLVNVWSIGRDPDVWPKNTEEFYPERFENDDIDIRGLDFRLIPFGSGRRRC  449

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ +GL  VKL++  L+HCF+W++P+ M   ++DM E FGL+  +  +++A P YRL
Sbjct  450   PGMQIGLPIVKLVLAYLVHCFDWKMPDGMLFEKIDMDEKFGLSVGRANNVIARPIYRL  507



>ref|XP_010027782.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54386.1| hypothetical protein EUGRSUZ_I00339 [Eucalyptus grandis]
Length=498

 Score =   286 bits (732),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 221/345 (64%), Gaps = 4/345 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL  LG  PH +L++L++KYGP+M+L+LG V  +VVSSP  AE  LKTHD VFA RP +
Sbjct  42    GNLPLLGQNPHHDLHKLAQKYGPLMHLRLGFVHTIVVSSPEVAEQFLKTHDIVFAGRPPH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   + +AF+ YGP+WR  +K  T ELL+ AKI SF  +RR E+   V  ++ A
Sbjct  102   EASKHISYEQRSLAFSSYGPYWRNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH--DLKLIVQEIVSLIGAFNIADYLPF  743
             A    A+DL+A++  L  +++ +M+FG    D    +   ++QE V L    NI DY+P+
Sbjct  162   AHDHTAIDLSAKISSLSADMSCRMIFGKKYMDKEFDEFMAVMQEGVVLGATPNIGDYVPY  221

Query  744   LKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS  923
             L  FDLQGL KR++A+ K  D  F +I+ EH +  K   +  +KD VD+ML  M      
Sbjct  222   LARFDLQGLTKRMKAVSKVFDAFFEKIIDEHMKAKKE--EGESKDFVDVMLGIMGLNEGE  279

Query  924   HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEE  1103
             + +D + IKA++ DM+  S+DTS   I+W + E+ R+P VMK LQ+ELE  VG+NR VEE
Sbjct  280   YHIDRSHIKAIILDMLSASMDTSATTIDWAITELTRHPSVMKKLQDELEKAVGMNRAVEE  339

Query  1104  KDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
              DL  L YL MVIKE  RLHP +  L+PRE+ ED  +NG  IP K
Sbjct  340   SDLEGLHYLNMVIKEIMRLHPASPFLLPREATEDCTVNGFHIPSK  384


 Score =   157 bits (398),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSD-NVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
             G   P KS V++N W+IG DP +W+  N EEF PERF+  SVD+ GHDF LLPFG GRR 
Sbjct  378   GFHIPSKSTVIVNVWSIGRDPKVWTTHNPEEFIPERFLGLSVDVMGHDFQLLPFGAGRRG  437

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+ ++ QL+HCF+W+LP  +SP ELDMTE FGL +P+  HLV  P YRL
Sbjct  438   CPGIQLGLTVVRFVLAQLVHCFDWDLPGGISPSELDMTEEFGLTAPRANHLVVTPRYRL  496



>gb|EYU24035.1| hypothetical protein MIMGU_mgv1a020942mg [Erythranthe guttata]
Length=499

 Score =   292 bits (748),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/348 (48%), Positives = 228/348 (66%), Gaps = 7/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L+ L++K+GPIM  +LG VPAVVVSSPAAAELILKTHDAVFASRPK 
Sbjct  42    GHLHLLGKNPHQDLHRLARKHGPIMGFRLGFVPAVVVSSPAAAELILKTHDAVFASRPKI  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              AV +++   + + FA +GP+WR  ++  T ELL AA+I  F   RR E+   V S+++A
Sbjct  102   IAVDSVSYEQRNLVFAAHGPYWRNMRRLCTSELLNAARIAQFQAARRAEVRLLVTSLKSA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A   E VDL+A V  L  ++   M+FG   +D+       K +  E   +   FN+ADY 
Sbjct  162   AELGEIVDLSARVTGLSADMNCVMVFGRKYDDSDLGEMGFKSVFMETAEISAKFNLADYF  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+   DLQGLN R++ LGK  D    +I+ +H Q+     +K  KD VD M+A M +  
Sbjct  222   PFIGALDLQGLNSRIKELGKVFDGFLEKIIDDHLQEKPE--KKETKDFVDTMMAVMNSGE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L DM++   DTS   +EW ++E++R+P +MK LQ+ELE+ VGLN MV
Sbjct  280   AGFEFDRRHVKAVLQDMLIAGTDTSSTSVEWAISELIRHPSIMKKLQKELESTVGLNHMV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHF-IPKK  1238
             EE  L  LEYL+ V+KE+ RLHP A LL+PRES+ED  +NG F IPKK
Sbjct  340   EESHLEKLEYLDFVVKETLRLHPPAPLLIPRESMEDCTINGIFHIPKK  387


 Score =   151 bits (381),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSR ++N WAIG DPS W+ N E F+PERF    VD RG DF L+PFG GRR CPG  
Sbjct  385   PKKSRAIVNVWAIGRDPSAWA-NPETFWPERFAGSDVDSRGRDFQLIPFGSGRRSCPGQQ  443

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             LGL  VKL++ QL+HCF+WELPN M P +LDM+E FG+   + +HL+ +P YRL+
Sbjct  444   LGLTVVKLMLAQLVHCFDWELPNGMLPSDLDMSEHFGVVMSRAEHLMLIPKYRLI  498



>ref|XP_004504031.1| PREDICTED: cytochrome P450 750A1-like [Cicer arietinum]
Length=502

 Score =   296 bits (757),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 229/348 (66%), Gaps = 7/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L +LG  PH +L++LSKKYGPIM+L+LG VP +VVSSP AAEL LKTHD VFASRP  
Sbjct  42    GSLLKLGANPHIDLHKLSKKYGPIMHLRLGLVPTIVVSSPQAAELFLKTHDLVFASRPPT  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI-EA  566
             +A K+I+   + M+F  YG +WR  +K  T ELL+  KI SF  +R  E+   +  I E 
Sbjct  102   EAAKHISWEQRNMSFGEYGSYWRNMRKMCTLELLSHTKINSFRSMREEELDILINFIREV  161

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADY  734
             A  G   VD++A+V  L  +++ +M+FG      + D    K ++QE + L    NI DY
Sbjct  162   ANDGTTTVDISAKVSTLSADMSCRMVFGKKYMDKDLDEKGFKSVIQEGMHLAATPNIGDY  221

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +P++ P DLQGL +R++ +GK  D  F +I+ EH Q   +      KD VD+ML  +   
Sbjct  222   IPYIAPLDLQGLTRRMKTIGKIFDDFFEKIIDEHIQ--SDNKDDKTKDFVDVMLGFVGTQ  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++  +IKA++ DM+ GS+DTS   +EW ++E++RNPRVMK +Q+ELE  VGL R 
Sbjct  280   ESEYRIERPNIKAIMLDMLAGSMDTSATSVEWAISELLRNPRVMKKVQKELEIVVGLKRK  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             V E DL  LEYL+MVIKE+FRLHPVA LL+P +SLED  +   FIPKK
Sbjct  340   VVESDLDKLEYLDMVIKENFRLHPVAPLLIPHQSLEDCMVEDFFIPKK  387


 Score =   147 bits (372),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSRV++N W++  DP+ W+D  E+F+PERF   ++D++G DF  +PFG GRR CPG+ 
Sbjct  385   PKKSRVIVNAWSVMRDPNAWTDP-EKFWPERFEGSNIDVKGRDFQFIPFGSGRRGCPGIQ  443

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  V+L+V QL+HCF+W L N M P +LDM E FGL  P+  HL+A+P+YRL
Sbjct  444   LGLTVVRLVVAQLVHCFDWRLCNHMLPSDLDMEEEFGLTMPRANHLIAIPTYRL  497



>ref|XP_011078642.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   294 bits (752),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 232/347 (67%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L+ +++K+GPIMY++ G VP V+VSSP AAEL LKTHD +FASRP +
Sbjct  43    GHLHLLGKNPHQDLHRIAQKHGPIMYMRFGLVPNVIVSSPKAAELFLKTHDLIFASRPPH  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K ++   + ++F  YGP+WR  +K  T ELL+  KI  F  +RR E+  +++S++ A
Sbjct  103   QAAKYLSWDQRNLSFGAYGPYWRNMRKLCTLELLSNLKISCFQTMRREELGIFIESLKQA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A     VDL+A+V  L   ++ +M+FG      + D    K ++QE + L    N+ DY 
Sbjct  163   ARDGIPVDLSAKVSSLTAEMSCRMVFGKKYEDKDIDERGFKTVIQEGMKLAAVPNLGDYF  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   D+QGL ++++AL K  D  F +++ EH +D  +G Q   KDIVD M++ M++  
Sbjct  223   PFLGILDIQGLTRKMKALSKVYDDFFEKVINEHVRDWDHGEQ--TKDIVDTMMSIMQSGQ  280

Query  918   SSH-KLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
             +   + D   +KA++ DM+ GS+DT+ + +EW L+E++RNP  MK +Q+ELE  VGL RM
Sbjct  281   TREFQFDRRHVKAIMLDMLAGSMDTAASSVEWILSELLRNPTTMKKVQKELEEVVGLERM  340

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE D+  LEYL+MV+KE+FRLHPVA LL+P  ++ED  +NG+ IPK
Sbjct  341   VEESDIDQLEYLDMVVKETFRLHPVAPLLIPHYAMEDCTVNGYDIPK  387


 Score =   149 bits (375),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR++IN  AIG DP  WS+  E+F PERF+   +D+RG  F LLPFG GRR C
Sbjct  382   GYDIPKASRIIINTHAIGRDPDAWSEP-EKFIPERFVGSEIDVRGQHFQLLPFGSGRRGC  440

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGLI V+LIV QL+HCF+W LPN + P ELDM E FGL   +  HL+A+P++RL
Sbjct  441   PGMQLGLIQVRLIVSQLVHCFDWRLPNGVLPKELDMAEEFGLVVNRANHLMAIPTFRL  498



>ref|XP_010694276.1| PREDICTED: cytochrome P450 CYP736A12-like [Beta vulgaris subsp. 
vulgaris]
Length=505

 Score =   287 bits (734),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/351 (45%), Positives = 232/351 (66%), Gaps = 13/351 (4%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH L TLPHR+L +L+KKYGPIM+L+LG +P  ++SSP AAELILK HD +F SR   
Sbjct  42    GNLHMLSTLPHRSLAKLAKKYGPIMHLRLGILPTTIISSPEAAELILKQHDLIFCSRAPT  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A   +  G+KG    PYG +WR  ++ +T  + T  K+     LR+ E+   V+ ++ A
Sbjct  102   LATFYMWYGTKGFGLTPYGDYWRRARRISTLHVFTTTKVVESQGLRKREIEGVVRWLKRA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSN------NDNHDLKLIVQEIVSLIGAFNIAD  731
             A  RE VDL+ +VG LIE + +KML G +N      N   DLK +++E+V++ G FN+ D
Sbjct  162   AESREVVDLSKKVGELIEEIMFKMLLGKNNEVVEDQNMRGDLKELMEEVVNVGGTFNLGD  221

Query  732   YLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKN  911
             +LPFL P DLQGL ++++ L K VDK+F +I+++H ++  +  QK  KD++  +L+ M N
Sbjct  222   FLPFLAPLDLQGLTRKMKNLTKRVDKIFDKIIEDHLKE--DIAQK--KDVLSNLLSIMSN  277

Query  912   PSSSHKLD---LASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVG  1082
             P++   LD     ++KA++ D+    +DTS   + W L+ ++ +PRVM LLQEEL+  V 
Sbjct  278   PNNEFFLDSFGRDNVKAIMLDLFTAGIDTSSHTLVWALSALLSHPRVMNLLQEELDAIVT  337

Query  1083  LNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
              NRMV+E DLPNL YL+MV+KE+ RL+P   LL+PRE LED+ ++G  I K
Sbjct  338   KNRMVKESDLPNLPYLDMVVKETLRLYPTVPLLLPRECLEDVVVDGFTIRK  388


 Score =   155 bits (392),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G +  K +R++IN WAI  D  +WS N EEFFPERF++  + IRG DF L+PFG GRR C
Sbjct  383   GFTIRKNTRILINYWAIARDTKLWSKNSEEFFPERFINSDIHIRGPDFMLIPFGAGRRGC  442

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  VK+++ Q++HCFNWELP+ + P E+DMTE FG   P+ + L+A+PSYRL
Sbjct  443   PGMQLGLATVKIVLAQMVHCFNWELPDGVVPEEMDMTERFGFTMPRTKKLLAIPSYRL  500



>ref|XP_010537439.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=505

 Score =   304 bits (778),  Expect(2) = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 230/349 (66%), Gaps = 7/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPH+ L  LSKKYGPIM + LG VP +VVSSP AAEL LKTHD VFASRPK+
Sbjct  45    GHLHMLGKLPHQTLTHLSKKYGPIMSINLGTVPTIVVSSPRAAELFLKTHDHVFASRPKS  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + + +G KG+   P+G  WR  +K     LL ++KIE F  +R  E+   +  +++A
Sbjct  105   QVAEILFNGYKGVVLTPHGTRWRNVRKLYAVHLLNSSKIEQFKLIRTEEIGVVMDHLKSA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND-NHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A   E V+++  V  L EN+ Y+M+FG   ND +  LK  V+++ S+ GAFNI+DY P L
Sbjct  165   AEKSEVVNISKIVVELFENMVYRMIFGRGKNDGDQKLKDFVEDMSSITGAFNISDYFPLL  224

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
              P DLQG  +R + L KS+D +F +I+ EHE   K+   K +KD VD++L+ +     S 
Sbjct  225   APLDLQGFARRTKQLRKSIDIIFEKIIHEHEH-QKDHKSKDHKDFVDVLLSLLDQSIDSQ  283

Query  927   K-----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                   +  + I A+L D++  S++TS   I+WT +EI+++PRVMK LQ+ELE  +G++R
Sbjct  284   DKNSEIIGRSEINAILLDLVAASLETSTKAIDWTFSEILKDPRVMKKLQKELETNIGMDR  343

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MV+E DLP L YL+MVIKE  RLHPV  LL P ES+ED+ L+G +IPKK
Sbjct  344   MVQESDLPKLTYLDMVIKEGLRLHPVIPLLAPHESMEDVVLDGFYIPKK  392


 Score =   137 bits (344),  Expect(2) = 5e-114, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV+IN W++G DP IW D  EEF+PERF +  +D++G DF L+PFG GRR C
Sbjct  386   GFYIPKKSRVLINVWSMGRDPDIWGDTTEEFYPERFENDDIDMQGLDFRLIPFGSGRRKC  445

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+++ ++N++ ++ QL+H F+W++P+ M P ++DM E  GLA  +  ++ A P YRL
Sbjct  446   LGMHMAMLNLRQVLAQLVHSFDWKMPDGMIPEDIDMDEKQGLAVGRANNVFARPIYRL  503



>ref|XP_004237154.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=499

 Score =   283 bits (723),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 221/341 (65%), Gaps = 6/341 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH +G   H++L++++KKYGPIM +K G +P +V SSP AAE  LK HD +FASRP N
Sbjct  43    GNLHMIGKNIHQDLHKIAKKYGPIMSMKFGVIPIIVASSPHAAEQFLKKHDLIFASRPNN  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A++ +A   + + FA YGP+WR  +K    ELL+  KI+SF D+R+ ++  +V  I  A
Sbjct  103   RAMRIVAYNQRNLTFAKYGPYWRNIRKLCMLELLSPIKIKSFQDMRKQQVTNFVTFINRA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A   + VD++A +  L  N++  M+FG    D+       K ++QE + +    NI D+ 
Sbjct  163   ASCHDEVDISANLSLLSANMSCLMIFGKKYMDDEFNERGFKDVIQEALIIAATPNIGDFF  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL  FD QGL  R + L K  D+    ++ EH Q++K   +K  KDIVD M+  M++  
Sbjct  223   PFLDKFDFQGLIPRTKKLAKVFDEFLERVIDEHVQNSKE--EKQTKDIVDTMMNIMQSGE  280

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA+L D+++ S+DTS   I+W  +E++R+P+VMK LQ+ELE  VG+NR+V
Sbjct  281   AEFEFDRRHIKAILLDLLIASIDTSATSIDWIFSELVRHPKVMKKLQKELEQVVGMNRIV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNG  1220
             EE DL  L+YL+M+IKE FRLHP+A LL+P ES++D  ++G
Sbjct  341   EESDLEKLKYLDMIIKEGFRLHPIAPLLIPHESIKDCIIDG  381


 Score =   157 bits (397),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G +  + SR+++N WAIG DP +W +  E+F PERF+   +D+RG DF LLPF  GRR C
Sbjct  381   GFNITRGSRILVNTWAIGRDPEVWPEP-EKFMPERFVGSDIDLRGRDFQLLPFSSGRRSC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGLI V+L++ QL+HCF+W+LPN M P++LDMTE FGL   + QHLVA+P+YRL
Sbjct  440   PGLQLGLIVVRLVIAQLVHCFDWKLPNDMMPNDLDMTEKFGLVVSRAQHLVAIPTYRL  497



>ref|XP_009608339.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=495

 Score =   288 bits (736),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 224/346 (65%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH +G  PH+    L+KKYGP MYL+LG VP +VVSSP   E +LKT+D VFASRP +
Sbjct  40    GHLHLIGKNPHQTFYRLAKKYGPFMYLRLGLVPTIVVSSPETVEKVLKTYDHVFASRPHH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + I  G + + F+ YG +WR  +K  T +LLT+ KI S+   R+ E+   VKSI+ A
Sbjct  100   EASQYICYGQRNLIFSKYGSYWRNMRKLCTLQLLTSQKINSYQSSRKEEVSILVKSIKQA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A+V  L  N++  M+FG      + D    K IVQE+V L    N+ D+ 
Sbjct  160   AQDGVAVDLSAKVSSLNANLSCLMVFGKKFMDEDLDKRGFKSIVQEVVHLAATPNLGDFF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P+L   DLQGL  RL+AL K  D+   +I+ EH Q  +   Q+  +D VD M+A M++  
Sbjct  220   PYLGVLDLQGLTSRLKALSKVFDEFLEKIIDEHVQSKE---QRETEDFVDTMMAIMQSGE  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA+L DM++ S+DTS   +EWTL E++R+P VMK LQ+ELE  VGL+RMV
Sbjct  277   AGFEFDRRHIKAVLLDMLMASMDTSATSVEWTLTELLRHPHVMKKLQKELEEVVGLDRMV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL+MVIKE+ RLH  A LL+  ES+ED  ++G ++ K
Sbjct  337   EESDLENLKYLDMVIKEALRLHSAAPLLI-HESIEDCVVDGFYVQK  381


 Score =   152 bits (383),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SR+++N +A   DP+ W +  ++FFPERF+  +VD+RGHDF LLPFG GRR C
Sbjct  376   GFYVQKGSRIIVNVYAAQRDPNAWPEP-DKFFPERFVESNVDLRGHDFQLLPFGSGRRSC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LG+I V+L+V QL+HCF+WELPN M P ELDM+E FG+ + + +HL+AVP+Y+L
Sbjct  435   PGMQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVTCRAKHLIAVPTYKL  492



>ref|XP_008364814.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=498

 Score =   285 bits (729),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 224/347 (65%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P  +L++L++KYG IMYL+LG    VVVSS  AAEL LKTHD  FASRP N
Sbjct  43    GSLHLLGKFPTMDLHQLAQKYGDIMYLRLGLQHTVVVSSTRAAELFLKTHDLNFASRPPN  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G + ++FA YG +W   +K    ELL+  KI SF  +RR E+   +KS++  
Sbjct  103   EGAKHLIFGQRSLSFAEYGSYWTNMRKICMLELLSNQKINSFKSMRREEVALLIKSVQDD  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A  R   ++T +V  L  N+T +M+FG    D          +++E + L  A N+ D++
Sbjct  163   ANSRRIANVTDKVSSLGINMTCRMVFGKKYKDEEFGGRGFASVMKEGMKLAAAPNLGDFI  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL K+++A+ K+ D+ F +++ EH Q      ++  KD +D MLA M +  
Sbjct  223   PCIAPLDLQGLTKKMKAVNKAFDEFFEKVIDEHLQYKD---KERTKDFIDAMLAHMGSEG  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM   S DTS   ++W L+E++R+P+VMK +Q+ELEN VGL RMV
Sbjct  280   SDYRIERLNIKAMMSDMFAASADTSSTTVQWALSELLRHPQVMKKVQKELENVVGLKRMV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D+  LEYL+MV+KE+ RLHPV  LL+P  ++ED  ++G+ IPKK
Sbjct  340   EESDMEKLEYLDMVVKETMRLHPVVPLLLPHAAIEDCTVDGYHIPKK  386


 Score =   154 bits (389),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DPS W D  E+F PERF   +VD+RGH F L+PFG GRR C
Sbjct  380   GYHIPKKSRVIVNAWAIGRDPSAWED-AEKFVPERFEGNNVDVRGHHFQLVPFGSGRRRC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ LG+  V  ++ QL+HCF+WELP+ M P+ELDMTE FGL   + ++L+A+PSYRL
Sbjct  439   VGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLVVSRAKNLLAIPSYRL  496



>ref|XP_008440675.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=494

 Score =   284 bits (726),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/347 (46%), Positives = 228/347 (66%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG LPHR+L  LSKKYG IMY++LG VP V+VSSP AAEL LKTHD VFASRP  
Sbjct  39    GCLHLLGKLPHRDLRSLSKKYGSIMYMRLGLVPTVIVSSPQAAELFLKTHDTVFASRPFV  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K ++ G K + FA YGP+WR  +K  T ELL++ K++SF  +R  E+   V  +  A
Sbjct  99    QASKYMSYGQKNLGFAQYGPYWRNMRKMCTLELLSSVKVKSFRSMRMEELGLLVDYLRDA  158

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A  R  V+L++++  L  ++T  M+FG    D        K ++QE + L+ + N+ D++
Sbjct  159   AKKRVIVNLSSKICSLNTDMTCLMVFGKKYEDQEFDERGFKSVIQEAMQLVASPNLGDFI  218

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQGL++R +A+ K  D     I+ EH  ++KN  +    D VD+ML  M +  
Sbjct  219   PQIAGLDLQGLDRRSKAISKIFDGFLERIIDEH-LESKN--ENKTMDFVDVMLEIMGSQE  275

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + ++++ ++IKAL+ DM+V ++DTS   I W + E++++P VMK +Q+ELE  VGL+R V
Sbjct  276   TEYQIERSNIKALILDMLVAAMDTSATTIGWAIPELIKHPHVMKKMQDELEKVVGLDRKV  335

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL +LEYL+MV+KE  RLHP A LLVP E+LED  ++G +IPKK
Sbjct  336   EETDLDHLEYLDMVVKEILRLHPPAPLLVPHEALEDCIVDGFYIPKK  382


 Score =   154 bits (390),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N WAIG DP+ W D  E+FFPERF+   VD+RG DF L+PFG GRR C
Sbjct  376   GFYIPKKSRIIVNGWAIGRDPNFWIDP-EKFFPERFIGSQVDVRGRDFQLIPFGSGRRGC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ +GL  V+L++ QL+HCF+WELPN   P +LDMTE FGL  P+ Q L+  P YRL
Sbjct  435   PGMQMGLTVVRLVIAQLVHCFDWELPNGTLPVKLDMTEEFGLTCPRAQDLMVTPIYRL  492



>ref|XP_004162313.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=509

 Score =   284 bits (726),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 229/347 (66%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG LPHRNL+ELS+KYGPIM +KLG VP ++VSSP AA+L LKTHD  FASRP +
Sbjct  45    GCLHLLGKLPHRNLHELSQKYGPIMSMKLGLVPTIIVSSPHAAQLFLKTHDLFFASRPSS  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K+I+   K + FAPYGP+WR  +K  T ELL+  KI SF  +R+ E+   ++ ++ A
Sbjct  105   QASKHISYQQKNLVFAPYGPYWRNMRKMCTLELLSNLKINSFMPMRKHELGLLIEYLKEA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A  +  V+L+A+V  L  ++   M FG    D        K ++QE + L  A N+ D++
Sbjct  165   AHNKAVVNLSAKVTSLTTDIICLMAFGKKYGDEEIDERGFKAVIQEGMQLSAAPNLGDFI  224

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQG  ++++ + K  D+   +I+ EH   A+ G  K  +D VD+ML  + +  
Sbjct  225   PAIAWLDLQGFTRKMKRVHKVYDEFLEKIINEHLV-ARGG--KKTRDFVDVMLDLIDSQQ  281

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++D ++IKA++ DM+  ++DTS   I W ++E++R+P VMK +Q+EL+  VGL+RMV
Sbjct  282   TEYQIDRSAIKAIMLDMLAAAMDTSSTTIGWAMSELIRHPDVMKKMQDELQEVVGLHRMV  341

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +E DL +LEYLEMV+KE  RL+P   LL+PRES+ED  ++G  IPKK
Sbjct  342   QESDLVSLEYLEMVVKEIMRLYPAGPLLIPRESVEDCTVDGFHIPKK  388


 Score =   153 bits (387),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N W IG DPS+W+D   +FFPERF+   +D++G+DF L+PFG GRR C
Sbjct  382   GFHIPKKSRVIVNVWTIGRDPSVWNDP-HKFFPERFIGSKIDLKGNDFELIPFGGGRRGC  440

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+W+LPN M P ELDM E FGL  P+ + L+ +P++RL
Sbjct  441   PGIQLGLTMVRLLLAQLVHCFDWKLPNGMLPSELDMIEEFGLTCPRAKDLMVIPTFRL  498



>ref|XP_006365792.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   272 bits (696),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 214/347 (62%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQ-LGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPK  386
             GNLH  LG   H+ L+ ++KK+GPIM ++ G VP +V SSP AAEL LK HD  FASRP 
Sbjct  43    GNLHMVLGKNLHQALHHIAKKHGPIMSMQFGLVPVIVASSPHAAELFLKKHDIAFASRPY  102

Query  387   NDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEA  566
             N A + IA   + + FA YGPHWR  +K  T +LLT  KI SF  +R+ E+  +V S++ 
Sbjct  103   NAAGQYIAYDHRDIVFAKYGPHWRNMRKLCTIKLLTNIKINSFRSMRKQELGIFVNSLKQ  162

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADY  734
             AA     VDL+A++  L  N++  M+ G        D    K I++E V L  + NI ++
Sbjct  163   AASNHIEVDLSAKLASLSANMSCLMVLGKKYMEEEFDERGFKNIMEETVVLAASPNIGEF  222

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              PFL  FDLQG   R++ L K  D  F +++ EH Q      QK  KDI+D M+  M++ 
Sbjct  223   FPFLSVFDLQGFIGRMKELAKIFDDFFEKVIDEHVQSKD---QKKAKDIIDTMMTIMQSG  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              +  K D   +KA+L D+++ S DT    I+W  +E++R+P+VMK LQ ELE  VG+NRM
Sbjct  280   EAEFKFDRRHVKAVLLDLLIASTDTISTAIDWIFSELLRHPKVMKKLQNELEQAVGINRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  LEYL+MVIKE  RLHP + LL P ES+ED  ++G  +PK
Sbjct  340   VEESDLERLEYLDMVIKEGLRLHPPSPLLTPHESIEDCIVDGFDVPK  386


 Score =   164 bits (415),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+ +N WAIG DP  W D  E+F PERF+  ++D+RGHDF LLPFG GRR C
Sbjct  381   GFDVPKGSRLFVNVWAIGRDPEAWPDP-EKFMPERFIDSNIDLRGHDFQLLPFGSGRRSC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN M P+ +DMTE FGL +P+ QHL+A+P+YRL
Sbjct  440   PGLQLGLTIVRLVLAQLVHCFDWELPNGMMPNHIDMTEKFGLVTPRAQHLMAIPTYRL  497



>ref|XP_009372721.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   282 bits (721),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 148/347 (43%), Positives = 225/347 (65%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P  +L++L++KYG IMYL+LG    VVVS+  AAEL LKTHD  FASRP N
Sbjct  41    GSLHLLGKFPTMDLHQLAQKYGDIMYLRLGLQHTVVVSTARAAELFLKTHDLNFASRPPN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G K ++FA YG +W   ++    ELL+  KI SF  +RR E+   +KS++  
Sbjct  101   EGAKHLIFGQKSLSFAEYGSYWTNMRRICMLELLSNQKINSFKSMRREEVALLIKSVQED  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A  R   +LT +V  L  ++T +M+FG    D       +  +++E + L  A N+ D++
Sbjct  161   ANNRRIANLTDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIASVMKEGMKLAAAPNLGDFI  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL K+++A+ K+ D+ F +++ EH Q      ++  KD +D +LA M +  
Sbjct  221   PCIAPLDLQGLTKKMKAVNKAFDEFFEKVIDEHLQYKD---KERTKDFIDALLAHMGSEG  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM   S DTS   ++W L+E++R+P+VMK +Q+ELEN VGL RMV
Sbjct  278   SDYRIERLNIKAMMSDMFAASADTSSTTVQWALSELLRHPQVMKKVQKELENVVGLKRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D+  LEYL+MV+KE+ RLHPV  LL+P  ++ED  ++G+ IPKK
Sbjct  338   EESDMEKLEYLDMVLKETMRLHPVVPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   154 bits (390),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR++IN WAIG DPS W D  E+F PERF   +VD+RGH F L+PFG GRR C
Sbjct  378   GYHIPKKSRIIINAWAIGRDPSAWED-AEKFVPERFEDNNVDVRGHHFQLVPFGSGRRRC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ LG+  V  ++ QL+HCF+WELP+ M P+ELDMTE FGL   + ++L+A+PSYRL
Sbjct  437   VGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLVVSRAKNLLAIPSYRL  494



>ref|XP_007159750.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
 gb|ESW31744.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
Length=497

 Score =   292 bits (748),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/346 (47%), Positives = 228/346 (66%), Gaps = 6/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PHR+L++L++KYGPIM+L+LG VP +VVSSP AA+L LKTHD ++ASRP  
Sbjct  38    GSLHLLGAKPHRDLHQLAQKYGPIMHLRLGFVPTIVVSSPHAAQLFLKTHDLIYASRPPL  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +    I+ G + +AFA YG +WR  +K  T ELL+ AKI SF  LR  E+   VK +  A
Sbjct  98    EVANYISWGQRNLAFAQYGSYWRSTRKMCTSELLSHAKINSFRPLREEELDLLVKHLREA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A     VD++A+V  L  +   +M+ G    D        K +++E++ L  A N+ DY+
Sbjct  158   AKDGAVVDVSAKVAALSADSACRMILGKKYMDQELDEMGFKAVMKELMYLAAAPNMGDYI  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQGL KR++ + K  D+ F +I+ EH Q  K   ++  KD VD+ML  +    
Sbjct  218   PYIGKLDLQGLIKRMKVMRKIFDEFFDKIIDEHIQSEKG--EEEVKDFVDVMLGFVGTEE  275

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
                ++++ +IKA+L D++VGS+DTS   IEWTL+E+++NPRVMK LQ ELE+ VG+ R V
Sbjct  276   LGFRVEIPNIKAILLDLLVGSIDTSATAIEWTLSELLKNPRVMKKLQVELESVVGMKRKV  335

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL  LEYL+MVIKES RLHPVA LLVP ++ ED  +   FIPK
Sbjct  336   EESDLEKLEYLDMVIKESLRLHPVAPLLVPHQTTEDCMVGDFFIPK  381


 Score =   142 bits (359),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SR+++N WAI  DP  W +  E+F+PERF   ++D+RG +F L+PFG GRR CPG+ 
Sbjct  380   PKNSRLIVNAWAIMRDPGAWIE-AEKFWPERFEGSNIDVRGREFELIPFGSGRRGCPGIQ  438

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  ++  V QL+HCF+W+LPN M P ELDM + FGL  P+  HL+A+PS RL
Sbjct  439   LGLTVIRHTVAQLVHCFDWKLPNDMMPDELDMADEFGLTMPRANHLLAIPSQRL  492



>ref|XP_009767392.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   284 bits (726),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 227/346 (66%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH +G   H++L +L+KKYGP MYL+LG VP ++VSSP   E +LKT+D VFASRP N
Sbjct  40    GHLHLIGKNAHQDLYKLAKKYGPFMYLRLGLVPTIIVSSPETVEKVLKTYDHVFASRPHN  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + I+ G + + F+ YG +WR  +K  T +LLT+ K+ S+   R+ E+   VKSI+ A
Sbjct  100   EASQYISYGQRNLIFSKYGSYWRNMRKLCTLQLLTSQKVNSYQSSRKEEVYILVKSIKQA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A+V  L  N++  M+FG      + D    K IVQE+  L    N+ D+ 
Sbjct  160   AQDGVAVDLSAKVSSLNANLSCLMVFGKKFMDEDLDKRGFKSIVQEVAHLAVTPNLGDFF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P+L   DLQGL  RL+AL K  D+   +I++EH Q  +   Q+  +D VD M+A M++  
Sbjct  220   PYLGVLDLQGLTGRLKALSKFFDEFLEKIIEEHVQSKE---QRETEDFVDTMMAIMQSGE  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L DM+  S+DTS   +EW L+E++R+P+VMK LQ+ELE  VGL+RMV
Sbjct  277   AGFEFDRRHVKAILLDMLTASMDTSATSVEWILSELLRHPQVMKKLQKELEEVVGLDRMV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL+MVIKE+ RLH VA LL   ES+ED  ++G F+ K
Sbjct  337   EESDLENLKYLDMVIKEALRLHSVAPLL-NHESIEDCVVDGFFVQK  381


 Score =   151 bits (381),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K SR+++N +A   D + W +  ++FFPERF+  +VD+RGHDF LLPFG GRR CPG+ L
Sbjct  381   KGSRIIVNVYAAQRDSNAWPEP-DKFFPERFVESNVDLRGHDFQLLPFGSGRRSCPGMQL  439

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             G+I V+L+V QL+HCF+WELPN M P ELDM+E FGL + + +HL+AVP+YRL
Sbjct  440   GIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGLVTYRAKHLMAVPTYRL  492



>ref|XP_004153472.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 ref|XP_004162329.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 gb|KGN48795.1| hypothetical protein Csa_6G501350 [Cucumis sativus]
Length=498

 Score =   283 bits (724),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 228/349 (65%), Gaps = 9/349 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH +G LPHR+L+ LS+KYGPIM++KLG V  ++VSSP AA+L LKTHD VFASRP  
Sbjct  41    GSLHLIGKLPHRDLHRLSQKYGPIMHMKLGLVHTIIVSSPHAAKLFLKTHDHVFASRPLI  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                  +  G K + FAPYG +WR  +K  T EL ++ KI SF  +R+ E+   ++ ++ A
Sbjct  101   HTSSIMTYGKKDLVFAPYGSYWRNIRKMCTLELFSSLKINSFKSMRKKEVRELIEYLKTA  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             +  R  V L+++V  LI ++T  M FG    D        K ++QE + L+ A N+ADY+
Sbjct  161   STDRMVVRLSSKVTSLIADMTCLMAFGKKYRDEEFGERGFKAVIQEGMQLVIAPNLADYI  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+ PFD+QGLN+R   + K  D  F  I++EH  ++K+G    NKD +D +L  M +  
Sbjct  221   PFVAPFDIQGLNRRATFVLKEFDGFFERIIEEH-IESKDG--NRNKDFMDHLLDIMMSSQ  277

Query  918   --SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                 +++D ++IKA+  D++  ++DTS   I+W LAE++++P+ MK LQ ELE  VGLNR
Sbjct  278   DPDGYQIDRSNIKAIALDVLSAAMDTSATAIDWALAELIKHPQAMKELQVELEKVVGLNR  337

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE  L +L+YL MVIKE  RLHP A LLVP ESLED  ++G  IPKK
Sbjct  338   MVEESHLEHLQYLGMVIKEVLRLHPPAPLLVPHESLEDCTVDGFHIPKK  386


 Score =   152 bits (383),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+ +N W+IG DP++W D  ++FFPERF+    D++G DFHL+PFG GRR C
Sbjct  380   GFHIPKKSRIFVNAWSIGQDPNVWIDP-QKFFPERFIHSLADVKGRDFHLIPFGSGRRSC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL+ V L+V  L+HCF+WELPN M   +LDM E FGL  P+ Q L+ +P+YRL
Sbjct  439   PGIHLGLLIVSLVVANLVHCFDWELPNCMLATDLDMEEEFGLTCPRAQELMLIPTYRL  496



>ref|XP_003596030.1| Cytochrome P450 [Medicago truncatula]
 gb|AES66281.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   288 bits (736),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 228/346 (66%), Gaps = 5/346 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L +LG  PH +L++LS+KYGPIM+L+LG VP +VVSSP AAEL LKTHD VFASRP  
Sbjct  18    GSLLKLGANPHLDLHKLSQKYGPIMHLRLGLVPTIVVSSPQAAELFLKTHDIVFASRPPI  77

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + +    K ++F+ YG +WR  +K  T ELL+  KI SF  +R  E+   +K I  A
Sbjct  78    EAAQLMFYNQKDVSFSVYGSYWRNMRKMCTLELLSHTKINSFRSMREQELDLLIKFIREA  137

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A     VD++A+V  L  ++T  ++FG   +D        K  +QE++SL    NIAD++
Sbjct  138   ANDGTTVDISAKVAALTADMTCIIVFGKKYSDKDLNEKGFKASMQELMSLAATPNIADFI  197

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DL GL +R++A+GK  D+   +I+ EH Q ++N      KD VD+ML  +    
Sbjct  198   PYIGALDLNGLTRRMKAIGKIFDEFLEKIIDEHIQ-SENKDDNKTKDFVDVMLGFVGTEE  256

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++ ++IK ++ DM++GS DTS   IEWT++E+++NPRVMK +Q+ELE  VG+ R V
Sbjct  257   SDYRIERSNIKGIMMDMLIGSTDTSATSIEWTISELLKNPRVMKKVQKELETVVGMKRKV  316

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL  LEYL MVIKES R+HPV  LLVP +S+ED  +   FIPK
Sbjct  317   EESDLDKLEYLNMVIKESLRIHPVVPLLVPHQSMEDCTVEDFFIPK  362


 Score =   147 bits (371),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SR+++N WAI  DP+ W+D  E+F+PERF   ++D+ GHDF L+PFG GRR CPG++
Sbjct  361   PKNSRIIVNGWAIMRDPNSWTDP-EKFWPERFEGNNIDVGGHDFQLIPFGSGRRGCPGLH  419

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  V+L+V Q++HCF+ +LPN M P +LDMTE FG+  P+  HL+A+P YRL
Sbjct  420   LGLTMVRLVVAQIVHCFDLKLPNDMLPSDLDMTEAFGITMPRANHLIALPVYRL  473



>ref|XP_008440670.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=497

 Score =   283 bits (725),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 228/349 (65%), Gaps = 9/349 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH +G LPHR+L+ LS+KYGPIM++KLG V  ++VSSP AA+L LKTHD VFASRP  
Sbjct  40    GSLHLIGKLPHRDLHHLSQKYGPIMHMKLGLVHTIIVSSPHAAKLFLKTHDQVFASRPLI  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                  ++ G K + FAPYG +WR  +K  T EL +  KI SF  +R+ E+   ++ ++ A
Sbjct  100   HTSNIMSYGQKDLVFAPYGSYWRNIRKMCTLELFSPVKINSFKSMRKEEVRELIEYLKTA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             +  R AV ++++V  L  ++T  M FG    D        K ++QE + L  A N+ADY+
Sbjct  160   SRDRVAVRVSSKVSSLSADMTCLMAFGKKYRDEEFGERGFKAVIQEAMQLAIAPNLADYI  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+  FD+QGLN+R   +GK  D     I++EH  ++K+G    NKD VD +L  M +  
Sbjct  220   PFVASFDIQGLNRRATFVGKEFDGFLERIIEEH-IESKDG--NRNKDFVDYLLDIMMSSQ  276

Query  918   SS--HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
              +  +++D ++IKA+  D++  ++DTS   I+W LAE++++P+ MK LQ ELE  VGLNR
Sbjct  277   EADEYQIDRSNIKAIALDVLSAAMDTSATAIDWALAELIKHPQAMKELQVELEKVVGLNR  336

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MVEE  L +L+YLEMVIKE  RLHP A LLVP ESLED  ++G  IPKK
Sbjct  337   MVEESHLEHLKYLEMVIKEVLRLHPPAPLLVPHESLEDCTVDGFHIPKK  385


 Score =   150 bits (380),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N W+IG DP++W+D  ++FFPERF+    D++G DF L+PFG GRR C
Sbjct  379   GFHIPKKSRIIVNAWSIGQDPNVWTDP-QKFFPERFIHSLTDVKGRDFQLIPFGSGRRGC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL+ V L+V  L+HCF+WELPN M   +LDM E FGL  P+ Q L+ +P+YRL
Sbjct  438   PGIQLGLLIVSLVVANLVHCFDWELPNCMLAIDLDMEEEFGLTCPRAQELMLIPAYRL  495



>ref|XP_008440671.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   279 bits (714),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 226/347 (65%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G LH LG LPHRNL++LS+KYGPIM +KLG VP ++VSSP AA+L LKTHD +FA+RP  
Sbjct  44    GCLHLLGKLPHRNLHKLSQKYGPIMSMKLGIVPTIIVSSPQAAKLFLKTHDLIFANRPSL  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K+I+   K + F+PYGP+WR  +K  T ELL+  KI SF  +R+ E+   ++  + A
Sbjct  104   QASKHISYQQKNLVFSPYGPYWRNMRKMCTLELLSNHKINSFMPIRKHELGLLIEYFKEA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  +  V+L+A+V  L  ++   M FG      + D    K ++QE + L  A N+ D++
Sbjct  164   AHNKTVVNLSAKVTSLTTDIICLMAFGKKYGDEDFDERGFKAVIQEGMQLAAAPNLGDFI  223

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQG  ++++ + K  D    +I+ EH      G +K  +D VD+ML  + +  
Sbjct  224   PTIAWLDLQGFTRKIKRVHKVYDDFLDKIINEHL--VARG-RKKTRDFVDVMLDLIDSQQ  280

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++D ++IKA++ DM+  ++DTS   I W ++E++R+P VMK +Q+EL+  VGL+RMV
Sbjct  281   TEYQIDRSAIKAIMLDMLAAAMDTSSTTIGWAMSELIRHPYVMKKMQDELQKVVGLHRMV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYLEMV+KE  RL+P A LL+P ESLED  +NG  IPKK
Sbjct  341   EESDLVCLEYLEMVVKEIMRLYPAAPLLIPHESLEDCTVNGFHIPKK  387


 Score =   155 bits (391),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N WAIG DPS+W+D   +FFPERF+   +D++G DF L+PFG GRR C
Sbjct  381   GFHIPKKSRLIVNAWAIGRDPSVWNDP-HKFFPERFIGSQIDLKGKDFELIPFGAGRRGC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN M P ELDM E FGL  P+ Q L+ +P +RL
Sbjct  440   PGMQLGLTMVRLLLAQLVHCFDWELPNGMLPSELDMIEEFGLTCPRAQDLMIIPIFRL  497



>ref|XP_006365795.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   270 bits (690),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 217/347 (63%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQ-LGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPK  386
             GNLH  LG   H+ L+ ++KK+GPIM ++ G VP +V SSP AAEL LK HD  FA+RP 
Sbjct  43    GNLHMVLGKNLHQALHHIAKKHGPIMSMQFGLVPVIVASSPHAAELFLKKHDIAFANRPY  102

Query  387   NDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEA  566
             N A + IA   + + FA YGPHWR  +K    +LL+  KI SF  +R+ E+  +V  ++ 
Sbjct  103   NAAAQYIAYDHRDIVFAKYGPHWRNMRKLCKMKLLSNIKINSFRSMRKQELGIFVNFLKQ  162

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADY  734
             AA  R  VDL+A++  LI +++  M+FG        D    K I  E   L+ + NIA++
Sbjct  163   AASNRVEVDLSADLASLIVDMSCLMVFGKKYMEEEFDERGFKNIFYEASFLVASPNIAEF  222

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              PFL  FDLQG   R++ L K  D+ F +++ EH Q  +   Q   KD+VD M+  M++ 
Sbjct  223   FPFLSVFDLQGFIARMKDLAKIFDEFFEKVIDEHVQSKE---QNQAKDMVDTMMTIMQSG  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              +  K+D   +KA+L D+++ S D     I+W L+E++R+P+VMK LQ ELE  VG+NRM
Sbjct  280   EAEFKIDRRDVKAVLLDLLLASTDNVSIAIDWILSELLRHPKVMKKLQIELEQAVGINRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  LEYL+MVI+E  RLHP +TLL P ES+ED  ++G  IPK
Sbjct  340   VEESDLERLEYLDMVIREGLRLHPPSTLLTPHESIEDCIVDGFDIPK  386


 Score =   164 bits (415),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+ +N WAIG DP  W D  E+F PERF+  ++D+RGHDF LLPFG GRR C
Sbjct  381   GFDIPKGSRLFVNVWAIGRDPEAWPDP-EKFMPERFVDSNIDLRGHDFQLLPFGSGRRSC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+WELPN M P+ +DMTE FGL +P+ QHL+A+P+YRL
Sbjct  440   PGLQLGLTIVRLVLAQLVHCFDWELPNGMMPNHIDMTEKFGLVTPRAQHLMAIPTYRL  497



>ref|XP_011100884.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=496

 Score =   278 bits (710),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/346 (45%), Positives = 225/346 (65%), Gaps = 6/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  PH++L  L++K+GPIM L+LG VPAVVVSSPA AEL+LKTHD VFASRP +
Sbjct  40    GHFHLLGKNPHQDLYHLARKHGPIMSLRLGFVPAVVVSSPAGAELVLKTHDLVFASRPPH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K I    + + F PYGP+WR  +K  T ELL+  +I+ F  +R+ E+   V S++ A
Sbjct  100   EAAKYIGYEQRDLVFLPYGPYWRNMRKLCTLELLSNLRIDQFRAMRKAELSLLVSSLKQA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +   E VDL+A V  L  ++   M+FG      + D    K ++ E V++   FN+ADY 
Sbjct  160   SELGEIVDLSARVSGLSGDMICLMIFGRKYADRDLDEKGFKAVISETVAIAAKFNLADYF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P +   DLQG+N+ ++ L K  D    +I+ +H Q+ +   +K  +D VD+M+A M++  
Sbjct  220   PGIGVLDLQGMNRNMKRLSKIFDGFLEKIIDDHVQNKQE--KKETEDFVDIMMAIMESGE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D  ++KA+L D+++  +DTS A  EW  +E++R+P+VMK LQ ELE  VGL +MV
Sbjct  278   AEFEFDRRNVKAVLLDLLIAGMDTSAAATEWAFSELIRHPQVMKKLQNELETVVGLEQMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE  L  LEYL+ V+KE+ RLHPVA LLVP ES++D  ++G  IPK
Sbjct  338   EESHLDRLEYLDFVVKETLRLHPVAPLLVPHESMQDCVIDGFHIPK  383


 Score =   155 bits (392),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR M+N WAIG DP++W D  E F PERF+  ++DIRG DF L+PFG GRR C
Sbjct  378   GFHIPKGSRTMVNIWAIGRDPNVWPDP-EAFKPERFIGSNIDIRGRDFRLIPFGSGRRGC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+HCF+WELPN M P +LDM+E FGL + + +HL+A+P YRL
Sbjct  437   PGLQLGLTMVRLLVAQLVHCFDWELPNCMLPSDLDMSEHFGLVTSRAKHLMAIPRYRL  494



>ref|XP_010537440.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=507

 Score =   289 bits (740),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 251/387 (65%), Gaps = 9/387 (2%)
 Frame = +3

Query  96    LLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKKYG  275
             +L + + +L + F      ESS++  +LPPGPR +P++G+LH LG LPH+ L  LSK YG
Sbjct  9     ILLVLVGSLGFLFVKVSRRESSRNLGELPPGPRGMPVVGHLHMLGKLPHQTLTHLSKIYG  68

Query  276   PIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHW  455
             PIM +KLG V  +VVSSP AAEL LKT+D VFASRPK  A     +GSK +   PYG HW
Sbjct  69    PIMSIKLGTVRTIVVSSPRAAELFLKTYDHVFASRPKTQAAGIFFNGSKAVTLTPYGTHW  128

Query  456   RGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTY  635
             R  +K     LL  +KI  F  +R  E+   +  ++ AA   E V+++  +  L EN+ Y
Sbjct  129   RNVRKLYVVHLLNTSKIIQFKPIRTEEIGRVIDRVKTAAEKNEVVNVSKILLELFENLVY  188

Query  636   KMLFGTS-NNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKL  812
             +M+ G S N+D+  LK +V+E+VSL GAFNI+DYLP L P DLQGL +R++ L KS+D +
Sbjct  189   RMILGRSKNDDDVKLKELVEEMVSLAGAFNISDYLPLLAPLDLQGLFRRMKQLRKSMDII  248

Query  813   FLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS------SSHKLDLASIKALLFDMIV  974
               +I++EHE        K +KD VD++L S+ N S      +S  +D   +  +L DM+ 
Sbjct  249   LDKIIEEHEHQKDY-KSKDDKDFVDVLL-SLLNQSIDPQDKNSEIIDRNHVIVILLDMVG  306

Query  975   GSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESF  1154
              S++TS   IEW  +EI++NPRVMK LQ+ELE  +G +RMV+E DL  L YL+MVIKE  
Sbjct  307   ASLETSVKAIEWIFSEILKNPRVMKKLQDELETIIGKDRMVQESDLSKLTYLDMVIKEGL  366

Query  1155  RLHPVATLLVPRESLEDIELNGHFIPK  1235
             RLHPV   LVP ES+ED+ ++G +IP+
Sbjct  367   RLHPVGPFLVPHESMEDVVVDGFYIPR  393


 Score =   143 bits (360),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+ SR++IN W+IG D  +W DNVEEF+PERF ++ +DI+G DF L+PFG GRR C
Sbjct  388   GFYIPRNSRILINVWSIGRDRDVWGDNVEEFYPERFENEDIDIQGLDFKLIPFGSGRRRC  447

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYR  1569
             PG+++G++NV+L++ QL+H F W++P+ M+  ++DM E FGL   +  ++ A+P YR
Sbjct  448   PGMHMGILNVRLVLAQLVHSFYWKMPHGMALEDIDMDEKFGLTVGRANNVFAIPIYR  504



>ref|XP_009378500.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   288 bits (738),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/347 (44%), Positives = 226/347 (65%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG +P+R+L +L+KKYG IMY++LG    VV+SSP AAEL LKTHD  FASRP +
Sbjct  43    GSLHLLGKVPNRDLYQLAKKYGDIMYMRLGLHHNVVISSPRAAELFLKTHDLTFASRPPH  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K+I  G K M+FA YG +WR  +K    ELL+  KI SF  +RR E+   ++S++  
Sbjct  103   EGAKHIIFGQKNMSFAEYGSYWRDMRKMCMLELLSNHKINSFKAMRREEVSLLIQSVQEE  162

Query  570   AGGREA-VDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADY  734
             A  R   ++L+ ++  L  ++T +M+FG    D+         +++E + L+ A N+ D+
Sbjct  163   ANNRRVPINLSGKISSLGVDLTCRMVFGKKYKDDEFDERGFTAVMKEAIQLVAAPNLNDH  222

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +PFL P DLQGL K+++ + K+ D  F +I+ +H Q      +   KD +D+ML  M + 
Sbjct  223   IPFLAPLDLQGLTKKMKTINKAFDAFFDKIIDDHLQSKD---EDRTKDFIDVMLGHMGSE  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++   +KAL+ DM   SVDT    I W  +E++R+P+VMK +Q+ELEN VGLNRM
Sbjct  280   ESDYRIERVHVKALMLDMFAASVDTPSTAILWAFSELLRHPQVMKKVQKELENVVGLNRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  LEYL+MV+KE+ RLHPV  LL+P  S+ED  ++G+ IPK
Sbjct  340   VEESDLEKLEYLDMVVKETLRLHPVVPLLLPHLSIEDCTVDGYHIPK  386


 Score =   144 bits (362),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR++IN WAIG DPS W D  E+F PERF   ++D++G  F L+PFG GRR C
Sbjct  381   GYHIPKNSRLIINAWAIGRDPSAWEDP-EKFVPERFEGSNIDVKGKHFQLVPFGSGRRRC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ LGL  ++ ++ Q++HCF+WELP+ M P+ELDMTE FGL   + + L+ +PSYRL
Sbjct  440   AGMQLGLTVIQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLVVSRTKDLLLIPSYRL  497



>ref|XP_008385983.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008359286.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   286 bits (733),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 224/347 (65%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG +P+RNL +L++KYG IMY++LG    +V+SSP AAEL LKTHD  FASRP +
Sbjct  43    GSLHLLGKVPNRNLYQLAQKYGDIMYMRLGLHHNIVISSPRAAELFLKTHDLTFASRPPH  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G   M+FA YGP+WR  +K    ELL+  KI SF  +RR E+   ++S++  
Sbjct  103   EGAKHVIFGQTNMSFAEYGPYWRDMRKMCMLELLSNHKINSFKAMRREEVSLLIQSVQXD  162

Query  570   AGGREA-VDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADY  734
             A  R   ++L+ ++  L  ++T +++FG    D          +++E + L+ A N+ D+
Sbjct  163   ANNRRVPINLSXKIASLGVDLTCRLVFGKKYKDVEFDERGFTAVMKEAIQLVAAPNLNDH  222

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +PFL P DLQGL K+++A+ K+ D  F  I+ +H Q      ++  KD VD+ L  M + 
Sbjct  223   IPFLAPLDLQGLTKKMKAINKAFDAFFENIIDDHLQSKD---EERTKDFVDVXLGHMGSE  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++   +KAL+ DM   SVDT    I W  +E++R+P+VMK LQ+ELEN VGLNRM
Sbjct  280   ESDYRIERXHVKALMLDMFAASVDTPSTVILWAFSELLRHPQVMKKLQKELENVVGLNRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  LEYL+MV+KE+ RLHP   LL+P  S+ED  ++G+ IPK
Sbjct  340   VEESDLEKLEYLDMVVKETLRLHPAVPLLLPHLSIEDCTVDGYHIPK  386


 Score =   144 bits (364),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR++IN WAIG DPS W D  E+F PERF   ++D++G  F L+PFG GRR C
Sbjct  381   GYHIPKNSRLIINAWAIGRDPSAWED-AEKFVPERFEGSNIDVKGKHFQLIPFGSGRRRC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ LGL  ++ ++ Q++HCF+WELP+ M P+ELDMTE FGL   + + L+ +PSYRL
Sbjct  440   AGMQLGLTVIQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLVVSRSKDLLLIPSYRL  497



>emb|CDP01387.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   284 bits (727),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 229/347 (66%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG  PH++L +L+KK+GP+MY++ G VPA++VSSP AAE  LKT+D VFASRP +
Sbjct  42    GNLHLLGKNPHQDLAKLAKKHGPLMYMRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             ++  +++   + ++FA YGP+WR  +K    +LL++ KI SF  +RR E+   VKS++ A
Sbjct  102   ESSWHVSYEQRNLSFAQYGPYWRNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A +  L  N++  M+FG      + D+   + ++QE + L    N+ DY 
Sbjct  162   ASDGAAVDLSAAISSLGANMSCLMIFGKKYMDKDFDDRGFRDVIQEALRLGATPNLGDYF  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P L   DLQGL +R + L K  DK F +I+ EH Q  ++   K  KD+VD+M+  M++  
Sbjct  222   PLLGVLDLQGLTRRFKDLAKVFDKFFEKIIDEHLQSQEH---KQTKDVVDIMMGIMQSGE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L D++V S+DTS   +EW ++E++R P  M+ LQ+ELE+KVGL R V
Sbjct  279   AEFEFDRRHVKAVLLDLLVASMDTSVTAVEWAISELLRRPEAMRKLQKELEDKVGLERTV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D+  LEYL+MVIKE+ RLHPVA LL+P ES+ED  ++   I KK
Sbjct  339   EESDVEGLEYLDMVIKETMRLHPVAPLLLPHESMEDCAVDDFHIQKK  385


 Score =   146 bits (369),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             KKSR++IN +AIGHDP++W D  E F PERF   ++D+RG DF L+PFG GRR CPG+ L
Sbjct  384   KKSRIIINVYAIGHDPNVWPDP-ETFIPERFKDSNIDLRGQDFQLIPFGSGRRGCPGLQL  442

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             G++ V+ ++ QL+HCFNWE  + + P +LDM+ETFGL   + +HL  VP+YRL
Sbjct  443   GILLVRFVLAQLVHCFNWEPADNIKPTDLDMSETFGLVLARAKHLKVVPTYRL  495



>ref|XP_009607201.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=498

 Score =   278 bits (710),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 152/346 (44%), Positives = 221/346 (64%), Gaps = 7/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH +G   H++L++++KKYGPIM ++ G VP +V SSP AAE  LK HD VFASRP N
Sbjct  43    GNLHMVGENLHQDLHKIAKKYGPIMTIRFGLVPVIVASSPHAAEQFLKNHDLVFASRPYN  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  ++I    + +  A YGP+WR  +K  T +LL+ AKI  F  +R+ E+   V  ++ A
Sbjct  103   EVPQHIFYERRNLVSAKYGPYWRNMRKLCTLQLLSNAKIHQFQPMRKQELGILVNFLKHA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A     +DL+A+V  L  N++  M+FG    D    +   K ++Q+I+ +    N A++ 
Sbjct  163   ASEGTVIDLSAKVASLSANMSCLMIFGKKYMDEDLGDKGFKALIQDILHIAALPNFAEFF  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL+  DLQG  +R++ L K  D+    ++ EH Q  +   QK  KD+VD +++ M++  
Sbjct  223   PFLRVLDLQGFARRMKELAKLFDEFLERVIDEHVQSTE---QKQAKDMVDTLMSIMQSKE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA+L D+++ S+DTS   IEWTL E++R+P VMK LQ ELE  VG NRMV
Sbjct  280   AEFEFDRRHIKAILLDLLIASMDTSSTTIEWTLTELLRHPEVMKKLQNELEQVVGRNRMV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL +LEYL+MVIKE  RLHPVA LL+P ES+ED  ++G  +PK
Sbjct  340   EESDLESLEYLDMVIKEGCRLHPVAPLLLPHESIEDCTVDGFHLPK  385


 Score =   149 bits (376),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+++N WAIG D   W +  E+F PERF   +VD+RG ++ LLPFG GRR C
Sbjct  380   GFHLPKGSRLLLNVWAIGRDSDTWIEP-EKFKPERFQGSNVDLRGRNYELLPFGSGRRGC  438

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+HCF+WELPN M P ++DMTE FGL + + QHL+A P+YRL
Sbjct  439   PGLQLGLTIVRLVVAQLVHCFDWELPNGMLPKDIDMTEKFGLVTARAQHLMATPTYRL  496



>ref|XP_008460602.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=528

 Score =   270 bits (689),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 230/351 (66%), Gaps = 10/351 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG LPHR+L+ LS+KYGPIM++KLG +P ++VSSP AAEL L+T+D VFASRP+ 
Sbjct  68    GSFHLLGKLPHRDLHTLSQKYGPIMHIKLGIIPTIIVSSPNAAELFLRTYDHVFASRPQT  127

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A   +  G K   F+ YG +WR  +K  T ELL+  K+  F  +RR ++   V++++ A
Sbjct  128   YASNYLFYGQKNFGFSKYGSYWRNMRKMCTHELLSNQKVSMFEPIRRNQVGLLVENLKEA  187

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKL-------IVQEIVSLIGAFNIA  728
             A  + AV+L+++V  ++ ++T  M+FG    ++ ++ +        V+E+V L+   N++
Sbjct  188   ARTQVAVNLSSKVLCVVRDMTCLMVFGKKYVEDQEMIMDEKSFHDAVKEVVQLVATPNLS  247

Query  729   DYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDA-KNGVQKSNKDIVDMMLASM  905
             D++P +  FD QG+N+R ++L    D     I++EH  D  KN  +  N+D VD++L  M
Sbjct  248   DFIPCVAWFDFQGINRRAKSLRNMFDGFLERIIEEHLDDQFKN--ENKNQDFVDVLLGLM  305

Query  906   KNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
              + ++ + +D ++IKAL+ +M++ ++DT+   I+W + E++R+P +MK +Q+EL+  VGL
Sbjct  306   GSQNNEYNIDPSTIKALILEMVITAMDTTATNIDWAIVELIRHPHIMKKMQQELDKVVGL  365

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
              RMV E DL +L+YL MVIKE  RLHP   LLVP ESL+D   NG  IPK+
Sbjct  366   QRMVLESDLEHLQYLNMVIKEVLRLHPPVPLLVPHESLQDCTTNGFHIPKQ  416


 Score =   155 bits (391),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PK+SR+++N WAIG DP++W+D  ++FFPERF+   VD++G DF L+PFG GRR 
Sbjct  409   NGFHIPKQSRIIVNAWAIGRDPTVWNDP-QKFFPERFIDSEVDLKGKDFELIPFGSGRRC  467

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             CPG++LGL  V+L++ QL+H F WELPN + P++LDMTE FGL  P+ QHL+  P YRL+
Sbjct  468   CPGMHLGLTMVRLLLAQLVHAFYWELPNGILPNQLDMTEEFGLTCPRAQHLMVTPIYRLI  527



>gb|EYU24037.1| hypothetical protein MIMGU_mgv1a005167mg [Erythranthe guttata]
Length=494

 Score =   291 bits (744),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/347 (46%), Positives = 230/347 (66%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH+NL+ L++K+GPIM L+LG VPAVVVSSPAAAEL+LKTHD VFASRPK+
Sbjct  38    GHLHLLGKNPHQNLHRLARKHGPIMGLRLGFVPAVVVSSPAAAELVLKTHDLVFASRPKS  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++   K + F PYGP+WR  +K  T ELL++ +I  F  LR  E+   V S++ A
Sbjct  98    AAAEYMSYQQKNIVFGPYGPYWRDMRKLCTLELLSSLRISQFQALRAAELCLLVDSLKQA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFG----TSNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A   E VDL+A V  +  ++   M+FG      + D+   K +  E + +   FN+ADY 
Sbjct  158   AELGEIVDLSARVSGVNGDMNCLMIFGRKYADKDFDDKGFKDVFMEAMEISAKFNLADYF  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQG+N+R++ L    D    +I+ EH Q+     ++  KD VD M+A M +  
Sbjct  218   PYIGVLDLQGMNRRMKELSNIFDGFLEQIIDEHLQEKPE--KEETKDFVDTMMAIMDSGE  275

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L D+++  +DTS   +EW ++E++R+PRVMK LQ ELE+ VG++R V
Sbjct  276   AGFEFDRRHVKAVLLDLLIAGMDTSSTAVEWAISELIRHPRVMKKLQNELESTVGIDRTV  335

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE  L NLEYL++V+KE+ RLHPVA LL+P ES+ED  ++G+ IPKK
Sbjct  336   EESHLDNLEYLDLVVKETLRLHPVAPLLIPHESMEDCTIDGYHIPKK  382


 Score =   133 bits (334),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR ++N WAIG DPS+W+ + E F PERF    +D+RG DF LLPFG GRR C
Sbjct  376   GYHIPKKSRAIVNVWAIGRDPSVWA-HPETFSPERFSGSDIDLRGRDFQLLPFGSGRRSC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             P + LGL+ VKL++ QL+HCF+WELPN M P +LDM+E FG+ + + +H++A+P YRL+
Sbjct  435   PALQLGLVLVKLVLAQLVHCFDWELPNGMLPSDLDMSEHFGIVTSRAEHIMAIPKYRLI  493



>emb|CDP12933.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   280 bits (717),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 226/347 (65%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG  PH++L +L+KK+GPIM+++ G VPA++VSSP AAE  LKT+D VFASRP +
Sbjct  42    GNLHLLGKNPHQDLEKLAKKHGPIMHMRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             ++   ++   + + F  YGP+WR  +K    +LL++ KI SF  +RR E+   VKS++ A
Sbjct  102   ESSWYVSYEQRNLTFGQYGPYWRNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A +  L  N++  M+FG      + D+   + ++QE + +    N+ DY 
Sbjct  162   ASDGAAVDLSASISSLGANMSCLMIFGKKYMDKDFDDRGFRDVIQEGLHVAAMPNLGDYF  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P L   DLQGL +R + L K  DK F +I+ EH Q  ++   K  KD VD+M+  M++  
Sbjct  222   PLLGVLDLQGLTRRFKDLAKVFDKFFEKIIDEHLQSQEH---KQTKDFVDIMMGIMQSGE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L D++V S+DTS   +EW ++E++R+P  M+ LQ+ELE KVGL R+V
Sbjct  279   AEFEFDRRHVKAILLDLLVASMDTSVTAVEWAISELLRHPEAMRKLQKELEEKVGLERIV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D+  LEYL+MVIKES RLHPVA LL+P ES+ED  ++   I KK
Sbjct  339   EESDIEGLEYLDMVIKESMRLHPVAPLLLPHESMEDCTVDDFHIQKK  385


 Score =   142 bits (357),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             KKSR++IN + IG DP++W D  E F PERF   ++D+RG DF L+PFG GRR CPG+ L
Sbjct  384   KKSRIIINIYTIGRDPNVWPDP-ETFNPERFKDSNIDLRGQDFRLIPFGSGRRSCPGLQL  442

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL+ V+ ++ QL+HCFNWEL + + P +LDM+E FG+ + +  HL  +P+YRL
Sbjct  443   GLLLVRFVLAQLVHCFNWELADNIRPTDLDMSEAFGIVTSRATHLRVIPTYRL  495



>gb|KHG07602.1| Cytochrome P450 [Gossypium arboreum]
Length=406

 Score =   258 bits (658),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 126/303 (42%), Positives = 200/303 (66%), Gaps = 12/303 (4%)
 Frame = +3

Query  342   LILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGD  521
             + LKTHDA+FASRPK   +++I++  +G+AF  +GP+WR  +K    +L T +KIES+  
Sbjct  1     MFLKTHDAIFASRPKVQVLQSISNSQRGIAFTEHGPYWRSVRKICNMQLFTTSKIESYAP  60

Query  522   LRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNN-DNHDLKLIVQEI  698
              R+  ++ + +S++ AA  +E V+++ ++  +   +T KM+ G+       +L  +++E+
Sbjct  61    TRKEVLMHFTESLKEAATAKEVVNISKKLAEINAEMTLKMVLGSVKKYKEFNLNELIEEL  120

Query  699   VSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKD  878
               + G FN+AD++PFL  FDLQG+    R L + +D+    ++ +H       +QK   D
Sbjct  121   TKIAGVFNLADFVPFLGAFDLQGIKASTRTLSEKLDQALEAVIDDH-------LQKKQDD  173

Query  879   IVDMMLASMK---NPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMK  1049
              V ++L  +    NP+    +D  SIKA++ DMIVG  DTS A +EW L+E++R+PRVM 
Sbjct  174   FVGVLLTELDQTMNPNGD-IMDRNSIKAIILDMIVGGSDTSAATLEWALSELIRHPRVML  232

Query  1050  LLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFI  1229
              LQ+ELE+  G  R+VEE DLP LEYL+MV++E+ RLHP+A LLVPRES+EDI ++G++I
Sbjct  233   KLQQELESIFGNKRIVEENDLPKLEYLDMVVRETLRLHPIAPLLVPRESMEDIVIDGYYI  292

Query  1230  PKK  1238
             PKK
Sbjct  293   PKK  295


 Score =   164 bits (414),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG D ++W +NVEEF PERF+   +D+ GHDF L+PFG GRR+C
Sbjct  289   GYYIPKKSRVLVNIWAIGRDSNVWPNNVEEFSPERFIDSKIDLHGHDFELIPFGAGRRLC  348

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG  LGLI VKLI+ QL+HCF+WELP+ MSP+ELDM E FG++ P+  +L   P YR+
Sbjct  349   PGKKLGLITVKLILAQLVHCFDWELPDGMSPNELDMIENFGVSLPRKTNLRVKPIYRM  406



>ref|XP_011090604.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=497

 Score =   263 bits (673),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 223/347 (64%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  P+++L+ L++KYGPIMY++ G VP ++VSSPAAAEL LK HD  FA++P +
Sbjct  41    GHFHLLGKNPYQDLHRLARKYGPIMYMRFGTVPTIIVSSPAAAELFLKKHDLTFANKPHH  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A   ++   + + F  YGP+WR  +K AT ELL+  KI  F  +R+ E+   V S+++A
Sbjct  101   EASNYLSYEQRNIVFGRYGPYWRNMRKLATLELLSNLKISQFQPMRKAEIDILVGSLKSA  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A   E VD++  +  +  ++T  M+FG    D    +  LK +++E V    AFN+ DY 
Sbjct  161   AEIGETVDMSVRIASVSADMTCLMVFGRKYADKDLNDEGLKEVMKETVEEAAAFNLGDYF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P+L+  DLQG  +RL+ L K  D+    I+ +H Q+ K   Q+S++D VD M+  M++  
Sbjct  221   PYLRGLDLQGSARRLKKLSKIFDRFLERIIDDHVQNKKEK-QQSSQDFVDTMMGIMESGE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +    D   +KA+L DM++  +DTS A +EW L+E++R+P V K LQ+ELE  VGL++ V
Sbjct  280   AGFDFDRRHVKAVLLDMLLAGIDTSTAAVEWALSEVIRHPVVTKKLQKELEEVVGLDQTV  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
              E  L +L+YL+ V++ES RLHPV+ LL+ RE +ED E++G  I KK
Sbjct  340   NESHLSSLKYLDYVVRESMRLHPVSPLLI-REGMEDCEVDGFHIQKK  385


 Score =   157 bits (396),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKS+V++N WAIG DP  W+D  E FFPERF+  +VD+RG D  L+PFG GRR C
Sbjct  379   GFHIQKKSQVLVNVWAIGRDPDAWTDP-ETFFPERFLGSNVDVRGRDSQLIPFGTGRRGC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+HCF+WELP  M P ELDM+E FGL + + +HLVA+P YRL
Sbjct  438   PGLQLGLTIVQLMVAQLVHCFDWELPEGMQPDELDMSENFGLITARAKHLVAIPKYRL  495



>ref|XP_009770873.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   272 bits (695),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/346 (43%), Positives = 217/346 (63%), Gaps = 6/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH +G   H++L +++KKYGPIM ++ G VP +V SSP AAE  LK HD VFASRP N
Sbjct  43    GNLHMVGENLHQDLYKIAKKYGPIMTIRFGLVPVIVASSPHAAEQFLKNHDLVFASRPYN  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  + +    + +  A YGP+WR  +K  T +LL+ AKI  F  +R+ E+   V  ++ A
Sbjct  103   EVPQYMFYERRNLVSAKYGPYWRNMRKLCTLQLLSNAKIHQFQPMRKQELGILVNFLKQA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A     +DL+A+V  L  N++  M+FG    D    +   K ++Q+I+ +    N A++ 
Sbjct  163   ASEGTVIDLSAKVASLSANMSCLMIFGKKYMDEDLGDKGFKALIQDILHIAALPNFAEFF  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL+  DLQG  +R++ L K  D+    ++ EH Q  +   QK  KD+VD ++  M++  
Sbjct  223   PFLRVLDLQGFARRMKELAKLFDEFLERVIDEHVQSTEE--QKQAKDMVDTLMDIMQSKE  280

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA+L D+++ S+DTS   IEW L E++R+P VMK LQ ELE  VG NRMV
Sbjct  281   AEFEFDRRHIKAILLDLLIASMDTSSTTIEWILTELLRHPEVMKKLQNELEQVVGKNRMV  340

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL+MVIKE  RLHPVA LL+P ES+ED  ++G  +PK
Sbjct  341   EESDLKNLQYLDMVIKEGCRLHPVAPLLLPHESIEDCTVDGFHLPK  386


 Score =   147 bits (372),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+++N WAIG D   W +  E+F PERF   +VD+RG ++ LLPFG GRR C
Sbjct  381   GFHLPKGSRLLLNVWAIGRDSDTWLEP-EKFKPERFQGSNVDLRGRNYELLPFGSGRRGC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+HCF+WELPN M P ++DMTE FGL + + Q+L+A+P+YRL
Sbjct  440   PGLQLGLTVVRLVVAQLVHCFDWELPNGMLPKDIDMTEKFGLVTARAQNLMAIPTYRL  497



>ref|XP_006354708.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=493

 Score =   269 bits (687),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/346 (43%), Positives = 212/346 (61%), Gaps = 10/346 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH  G   H++L ++SKKYGPIM +  G VP +V SSP AAE  LK HD +FASRP N
Sbjct  41    GNLHMFGENLHQDLGKISKKYGPIMSIHFGLVPVIVASSPHAAEQFLKIHDLIFASRPSN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             D  + +    + +  + YGP+WR  +K  T  LL+ AKI+SF  +R+ ++   V  ++  
Sbjct  101   DVAETVFYNRRNLVSSNYGPYWRNMRKLCTLHLLSNAKIQSFQPMRKKQVQILVDLMKQE  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
                R  +D++A++  L  N++  M+FG    D          ++Q+I+ + G  N A++ 
Sbjct  161   ---RNVIDVSAKIASLSANMSCLMIFGKKYMDEDLGEKGFNALIQDILCIAGLPNFAEFF  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL+  DLQG  +R + L K  D+    ++ EH  D        +KD+VD ++  M++  
Sbjct  218   PFLRVLDLQGFTRRSKELAKLFDEFLERVIDEHVCDK---FSHEHKDMVDTLMEIMQSGE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
                  D   +KA+L D++V S+DTS   I+W LAE++R+P VMK LQ ELE  VG NRMV
Sbjct  275   GEFDFDRRHVKAILLDLLVASMDTSATTIDWILAELLRHPNVMKKLQNELEQVVGKNRMV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NLEYLEMVIKES RLHPVA LL+P ES+ED E++G  IPK
Sbjct  335   EESDLENLEYLEMVIKESSRLHPVAPLLIPHESIEDCEVDGFHIPK  380


 Score =   150 bits (380),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR++IN W IG DP IW +  E F PERF   ++D+RG  F LLPFG GRR C
Sbjct  375   GFHIPKGSRLLINVWTIGRDPDIWVEP-ENFKPERFQGSNIDLRGRHFELLPFGSGRRSC  433

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ QL+HCF+W+LPN M+P ++DMTE FGL + +VQHL  +P YRL
Sbjct  434   PGLQLGLTTVRLVLAQLVHCFDWKLPNGMTPKDIDMTEKFGLVTTRVQHLRLIPKYRL  491



>ref|XP_006354701.1| PREDICTED: cytochrome P450 84A1-like [Solanum tuberosum]
Length=496

 Score =   272 bits (696),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/350 (44%), Positives = 223/350 (64%), Gaps = 12/350 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH +G  PH++  +L+KKYGP M+L+LG VP +VVSSP   E +LKT+D VFASRP +
Sbjct  38    GHLHLIGKNPHQDFYKLAKKYGPFMHLQLGLVPTIVVSSPKTIEKVLKTYDHVFASRPHH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A +++  G + + F+ YG +WR  +K  T  L+++ KI S+   R+ E+   VKSI+  
Sbjct  98    EASQHVCYGQRNLIFSKYGSYWRNMRKLTTMNLVSSQKINSYQPSRKEEVSLLVKSIKHV  157

Query  570   AGGRE----AVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNI  725
             A   +    AVDL+A+V  L  N++  M+FG      + D    K +VQE+V L    N+
Sbjct  158   ADHDQEHVVAVDLSAKVSSLNANLSCLMVFGKKFMDEDLDKRGFKYLVQEVVHLAATPNL  217

Query  726   ADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASM  905
              D+ P+L   DLQG+  RL+AL K  D+   +I+ EH +  +   QK  KD VD M+  M
Sbjct  218   GDFFPYLGVLDLQGITSRLKALSKVFDEFLEKIIDEHVESKE---QKETKDFVDTMMDIM  274

Query  906   KNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
             ++  +  K D   +KA+L DM++ S+DTS   +EW L E++R+P VMK LQ+ELE  VGL
Sbjct  275   QSGEAGFKFDRCHVKAVLLDMLMTSMDTSATSVEWILTELLRHPHVMKKLQKELEQVVGL  334

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             +RMVEE DL NL YL+MVIKE+ RLH  A LL+  ES++D  ++G F+ K
Sbjct  335   DRMVEESDLENLNYLDMVIKEALRLHSAAPLLI-HESIQDCVVDGFFVQK  383


 Score =   147 bits (370),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K SR+++N +A   DP+ W +  ++F PERF+  +VD+RGHDF LLPF  GRR CPG+ L
Sbjct  383   KGSRIIVNVYAAQRDPNAWPEP-DKFLPERFVESTVDLRGHDFQLLPFSSGRRSCPGMQL  441

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             G+I V+L+V QL+HCF+WELPN M P ELDM+E FG+ + + +HL+A+P+YRL
Sbjct  442   GIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVNCRAKHLMAIPTYRL  494



>gb|EYU31078.1| hypothetical protein MIMGU_mgv1a004963mg [Erythranthe guttata]
Length=502

 Score =   270 bits (689),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 223/347 (64%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  PH++L+ L++K+GPIM+++ G V  ++VSSPAAAEL LKTHD VFA+RP +
Sbjct  45    GHFHLLGKNPHQDLHRLARKHGPIMHMRFGSVDTIIVSSPAAAELFLKTHDLVFANRPHH  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A   I    + + F PYGP+WR  +K  T ELL+ +KI  F  +R+ E+  +V S++ A
Sbjct  105   EASTYIGYEQRNIVFGPYGPYWRNMRKLVTLELLSGSKINQFQPMRKAELGLFVDSLKRA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
               GRE VD++  +  L  ++T  M++G      + D    K +++  +    AFNI DY 
Sbjct  165   GPGREPVDMSERIMSLAADMTCLMVYGRKFAGKDLDERGFKEVMKMTMEEAAAFNIGDYF  224

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P+L+  DLQG  +RL+ L K  D     I+ +H    K   ++ + D VD +++ M++  
Sbjct  225   PYLRGLDLQGSARRLKKLSKIFDGFLERIIDDHAP-KKEERKEISMDFVDTLMSIMESGE  283

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +    D   +KA+L DM++  +DTS A +EW L+++++NP VMK LQ+ELE  VG+++MV
Sbjct  284   AGFDFDRRHVKAVLLDMLLAGMDTSAAAVEWALSDLVKNPTVMKKLQKELEEIVGMDQMV  343

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE  LPNL+YL+ V++ES R+HPV  LL+  ES+ED E++G  IPKK
Sbjct  344   EESHLPNLKYLDYVVRESMRIHPVGPLLI-HESMEDCEVDGFHIPKK  389


 Score =   149 bits (376),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFM-SKSVDIRGHDFHLLPFGYGRRV  1395
             G   PKK+RV+IN WAIG DP+ W+ + E+F+PERF+ S +VD+RG D+ L+PFG GRR 
Sbjct  383   GFHIPKKTRVLINVWAIGRDPNAWA-HPEKFWPERFVESPNVDLRGRDYQLIPFGTGRRG  441

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+LIV QL+HCF+WELP+ +S  ELDM+E FGL + + +HL+ +P+YRL
Sbjct  442   CPGLQLGLTIVQLIVAQLVHCFDWELPHGVSASELDMSENFGLVTSRAKHLMVIPTYRL  500



>gb|KHF98693.1| Cytochrome P450 [Gossypium arboreum]
Length=411

 Score =   258 bits (660),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 198/302 (66%), Gaps = 10/302 (3%)
 Frame = +3

Query  342   LILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGD  521
             + LKTHDA+FASRPK   +++I++  +G+AF  +GP+WR  +K    +L T +KIES+  
Sbjct  1     MFLKTHDAIFASRPKVQVLQSISNSQRGIAFTEHGPYWRSVRKICNMQLFTTSKIESYAP  60

Query  522   LRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNN-DNHDLKLIVQEI  698
              R+  ++ + +S++ AA  +E V+++ ++  +   +T KM+ G+       +L  +++E+
Sbjct  61    TRKEVLMHFTESLKEAATAKEVVNISKKLAEINAEMTLKMVLGSVKKYKEFNLNELIEEL  120

Query  699   VSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKD  878
               + G FN+AD++PFL  FDLQG+    + LG+ +DK    I+K+H       +QK   D
Sbjct  121   TKIAGVFNLADFVPFLGAFDLQGIKASTQTLGEKLDKALETIIKDH-------LQKKQDD  173

Query  879   IVDMMLASMKNPSSSHK--LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKL  1052
              V  +L  +    +S+   +D  SIKA+  DMIVG  DTS A +EW L+E++R PRVM  
Sbjct  174   FVGTLLTELNQTINSNGDIMDRNSIKAITLDMIVGGFDTSAATLEWALSELIRQPRVMLK  233

Query  1053  LQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIP  1232
             LQ+ELE+  G  R+VEE DLP LEYL+MV++E+ RLHP+A LL+PRES+EDI ++G++I 
Sbjct  234   LQQELESIFGNKRIVEENDLPKLEYLDMVVRETLRLHPIAPLLIPRESMEDIVIDGYYIA  293

Query  1233  KK  1238
             KK
Sbjct  294   KK  295


 Score =   160 bits (404),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSRV++N WAIG DP++WS+NVEEF PERF+  ++D+ GHDF L+PFG GRR+C
Sbjct  289   GYYIAKKSRVLVNIWAIGRDPNVWSNNVEEFSPERFIDCNIDLHGHDFALIPFGAGRRLC  348

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG  LGLI VKLI+ QL+HCF+WELP  MS +ELDM E FG++ P+   L   P YR+
Sbjct  349   PGKKLGLITVKLILAQLVHCFDWELPGGMSLNELDMRENFGVSLPRKTSLCVKPIYRM  406



>ref|XP_004237435.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=500

 Score =   268 bits (686),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 223/351 (64%), Gaps = 13/351 (4%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH +G  PH++  +L+K+YGP M+++LG VP +VVSSP   E +LKT+D VFASRP +
Sbjct  41    GHLHLIGKNPHQDFYKLAKRYGPFMHIQLGLVPTIVVSSPNTIEKVLKTYDHVFASRPHH  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A +++  G + + F+ YGP+WR  +K  T  L+++ KI S+   R+ E+   VKSI+  
Sbjct  101   EASQHVCYGQRNLIFSKYGPYWRNMRKLTTMNLVSSQKINSYQPSRKEEVSLMVKSIKHV  160

Query  570   AGGRE-----AVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFN  722
             A   +     AVDL+A+V  L  N++  M+FG      + D    K +VQE+V L    N
Sbjct  161   ADHNDQQHVVAVDLSAKVSSLNANLSCLMVFGKKFMDDDLDKRGFKSLVQEVVHLAATPN  220

Query  723   IADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLAS  902
             + D+ P+L   DLQG+  RL+ L K  D+   +I+ EH +  +   Q+  KD VD M+  
Sbjct  221   LGDFFPYLGVLDLQGITSRLKTLSKVFDEFLEKIIDEHVESKE---QRETKDFVDTMMDI  277

Query  903   MKNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVG  1082
             M++  +  + D   +KA+L DM++ S+DTS   +EW L E++R+P VMK LQ+ELE  VG
Sbjct  278   MQSGEAGFEFDRRHVKAVLLDMLMASMDTSATSVEWILTELLRHPHVMKKLQKELEQVVG  337

Query  1083  LNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             L+RMV+E DL NL YL+MVIKE+ RLH  A LL+  ES+ED  ++G F+ K
Sbjct  338   LDRMVDESDLENLNYLDMVIKEALRLHSAAPLLI-HESIEDCVVDGFFVQK  387


 Score =   150 bits (378),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K SR+++N +A   DP+ W +  ++F PERF+  SVD+RGHDF LLPFG GRR CPG+ L
Sbjct  387   KGSRIVVNVYAAQRDPNAWPEP-DKFLPERFVESSVDLRGHDFQLLPFGSGRRSCPGMQL  445

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             G+I V+L+V QL+HCF+WELPN M P ELDM+E FG+ + + +HL+A+P+YRL
Sbjct  446   GIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVTCRAKHLMAIPTYRL  498



>ref|XP_006354704.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=497

 Score =   271 bits (693),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 221/347 (64%), Gaps = 9/347 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG     +L++ S KYGPI+Y+K G VP  V+SSP +AE ILKT+D +FASRP N
Sbjct  41    GHLHLLGENLTHDLHKFSLKYGPIIYMKFGLVPTYVISSPESAEKILKTYDHIFASRPHN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSI-EA  566
             +  + I+ G + + F+ YG +WR  +K  T  LL+  KI SF   R  E+   +KSI E 
Sbjct  101   ETAQYISYGQRNLIFSKYGAYWRNMRKLCTVHLLSNMKINSFQSTRSEEIAIMIKSIKEI  160

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADY  734
             A G R  VDL+A+V +L  N++  M+FG    D+       K +VQE+ +L    N+ D+
Sbjct  161   AQGRRVDVDLSAQVSKLSANLSCLMVFGKKFTDDDLDKRGFKYLVQEVTTLAATPNLGDF  220

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              PFL   DLQGL +R++   K +D    +I+ EH  +AK+   K NKD VD M+  M++ 
Sbjct  221   FPFLGVIDLQGLTRRMKDTSKVLDPFVEKIIDEH-VNAKD--HKKNKDFVDTMMEIMQSG  277

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              +  + D   +KA++ DM+V S+DTS + IEW L+E++RNP +MK LQ+ELE  VGLNRM
Sbjct  278   EAEFQFDRRHVKAVMLDMLVASIDTSSSSIEWMLSELLRNPDIMKKLQKELEEVVGLNRM  337

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             V+E DL NL+YL MV KESFRLH  A LL+  E++ED  ++  +I K
Sbjct  338   VQESDLENLKYLNMVFKESFRLHAAAPLLL-HEAMEDCMVDDFYIKK  383


 Score =   147 bits (370),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K S+V++N + I  DP+ W+D  ++F PERF+  +VD+RG D+ LLPFG GRR  PG+ L
Sbjct  383   KGSQVIVNAYTIHRDPNFWTD-ADKFLPERFLESNVDVRGRDYQLLPFGSGRRSFPGMQL  441

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              LI V+L+V QL+HCF+WELPN+M P +LDMTE FG+ + +  HL+AVP+YRL
Sbjct  442   ALIIVRLVVAQLVHCFDWELPNEMQPKDLDMTEQFGIVTGRANHLMAVPTYRL  494



>ref|XP_010537437.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=509

 Score =   300 bits (767),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 229/349 (66%), Gaps = 7/349 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPH+ L  LSK YGPIM +KLG V  +VVSSP AAEL LKTHD VFASRPK 
Sbjct  47    GHLHMLGKLPHQTLTHLSKIYGPIMSIKLGTVRTIVVSSPRAAELFLKTHDLVFASRPKT  106

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A +   +GSK +   PY  +WR  +K     LL  +KIE F  +R  E+   +  ++ A
Sbjct  107   QAGEIFFNGSKAVVLTPYSKYWRDVRKLYAVHLLNPSKIEQFKPIRTEEIGVVMNHLKNA  166

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHD-LKLIVQEIVSLIGAFNIADYLPFL  746
             A   E V+++  +  L+EN+ Y+M+FG   ND  D LK +++EI S  GAFNI+DY P L
Sbjct  167   AEKDEVVNVSNIMVELLENLVYRMIFGRGKNDADDKLKELLEEIASTTGAFNISDYFPLL  226

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP----  914
              P DLQGL +R++   KS+D +F +I++EHEQ  K+   K +KD VD++L+ +       
Sbjct  227   APLDLQGLARRMKTQRKSIDVIFDKIIEEHEQQ-KHHRSKDHKDFVDVLLSLLDQSIDPQ  285

Query  915   -SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
                S  +    IKA+L D++  + +TS   IEWT +EI++NPRVMK L+EELE  +G+++
Sbjct  286   DEKSEIISRTHIKAILLDIVGVASETSAKAIEWTFSEILKNPRVMKKLREELETVIGMDK  345

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             MV+E DLP L YL+MVIKE  RLHPV  L VP ES+ED+ ++G +IP+K
Sbjct  346   MVQESDLPKLTYLDMVIKEGLRLHPVGPLSVPHESMEDVWVDGFYIPRK  394


 Score =   118 bits (296),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 81/124 (65%), Gaps = 10/124 (8%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KS V+IN W++G D  +W DN EEF+PER+ ++  DI+G DF  +PFG GRR C
Sbjct  388   GFYIPRKSTVLINMWSMGRDRDVWGDNTEEFYPERYENEDSDIQGLDFKFIPFGSGRRRC  447

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTE------TFGLASPKVQHLVAVP  1560
             PG+ + ++N++L++ Q++H F+W++P  M   ++DM E      T G A+    ++ A P
Sbjct  448   PGMQMAMLNLRLVLAQMVHSFDWKMPYGMVSEDIDMDEEHIAYVTVGRAN----NVFARP  503

Query  1561  SYRL  1572
              YRL
Sbjct  504   IYRL  507



>gb|EYU24036.1| hypothetical protein MIMGU_mgv1a005182mg [Erythranthe guttata]
Length=494

 Score =   287 bits (734),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/347 (46%), Positives = 227/347 (65%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P  NL+ L++K+GPIM L+LG VPAVVVSSPAAAELILKTHD VFASRPK+
Sbjct  38    GHLHLLGKNPPHNLHRLARKHGPIMGLRLGFVPAVVVSSPAAAELILKTHDLVFASRPKS  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++   K + F PYGP+WR  +K  T ELL++ +I  F  +R  E+   V S++ A
Sbjct  98    AAAEYMSYQQKNIIFGPYGPYWRDMRKICTLELLSSLRISQFQAMRAAELRLMVDSLKQA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFG----TSNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A   E VDL+A V  +  ++   M+FG      + D    K +  E+V +   FN+ADY 
Sbjct  158   AELGEIVDLSARVSGVNGDMNCLMIFGRKYADEDFDEKGFKAVFTEVVEMSAKFNLADYF  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQG+N+R++ L K  D    +I+ EH Q+     +K  KD VD M+A M++  
Sbjct  218   PYIGVLDLQGMNRRMKELSKIFDGFLEKIIDEHLQEKPE--KKETKDFVDTMMAVMESGE  275

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L D++V  +DTS   +EW ++E++R+PRVMK LQ ELE+ VG++R V
Sbjct  276   AGFEFDRRHVKAVLLDLLVAGMDTSSTAVEWAISELIRHPRVMKKLQNELESTVGIDRTV  335

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE  L  LEYL+ V+KE+ RLHPV  LLVP ES+ED  ++G+ IPKK
Sbjct  336   EESHLNKLEYLDSVVKETLRLHPVVPLLVPHESMEDCTIDGYHIPKK  382


 Score =   131 bits (329),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR ++N WAIG DPS+W+ + E F PERF    +D+RG DF L+PFG GRR C
Sbjct  376   GYHIPKKSRAIVNMWAIGRDPSVWA-HPETFSPERFSGSGIDLRGRDFQLVPFGSGRRTC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LG++ VKL++ QL+HCF+WELPN M P +LDM+E FGL + + +H++A+P YRL
Sbjct  435   PALQLGVVLVKLVLAQLVHCFDWELPNGMLPCDLDMSEHFGLVTSRAEHIMAIPKYRL  492



>ref|XP_004162326.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=507

 Score =   272 bits (695),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/349 (44%), Positives = 229/349 (66%), Gaps = 9/349 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L  L   PHR+L+ LS+KYGPIM++KLG V  +VVSSP AAEL LKTHD +FASRP  
Sbjct  50    GSLSLLKEFPHRDLHRLSQKYGPIMHIKLGLVNTIVVSSPQAAELFLKTHDLIFASRPLT  109

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                K ++ G K + FA YG +WR  +K  T ELL+  KI SF  +R+ E+   ++ ++ A
Sbjct  110   MVSKFLSYGQKNLVFAQYGSYWRNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEA  169

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNN----DNHDLKLIVQEIVSLIGAFNIADYL  737
             A    +++++++   LI ++T  M+FG        D+   K ++QE++ LI A N+ D++
Sbjct  170   ASDGVSINISSKAASLITDMTCLMVFGRKFGDEELDDRGFKAMMQEVMQLIAAPNLGDFI  229

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF++ FDLQGLN+R+  + K  D  F  I+ EH    K+  +K  KD +D+ML  M    
Sbjct  230   PFIERFDLQGLNRRMINVSKVFDGFFERIIDEH---LKSMGEKKTKDFLDVMLDLMNTEC  286

Query  918   SS--HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
              S  +++D +++KA++ DM+  ++DTS   I W L E++R+P+VMK +++ELEN VGL+ 
Sbjct  287   LSYEYRIDRSNVKAIILDMLGAAMDTSATVIGWALPELIRHPQVMKKVKDELENVVGLDT  346

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +VEE  L +L+YL+MVIKE  RL+P   LLVP ESL+D  ++G FIP+K
Sbjct  347   IVEESHLIHLQYLDMVIKEILRLYPPVPLLVPHESLQDCVVDGFFIPRK  395


 Score =   145 bits (366),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSRV++N WAIG DP+ W   ++ F PERFM   +D++G DF L+PFG GRR C
Sbjct  389   GFFIPRKSRVIVNAWAIGRDPTAWIHPLK-FHPERFMDSQLDVKGRDFQLIPFGAGRRGC  447

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V+L++ QL+HCF+W+L   MS  ELDMTE FGL  P+ Q L+ +P YRL
Sbjct  448   PGIHLGLTVVRLVLAQLLHCFDWKLLGGMSIDELDMTENFGLTCPRAQDLILIPVYRL  505



>ref|XP_004143566.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=506

 Score =   272 bits (695),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/349 (44%), Positives = 229/349 (66%), Gaps = 9/349 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L  L   PHR+L+ LS+KYGPIM++KLG V  +VVSSP AAEL LKTHD +FASRP  
Sbjct  49    GSLSLLKEFPHRDLHRLSQKYGPIMHIKLGLVNTIVVSSPQAAELFLKTHDLIFASRPLT  108

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                K ++ G K + FA YG +WR  +K  T ELL+  KI SF  +R+ E+   ++ ++ A
Sbjct  109   MVSKFLSYGQKNLVFAQYGSYWRNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEA  168

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNN----DNHDLKLIVQEIVSLIGAFNIADYL  737
             A    +++++++   LI ++T  M+FG        D+   K ++QE++ LI A N+ D++
Sbjct  169   ASDGVSINISSKAASLITDMTCLMVFGRKFGDEELDDRGFKAMMQEVMQLIAAPNLGDFI  228

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF++ FDLQGLN+R+  + K  D  F  I+ EH    K+  +K  KD +D+ML  M    
Sbjct  229   PFIERFDLQGLNRRMINVSKVFDGFFERIIDEH---LKSMGEKKTKDFLDVMLDLMNTEC  285

Query  918   SS--HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
              S  +++D +++KA++ DM+  ++DTS   I W L E++R+P+VMK +++ELEN VGL+ 
Sbjct  286   LSYEYRIDRSNVKAIILDMLGAAMDTSATVIGWALPELIRHPQVMKKVKDELENVVGLDT  345

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +VEE  L +L+YL+MVIKE  RL+P   LLVP ESL+D  ++G FIP+K
Sbjct  346   IVEESHLIHLQYLDMVIKEILRLYPPVPLLVPHESLQDCVVDGFFIPRK  394


 Score =   145 bits (366),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSRV++N WAIG DP+ W   ++ F PERFM   +D++G DF L+PFG GRR C
Sbjct  388   GFFIPRKSRVIVNAWAIGRDPTAWIHPLK-FHPERFMDSQLDVKGRDFQLIPFGAGRRGC  446

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL  V+L++ QL+HCF+W+L   MS  ELDMTE FGL  P+ Q L+ +P YRL
Sbjct  447   PGIHLGLTVVRLVLAQLLHCFDWKLLGGMSIDELDMTENFGLTCPRAQDLILIPVYRL  504



>gb|KCW79056.1| hypothetical protein EUGRSUZ_C00482, partial [Eucalyptus grandis]
Length=417

 Score =   340 bits (872),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 190/390 (49%), Positives = 259/390 (66%), Gaps = 15/390 (4%)
 Frame = +3

Query  90    LALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKK  269
             L L +  L TL+ FFRH R  +  K     PP P      GNLHQLG LPHR L+ L+K 
Sbjct  7     LVLSTTLLITLYLFFRHLRCRQPHKLPPGPPPLPVI----GNLHQLGNLPHRCLHSLAKS  62

Query  270   YGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGP  449
             YGPIM+L+LG  P VVVSSP AAEL+LKT+D +F+SRP  DA+++++ G+KGMAFA  G 
Sbjct  63    YGPIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDALRHMSYGNKGMAFAESGA  122

Query  450   HWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENV  629
             +WRG KK  T +LL+ AK+ESF  +RR E+   V+ + AAA   E VD++AEVG+LI ++
Sbjct  123   YWRGMKKLCTLQLLSTAKVESFAPMRREELGRVVRRVRAAAAEHEVVDVSAEVGQLIADL  182

Query  630   TYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
               +M+ G S  D  +LK ++ E ++L GAFN+ADY+P L   DLQG+ +R +A+ ++VDK
Sbjct  183   ACRMILGCSTRDKFNLKPVIHEGLNLAGAFNLADYVPLLGALDLQGITRRAKAVNRAVDK  242

Query  810   LFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS--------HKLDLASIKALLFD  965
             +  +I++EHE+       K   D +D +LA M +P +         H L   +IKAL  D
Sbjct  243   VLEDIIREHEEVTTG---KYEGDFIDTLLAGMGHPMNGSPQDDEPVHGLGRTNIKALALD  299

Query  966   MIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIK  1145
             MI  S +TS   IEW ++E++R+P  MK LQ ELE  VGL R VEE DLP L Y++MV+K
Sbjct  300   MIAASYETSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLPKLNYMDMVVK  359

Query  1146  ESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             ESFRL+P A LL+P ES E IE+ G++IPK
Sbjct  360   ESFRLYPPAPLLIPHESTEGIEMGGYYIPK  389



>ref|XP_009615258.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   268 bits (684),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 149/346 (43%), Positives = 220/346 (64%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L +L+ K+GPIMY++LG VPA+V SS  AAE +LKT+D +FASRP +
Sbjct  40    GHLHLLGKNPHQDLQKLANKHGPIMYMRLGLVPAIVASSADAAEKVLKTNDHIFASRPHH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + +A G K   FA YGP+WR  +K  T  LL++ KI SF  +R+ ++   + S++  
Sbjct  100   EASQYMAYGQKNFIFAKYGPYWRNIRKLCTVHLLSSHKINSFQSMRKQQVQLLIDSLKRE  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R  VDL+A++  L  N+T  M+FG      + D    K +VQ+++ L    N+ D+ 
Sbjct  160   AHDRIVVDLSAKITSLNANLTCLMVFGKKYMDEDLDKRGFKAVVQDVLHLAATPNLGDFF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQGL ++L+ L K  D+   +I+ EH Q      QK  KD VD M+  M++  
Sbjct  220   PFLGVIDLQGLTRKLKDLSKVFDEFLEKIIDEHVQSHD---QKQTKDFVDTMMEIMQSGE  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA+L DM++ ++DTS   +EW L E++R+P VMK LQ+EL+  VG+ RMV
Sbjct  277   AEFQFDRRHIKAILLDMLMAAMDTSATSVEWILTELLRHPNVMKKLQKELDEVVGIERMV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL+MV+KE  RLH V  ++   E++ED  ++G  I K
Sbjct  337   EESDLENLKYLDMVVKEGLRLHSVVPIM-HHEAMEDCVVDGFHIQK  381


 Score =   149 bits (376),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SR+MINC+A+  DP++W +  E+FFPERF+  SVDIRG DF LLPFG GRR C
Sbjct  376   GFHIQKGSRIMINCYAVQRDPNVWPEP-EKFFPERFVGSSVDIRGRDFQLLPFGSGRRSC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LG+  V+L+V QL+HCF+WE+PN M P +L++ E FGL + K + L+A+P+YRL
Sbjct  435   PGMQLGVTIVRLVVAQLVHCFDWEIPNGMQPLDLEIDEQFGLVTCKEKPLMAIPTYRL  492



>ref|XP_009782203.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=494

 Score =   270 bits (689),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 222/346 (64%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L +L+ K+GPIMY++LG VP +V SS  AAE +LKT+D +FASRP +
Sbjct  40    GHLHLLGKNPHQDLQKLANKHGPIMYMRLGLVPTIVASSADAAEKVLKTYDHIFASRPHH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + +A G K + FA YGP+WR  +K  T  LL++ KI SF  +R+ ++   + S++  
Sbjct  100   EASQYMAYGQKNLIFAKYGPYWRNMRKLCTVHLLSSHKINSFQSMRKQQVQLLIDSLKRE  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A++  L  N+T  M+FG     ++ D    K +VQ++V L    N+ D+ 
Sbjct  160   AHDHVAVDLSAKITSLNANLTCLMVFGKKYMDADLDKRGFKAVVQDVVHLAATPNLGDFF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQGL ++L+ L K  D+   +I+ +H Q   +   K  KD VD M+  M++  
Sbjct  220   PFLGVIDLQGLTRKLKDLSKVFDEFLEKIIDDHVQSHDD---KQTKDFVDTMMEIMQSGE  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D  +IKA+L DM++ ++DTS   +EW L E++R+P VMK LQ+ELE  VG+ +MV
Sbjct  277   AEFQFDCRNIKAILLDMLMAAIDTSATSVEWILTELLRHPHVMKKLQKELEELVGIEKMV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL+MV+KE  RLH +  ++   E++ED  ++G  I K
Sbjct  337   EESDLENLKYLDMVVKEGLRLHSIVPIM-HHEAMEDCVVDGFHIQK  381


 Score =   146 bits (369),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SR+MINC+A+  DP++W +  E+FFPERF+  +VD RG DF LLPFG GRR C
Sbjct  376   GFHIQKGSRIMINCYAVQRDPNVWPEP-EKFFPERFVGSNVDTRGRDFQLLPFGSGRRSC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LG+  V L+V QL+HCF+WE+PN M P +LD+ E FGL + K + L+A+P+YRL
Sbjct  435   PGMQLGITIVSLVVAQLVHCFDWEIPNGMQPLDLDIDEQFGLVTCKEKPLMAIPTYRL  492



>ref|XP_003630098.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04574.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=477

 Score =   261 bits (668),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/325 (46%), Positives = 214/325 (66%), Gaps = 10/325 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L +LG  PHR+L++LS+KYGPIM+L+LG +P +VVSSP AAEL LKTHD VFASRP +
Sbjct  39    GSLLKLGANPHRDLHQLSQKYGPIMHLRLGLIPTIVVSSPQAAELFLKTHDLVFASRPPH  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K I+   + ++F  YG +WR  +K  T ELL+ AKI SF  +R  E+   +  ++A 
Sbjct  99    LAAKIISWDQRNLSFGEYGSYWRNMRKMCTLELLSHAKINSFKTMREQELDLLIMFLKAN  158

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
              G +  VDL+A+V  L  +++ +M+ G      + D    K ++QE + L    NI DY+
Sbjct  159   DGTK--VDLSAKVSTLAADMSCRMVLGKKYIDKDLDEKGFKAVMQEGMHLAATPNIGDYI  216

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQ-DAKNGVQKSNKDIVDMMLASMKNP  914
             P++   DLQGL +R++A+GK  D  F +I+ EH Q D K+     NKD VD+ML  +   
Sbjct  217   PYVGSLDLQGLTRRMKAIGKIFDDFFEKIIDEHIQSDYKD---DKNKDFVDVMLGFLGTQ  273

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++  +IKA+L DM+ GS+DTS   IEW ++E+++NP VMK +Q ELE  VG+ R 
Sbjct  274   ESEYRIERPNIKAILLDMLAGSMDTSATAIEWAISELIKNPIVMKKVQNELETVVGMKRK  333

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPV  1169
             VEE DL  LEYL+M IKES RLHPV
Sbjct  334   VEESDLEKLEYLDMAIKESLRLHPV  358


 Score =   154 bits (390),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +1

Query  1225  SYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPG  1404
             S PKK+RV++N W++  DP+ W+D  E F+PERF   ++D+RG DF L+PFG GRR CPG
Sbjct  361   SIPKKARVIVNSWSVMRDPNAWTDP-EMFWPERFEESNIDVRGRDFQLIPFGSGRRGCPG  419

Query  1405  VNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             + LGL  ++L+V QL+HCF+W+LPN M P +LDMTE FGL  P+  HL A+P+YRL
Sbjct  420   LQLGLTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEEFGLTMPRANHLTAIPTYRL  475



>emb|CBI15435.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   240 bits (613),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 176/245 (72%), Gaps = 7/245 (3%)
 Frame = +3

Query  522   LRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNN-DNHDLKLIVQEI  698
             +R+ E+   V+S++  A  RE V+++ +VG LIE++T++MLFG   +    DLK +VQE 
Sbjct  1     MRKEELGVLVQSLKQMAAAREVVNISKKVGELIEDMTHRMLFGRCKDYQRADLKALVQET  60

Query  699   VSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKD  878
             + L+GAFNIADY+PFL   DLQGL +R++A+  +VD +  +++ EH+QDA    Q ++KD
Sbjct  61    LILVGAFNIADYVPFLGALDLQGLKRRMKAISGAVDHILEKVIDEHKQDASEN-QGNHKD  119

Query  879   IVDMMLASMKNPSSSHK-----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRV  1043
              VD+ML+ M    + H+     ++  +IK +++D+I+G++DTS   IEW L+E+ R+PRV
Sbjct  120   FVDVMLSLMNEMKNFHQEPSYLIEQENIKGIVWDIIIGAIDTSATTIEWLLSELFRHPRV  179

Query  1044  MKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGH  1223
             M+ LQEELEN +G+ RMVEE DL NL YL+MV+KE  RLHP   LL+P ES+EDI LNG+
Sbjct  180   MRQLQEELENVIGMERMVEEVDLANLVYLDMVLKEGLRLHPAGPLLLPHESIEDITLNGY  239

Query  1224  FIPKK  1238
             +IPKK
Sbjct  240   YIPKK  244


 Score =   176 bits (445),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   PKKSR++IN WAIG DP+IWS+NVE+FFPERF+  ++D +G DF  +PFG GRR 
Sbjct  237   NGYYIPKKSRIIINAWAIGRDPNIWSNNVEDFFPERFIGSNIDFQGKDFQFIPFGSGRRK  296

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             CPG+ LGLINV+L++ QL+HCF+W+LPN M P ELDM+E FGLA P+  HL A+P+YRLL
Sbjct  297   CPGMQLGLINVRLVLAQLVHCFDWKLPNGMLPSELDMSEEFGLALPRATHLHALPTYRLL  356



>ref|XP_009770688.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   269 bits (687),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 216/346 (62%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P ++  +LSKK+GPIMYLKLG VP  V+SSP +AE IL+T D VFASRP N
Sbjct  41    GHLHLLGENPTQDFYKLSKKHGPIMYLKLGLVPTYVISSPESAENILRTFDHVFASRPHN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  + I+ G + + F+ YG +WR  +K  T  LL+  KI S+   R  E+   +KSI+ +
Sbjct  101   ETAQYISYGQRNLIFSKYGAYWRNMRKLCTVHLLSNHKINSYRSTRSEEVALMIKSIKPS  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A     VDL+A+V  L  N++  M+FG    D        K +VQE+  L    N+ D+ 
Sbjct  161   AEDGVVVDLSAKVSSLSANLSCLMIFGKKFMDEDLGKRGFKSLVQEVTHLAATPNLGDFF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF    D+QGL +R++ + K  D+   +I+ EH Q      QK  KD VD M++ M++  
Sbjct  221   PFFGIIDIQGLTRRMKDISKVFDEFVEKIIDEHVQTTD---QKKTKDFVDTMMSIMQSGE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L DM+V S+DTS   +EW L+E+++NP VM+ LQ+ELE  VGLNRMV
Sbjct  278   AEFQFDRRHVKAILLDMLVASIDTSSTSVEWMLSELLKNPNVMEKLQKELEEVVGLNRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL MV KESFRLH  A LL+  E++ED  ++  +I K
Sbjct  338   EESDLDNLKYLNMVFKESFRLHAAAPLLL-HEAMEDCIVDDFYIQK  382


 Score =   147 bits (370),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K S+V++N ++I  DP++W +  ++F PERF+  +VD+RG DF LLPFG GRR CPG++L
Sbjct  382   KGSQVIVNSYSIHMDPNVWPE-ADKFLPERFLESNVDVRGRDFQLLPFGSGRRSCPGMHL  440

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              LI V+L+V QL+HCF+W+LPN M P +LDMTE FG+ + + +HL+A+P+YRL
Sbjct  441   ALIIVRLVVAQLVHCFDWKLPNGMQPKDLDMTEKFGIVTGRAKHLMAIPTYRL  493



>ref|XP_010050339.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=476

 Score =   341 bits (874),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/390 (49%), Positives = 259/390 (66%), Gaps = 15/390 (4%)
 Frame = +3

Query  90    LALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKK  269
             L L +  L TL+ FFRH R  +  K     PP P      GNLHQLG LPHR L+ L+K 
Sbjct  7     LVLSTTLLITLYLFFRHLRCRQPHKLPPGPPPLPVI----GNLHQLGNLPHRCLHSLAKS  62

Query  270   YGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGP  449
             YGPIM+L+LG  P VVVSSP AAEL+LKT+D +F+SRP  DA+++++ G+KGMAFA  G 
Sbjct  63    YGPIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDALRHMSYGNKGMAFAESGA  122

Query  450   HWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENV  629
             +WRG KK  T +LL+ AK+ESF  +RR E+   V+ + AAA   E VD++AEVG+LI ++
Sbjct  123   YWRGMKKLCTLQLLSTAKVESFAPMRREELGRVVRRVRAAAAEHEVVDVSAEVGQLIADL  182

Query  630   TYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
               +M+ G S  D  +LK ++ E ++L GAFN+ADY+P L   DLQG+ +R +A+ ++VDK
Sbjct  183   ACRMILGCSTRDKFNLKPVIHEGLNLAGAFNLADYVPLLGALDLQGITRRAKAVNRAVDK  242

Query  810   LFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS--------HKLDLASIKALLFD  965
             +  +I++EHE+       K   D +D +LA M +P +         H L   +IKAL  D
Sbjct  243   VLEDIIREHEEVTTG---KYEGDFIDTLLAGMGHPMNGSPQDDEPVHGLGRTNIKALALD  299

Query  966   MIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIK  1145
             MI  S +TS   IEW ++E++R+P  MK LQ ELE  VGL R VEE DLP L Y++MV+K
Sbjct  300   MIAASYETSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLPKLNYMDMVVK  359

Query  1146  ESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             ESFRL+P A LL+P ES E IE+ G++IPK
Sbjct  360   ESFRLYPPAPLLIPHESTEGIEMGGYYIPK  389



>ref|XP_004253509.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=493

 Score =   264 bits (674),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 217/346 (63%), Gaps = 11/346 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG    ++L++ S KYG I+Y+K G VP  V+SSP +AE ILKT+D +FASRP N
Sbjct  41    GHLHLLGENLTQDLHKFSLKYGAIIYMKFGLVPTYVISSPQSAEKILKTYDHIFASRPHN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  + I+ G + + F+ YG +WR  +K  T  LL+  KI SF   R  E+   +K I   
Sbjct  101   ETAQYISYGQRNLIFSKYGAYWRNMRKLCTVHLLSNMKIHSFQSTRSEEIALMIKEI---  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A G   VDL+A+V +L  N++  M+FG    D+       K +VQE+ +L    N+ D+ 
Sbjct  158   AQGHVEVDLSAQVSKLSANLSCLMVFGKKFTDDDLDKRGFKYLVQEVTTLAATPNLGDFF  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQGL +R++   K +D    +I+ EH  +AK   QK NKD VD M+  M++  
Sbjct  218   PFLGVIDLQGLTRRMKDTSKVLDPFVEKIIDEH-VNAKE--QKKNKDFVDTMMDIMQSGE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA++ DM+V S+DTS + IEW L+E++RNP +MK LQ ELE  VGLNRMV
Sbjct  275   AEFQFDRRHVKAVMLDMLVASIDTSSSSIEWMLSELLRNPDIMKKLQRELEEVVGLNRMV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             +E DL NL+YL MV KESFRLH  A LL+  E++ED  ++  +I K
Sbjct  335   QESDLENLKYLNMVFKESFRLHAAAPLLL-HEAMEDCVVDDFYIKK  379


 Score =   151 bits (381),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K S+V++N + I  DP+ W+D  ++F PERF+  +VD+RG D+ LLPFG GRR CPG+ L
Sbjct  379   KGSQVIVNAYTIHRDPNFWTD-ADKFMPERFLESNVDVRGRDYQLLPFGSGRRSCPGMQL  437

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              LI V+L+V QL+HCF+WELPN+M+P +LDMTE FG+ + +  HL+AVP+YRL
Sbjct  438   ALIIVRLVVAQLVHCFDWELPNEMNPKDLDMTEQFGIVTGRANHLMAVPTYRL  490



>ref|XP_009607200.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=497

 Score =   266 bits (680),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/346 (43%), Positives = 211/346 (61%), Gaps = 4/346 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH +    H++L +++KKYGPIM ++ G VP +V SSP AAE  LK HD+ FASRP +
Sbjct  38    GNLHMVSDNLHQDLYKIAKKYGPIMTIRFGLVPVIVASSPHAAEQFLKNHDSTFASRPYH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  + I    + +  A YGP+WR  +K  T +LL+ AKI  F  +R+ E+   V  +  A
Sbjct  98    EVSQYIFYEQRNLVSAKYGPYWRNMRKLCTLQLLSNAKIHQFQPMRKQEVGILVNFLRHA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
             A     +DL+A+V  L  N++  M+FG    D        K ++Q+I+ L    N+A++ 
Sbjct  158   ASEGTVIDLSAKVASLSANMSCLMIFGKKYMDEDLGEKGFKALIQDILHLAALPNVAEFF  217

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL+  DLQG + R++ L +  D L   +V EH        QK   D+VD ++  M++  
Sbjct  218   PFLRVLDLQGFSHRMKELAQLFDGLLERVVDEHVVVQSTEQQKQATDMVDTLMGIMQSKE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L D+++ S DTS   IEW L E++R+P VMK LQ ELE  VG NRMV
Sbjct  278   AEFEFDRRHVKAVLLDLLIASTDTSSTTIEWILTELLRHPDVMKKLQCELEQVVGKNRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE D  NL+YL+MVIKES RLHPVA LL+P ES+ED  ++G  IPK
Sbjct  338   EELDFENLQYLDMVIKESCRLHPVAPLLIPHESIEDCVIDGFHIPK  383


 Score =   149 bits (375),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+++N WAIG D   W +  E+F PERF   ++D+ G +F LLPFG GRR C
Sbjct  378   GFHIPKGSRLLVNVWAIGRDSDTWLEP-EKFKPERFQGSNIDLGGQNFQLLPFGSGRRSC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+HCF+WELPN M P  +DMTE FGL + + QHL+A+P+YRL
Sbjct  437   PGLQLGLTIVRLVVAQLIHCFDWELPNGMLPEHIDMTEKFGLVTARAQHLMAIPTYRL  494



>ref|XP_004301061.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   340 bits (873),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 196/390 (50%), Positives = 272/390 (70%), Gaps = 11/390 (3%)
 Frame = +3

Query  90    LALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKK  269
             +A+L + LA LW       +  S    +KLPPGPRPLPIIGNLH LG LPHR L  L+K+
Sbjct  7     IAILLVLLACLWSLI----SAFSKSKHQKLPPGPRPLPIIGNLHMLGNLPHRTLQNLAKQ  62

Query  270   YGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGP  449
             YG IM ++LG VP +V+SSP AAEL LKTHD  FASRPK  A + ++ G+KGMAF+ YGP
Sbjct  63    YGDIMSIRLGNVPTIVISSPKAAELFLKTHDTNFASRPKIQASEYLSYGTKGMAFSEYGP  122

Query  450   HWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENV  629
             +WR  +K  T +L  +AK+E+F  LR+ E+   V  ++ AA   E VD++ ++G + E +
Sbjct  123   YWRHVRKLCTLQLFCSAKLEAFAPLRKEELGGLVGKLKKAAEEGEVVDVSEKIGEMNEGI  182

Query  630   TYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
             TY+M+ G   +D  DLK IV+E+  L+GAFNI+D++P L  FD+QGL KRL+ + ++VD+
Sbjct  183   TYRMVLGCKRDDRFDLKAIVEEMFFLVGAFNISDFIPSLSAFDIQGLTKRLKKVSRTVDQ  242

Query  810   LFLEIVKEHEQDAKN--GVQKSNKDIVDMMLASMKNP-----SSSHKLDLASIKALLFDM  968
             L  +I+ +HEQ A+   G Q  ++D VD++L+  K P        H LD  ++KA+L DM
Sbjct  243   LLDKIIDDHEQAAETEGGKQGQHEDFVDVLLSFTKQPLNPNDEQVHFLDRENVKAILLDM  302

Query  969   IVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKE  1148
             I  + DTS   I W+LAE+MR+PR+MK LQEEL+  VG++R VEE DLP L+YL +V+KE
Sbjct  303   ITAAFDTSATTIIWSLAELMRHPRIMKQLQEELQIVVGMDRGVEESDLPKLDYLNLVVKE  362

Query  1149  SFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             SFRLHPVA LL+P ES++DI ++G+ IPKK
Sbjct  363   SFRLHPVAPLLLPHESIKDITIDGYDIPKK  392


 Score =   172 bits (435),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  1183  FPESRWKISS*TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDF  1362
              P    K  +  G   PKKSR+++N W+I  DP++WS+NVEEF PERF + ++D++GHD+
Sbjct  374   LPHESIKDITIDGYDIPKKSRLIVNFWSIARDPNVWSENVEEFCPERFTNSNIDLQGHDY  433

Query  1363  HLLPFGYGRRVCPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQ  1542
              L+PFG GRR CPG+ LGL  V+L++ QLMHCFNWELPN M P +LDMTE FGL+  K +
Sbjct  434   QLIPFGTGRRGCPGMQLGLTTVRLVLAQLMHCFNWELPNGMLPQDLDMTEKFGLSLSKAK  493

Query  1543  HLVAVPSYRLL  1575
             HL+A P+YRL+
Sbjct  494   HLLAKPTYRLM  504



>gb|AES98630.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=622

 Score =   259 bits (661),  Expect(2) = 7e-106, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 195/277 (70%), Gaps = 6/277 (2%)
 Frame = +3

Query  423   GMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTA  602
             G+AF+ YGP+WR  +K  T +LL+A+K+E FG +R+ ++   +KS+E AA   E V+++ 
Sbjct  229   GLAFSKYGPYWRSVRKLCTLKLLSASKVEMFGSIRKEKLDVLIKSLEKAALVSEVVNVSE  288

Query  603   EVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRL  782
              V  LIE++ YKM+ G S  D  DLK +VQ++++L+GAFN+ADY+P+L  FDLQGL +  
Sbjct  289   VVENLIEDIVYKMILGRSKYDQFDLKRVVQDVLALVGAFNLADYVPWLGVFDLQGLTRAC  348

Query  783   RALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----SSSHKLDLASI  947
             +  GK++D++   I+ EHEQ   N  +  ++D VD++L  M          +H +D  +I
Sbjct  349   KETGKAIDEVLEVILTEHEQ-TTNVDKNRHEDFVDILLTFMHQTIDLENEENHFIDRTNI  407

Query  948   KALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEY  1127
             KA+L D+ V ++DTS   IEW L+E++R+PRVMK+LQ+E++N+VG  RM+EEKDL NL Y
Sbjct  408   KAILLDLTVAAIDTSATVIEWALSELLRHPRVMKILQDEIQNEVGNERMIEEKDLENLSY  467

Query  1128  LEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             LEMV+ E+ RL+PVA LL+PRE  E + ++G+FI +K
Sbjct  468   LEMVVHETLRLYPVAPLLLPRECRESVTIDGYFIKEK  504


 Score =   155 bits (391),  Expect(2) = 7e-106, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    +K+RV++N WAIG D ++WS+N EEF+PERF+ K ++ +G +F  LPFG GRR C
Sbjct  498   GYFIKEKTRVIVNAWAIGRDSNVWSENAEEFYPERFIGKKMNYQGQEFESLPFGSGRRRC  557

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+  GL+ VKL++ QL+HCF+WELP  +SP  L+M E FGL  P+ QHL  +P+YRL
Sbjct  558   PGIQSGLVTVKLVIAQLVHCFDWELPYNISPSNLNMEEKFGLTIPRAQHLHVIPTYRL  615



>emb|CDP12853.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   251 bits (641),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 141/322 (44%), Positives = 208/322 (65%), Gaps = 6/322 (2%)
 Frame = +3

Query  282   MYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRG  461
             M+L+ G +  ++VSSP AAE  LKT+D VFASRP ++A K +  G + +AF  YGP+WR 
Sbjct  1     MHLRFGFISNIIVSSPHAAEQFLKTYDLVFASRPPHEAAKYLMFGQRSLAFGKYGPYWRN  60

Query  462   NKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKM  641
              +K  T  LL+  KI SF  +R+ E+  +V+S++ AA  ++ VD+ AEV  L  N+T  M
Sbjct  61    MRKLCTLNLLSNLKIGSFQSVRKEELGLFVESLKQAALNQDVVDIGAEVAALSANMTCLM  120

Query  642   LFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
             +FG        D    K +++E + L+   N+ DY PFLK  DL+GL +R++ +GK  D+
Sbjct  121   VFGKKYADKEFDERGFKAVIKEAMQLMATPNLGDYYPFLKVLDLRGLTRRMKTVGKIFDE  180

Query  810   LFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDLASIKALLFDMIVGSVDT  989
                +I+ EHEQ A     +   D V  +LA MK+  +  + D   IKA+L D++  ++DT
Sbjct  181   FLEKIIDEHEQSANQA--RHADDFVYTILALMKSKETEFEFDRRHIKAVLVDLLTAAMDT  238

Query  990   SYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPV  1169
             +   +EW LAE+++NPRVMK +Q+EL+ KVGL+RMVEE +L NL YL+MV+KE+ RLHPV
Sbjct  239   TATTVEWILAELLKNPRVMKKVQQELDEKVGLHRMVEESELENLTYLDMVVKEALRLHPV  298

Query  1170  ATLLVPRESLEDIELNGHFIPK  1235
               LL+P  +LED  ++G  IPK
Sbjct  299   VPLLLPHAALEDCIVDGFHIPK  320


 Score =   162 bits (411),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SRV IN W IG DP+ WSD  E+F PERF+  ++D+RGHDF L+PFG GRR+C
Sbjct  315   GFHIPKDSRVTINAWTIGRDPNAWSDP-EKFTPERFIGSNIDVRGHDFQLIPFGSGRRIC  373

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L++ +++HCFNWELPN M P ELDMTE FGL   + +HL+A+P+YRL
Sbjct  374   PGMQLGLTVVRLMLARMVHCFNWELPNGMLPSELDMTEEFGLVMTRAKHLMAIPTYRL  431



>ref|XP_011090597.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=495

 Score =   265 bits (678),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 218/346 (63%), Gaps = 7/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  PH++ + L++KYGPIMYL+ G VP +VVSSPAAAEL+LKTHD +FA R  +
Sbjct  40    GHFHLLGKNPHQDFHNLAQKYGPIMYLRFGFVPTIVVSSPAAAELVLKTHDLIFAGRAHH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K I+   + + FA YG +WR  +K  T ELL+  KI  F  +RR E+  +V+S++ A
Sbjct  100   QAAKEISYDKRNIVFAQYGIYWRNMRKLCTLELLSNFKINQFQPMRRAEIEVFVESLQRA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFG----TSNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             AG RE VD++A +  +I ++T  M+FG      + D    K ++ E + +    NIADY 
Sbjct  160   AGKRETVDISARISAMIGDMTCLMVFGRKFADGDLDEKGFKAVIGETLQVAALPNIADYF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQGL +R++ L K+ D     I+ +H Q+ +   +K  +D  D M+  M++  
Sbjct  220   PFLAALDLQGLTRRMKELSKTFDGFLERIIDDHIQNKQE--KKHAQDFADTMITIMESGE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L  +I+    TS   +EW L+E++R+P+ MK LQ+ELE  VG++++V
Sbjct  278   AGFEFDRRHVKAVLLVIILAXXXTSSTVVEWALSELIRHPKAMKKLQQELEQAVGMDQIV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE  L  LEYL+MV+KE+ RLHP   LL+  ESLED  ++   +PK
Sbjct  338   EESHLDRLEYLDMVVKETLRLHPAVPLLI-HESLEDCVVDQFHVPK  382


 Score =   148 bits (373),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SRV++N W+IG DP+ W +  ++F PERF+  ++D+RG DF L+PFG GRR CPG+ 
Sbjct  381   PKGSRVIVNVWSIGKDPNAWREP-QKFLPERFIGSNIDLRGQDFQLIPFGSGRRGCPGLQ  439

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             LGL  V+L++ QL+HCF+WELP+ M   ELDM E FGL + +  HL+AVP+YRLL
Sbjct  440   LGLTVVRLVLAQLVHCFDWELPDGMVASELDMAEHFGLVTCRENHLLAVPTYRLL  494



>ref|XP_004237505.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   278 bits (712),  Expect(2) = 9e-106, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 225/346 (65%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L  L+KK+GPIMY++LG VP ++ SS  AAE +LKT+D +FASRP +
Sbjct  40    GHLHLLGKNPHKDLQNLAKKHGPIMYMRLGLVPTIIASSADAAEKVLKTYDHIFASRPHH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A +++A G K + FA Y  +WR  +K  T  LL+  KI SF  +R+ E+   ++S++  
Sbjct  100   EASQHLAYGQKNLVFAKYDVYWRNIRKLCTVHLLSNQKIHSFQSMRKQEVELLIESLKQE  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R  +DL+A+V  L  N+T  M+FG      + D    K IVQ++V L G  N+ D+ 
Sbjct  160   ARDRVVIDLSAKVTSLNANLTCLMVFGKKYMDEDLDKRGFKAIVQDVVHLAGMPNLGDFF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQG+ ++L+ L K  D+   +I+ EH    ++   K NKD VD M+  M++  
Sbjct  220   PFLGAIDLQGITRKLKDLSKVFDEFLEKIIDEHVYAHEH---KQNKDFVDTMMDIMQSGD  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA+LFDM++ ++DT+ +  EW L E++R+P+VMK LQ+EL+  VGL+RMV
Sbjct  277   AKFQFDRHHIKAILFDMLIAAMDTTASSTEWILTELLRHPQVMKELQKELQEVVGLDRMV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL+MV+KE  RLHPVA L    ES+ED  ++G  I K
Sbjct  337   EESDLENLKYLDMVVKEGLRLHPVAPLFY-HESIEDCVVDGFHIQK  381


 Score =   135 bits (339),  Expect(2) = 9e-106, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K +R++INC+AI  DP++W D  E+F PERF+  SVD RG DF L+PFG GRR C
Sbjct  376   GFHIQKGTRIIINCYAIHMDPNVWPDP-EKFLPERFVGSSVDFRGRDFQLVPFGSGRRSC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ L ++ V+L+V QL+HCF WELPN +   +LD+ E FG+ + + + L+A+P+Y+L
Sbjct  435   PGMQLAVMVVRLVVAQLVHCFEWELPNGIESCDLDIDEKFGIVTCREKPLLAIPTYKL  492



>ref|XP_004291274.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=505

 Score =   340 bits (872),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 198/392 (51%), Positives = 272/392 (69%), Gaps = 12/392 (3%)
 Frame = +3

Query  90    LALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKK  269
             +A+L + LA LW       +  S    +KLPPGPRPLPIIGNLH LG LPHR L  L+K+
Sbjct  7     IAILLVLLACLWSLI----SASSKSKHQKLPPGPRPLPIIGNLHMLGNLPHRTLQNLAKQ  62

Query  270   YGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGP  449
             YG IM ++LG VPA+V+SSP AAEL LK HD  FASRPK  A + ++ GSKGM F+ YGP
Sbjct  63    YGDIMSIRLGNVPAIVISSPKAAELFLKIHDTNFASRPKIQASEYLSYGSKGMVFSEYGP  122

Query  450   HWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENV  629
              WR  +K    +L   AK+E+F  LR+ E+   V  ++ AA   E VD++ ++G + E++
Sbjct  123   CWRHVRKICKLQLFCPAKLEAFAPLRKEELGGLVGKLKRAAEEGEVVDVSEKIGEMNEDI  182

Query  630   TYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
             TY+M+ G   ++  DLK IV+E+V LIGAFNI+D++P L  FD+QGL KRL+ + + VD+
Sbjct  183   TYRMVLGCKRDNRFDLKAIVEEVVFLIGAFNISDFIPSLSAFDIQGLTKRLKKVSRMVDQ  242

Query  810   LFLEIVKEHEQDAKN---GVQKSNKDIVDMMLASMK-----NPSSSHKLDLASIKALLFD  965
             L  +I+ +HEQDA+    G Q  +++ VD++L+        N    H LD  + KA+L +
Sbjct  243   LLDKIIDDHEQDAETKSGGKQGQHENFVDVLLSFTNQSLNLNDEQVHFLDRENAKAILLE  302

Query  966   MIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIK  1145
             MI G+ DTS   I W+LAE+MR+PR+MK LQEEL+  VG++RMVEE DLP L+YL +V+K
Sbjct  303   MITGAFDTSTTTIIWSLAELMRHPRIMKRLQEELQTVVGMDRMVEESDLPKLDYLNLVVK  362

Query  1146  ESFRLHPVATLLVPRESLEDIELNGHFIPKKI  1241
             ESFRLHPVA LLVPRES++DI ++G+ IPKK+
Sbjct  363   ESFRLHPVAPLLVPRESIKDITIDGYDIPKKL  394


 Score =   172 bits (436),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  1186  PESRWKISS*TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFH  1365
             P    K  +  G   PKK R+++N W+IG DP++WS+NVEEF PERF + ++D+RGHD+ 
Sbjct  376   PRESIKDITIDGYDIPKKLRLIVNLWSIGRDPNVWSENVEEFCPERFTNSNIDLRGHDYQ  435

Query  1366  LLPFGYGRRVCPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQH  1545
             L+PFG GRR CPG+ LGL  V+L++ QL+HCFNWELPN M P +LDMTE FGL+  K +H
Sbjct  436   LIPFGTGRRGCPGMQLGLTTVRLVLAQLVHCFNWELPNGMLPQDLDMTEQFGLSMSKAKH  495

Query  1546  LVAVPSYRLL  1575
             L+A P+YRL+
Sbjct  496   LLAKPTYRLM  505



>ref|XP_003615672.1| Cytochrome P450 [Medicago truncatula]
Length=716

 Score =   259 bits (661),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 195/277 (70%), Gaps = 6/277 (2%)
 Frame = +3

Query  423   GMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTA  602
             G+AF+ YGP+WR  +K  T +LL+A+K+E FG +R+ ++   +KS+E AA   E V+++ 
Sbjct  323   GLAFSKYGPYWRSVRKLCTLKLLSASKVEMFGSIRKEKLDVLIKSLEKAALVSEVVNVSE  382

Query  603   EVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRL  782
              V  LIE++ YKM+ G S  D  DLK +VQ++++L+GAFN+ADY+P+L  FDLQGL +  
Sbjct  383   VVENLIEDIVYKMILGRSKYDQFDLKRVVQDVLALVGAFNLADYVPWLGVFDLQGLTRAC  442

Query  783   RALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----SSSHKLDLASI  947
             +  GK++D++   I+ EHEQ   N  +  ++D VD++L  M          +H +D  +I
Sbjct  443   KETGKAIDEVLEVILTEHEQ-TTNVDKNRHEDFVDILLTFMHQTIDLENEENHFIDRTNI  501

Query  948   KALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEY  1127
             KA+L D+ V ++DTS   IEW L+E++R+PRVMK+LQ+E++N+VG  RM+EEKDL NL Y
Sbjct  502   KAILLDLTVAAIDTSATVIEWALSELLRHPRVMKILQDEIQNEVGNERMIEEKDLENLSY  561

Query  1128  LEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             LEMV+ E+ RL+PVA LL+PRE  E + ++G+FI +K
Sbjct  562   LEMVVHETLRLYPVAPLLLPRECRESVTIDGYFIKEK  598


 Score =   154 bits (389),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    +K+RV++N WAIG D ++WS+N EEF+PERF+ K ++ +G +F  LPFG GRR C
Sbjct  592   GYFIKEKTRVIVNAWAIGRDSNVWSENAEEFYPERFIGKKMNYQGQEFESLPFGSGRRRC  651

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+  GL+ VKL++ QL+HCF+WELP  +SP  L+M E FGL  P+ QHL  +P+YRL
Sbjct  652   PGIQSGLVTVKLVIAQLVHCFDWELPYNISPSNLNMEEKFGLTIPRAQHLHVIPTYRL  709


 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  210  GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFA  374
            GNLH LG LPHR L  LSKKYGPIM L+LG+VP +++SS  AAE  LKTHD  FA
Sbjct  49   GNLHLLGKLPHRTLQSLSKKYGPIMSLQLGQVPTIIISSSKAAESFLKTHDIKFA  103



>ref|XP_009372715.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   261 bits (666),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 220/347 (63%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P  +L +L++KYG IMYL+LG    VVVSS  AAEL LKTHD  FA+RP N
Sbjct  41    GSLHLLGKFPTMDLRQLAQKYGDIMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G K ++FA YG +W   +K    ELL+  KI SF  +RR E+   +KS++  
Sbjct  101   EGAKHLIFGQKSLSFAEYGSYWTNMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQED  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A  R   +LT +V  L  ++T +M+FG    D       +  +++E + L GA N  D+ 
Sbjct  161   ANNRRIANLTDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVYVMKEGLKLAGAPNWGDFF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL K+++A+ K  D  + +I+ EH Q       +  KD  D MLA M +  
Sbjct  221   PCIAPLDLQGLTKKMKAVNKVFDDFYEKIIDEHLQSMD---AERTKDFTDAMLAYMGSEE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM+V S DTS   + W L+E+MR+P+VMK +Q+E++N VGLNRMV
Sbjct  278   SDYRIERLNIKAMMSDMLVASADTSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D   LEYL+MV+KE+ RLHPV  LL+P  ++ED  ++G+ IPKK
Sbjct  338   EESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   152 bits (384),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DPS W D  E+F PERF   +VD+RGH F +LPFG GRR C
Sbjct  378   GYHIPKKSRVIVNVWAIGRDPSAWED-AEKFVPERFEDSNVDVRGHHFQILPFGSGRRRC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ LG+  V  ++ QL+HCF+WELP+ M P+ELDM E FGLA  + ++L+A+P YRL
Sbjct  437   VGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMAEEFGLAVSRAKNLLAIPLYRL  494



>gb|KCW78883.1| hypothetical protein EUGRSUZ_C00326 [Eucalyptus grandis]
Length=486

 Score =   338 bits (866),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 273/432 (63%), Gaps = 25/432 (6%)
 Frame = +3

Query  96    LLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLNELSKKYG  275
             L +  L TL++FFRH R +++ K     PP P      GNLHQLG LPHR L+ L+K YG
Sbjct  9     LSTALLVTLYFFFRHLRCQQAHKLPPGPPPLPVI----GNLHQLGNLPHRCLHSLAKSYG  64

Query  276   PIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHW  455
             PIM+L+LG  P VVVSSP AAEL+LKT+D +F+SRP  DA+ +++ G+KGM FA  G +W
Sbjct  65    PIMFLRLGNKPTVVVSSPGAAELVLKTYDGIFSSRPSVDALHHLSYGNKGMGFAESGAYW  124

Query  456   RGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTY  635
             RG +K  T +LL+ AK+ESF  +RR E+   V+ + AAA   EAVD++AEVG+LI ++  
Sbjct  125   RGMRKLCTLQLLSPAKVESFAPMRREELGRVVRRVRAAAAEHEAVDVSAEVGQLIADLAC  184

Query  636   KMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLF  815
             +M+ G S  D  +L+  + E ++L GAFN+ADY+P L   DLQG+ +R +A+ ++VDK+ 
Sbjct  185   RMILGCSTRDKFNLEPGIHEALNLAGAFNLADYVPLLGALDLQGITRRAKAVNRAVDKVL  244

Query  816   LEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS--------HKLDLASIKALLFDMI  971
              +I++EHE+D      K   D +D +LA   +P +         H L   +IKAL  DMI
Sbjct  245   EDIIREHEEDTTG---KYEGDFIDTLLAGTGHPMNGSPQDDEPVHVLGRTNIKALALDMI  301

Query  972   VGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKES  1151
               S +TS   IEWT++E++R+P  MK LQ ELE  VGL R VEE DLP L Y++MV+KES
Sbjct  302   AASYETSSTAIEWTMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLPKLNYMDMVVKES  361

Query  1152  FRLHPVATLLVPRESLEDIELNGHFIPKKIASHDKLLGNRARPQHL----VGQRGRVFSR  1319
             FRL+P   LL+P ES E IE+ G+++PK     ++      RP+      V  +GR F  
Sbjct  362   FRLYPPGPLLIPHESTEGIEMGGYYVPKGTRDPEEF-----RPERFADGGVDVKGRDFQL  416

Query  1320  -EVHEQERGYPG  1352
                    RG PG
Sbjct  417   IPFGSGRRGCPG  428


 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  1303  EEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNLGLINVKLIVGQLMHCFNWELPNK  1482
             EEF PERF    VD++G DF L+PFG GRR CPG++LGL+NV+L++ QL+HCF+WELP  
Sbjct  395   EEFRPERFADGGVDVKGRDFQLIPFGSGRRGCPGMHLGLVNVRLVLAQLVHCFDWELPAG  454

Query  1483  MSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
              SP ELDM+E FG++ P+ +HL+  P YRLL
Sbjct  455   TSPKELDMSEDFGMSMPRAKHLILKPIYRLL  485



>ref|XP_009372727.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   263 bits (672),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 221/347 (64%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P  +L +L++KYG IMYL+LG    VVVS+  AAEL LKTHD  FASRP N
Sbjct  41    GSLHLLGKFPTMDLRQLAQKYGDIMYLRLGLQHTVVVSTARAAELFLKTHDLNFASRPPN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G K ++FA YG +W   +K    ELL+  KI SF  +RR E+   +KS++  
Sbjct  101   EGAKHLIFGQKSLSFAEYGSYWTNMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQED  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A  R   +LT +V  L  ++T +M+FG    D       +  +++E + L GA N  D+ 
Sbjct  161   ANNRRIANLTDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNWGDFF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL K+++A+ K  D  + +I+ EH Q       +  KD +D MLA M +  
Sbjct  221   PCIAPLDLQGLTKKMKAVNKVFDDFYEKIIDEHLQSKD---AERTKDFIDAMLAYMGSEE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM+V S DTS   + W L+E+MR+P+VMK +Q+E++N VGLNRMV
Sbjct  278   SDYRIERLNIKAMMSDMLVASADTSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D   LEYL+MV+KE+ RLHPV  LL+P  ++ED  ++G+ IPKK
Sbjct  338   EESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   148 bits (373),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DPS W D  E+F PERF   +VD+RGH F +LPFG GRR C
Sbjct  378   GYHIPKKSRVIVNVWAIGRDPSAWED-AEKFVPERFEDSNVDVRGHHFQILPFGSGRRRC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVP  1560
              G+ LG+  V  ++ QL+HCF+WELP+ M P+ELDMTE FGLA  + ++L+A+P
Sbjct  437   VGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIP  490



>ref|XP_008385982.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   264 bits (674),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/347 (43%), Positives = 232/347 (67%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG +P+RNL +L++KYG IMY++LG    +V+SSP AAEL LKTHD  FASRP +
Sbjct  43    GSLHLLGKVPNRNLYQLAQKYGDIMYMRLGLQHNIVISSPRAAELFLKTHDLNFASRPPH  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G   M+FA YGP+WR  +K  T ELL+  KI SF  +RR E+   ++S++  
Sbjct  103   EGAKHVIFGQTNMSFAKYGPYWRDMRKMCTLELLSNHKINSFKAMRREEVSLLIQSVQED  162

Query  570   AGGREA-VDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADY  734
             A  R   ++L+ ++  L  ++T +++FG      + D      +++E + ++ A N+ D+
Sbjct  163   ANBRRVPINLSDKIASLSVDLTCRLVFGKKYKDEDFDERGFTAVLKESIQIVAAPNLNDH  222

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
             +PFL+PFDLQGL K+++++ K  +  F +I+ +H Q      ++  KD VD++L  M + 
Sbjct  223   IPFLRPFDLQGLTKKMKSINKKFNTFFEKIIDDHLQSKD---EERTKDFVDVVLGRMGSE  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              S ++++   +KA++ DM   ++DT  + I W L+E++R+P+VMK LQ+ELEN VGLNRM
Sbjct  280   ESDYRIERVHVKAVMLDMFAAALDTPPSAILWALSELLRHPQVMKKLQKELENVVGLNRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  LEYL++V+KE+ RLHPV  LL+P  S+ED  ++G+ IPK
Sbjct  340   VEESDLEKLEYLDIVVKETLRLHPVLPLLLPHLSIEDCTVDGYHIPK  386


 Score =   147 bits (371),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+++N WAIG DPS W D  E+F PERF   ++D++G  F L+PFG GRR C
Sbjct  381   GYHIPKNSRLIVNAWAIGRDPSAWED-AEKFVPERFEGSNIDVKGKHFQLIPFGSGRRRC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ LGL  V+ ++ Q++HCF+WELP+ M P+ELDMTE FGLA  + + L+ +PSYRL
Sbjct  440   AGMQLGLTVVQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLAVSRTKDLLLIPSYRL  497



>ref|XP_006348217.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
 ref|XP_006354706.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=492

 Score =   270 bits (689),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 212/343 (62%), Gaps = 1/343 (0%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH  G   H++L +++KKYGPIM +  G VP ++ SSP AA+  LK HD +FASRP +
Sbjct  38    GNLHMFGENLHQDLYKIAKKYGPIMTIYFGLVPTIIASSPHAAQQFLKNHDQIFASRPYH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A   I    + +    YGP+WR  +K  TQ+LL+  KI SF  +R+ E+   V  +E A
Sbjct  98    AACYYIFYKQRNLIMGKYGPYWRHMRKLCTQQLLSNVKINSFQSMRKQELQILVNFLEKA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS-NNDNHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A  R+ VDL+A++  L  N+   M+ G   NN + D K +V+E   +    N+A+  PFL
Sbjct  158   ASNRDVVDLSAKLASLSANMACLMVIGKKYNNVDGDFKDMVKETSRMAATPNLAELFPFL  217

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
             +  D QG   R++ + KS D+    ++ EH +   +   K++ D+VD ++  M++  +  
Sbjct  218   RFIDFQGSIHRMKQIAKSCDEFLENVIDEHARQYSSDQSKTSTDMVDTLMEIMQSGEAEF  277

Query  927   KLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEK  1106
             + D   +KA+L D++V S+DTS   IEW L+E+ R+P VMK LQ EL+  VG   +VEEK
Sbjct  278   EFDRRHVKAILLDLLVASMDTSSTSIEWILSELFRHPNVMKKLQSELDYVVGQKGIVEEK  337

Query  1107  DLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             DL NL+YL MVIKE FRLHPVA LL+P ES+ED  L+G  IPK
Sbjct  338   DLENLDYLNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFHIPK  380


 Score =   141 bits (355),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SRV++N WAIG DP +W +  E+F PERF+  ++D+RG +F LLPFG GRR C
Sbjct  375   GFHIPKGSRVLVNVWAIGRDPDVWHEP-EKFIPERFVESTIDVRGQNFQLLPFGSGRRSC  433

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+L+V QL+H F+WE PN M   +++MTE FGL + +   L+A+P YR+
Sbjct  434   PGLQLGLTIVRLVVAQLVHSFDWEFPNGMMSCDINMTEKFGLVTARALSLMAIPIYRV  491



>ref|XP_008344234.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=496

 Score =   260 bits (664),  Expect(2) = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 219/347 (63%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P  +L +L++KYG IMYL+LG    VVVSS  AAEL LKTHD  FASRP N
Sbjct  41    GSLHLLGKFPTMDLRQLAQKYGDIMYLRLGLQYTVVVSSARAAELFLKTHDLNFASRPPN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G K ++FA YG +W   +K    ELL+  KI SF  +RR E+   +KS++  
Sbjct  101   EGAKHLIFGQKSLSFAEYGSYWTNMRKICMLELLSNQKINSFKSMRREEVALLIKSVQED  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
                R   +LT +V  L  ++T +M+FG    D       +  +++E + L  A N+ D+ 
Sbjct  161   TNNRRIANLTDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVSVMKEGLKLAAAPNLGDFF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL K+++A+ K  D  + +I+ +H Q       +  KD  D ML+ M +  
Sbjct  221   PCIAPLDLQGLTKKMKAVNKVFDDFYEKIIDKHLQSKD---AERTKDFTDAMLSYMGSEE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM+V S DTS   + W L+E+MR+P+VMK +Q+ELEN VGLNRMV
Sbjct  278   SDYRIERLNIKAMMSDMLVASADTSSTTVLWVLSELMRHPQVMKKVQKELENVVGLNRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D   LEYL+MV+KE+ RLHPV  LL+P  ++ED  ++G+ IPKK
Sbjct  338   EESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   150 bits (379),  Expect(2) = 8e-105, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKS V++N WAIG DP  W D  E+F PERF   +VD+RGH F +LPFG GRR C
Sbjct  378   GYHIPKKSSVIVNVWAIGRDPIAWGD-AEKFVPERFEDSNVDVRGHHFQILPFGSGRRRC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ LG+  V  +  QL+HCF+WELP+ M P+ELDMTE FGLA  + ++L+A+PSYRL
Sbjct  437   IGMQLGITVVHFVSAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIPSYRL  494



>ref|XP_004488758.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=496

 Score =   280 bits (716),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 230/347 (66%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L +LG+ PHR+L++LS+KYGPIM+++LG +P +VVSSP AA+  LKTHD VFASRP  
Sbjct  39    GSLLKLGSNPHRDLHQLSQKYGPIMHMRLGLIPTIVVSSPQAAKHFLKTHDLVFASRPYV  98

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K I    K +AF  YG +WR  +K  T EL++ +KI SF  +R  E+   +K +  A
Sbjct  99    EAAKYIFWEQKDVAFCEYGSYWRNMRKMCTLELMSQSKINSFRSMREEEVDILIKFLREA  158

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             +     VD++A+V  L+ ++T +M+ G    D        KL++ E ++L+G  NI DY+
Sbjct  159   SNDGTKVDISAKVSTLMVDMTCRMVVGKKYMDKELDEKGFKLMMDEAMNLLGTPNIGDYI  218

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEH-EQDAKNGVQKSNKDIVDMMLASMKNP  914
             P++   DLQGL KR++ + K  D  F +I++EH + + K+G      D VD++L  +   
Sbjct  219   PYIGLLDLQGLTKRMKVISKIFDDFFDKIIEEHIKSNDKDG---EPMDFVDVLLGFLGTE  275

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                ++++ ++IKA++ D+ + S DTS   IEWT++E+++NPRVMK +Q+ELE+ VGL R 
Sbjct  276   EYDYRIERSNIKAIMMDIFIASTDTSSTTIEWTISELLKNPRVMKKVQKELESVVGLKRK  335

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  LEYL+MVIKESFR+HP   LL+P +SLED  +   FIPK
Sbjct  336   VEESDLDKLEYLDMVIKESFRIHPAGPLLIPHQSLEDCMVEDFFIPK  382


 Score =   130 bits (326),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SRV++N W+I  D   WSD  E+F+PERF   ++D +G  F L+PFG GRR CPG+ 
Sbjct  381   PKNSRVIVNAWSIMRDKMAWSDP-EKFWPERFEGSNIDAKGSYFELIPFGSGRRGCPGLK  439

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  V+L+V QL+HCF+++LP+ +  ++LDMTE FGL   +  HL+ +P+YRL
Sbjct  440   LGLTIVRLVVAQLVHCFDFKLPDNILSYDLDMTEKFGLNLIRANHLLVIPTYRL  493



>gb|KHN38214.1| Cytochrome P450 71A1 [Glycine soja]
Length=436

 Score =   259 bits (661),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 206/323 (64%), Gaps = 6/323 (2%)
 Frame = +3

Query  282   MYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRG  461
             M+L+LG VP +VVSSP AAEL LKTHD VFASRP  +A K I+   + ++FA YG +WR 
Sbjct  1     MHLRLGFVPTIVVSSPQAAELFLKTHDLVFASRPPLEAAKYISWEQRNLSFAEYGSYWRN  60

Query  462   NKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKM  641
              +K  T ELL+  KI SF  +R  E+   VK +  AA     VDL+A+V  L  +++ +M
Sbjct  61    VRKMCTLELLSHTKINSFRSMREEELDLMVKLLREAAKDGAVVDLSAKVSTLSADMSCRM  120

Query  642   LFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
             + G      + D    K ++QE + L    N+ DY+P++   DLQGL KR++ +GK  D 
Sbjct  121   VLGKKYMDRDLDEKGFKAVMQEGMHLAATPNMGDYIPYIAALDLQGLTKRMKVVGKIFDD  180

Query  810   LFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDLASIKALLFDMIVGSVDT  989
              F +I+ EH Q  K   +   KD VD+ML  +    S ++++  +IKA+L DM+ GS+DT
Sbjct  181   FFEKIIDEHLQSEKG--EDRTKDFVDVMLDFVGTEESEYRIERPNIKAILLDMLAGSMDT  238

Query  990   SYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPV  1169
             S   IEWTL+E+++NPRVMK +Q ELE  VG+ R VEE DL  L YL+MV+KES RLHPV
Sbjct  239   SATAIEWTLSELLKNPRVMKKVQMELETVVGMKRKVEESDLDKLVYLDMVVKESMRLHPV  298

Query  1170  ATLLVPRESLEDIELNGHFIPKK  1238
             A LL+P +S ED  +   FIPKK
Sbjct  299   APLLIPHQSTEDCMVGDLFIPKK  321


 Score =   150 bits (380),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSRV++N WAI  DPS W D  E+F+PERF   S+D+RG +F L+PFG GRR CPG+ 
Sbjct  319   PKKSRVIVNAWAIMRDPSAW-DEAEKFWPERFEGSSIDVRGREFELIPFGSGRRGCPGLQ  377

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  V+L V Q++HCF+W+LP  + P +LDM E FGL  P+  HL A+P+YRL
Sbjct  378   LGLTVVRLTVAQIVHCFDWKLPKDILPDDLDMKEEFGLTMPRANHLHAIPTYRL  431



>ref|XP_009372726.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   260 bits (665),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 220/347 (63%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P  +L +L++KYG IMYL+LG    VVVSS  AAEL LKTHD  FA+RP N
Sbjct  41    GSLHLLGKFPTMDLRQLAQKYGDIMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G K ++FA YG +W   +K    ELL+  KI SF  +RR E+   +KS++  
Sbjct  101   EGAKHLIFGQKSLSFAEYGSYWTNMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQED  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A  R   +LT +V  L  ++T +M+FG    D       +  +++E + L GA N  D+ 
Sbjct  161   ANNRRIANLTDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNWGDFF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL K+++A+ K  D  + +I+ EH Q       +  KD  D MLA M +  
Sbjct  221   PCIAPLDLQGLTKKMKAVNKVFDDFYEKIIDEHLQSMD---AERTKDFTDAMLAYMGSEE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM+V S DTS   + W L+E+MR+P+VMK +Q+E++N VGLNRMV
Sbjct  278   SDYRIERLNIKAMMSDMLVASADTSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D   LEYL+MV+KE+ RLHPV  LL+P  ++ED  ++G+ IPKK
Sbjct  338   EESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   148 bits (373),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DPS W D  E+F PERF   +VD+RGH F +LPFG GRR C
Sbjct  378   GYHIPKKSRVIVNVWAIGRDPSAWED-AEKFVPERFEDSNVDVRGHHFQILPFGSGRRRC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVP  1560
              G+ LG+  V  ++ QL+HCF+WELP+ M P+ELDMTE FGLA  + ++L+A+P
Sbjct  437   VGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIP  490



>ref|XP_006366158.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=498

 Score =   260 bits (665),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 215/347 (62%), Gaps = 9/347 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++  +L+K +GP+MY++LG VP +VVSS   AE  LKT+D +FASRP N
Sbjct  41    GHLHLLGKNPHQDFLKLAKTHGPLMYVRLGLVPTIVVSSADTAEKFLKTYDHIFASRPHN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIE-A  566
             +A   +A G K +  A +GP+WR  +K  TQ L    KI SF  +R+ ++   +KS++  
Sbjct  101   EAAYYLAYGQKNLISAKHGPYWRSMRKLCTQHLFGNQKINSFQSMRKQQVEVMIKSLKNE  160

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADY  734
             A   R  VDL+A++  L  ++T  M+FG      + D    K +V+E+  L    N+ ++
Sbjct  161   ACDHRVVVDLSAKISSLNADLTCLMVFGKKYMDEDLDKRGFKALVKEVEHLAATPNLGEF  220

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              PFL   DLQGL +R++ L K  D  F +I+ EH Q      QK +KD VD ML  M++ 
Sbjct  221   FPFLGVIDLQGLTRRIKDLSKVFDDFFEKIIDEHVQSRD---QKQSKDFVDTMLDIMQSG  277

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              +  + D   IKA+LFDM++ ++ TS + IEW L E++R+P VMK LQ+ELE  VGL +M
Sbjct  278   EAEFQFDRRHIKAILFDMLIAAMGTSPSAIEWILTELLRHPHVMKKLQKELEEVVGLEKM  337

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             V+E DL NL YL+MV+KE  RLH VA  L P E++ED  +N   I K
Sbjct  338   VKESDLENLNYLDMVVKEGLRLHAVAP-LAPHEAMEDCVVNSFNIQK  383


 Score =   147 bits (372),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K SR+MIN +A+  DP+IW +  E+F PERF+  S+DIRGHDF LLPFG GRR CP + L
Sbjct  383   KGSRIMINFYAVQRDPNIWPEP-EKFLPERFVGSSIDIRGHDFQLLPFGSGRRRCPAMQL  441

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              ++ V LIV QL+HCF+WELPN M P +LD+ E FGLA+ +  HL+A+P+YRL
Sbjct  442   AIVLVYLIVAQLVHCFDWELPNGMQPCDLDVEEHFGLATSRENHLMAIPTYRL  494



>ref|XP_006354722.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=494

 Score =   270 bits (691),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/346 (43%), Positives = 219/346 (63%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L +L+ K+GPIMY++LG VP ++ SS  AAE +LKT+D +FA+RP +
Sbjct  40    GHLHLLGKNPHQDLQKLANKHGPIMYVRLGLVPTIIASSADAAEKVLKTYDHIFATRPHH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + ++ G K + FA YG +WR  +K     LL+  KI SF  +R+ E+   ++S++  
Sbjct  100   EASQYLSYGQKNLIFAKYGVYWRNMRKLCVVHLLSNNKINSFQSMRKQEVELLIESLKKE  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVDL+A++  L  N+T  M+FG      + D    K +VQ++V L    N+ D+ 
Sbjct  160   AHDRVAVDLSAKITSLNANLTCLMVFGKKYMDEDLDKRGFKSVVQDVVHLAATPNLGDFF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+   DLQGL ++L+ L K  D+   +I+ EH        QK  KD VD M+  M++  
Sbjct  220   PFIGAIDLQGLTRKLKDLSKVFDEFLEKIIDEHVHSHD---QKQTKDFVDTMMGIMQSGE  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA+LFDM++ ++DT+ +  EW L E++R+P+VMK LQ+EL+  VGL RMV
Sbjct  277   AEFQFDRRHIKAILFDMLIAAMDTTASSTEWILTELLRHPQVMKKLQKELQEVVGLERMV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL MV+KE  RLHPV  L    ES+ED  ++G  I K
Sbjct  337   EESDLENLKYLNMVVKEGLRLHPVVPLFY-HESMEDCVVDGFHIQK  381


 Score =   137 bits (346),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SRVM+NC+A   DP++W D  E+F PERF+   +D RG DF L+PFG GRR C
Sbjct  376   GFHIQKGSRVMVNCYAAQRDPNVWPDP-EKFLPERFVGSCIDFRGRDFQLVPFGSGRRSC  434

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ L ++ V+L+V QL+HCF WELPN M P +LD+ E FG+ + + + L+A+P+Y L
Sbjct  435   PGMQLAVMVVRLVVAQLVHCFEWELPNGMQPCDLDIDEKFGIVTCREKPLMAIPTYNL  492



>ref|XP_009631554.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=503

 Score =   265 bits (677),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/346 (44%), Positives = 216/346 (62%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P ++  +LSKK+GPIMYLKLG VP  V+SSP +AE ILKT+D VFASRP N
Sbjct  49    GHLHLLGENPTQDFYKLSKKHGPIMYLKLGLVPTYVISSPESAEKILKTYDHVFASRPHN  108

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  + I+ G + + F+ YG +WR  +K  T  LL+  KI S+   R  E+   +KSI+ +
Sbjct  109   ETAQYISYGQRNLIFSKYGAYWRNMRKLCTVHLLSNHKINSYRSTRSEEVALMIKSIKPS  168

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A     VDL+A+V  L  N++  M+FG      + D    K +VQE+  L    N+ D+ 
Sbjct  169   AQDGVVVDLSAKVSSLSANLSCLMVFGKKFMDEDLDKRGFKSLVQEVTHLAATPNLGDFF  228

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF    D+QGL +R++ + K  D+   +I+ EH Q      QK  KD VD M++ M++  
Sbjct  229   PFFGVIDIQGLTRRMKDISKVFDEFVEKIIDEHVQTTD---QKKTKDFVDTMMSIMQSGE  285

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L DM+V S+DTS   +EW L+E+++NP VM+ LQ+ELE  V L+RMV
Sbjct  286   AEFQFDRRHVKAVLLDMLVASIDTSSTSVEWMLSELLKNPNVMEKLQKELEEVVVLDRMV  345

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL  L+YL MV KESFRLH  A LL+  E++ED  ++  +I K
Sbjct  346   EESDLDKLKYLNMVFKESFRLHAAAPLLL-HEAMEDCMVDDFYIQK  390


 Score =   142 bits (359),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K S+V++N ++I  DP++W +  ++F PERF+  +VD+RG DF LLPFG GRR CPG++L
Sbjct  390   KGSQVIVNSYSIHMDPNVWPE-ADKFLPERFLESNVDVRGRDFQLLPFGSGRRSCPGMHL  448

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              LI V+L+V QL+HCF+W+LPN + P +LDMTE FG+ + + ++L+A+P+YRL
Sbjct  449   ALIIVRLVVAQLVHCFDWKLPNGIQPKDLDMTEKFGIVTGRAKNLMAIPTYRL  501



>ref|XP_004237615.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=492

 Score =   271 bits (693),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/346 (44%), Positives = 221/346 (64%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L +L+ K+GPIMY++LG VP  V SS  AAE +LKT+D VFASRP +
Sbjct  37    GHLHLLGKNPHQDLQKLANKHGPIMYMRLGLVPTFVASSADAAEKVLKTYDHVFASRPHH  96

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + ++ G K + FA YG +WR  +K  T  LL+  KI SF  +R+ ++   ++S++  
Sbjct  97    EASQYLSYGQKNLIFAKYGVYWRNMRKLCTVHLLSNNKINSFQSMRKQQVQLLIESLKKE  156

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R AVDL+A++  L  N+T  M+FG      + D    K IVQ++V L    N+ D+ 
Sbjct  157   AHDRVAVDLSAKITSLNANLTCLMVFGKKYMDEDLDKRGFKSIVQDVVHLAATPNLGDFF  216

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQGL ++L+ L +  D+   +I+ EH    ++   K  KD VD M+  M++  
Sbjct  217   PFLGAIDLQGLTRKLKDLSEVFDEFLEKIIDEHVHSHEH---KQTKDFVDTMMGIMQSGV  273

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  +LD   IKA+LFDM++ ++DT+ +  EW L E++R+P+VMK LQ+EL+  VGL R V
Sbjct  274   AEFQLDRRHIKAILFDMLIAAMDTTASSTEWILTELLRHPQVMKKLQKELQEVVGLERTV  333

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL+YL+MV+KE  RLHPV  L    ES+ED  ++G  I K
Sbjct  334   EESDLENLKYLDMVVKEGLRLHPVVPLFY-HESMEDCVVDGFHIKK  378


 Score =   135 bits (341),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SRVM+NC+A   DP++W +  E F PERF+   +D RG DF L+PFG GRR C
Sbjct  373   GFHIKKGSRVMVNCYAAQRDPNVWPEP-EMFLPERFVGSCIDFRGRDFQLVPFGSGRRSC  431

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ L +I V+L+V QL+HCF WELPN M P +LD+ E FG+ + + + L+A+P+Y L
Sbjct  432   PGMQLAVIVVRLVVAQLVHCFEWELPNGMQPCDLDIDEKFGMVTCREKPLMAIPTYNL  489



>gb|EYU31074.1| hypothetical protein MIMGU_mgv1a005121mg [Erythranthe guttata]
Length=496

 Score =   255 bits (651),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/348 (41%), Positives = 210/348 (60%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  PH++L+ L++K+GPIMYL+ G VP VV SSPA AEL+LKTHD VFA R  N
Sbjct  38    GHFHLLGKNPHQDLHRLAQKHGPIMYLRFGFVPTVVFSSPAGAELVLKTHDLVFAGRASN  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K+I+   + + FA YG +WR  +K AT  LL+ +K+  F  +R+ E+   V S+  A
Sbjct  98    QAAKHISYDGRNIVFAQYGSYWRDMRKLATLNLLSTSKVSQFQPVRKAELRLAVDSLRRA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFG------TSNNDNHDLKLIVQEIVSLIGAFNIAD  731
             A GRE VD++  +   I ++   M+FG               K ++ E   +    N+ D
Sbjct  158   AAGRETVDVSEMIMGTIGDMVCLMVFGRKFAGGELGGSGGGFKYVIDETFQVAAKPNLGD  217

Query  732   YLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKN  911
             + P++   DLQGL +R++ L  + D    +I+ +H    K   +K N+D VD M+A M +
Sbjct  218   FFPYMGTIDLQGLTRRMKELSTTFDGFLEKIIDDHVLQNKQQ-KKENQDFVDTMMAIMDS  276

Query  912   PSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNR  1091
               +  + D   +KA+L DM++G  DTS A I+W LAE++R+P++MK LQ+ELE  VGL++
Sbjct  277   GEAGFEFDRRHVKAVLLDMLLGGTDTSSATIDWALAELIRHPQIMKKLQQELEQVVGLDQ  336

Query  1092  MVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
              VEE  L  L+YL  V+KE+FRLHPV  L +  E+LED  +    I K
Sbjct  337   YVEESHLEKLDYLNFVVKETFRLHPVVPLFI-HEALEDCTVEEFHIAK  383


 Score =   151 bits (381),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K +R+M+N W++  DP++W D  E+FFPERF+  ++D+ GHDF LLPFG GRR CPG+ L
Sbjct  383   KGTRIMVNVWSMSKDPNVWQDP-EKFFPERFIGSNLDLHGHDFELLPFGSGRRSCPGLQL  441

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL  V+L++ QL+HCF+WELPN MSP ELDM+E FGL + K +H++A+P  RL
Sbjct  442   GLTTVRLVLAQLVHCFDWELPNGMSPSELDMSEHFGLVTGKDKHIMAIPVCRL  494



>ref|XP_010094781.1| Cytochrome P450 71D8 [Morus notabilis]
 gb|EXB56946.1| Cytochrome P450 71D8 [Morus notabilis]
Length=508

 Score =   333 bits (855),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 251/350 (72%), Gaps = 8/350 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH L  LPHR L  L+KKYGPIM ++LG+VP VVVSSP AAELIL+THDA+FASRPK 
Sbjct  42    GNLHMLTPLPHRGLQALAKKYGPIMSMRLGRVPTVVVSSPQAAELILQTHDAIFASRPKV  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A   ++ GSKGMAF  YGP+WR  +KF T +LLT++K  SF  LR  E+ + V S+ AA
Sbjct  102   QASAYLSYGSKGMAFNEYGPYWRNVRKFCTLQLLTSSKTASFAALRAAEVASLVASLRAA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND-NHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A   E VD++++VGRL+ +++ +++ G +  D  +DLK +V+EI+ L GAFN+ADY+P+L
Sbjct  162   AAAGEVVDVSSKVGRLVADISCRIVLGRNVGDERYDLKRLVEEIMRLTGAFNLADYVPYL  221

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
              P DLQG  ++L+ + K +DK+  EI+ EHE+  +   Q  + D +D++L+ M  P +  
Sbjct  222   APLDLQGYTRQLKKVNKEMDKVLEEIIAEHEEVGRYK-QGHHDDFIDVLLSLMNQPMNPQ  280

Query  927   K------LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
                    +D  +IKA+L D++  ++DTS A +EWTL+E+++NPRVMK  Q ELE+ +G+ 
Sbjct  281   DRENVFIIDRTNIKAILVDLLTAALDTSSASVEWTLSELIKNPRVMKNAQRELESVIGME  340

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             R VEEKD+  L+YL+MV+KESFRLHPV  LL+PRESL++I + G+ IP K
Sbjct  341   RTVEEKDVEKLDYLDMVVKESFRLHPVIPLLLPRESLKEITIKGYHIPNK  390


 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 6/135 (4%)
 Frame = +1

Query  1171  PRCSFPESRWKISS*TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERF-MSKSVDI  1347
             PR S  E   K     G   P KSRV++N WAIG DP++WS+NVEEF+PERF  S  +D 
Sbjct  373   PRESLKEITIK-----GYHIPNKSRVIVNVWAIGRDPNVWSENVEEFYPERFGESDDIDF  427

Query  1348  RGHDFHLLPFGYGRRVCPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLA  1527
             RG DF LLPFG GRR CPG+ LGL  +  +V QL+HCF+WE+P+ M+P E+DM E FGL+
Sbjct  428   RGRDFRLLPFGSGRRGCPGMQLGLTTIHFVVAQLVHCFSWEVPSGMNPAEIDMIEKFGLS  487

Query  1528  SPKVQHLVAVPSYRL  1572
               +  HL+  P YRL
Sbjct  488   VVRANHLLLKPIYRL  502



>ref|XP_004143572.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase 1-like 
[Cucumis sativus]
Length=500

 Score =   271 bits (693),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/346 (43%), Positives = 219/346 (63%), Gaps = 7/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PHR+ + LSKKYG IM++KLG V  +VVSS  AAEL LKTHD  FA+ P N
Sbjct  45    GSLHILGKFPHRDFHRLSKKYGAIMHIKLGLVNTIVVSSSEAAELFLKTHDLDFANHPPN  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             DA+K+I+ G   M  A  GP+ R  +K  TQ+LL + K+ SF  +R  E+  +++ +  A
Sbjct  105   DALKHISFGQSSMVVAKDGPYVRSVRKMCTQKLLNSHKLNSFKSMRMEEVGLFIQELREA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A     V+LT+++  L  N+    +FG    D        K +V E + +IGA N+ D++
Sbjct  165   ARSGLLVNLTSKLSSLGANMICLTVFGRKYKDKELDAKGFKRMVGEALKVIGAVNVGDFI  224

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+ P DLQGL +R +++ K  D+    I+ EH +   N    S KD VD+ML  M++  
Sbjct  225   PFIAPLDLQGLIRRAKSVHKVFDRFLERIIDEHLESKNNN---STKDFVDVMLEIMESQQ  281

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++D ++IKA++ D++   +DT+   I W +AE++R+P +MK +Q ELE  VGL RMV
Sbjct  282   TDYQIDRSTIKAIMLDLLFAGMDTTTTTIGWAIAELIRHPEIMKKVQNELEEVVGLKRMV  341

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             +E +L +L+YLEMV+KE FRLHP A LL+P + L+D  +N   IPK
Sbjct  342   QESELSHLKYLEMVVKEVFRLHPPAPLLIPHQPLKDCIVNNFHIPK  387


 Score =   134 bits (336),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SRV++N WAIG DP  W+D    FFPERF+   VD++G+ F L+PFG GRR C G+ 
Sbjct  386   PKMSRVIVNAWAIGRDPCAWTD-AHRFFPERFIGSKVDVKGNHFELIPFGSGRRGCVGIQ  444

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             +GL+ V  ++  L+HCF+W+LPN M P +LD TE FG++ P    ++  P YRL
Sbjct  445   MGLLKVHFVLAXLLHCFDWKLPNGMLPVDLDTTEEFGISCPLAHDVMVTPIYRL  498



>ref|XP_004172515.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase 1-like 
[Cucumis sativus]
Length=475

 Score =   271 bits (693),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/346 (43%), Positives = 219/346 (63%), Gaps = 7/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PHR+ + LSKKYG IM++KLG V  +VVSS  AAEL LKTHD  FA+ P N
Sbjct  20    GSLHILGKFPHRDFHRLSKKYGAIMHIKLGLVNTIVVSSSEAAELFLKTHDLDFANHPPN  79

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             DA+K+I+ G   M  A  GP+ R  +K  TQ+LL + K+ SF  +R  E+  +++ +  A
Sbjct  80    DALKHISFGQSSMVVAKDGPYVRSVRKMCTQKLLNSHKLNSFKSMRMEEVGLFIQELREA  139

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A     V+LT+++  L  N+    +FG    D        K +V E + +IGA N+ D++
Sbjct  140   ARSGLLVNLTSKLSSLGANMICLTVFGRKYKDKELDAKGFKRMVGEALKVIGAVNVGDFI  199

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+ P DLQGL +R +++ K  D+    I+ EH +   N    S KD VD+ML  M++  
Sbjct  200   PFIAPLDLQGLIRRAKSVHKVFDRFLERIIDEHLESKNNN---STKDFVDVMLEIMESQQ  256

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++D ++IKA++ D++   +DT+   I W +AE++R+P +MK +Q ELE  VGL RMV
Sbjct  257   TDYQIDRSTIKAIMLDLLFAGMDTTTTTIGWAIAELIRHPEIMKKVQNELEEVVGLKRMV  316

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             +E +L +L+YLEMV+KE FRLHP A LL+P + L+D  +N   IPK
Sbjct  317   QESELSHLKYLEMVVKEVFRLHPPAPLLIPHQPLKDCIVNNFHIPK  362


 Score =   134 bits (336),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SRV++N WAIG DP  W+D    FFPERF+   VD++G+ F L+PFG GRR C G+ 
Sbjct  361   PKMSRVIVNAWAIGRDPCAWTD-AHRFFPERFIGSKVDVKGNHFELIPFGSGRRGCVGIQ  419

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             +GL+ V  ++  L+HCF+W+LPN M P +LD TE FG++ P    ++  P YRL
Sbjct  420   MGLLKVHFVLAXLLHCFDWKLPNGMLPVDLDTTEEFGISCPLAHDVMVTPIYRL  473



>ref|XP_006367702.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=542

 Score =   264 bits (674),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/346 (43%), Positives = 216/346 (62%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L +L+KK+GPIMY++LG VP +VVSS  AAE +L+ +D +FASRP +
Sbjct  84    GHLHLLGKNPHQDLQKLAKKHGPIMYVRLGLVPTIVVSSADAAEKVLRRYDHIFASRPHH  143

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ G K +AFA YGP+W   +K  T  LL+  KI SF  +R+ E+   ++SI+  
Sbjct  144   QTSQYLSYGQKNLAFAKYGPYWHNMRKLCTVHLLSNHKIHSFQSMRKQEVELLIESIKME  203

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A++  L  N+T  M+FG      + D    K +VQ+ V L    N+ D+ 
Sbjct  204   AHHHVAVDLSAKITSLNANLTCLMVFGKKYMDEDFDKRGFKTVVQDAVHLAAMPNLGDFF  263

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQG  ++L+ L K  D+    I+ EH    +   +K  KD VD M+  MK+  
Sbjct  264   PFLGVIDLQGFTRKLKDLSKVFDEFLERIIDEH---VEYHDRKQTKDFVDTMMDIMKSGE  320

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +    D   IKA+L DM++ S+DT+ +  +W LAE++R+P+VMK LQ+EL+  VG+ RMV
Sbjct  321   AEFPFDRTHIKAILLDMLLASMDTTASSTDWILAELLRHPQVMKKLQKELQEVVGVERMV  380

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL NL YLEMV+KE  RLHPV  L    E++ED  ++G  I K
Sbjct  381   EESDLVNLNYLEMVVKEGMRLHPVGPLFY-HEAMEDCVVDGFQIHK  425


 Score =   140 bits (352),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SR +INC+A+  DP++W +  E+FFPERF   S+D RG+DF L+PFG GRR C
Sbjct  420   GFQIHKGSRTVINCYAVQRDPNVWPEP-EKFFPERFFGSSIDFRGNDFQLVPFGSGRRSC  478

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LG+  V+L+V QL+HCF WELPN + P +LD+ E FG+ + + + L+A+P+YRL
Sbjct  479   PGMQLGVTVVRLVVAQLVHCFEWELPNGIQPCDLDIDEHFGIVTCREKPLLAIPTYRL  536



>ref|XP_008441066.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=499

 Score =   280 bits (715),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/350 (45%), Positives = 228/350 (65%), Gaps = 16/350 (5%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG L H++L+ LS+ YGPIM+++LG +PA++VSS  A EL LKTHD  FASRP  
Sbjct  44    GSLHLLGKLIHKDLHYLSQIYGPIMHIQLGLLPAIIVSSARATELFLKTHDLHFASRPLT  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                 +I+ G KG+ FA YGP+WR  +K  T ELL++ KI SF  +R+ E+ + +K +E A
Sbjct  104   ITSNHISYGRKGIVFAQYGPYWRNIRKMCTLELLSSLKINSFSSMRKQEVGSLIKGLEDA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A    AVDLT+++  +I ++   M+ G    DN       K +++E   L  A N+ D++
Sbjct  164   ATDGVAVDLTSKISSVIGDMICVMVLGRKYEDNELGEKGFKGLIREATQLAAAPNLGDFI  223

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEH---EQDAKNGVQKSNKDIVDMMLASMK  908
             P +  FD+QG   R +A+GK  D     IV+EH   E+D K      +KD VD++L  M 
Sbjct  224   PLIARFDVQGFGGRAKAVGKIFDGFLESIVEEHVVFEKDNK------DKDFVDVLLDLMG  277

Query  909   NPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
               S  +++D ++IKA++ D ++ +VD++   I W L+E++++P +MK LQEELE  VGLN
Sbjct  278   --SREYQIDRSNIKAIILDFVIAAVDSTTTTINWMLSELIKHPHIMKKLQEELEKVVGLN  335

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             RMVEE DL NL+YLEMV+KES R+HP    L+PRE ++D  +NG+ IPKK
Sbjct  336   RMVEESDLSNLKYLEMVMKESLRMHPPVP-LIPRECIQDCNINGYHIPKK  384


 Score =   124 bits (310),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR++IN WAIG DP+ W D   +F PERF+   VD+RG DF L+PFG GRR C
Sbjct  378   GYHIPKKSRIVINAWAIGRDPNTWVDP-HKFDPERFLESEVDVRGRDFELIPFGSGRRGC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ L L+ V+L+V QL+HCF+ +LP+ MSP ELDMTE  GL  P+ Q+L  +P +RL
Sbjct  437   VGIQLALVVVRLVVAQLLHCFDLKLPDGMSPLELDMTEILGLTCPRAQNLRVIPIFRL  494



>gb|EYU31075.1| hypothetical protein MIMGU_mgv1a005090mg [Erythranthe guttata]
Length=497

 Score =   255 bits (652),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 212/347 (61%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  PH++L+ L++K+GPIMYL+ G VP VV SSPA AEL+LKTHD VFA RP  
Sbjct  40    GHFHLLGKNPHQDLHRLAQKHGPIMYLRFGFVPTVVFSSPAGAELVLKTHDLVFAGRPSI  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K+I+   + + FA YG +WR  +K AT  LL+++KI  F  +R+ E+   V S+  A
Sbjct  100   QAAKHISYDGRNIVFAQYGSYWRDMRKLATINLLSSSKISQFQPVRKAELRLAVDSLRRA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFG-----TSNNDNHDLKLIVQEIVSLIGAFNIADY  734
             A GRE VD++  +   I ++   M+FG          +   K ++ E   +    N+ D+
Sbjct  160   AAGRETVDVSEMIMGTIGDMVCLMVFGRKFAGGGLGGSGGFKSVIDETFQVAAKPNLGDF  219

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              P++   DLQGL +R++ L  + D    +I+ +H    K   +K N+D VD M+A M + 
Sbjct  220   FPYMGTIDLQGLTRRMKELSTTFDGFLEKIIDDHVLQNKQQ-KKENQDFVDTMMAIMDSG  278

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              +  + D   +KA+L DM++G  DTS A I+W LAE++R+P++MK LQ+ELE  VGL++ 
Sbjct  279   EAGFEFDRRHVKAVLLDMLLGGTDTSSATIDWALAELIRHPQIMKKLQQELEQVVGLDQY  338

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE  L  L+YL  V+KE+FRLHPV  L +  E+LED  +    I K
Sbjct  339   VEESHLEKLDYLNFVVKETFRLHPVVPLFI-HEALEDCTVEEFHIAK  384


 Score =   148 bits (373),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K +R+M+N W++  DP++W D  E+FFPERF+   +D+ GHDF LLPFG GRR CPG+ L
Sbjct  384   KGTRIMVNVWSMSKDPNVWQDP-EKFFPERFIGSDLDLLGHDFELLPFGSGRRSCPGLQL  442

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL  V+L++ QL+HCF+WEL N MSP+ELDM+E FGL + K +H++A+P  RL
Sbjct  443   GLTTVRLVLAQLVHCFDWELTNGMSPNELDMSEHFGLVTGKDKHIMAIPVCRL  495



>ref|XP_009372725.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   260 bits (665),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 221/347 (64%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  P  +L +L++KYG IMYL+LG    VVVSS  AAEL LKTHD  FA+RP N
Sbjct  41    GSLHLLGKFPTMDLRQLAQKYGDIMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPN  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  K++  G K ++FA YG +W   +K    ELL+  KI SF  +RR E+   +KS++  
Sbjct  101   EGAKHLIFGQKSLSFAEYGSYWTNMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQED  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A  R   +LT +V  L  ++T +M+FG    D       +  +++E + L GA N+ D+ 
Sbjct  161   ANNRRIANLTDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNLGDFF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL K+++A+ K  D  + +I+ EH Q       +  KD +D MLA M +  
Sbjct  221   PCIAPLDLQGLTKKMKAVNKEFDDFYEKIIDEHLQSKD---AERTKDFIDAMLAYMGSEE  277

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM+V S DTS   + W L+ +MR+P+VMK +Q+E++N VGLNRMV
Sbjct  278   SDYRIERLNIKAMMSDMLVASADTSSTTVLWALSGLMRHPQVMKKVQKEIKNVVGLNRMV  337

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D   LEYL+MV+KE+ RLHPV  LL+P  ++ED  ++G+ IPKK
Sbjct  338   EESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   142 bits (359),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV++N WAIG DPS+W D  E+F PERF   +VD+RGH F +LPFG GRR C
Sbjct  378   GYHIPKKSRVIVNVWAIGRDPSVWED-AEKFVPERFEDSNVDVRGHHFQILPFGSGRRRC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVP  1560
              G+ LG+  V  ++ QL+H F+WELP+ M P+ELDMT  FGLA  + ++L+A+P
Sbjct  437   VGMQLGITVVHFVLAQLVHWFDWELPDNMLPNELDMTAEFGLAVSRAKNLLAIP  490



>ref|XP_004162328.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=499

 Score =   280 bits (716),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/350 (45%), Positives = 228/350 (65%), Gaps = 16/350 (5%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG L HR+L+ LSK YGPIM+++LG +PA++VSS  A EL LKTHD  FASRP  
Sbjct  44    GSLHLLGKLIHRDLHYLSKIYGPIMHIQLGFLPAIIVSSARATELFLKTHDLHFASRPLT  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                 +I+ G KG+AFA YGP+WR  +K  T ELL++ KI SF  +R+ E+ + ++ +E A
Sbjct  104   ITSNHISYGRKGVAFAQYGPYWRNIRKMCTLELLSSLKINSFSSMRKQEVGSLIEGLEVA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A    AVDLT+++  +I ++   M+ G    DN       K +++E   L  A N+ D++
Sbjct  164   ATDGVAVDLTSKISCVIGDMICVMVLGRKYEDNELDEKGFKGLIREATQLAAAPNLGDFI  223

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEH---EQDAKNGVQKSNKDIVDMMLASMK  908
             P +  FD+QG   R +A+GK  D     IV+E    ++D K      +KD VD++L  M 
Sbjct  224   PLIARFDVQGFGGRAKAVGKIFDGFLERIVEERVVFQRDNK------DKDFVDVLLDLMG  277

Query  909   NPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
               S  +++D ++IKA++ D ++ +VD++   I W L+E+++NP +MK LQEELE  VGLN
Sbjct  278   --SREYQIDRSNIKAIILDFLIAAVDSTTTTINWMLSELIKNPHIMKKLQEELEKVVGLN  335

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             RMVEE DL NL+YLEMVIKES R+HP    L+PRE ++D  +NG+ IP+K
Sbjct  336   RMVEESDLSNLKYLEMVIKESLRMHPPVP-LIPRECIQDCNINGYHIPEK  384


 Score =   122 bits (307),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSR++IN WAIG DP+ W D   +F PERF+   VD++G DF L+PFG GRR C
Sbjct  378   GYHIPEKSRIVINAWAIGRDPNTWVDP-HKFDPERFLESEVDVKGRDFELIPFGSGRRGC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ L L+ V+L+V QL+HCF+ +LPN MSP ELDMTE  GL  P+ Q+L  VP +RL
Sbjct  437   VGIQLALVVVRLVVAQLVHCFDLKLPNGMSPLELDMTEILGLICPRAQNLKVVPIFRL  494



>ref|XP_011090598.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   256 bits (653),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 216/351 (62%), Gaps = 12/351 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  PH++ + L++KYGPIMYL+ G VP +VVSSPAAAEL+LKTHD +FA R  +
Sbjct  40    GHFHLLGKNPHQDFHNLAQKYGPIMYLRFGFVPTIVVSSPAAAELVLKTHDLIFAGRAHH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K I+   + + FA YG +WR  +K  T ELL+  KI  F  +RR E+  +V+S++ A
Sbjct  100   QAAKEISYDKRNIVFAQYGIYWRNMRKLCTLELLSNFKINQFQPMRRAEIEVFVESLQRA  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFG----TSNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             AG RE VD++A++  LI ++T  M+FG      + D    K ++ E + +    NIADY 
Sbjct  160   AGKRETVDISAKISALIGDMTCLMVFGRKFADGDLDEKGFKAVIGETLQVAALPNIADYF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQGL +R++ L K+ D     I+ +H Q+ +   +K  +D  D M+  M++  
Sbjct  220   PFLAALDLQGLTRRMKELSKTFDGFLERIIDDHIQNKQE--KKHAQDFADTMITIMESGE  277

Query  918   SSHKLDLASIKALLF-----DMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVG  1082
             +  + D   +KA+L      D+           +EW L+E++R+P+ MK LQ+ELE  VG
Sbjct  278   AGFEFDRRHVKAVLLVIILQDLXXXXXXXXXTVVEWALSELIRHPKAMKKLQQELEKVVG  337

Query  1083  LNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             ++++VEE  L  LEYL+MV+KE+ RLHP   LL+  ESLED  ++   +PK
Sbjct  338   MDQIVEESHLDRLEYLDMVVKETLRLHPAVPLLI-HESLEDCVVDQFHVPK  387


 Score =   146 bits (369),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SR+++N W+IG DP+ W +  ++F PERF+  ++D+RG DF L+PFG GRR CPG+ 
Sbjct  386   PKGSRLIVNVWSIGKDPNAWREP-QKFLPERFIGSNIDLRGQDFQLIPFGSGRRGCPGLQ  444

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL  1575
             LGL  V+L++ QL+HCF+WELP+ M   ELDM E FGL + +  HL+AVP+YRLL
Sbjct  445   LGLTVVRLVLAQLVHCFDWELPDGMVASELDMAEHFGLVTCRENHLLAVPTYRLL  499



>emb|CDP01384.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   265 bits (676),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 224/347 (65%), Gaps = 7/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG  PH +L +L+KK+GP+MYL+ G VPA++VSSP AAE  LKT+D VFASRP +
Sbjct  42    GNLHLLGKNPHHDLAKLAKKHGPLMYLRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYH  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A   ++   + + F  YGP+WR  +K    +LL++ KI SF  +RR E+   VKS++ A
Sbjct  102   EASWYVSYEQRNLTFGQYGPYWRNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A +  L  N++  M+FG      + D+   + ++QE + +    N+ DY 
Sbjct  162   ASDGAAVDLSAAISSLGANMSCLMIFGKKYMDKDFDDRGFRDVIQEGLHVAAMPNLGDYF  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P L   DLQGL +R + L K  DK F +I+ EH    ++   K  KD VD+M+  M++  
Sbjct  222   PLLGLLDLQGLTRRFKDLAKVFDKFFEKIIDEHLHSQEH---KQTKDFVDIMMGIMQSGE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D + +KA+L D++V S+DTS   +EW ++E++R+P  M+ LQ+ LE KVGL R+V
Sbjct  279   AEFEFDRSHVKAILLDLLVASMDTSVTAVEWAISELLRHPEAMRKLQKALEEKVGLERIV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE D+  LEYL+MVIKES RLHPVA LL+P ES+ED  ++   I KK
Sbjct  339   EESDIEGLEYLDMVIKESMRLHPVAPLLLPHESMEDCTVDDFHIQKK  385


 Score =   137 bits (346),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             KKSR++IN + IG DP++W D    F PERF   ++D+RG DF L+PFG GRR CPG+ L
Sbjct  384   KKSRIIINIYTIGRDPNVWPDPAT-FNPERFKDSNIDLRGQDFRLIPFGSGRRSCPGLQL  442

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL+ V+ ++ QL+HCFNW+L + + P +LDM+E FGL + + +HL  VP+ RL
Sbjct  443   GLLLVRFVLAQLVHCFNWDLADNIQPTDLDMSEAFGLVTSRAKHLKVVPTCRL  495



>ref|XP_004153471.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
 ref|XP_004162314.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=497

 Score =   263 bits (671),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/348 (45%), Positives = 226/348 (65%), Gaps = 8/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPHR+ + LS+KYGPIM++KLG VP ++VSSP AAEL LKTHD VFASRP  
Sbjct  41    GSLHLLGKLPHRDFHILSQKYGPIMHIKLGLVPTIIVSSPKAAELFLKTHDLVFASRPLL  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K +  G K + FAPYGP+WR  +K  T ELL+  KI SF  +R+ E+   ++ ++  
Sbjct  101   EASKQMNYGQKNLVFAPYGPYWRNMRKMCTLELLSNLKINSFMPMRKHELGLLIEYLKEV  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNN----DNHDLKLIVQEIVSLIGAFNIADYL  737
             A  +  V+L+A+V  L  ++   M FG        D    K  +QE   L    N+ D+ 
Sbjct  161   AHNKAVVNLSAKVTSLTTDLICLMAFGKKYGDEEIDERGFKATIQEGSQLAATPNLGDFF  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMK-NP  914
             PF+  FD+Q LN R++ + K +D     IV EH  +AK    K  KD+VD+ML  M    
Sbjct  221   PFIARFDVQRLNNRMQCVHKVLDGFLERIVNEH-LEAKG--DKKTKDLVDVMLELMNFQE  277

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              + +++D ++IKA++ DM+   +DTS   I W ++E++++P +MK LQEELEN++GL+++
Sbjct  278   ETDYQIDRSAIKAIMLDMLSAGMDTSATVIGWAMSELIKHPHIMKKLQEELENEIGLDKI  337

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DL  LEYL+MV+KE FRL+P A LL+P ESL+D  ++G  IPKK
Sbjct  338   VEESDLERLEYLKMVVKEIFRLYPPAPLLLPHESLQDCIVDGFHIPKK  385


 Score =   138 bits (348),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR++IN WAIG D + W D   +F PERF+   VD++G DF L+PFG GRR C
Sbjct  379   GFHIPKKSRIIINVWAIGRDRNSWIDP-HKFDPERFIDSQVDVKGRDFQLIPFGSGRRGC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V+ ++ QL+HCF+W L N M   +LDMTE FGL  P++  L+ +P YRL
Sbjct  438   PGMQLGLTLVQFVLAQLVHCFDWMLSNGMPASQLDMTEEFGLTCPRLHDLIVIPRYRL  495



>ref|XP_004143494.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=501

 Score =   255 bits (651),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 230/347 (66%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L+ L   PHR+L+ LS+KYGPIM++KLG V  ++VSSP AAEL LKTHD +FASRP  
Sbjct  45    GSLNLLKEFPHRDLHRLSQKYGPIMHIKLGLVNTIIVSSPPAAELFLKTHDLIFASRPLT  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                K ++ G K + FA YG +WR  +K  T ELL+  KI SF  +R+ E+   ++ ++ A
Sbjct  105   MVSKFLSYGQKNLVFAQYGSYWRNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A    +V+++++V  L  ++T  M+FG    D    +   K ++QE++ L+ A N+ D +
Sbjct  165   ANDGVSVNISSKVVSLSTDMTCLMVFGRKFGDEELDDRGFKAMIQEVMQLVAAPNLGDLI  224

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+  FDLQGL +R++ + K  D+ F  I+ EH    K+  +K  KD +D+ML  MK+  
Sbjct  225   PFIAMFDLQGLTRRMKNINKVFDRFFERIIDEH---LKSMGEKKTKDFLDVMLDLMKSED  281

Query  918   S-SHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
             +  +++D +S+KA++ D++  ++DTS   I W LAE++R+P VMK +Q+E+EN VGL+RM
Sbjct  282   THEYRIDRSSVKAIILDVLGAAMDTSATVIGWALAELIRHPDVMKKVQDEVENVVGLDRM  341

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL +LEYL+MVIKE  RL+P   LLVP ESL+D  +   FIPK
Sbjct  342   VEELDLIHLEYLDMVIKEILRLYPPLPLLVPHESLQDCIVEDFFIPK  388


 Score =   145 bits (367),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SRV++N WAIG +PS W   ++ F PERFM   +D+RG DF L+PFG GRR CPG+ 
Sbjct  387   PKNSRVIVNAWAIGRNPSAWIHPLK-FCPERFMGSHLDVRGRDFQLIPFGAGRRGCPGIQ  445

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LG+  ++L++ QL+HCF+W+LPN  S  ELDMTE FGL  P+ Q L+ +P YRL
Sbjct  446   LGMTVIRLVLAQLLHCFDWKLPNGTSIDELDMTEEFGLTCPRAQDLIVIPIYRL  499



>ref|XP_004162312.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=501

 Score =   255 bits (651),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 230/347 (66%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L+ L   PHR+L+ LS+KYGPIM++KLG V  ++VSSP AAEL LKTHD +FASRP  
Sbjct  45    GSLNLLKEFPHRDLHRLSQKYGPIMHIKLGLVNTIIVSSPPAAELFLKTHDLIFASRPLT  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                K ++ G K + FA YG +WR  +K  T ELL+  KI SF  +R+ E+   ++ ++ A
Sbjct  105   MVSKFLSYGQKNLVFAQYGSYWRNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             A    +V+++++V  L  ++T  M+FG    D    +   K ++QE++ L+ A N+ D +
Sbjct  165   ANDGVSVNISSKVVSLSTDMTCLMVFGRKFGDEELDDRGFKAMIQEVMQLVAAPNLGDLI  224

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+  FDLQGL +R++ + K  D+ F  I+ EH    K+  +K  KD +D+ML  MK+  
Sbjct  225   PFIAMFDLQGLTRRMKNINKVFDRFFERIIDEH---LKSMGEKRTKDFLDVMLDLMKSED  281

Query  918   S-SHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
             +  +++D +S+KA++ D++  ++DTS   I W LAE++R+P VMK +Q+E+EN VGL+RM
Sbjct  282   THEYRIDRSSVKAIILDVLGAAMDTSATVIGWALAELIRHPDVMKKVQDEVENVVGLDRM  341

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL +LEYL+MVIKE  RL+P   LLVP ESL+D  +   FIPK
Sbjct  342   VEELDLIHLEYLDMVIKEILRLYPPLPLLVPHESLQDCIVEDFFIPK  388


 Score =   145 bits (366),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK SRV++N WAIG +PS W   ++ F PERFM   +D+RG DF L+PFG GRR CPG+ 
Sbjct  387   PKNSRVIVNAWAIGRNPSAWIHPLK-FCPERFMGSHLDVRGRDFQLIPFGAGRRGCPGIQ  445

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LG+  ++L++ QL+HCF+W+LPN  S  ELDMTE FGL  P+ Q L+ +P YRL
Sbjct  446   LGMTVIRLVLAQLLHCFDWKLPNGTSIDELDMTEEFGLTCPRAQDLIVIPIYRL  499



>ref|XP_006354705.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=504

 Score =   251 bits (642),  Expect(2) = 8e-102, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 220/354 (62%), Gaps = 16/354 (5%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG    ++L++ S KYGPI+Y+K G VP  V+SSP +AE ILKT+D +FASRP +
Sbjct  41    GHLHLLGENLTQDLHKFSLKYGPIIYMKFGLVPTYVISSPQSAEKILKTYDHIFASRPHS  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +  + I+ G + + F+ +G +WR  +K  T  LL+  KI SF   R  E+   +KSI+  
Sbjct  101   ETSQYISYGQRNLIFSKHGAYWRNMRKLCTVHLLSNMKINSFQSTRSEEIDIMIKSIKEI  160

Query  570   AGGREA--------VDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIG  713
             A G+          VDL+A+V +L  N++  M+FG      + D    K +VQE+ +L  
Sbjct  161   AQGQGQSQGQGHVEVDLSAQVSKLTANLSCLMVFGKKFTDEDLDKRGFKYLVQEVTTLAA  220

Query  714   AFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMM  893
               N+ D+ PFL   DLQGL +R++   K +D    +I+ EH  +AK+   K NKD VD M
Sbjct  221   TPNLGDFFPFLGVIDLQGLTRRMKDTSKVLDPFVEKIIDEH-VNAKD--HKKNKDFVDTM  277

Query  894   LASMKNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELEN  1073
             +  M++     + D   +KA++ DM+V S+ TS + IEW L+E+++NP +MK LQ+ELE 
Sbjct  278   MDIMQSGEVEFQFDRRHVKAVMLDMLVASIGTSSSSIEWMLSELLKNPDIMKKLQKELEE  337

Query  1074  KVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
              VGLNRMVEE DL NL+YL MV KESFRLH  A LL+  E++ED  ++  ++ K
Sbjct  338   VVGLNRMVEESDLENLKYLNMVFKESFRLHVAAPLLL-HEAMEDCMVDDFYVKK  390


 Score =   148 bits (374),  Expect(2) = 8e-102, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             K S+V++N + I  DP+ W+ N ++F PERF+  +VD+RG D+ LLPFG GRR CPG+ L
Sbjct  390   KGSQVIVNAYTIHRDPNFWT-NADKFLPERFLESNVDVRGRDYQLLPFGSGRRSCPGMQL  448

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              LI V+L+V QL+ CF+WELPN+M P +LDMTE FG+ + +  HL+AVP+YRL
Sbjct  449   ALIIVRLVVAQLVQCFDWELPNEMQPKDLDMTEQFGMVTGRASHLMAVPTYRL  501



>emb|CBI15433.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   331 bits (848),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 172/379 (45%), Positives = 261/379 (69%), Gaps = 14/379 (4%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L+ LG+LPHRNL+ L+KKYGPIM+++LG VP +VVSSP AA+L++KTHD VFASRPK 
Sbjct  143   GSLYMLGSLPHRNLSRLAKKYGPIMFMRLGCVPTIVVSSPEAAKLVMKTHDVVFASRPKL  202

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A + ++ G+KG+AF  YGP+WR  +K     L ++AKI SF  +R+ E+   VKS++  
Sbjct  203   QAYEYLSYGAKGIAFTEYGPYWRHVRKLCALHLFSSAKINSFASVRKAEVGLLVKSVKEM  262

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E VD++A+V  ++E++ Y+M+FG + +   DLK +++E   L G FN+ADY+PFL 
Sbjct  263   ASAGEVVDISAKVAGVVEDMAYRMVFGHNKDRIFDLKTLIREATRLAGTFNLADYVPFLG  322

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSS--  923
             P DLQGL + LR   +++D++  +I+ +H QD     + ++ + +D++L+ M   ++   
Sbjct  323   PLDLQGLTQLLRTNNEAIDEVLDKIIDKHIQDVSKD-EVNHMNFIDVVLSLMNKSNNFED  381

Query  924   ---HKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                + +D  + KA++ D++VG +D+S   IEW ++E++R+PRVM+ LQEEL+N VG+ RM
Sbjct  382   DPLYAIDRQNAKAIILDILVGGIDSSITSIEWVISELLRHPRVMRRLQEELKNVVGMCRM  441

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKKIASHDKLLGNRA  1274
             VEE DL NL YL MV+KE+ RLHP+   LVPRES+EDI +NGH+IPKK     ++L N  
Sbjct  442   VEESDLENLGYLNMVVKETLRLHPIGPFLVPRESIEDIVINGHYIPKK----SRILIN--  495

Query  1275  RPQHLVGQRGRVFSREVHE  1331
                  +G+   V+S  V E
Sbjct  496   --TWTIGRDPNVWSNNVEE  512


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSV  1341
             G   PKKSR++IN W IG DP++WS+NVEEFFPE   + S+
Sbjct  483   GHYIPKKSRILINTWTIGRDPNVWSNNVEEFFPESHANLSI  523



>ref|XP_004237617.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   252 bits (644),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 139/343 (41%), Positives = 209/343 (61%), Gaps = 1/343 (0%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH  G   H++L +++KK+GPIM +  G +P +V SSP AA+  LK HD +FASRP +
Sbjct  38    GNLHMFGENLHQDLYKIAKKHGPIMTIYFGLIPTIVASSPYAAQQFLKDHDQIFASRPYH  97

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A   I    + +    YGP+WR  +K  T +LL   KI SF  +R+ E+   V  +  A
Sbjct  98    AACYYIFYKQRNLIMGKYGPYWRHMRKLCTLQLLNNVKINSFQSMRKQEVQILVNFLIKA  157

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS-NNDNHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A  R+ VDL+A++  L  N+   M+ G   NN + D K ++Q+   +    N+A+  PFL
Sbjct  158   ASNRDVVDLSAKLASLSANMACLMVIGKKYNNVDGDFKDMIQQTSHMAATPNLAELFPFL  217

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
             +  D QG   R++ + +S D+    ++ EH +   +   K++ D+VD ++  M++  +  
Sbjct  218   RFIDFQGSVLRMKQIAESCDEFLENVIDEHTRQYSSDQSKTSIDMVDTLMEIMQSGEAEF  277

Query  927   KLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEK  1106
             + D   +KA+L D++V S+DTS   IEW L+E++++P VMK LQ EL+N      +VEEK
Sbjct  278   EFDRRHVKAILLDLLVASMDTSSTSIEWILSELLKHPNVMKKLQSELDNVFDQKGIVEEK  337

Query  1107  DLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             DL NL+YL MVIKE FRLHPVA LL+P ES+ED  L+G  +PK
Sbjct  338   DLKNLDYLNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFQMPK  380


 Score =   147 bits (371),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SRV++N WAIG DP +W +  E+F PERF+  ++D+RG +F LLPFG GRR C
Sbjct  375   GFQMPKGSRVLVNVWAIGRDPDVWREP-EKFIPERFVESTIDVRGQNFQLLPFGSGRRSC  433

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LGL  V L+V QL+H F+WELPN M P++++MTE FGL + +   L+A+P YRL
Sbjct  434   PGLQLGLTIVHLVVAQLVHSFDWELPNGMMPNDINMTEKFGLVTARALPLMAIPIYRL  491



>gb|EYU27291.1| hypothetical protein MIMGU_mgv1a023536mg [Erythranthe guttata]
Length=497

 Score =   262 bits (669),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 216/346 (62%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  PH+NL+ L++KYGPIM+L+LG VPA VVSSPA AEL LKTHD  FA+R  +
Sbjct  43    GHFHLLGKNPHQNLHRLAQKYGPIMFLRLGMVPAFVVSSPAGAELFLKTHDLSFANRHPS  102

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A ++I+ GS+ +A APYGP+WR  +K +T  LL+  KI  F  +R+GE+ A V  +  A
Sbjct  103   QAAEHISYGSRNIASAPYGPYWRNMRKLSTVNLLSNIKINQFQAMRKGELGALVNRLRRA  162

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNND----NHDLKLIVQEIVSLIGAFNIADYL  737
             +  RE VD+   V  L  ++   M+FG    D    +   K +++E + +  A N+ DY 
Sbjct  163   SDNREIVDVGKMVTTLTGDMICMMVFGRKYGDSDLGDKGFKAVIEEALDIAAAPNLGDYF  222

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PF+   DLQGL +R++ L K  D    +I+  H Q   N  +K  +D VD M+A M +  
Sbjct  223   PFMGTIDLQGLTRRMKQLSKIFDGFLGKIIDNHVQ---NKQEKETQDFVDTMIAIMDSGE  279

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   +KA+L DM++G  DTS   + W LAE++R+P++MK LQ+EL+  VG++  +
Sbjct  280   AGFEFDHRHVKAVLLDMLIGGTDTSAVTVNWALAELIRHPQIMKKLQQELDKVVGMDEYI  339

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE  L  L+YL  VIKE+FRLHP+   L+  +++ED+ +    +PK
Sbjct  340   EESHLDKLDYLNFVIKETFRLHPIVP-LIGHKTMEDLTVENFHVPK  384


 Score =   136 bits (343),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK S V +N W+I  DP++W D  E+F+PERF   +VD++G DF LLPFG GRRVCPG  
Sbjct  383   PKGSSVFVNVWSIHKDPNVWEDP-EKFWPERFSETNVDLQGRDFRLLPFGSGRRVCPGYQ  441

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  V+L++ +L+HCF+WELPN M P+ELDM E F     + + L+A+P YRL
Sbjct  442   LGLTVVRLVLARLVHCFDWELPNGMLPNELDMAEHFRFVMSREKPLMAIPVYRL  495



>ref|XP_004143569.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Cucumis sativus]
Length=499

 Score =   278 bits (712),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/350 (45%), Positives = 230/350 (66%), Gaps = 16/350 (5%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG L HR+L+ LS+ YGPIM+++LG +PA++VSSP A EL LKTHD  FASRP  
Sbjct  44    GSLHLLGKLIHRDLHYLSQIYGPIMHIQLGFLPAIIVSSPRATELFLKTHDLHFASRPLT  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                 +I+ G KG+AFA YGP+WR  +K  T ELL++ KI SF  +R+ E+ + ++ ++ A
Sbjct  104   ITSNHISYGRKGVAFAQYGPYWRNIRKMCTLELLSSLKINSFSSMRKQEVGSLIEVLKXA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH----DLKLIVQEIVSLIGAFNIADYL  737
             A    AVDLT+++  +I ++   M+ G    DN       K +++E   L  A N+ D++
Sbjct  164   ATDGVAVDLTSKISCVIGDMICVMVLGRKYEDNELDEKGFKGLIREATQLAAAPNLGDFI  223

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEH---EQDAKNGVQKSNKDIVDMMLASMK  908
             P +  FD+QG   R +A+GK  D     IV+EH   ++D K      +KD VD++L  M 
Sbjct  224   PLIARFDVQGFGGRAKAVGKIFDGFLERIVEEHVVFQRDNK------DKDFVDVLLDLMG  277

Query  909   NPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
               S  +++D ++IKA++ D ++ +VD++   I W L+E+++NP +MK LQEELE  VGLN
Sbjct  278   --SREYQIDRSNIKAIILDFLIAAVDSTTTTINWMLSELIKNPHIMKKLQEELEKVVGLN  335

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             RMVEE DL NL+YLEMVIKES R+HP    L+PRE ++D  +NG+ IP+K
Sbjct  336   RMVEESDLSNLKYLEMVIKESLRMHPPVP-LIPRECIQDCNINGYHIPEK  384


 Score =   119 bits (299),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+KSR++IN WAIG DP+ W D   +F PERF+   VD++G DF L+PFG GRR C
Sbjct  378   GYHIPEKSRIVINAWAIGRDPNTWVDP-HKFDPERFLESEVDVKGRDFELIPFGSGRRGC  436

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
              G+ L L+ V+L+V QL+HCF+ + PN MSP ELDMTE  GL  P+ Q+L  VP +RL
Sbjct  437   VGIQLALVVVRLVVAQLVHCFDLKPPNGMSPLELDMTEILGLICPRAQNLKVVPIFRL  494



>ref|XP_002514610.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47716.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=511

 Score =   328 bits (841),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 249/361 (69%), Gaps = 14/361 (4%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPH++L  L+K++G IM+LKLG V  VVVSS  AAEL LKTHDA FA+RPK 
Sbjct  54    GNLHLLGLLPHQSLYHLAKEHGQIMFLKLGFVDTVVVSSAQAAELFLKTHDAAFANRPKV  113

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                  ++ GS+GM F  YGP+WR  +K  T +LL+++KIESF  LR+ E+   V +I+ A
Sbjct  114   LVSHYLSYGSRGMIFDDYGPYWRNVRKVCTLQLLSSSKIESFAPLRKEELELMVATIKQA  173

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  +E VD++A +G   EN+  +M+FG  +ND  DL+ +++E + LIGA NIADY+P++ 
Sbjct  174   AERKEMVDVSARLGDFSENLICRMIFGQRSNDEFDLRPLIKESLELIGAINIADYVPYIG  233

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMK-------  908
               DLQGL +R+RA  K +DK+  +I+  HE+D +    K  KD +D+ML+ M        
Sbjct  234   VLDLQGLTRRMRAYRKGMDKVLEKIIDSHEKDGRWKT-KEQKDFIDVMLSVMNRSSPMIP  292

Query  909   -NPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGL  1085
              N   S+ +D   IKA++ D+IVG  +TS + IEWT +E++R+PRVMK LQ+ELE  VGL
Sbjct  293   PNDPQSYVIDRTCIKAIIQDIIVGGFETSTSSIEWTFSELLRHPRVMKCLQKELETVVGL  352

Query  1086  NRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKKIASHDKLLG  1265
             +RMVEE+DLPNL YL+M++KES RL+P    L+PR+ +EDI +NG+ IP    S+ ++L 
Sbjct  353   DRMVEERDLPNLTYLDMIVKESLRLYPTLP-LIPRKCVEDITVNGYHIP----SNSRILV  407

Query  1266  N  1268
             N
Sbjct  408   N  408


 Score =   148 bits (374),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 4/118 (3%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P  SR+++N WAIG D ++WSDN  EF+PERF  + VD+RG  F L+PFG GRR C
Sbjct  396   GYHIPSNSRILVNAWAIGRDTNVWSDNALEFYPERFKDECVDLRGLHFQLIPFGSGRRSC  455

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LGL N++L++ QL HCFNW+LP+     +LDMTE +GL  P+  H  A+P+YRL
Sbjct  456   PGMSLGLRNIRLVIAQLAHCFNWDLPSG----DLDMTEKYGLTLPRANHFSALPTYRL  509



>ref|XP_009588170.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=494

 Score =   255 bits (651),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 216/346 (62%), Gaps = 8/346 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG  PH++L +L+ K+GPIMY++LG VPA+V SS  AAE +LKT+D +FASRP +
Sbjct  40    GHLHLLGKNPHQDLQKLANKHGPIMYMRLGLVPAIVASSADAAEKVLKTNDHIFASRPHH  99

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A + +A G K   FA YGP+WR  +K  T  LL++ KI SF   R  ++   + S++  
Sbjct  100   EASQYMAYGQKNFIFAKYGPYWRNMRKLCTVHLLSSHKINSFQSTRNQQVQLLIDSLKRE  159

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A  R  VDL+A++  L  N+T  M+FG      + D    K +VQ+++ L    N+ D+ 
Sbjct  160   AHDRVVVDLSAKITSLNANLTCLMVFGKKYMDEDLDKRGFKAVVQDVLHLAATPNLGDFF  219

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL   DLQGL ++L+ L K  D+   +I+ EH Q      QK   D VD M+  M++  
Sbjct  220   PFLGVIDLQGLTRKLKDLSKVFDEFLEKIIDEHLQSHD---QKQTNDFVDTMMEIMQSGE  276

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             +  + D   IKA++ DM++ ++DTS   +EW L E++R+P VMK LQ+EL+  VG+ ++V
Sbjct  277   AEFQFDRQHIKAIIQDMLMAAMDTSATSVEWILTELLRHPNVMKKLQKELDEVVGIEKIV  336

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             +E DL NL+YL+MV KE  RLH V  L+   E++E+  +NG  I K
Sbjct  337   KEPDLENLKYLDMVAKEGLRLHSVVPLM-HHEAMEECVVNGFHIQK  381


 Score =   142 bits (358),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G    K SR+MINC+A+  DP++W +  E+FFPERF+  S+DIR  DF LLPFG GRR 
Sbjct  375   NGFHIQKGSRIMINCYAVQRDPNVWPEP-EKFFPERFVGSSIDIRRRDFQLLPFGSGRRS  433

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LG+  ++L+V QL+HCF+WE+ N M P +L++ E FGL + K + L+A+P+YRL
Sbjct  434   CPGMQLGVTIIRLVVAQLVHCFDWEISNGMQPLDLEIDEQFGLVTCKEKPLMAIPTYRL  492



>ref|XP_003615678.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98636.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score =   327 bits (839),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 247/348 (71%), Gaps = 7/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LGTLPHR L  LSKKYGPIM L+LG+VPA+V+SS  AAE  LKTHD VFASRPK 
Sbjct  48    GNLHILGTLPHRTLQSLSKKYGPIMSLQLGQVPAIVISSSKAAESFLKTHDIVFASRPKI  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + ++ GSKGMAF  YGP+WR  +KF T +LL+A+K+E  G +R+ E+   V +++ A
Sbjct  108   QGSELMSYGSKGMAFCEYGPYWRSVRKFCTLKLLSASKVEMSGPIRKEELSILVNTLKKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E V+++  V  LIE++ YK++FG S  +  DLK +VQE ++LIGAFN+ADY+P+L 
Sbjct  168   ALVGEVVNVSEVVENLIEDIVYKLMFGRSKYEQFDLKSLVQEGLALIGAFNLADYVPWLG  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
              FDLQGL K  + + K++D++   I+ EHEQ A   V K+ KD VD++L+ M        
Sbjct  228   IFDLQGLTKSCKKVSKALDEVLEVILTEHEQAA--NVNKTQKDFVDILLSIMHQTIDIEG  285

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               +  +D  +IKA+L DMIV ++DTS   IEW L+E++R+PRVMK LQ+E++N+VG  RM
Sbjct  286   EQNLVIDRTNIKAILLDMIVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKRM  345

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             V EKDL  L YL+MV+ E+ RL+PVA LLVPRES E   ++G+FI +K
Sbjct  346   VNEKDLKKLNYLDMVVDETLRLYPVAPLLVPRESRESTTIDGYFIKEK  393


 Score =   159 bits (403),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +1

Query  1186  PESRWKISS*TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFH  1365
             P    + ++  G    +K+R+++N WAIG DP++WS+N +EF+PERF+ K ++  G +F 
Sbjct  376   PRESRESTTIDGYFIKEKTRLIVNAWAIGRDPNVWSENAKEFYPERFVEKKMNYLGQEFE  435

Query  1366  LLPFGYGRRVCPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQH  1545
              +PFG GRR CPG+ LGLI VKL++ Q +HCFNWELP+ +SP  L+M E FGL  P+ QH
Sbjct  436   SIPFGSGRRRCPGIQLGLITVKLVIAQFIHCFNWELPHNISPSNLNMEEKFGLTIPRAQH  495

Query  1546  LVAVPSYRL  1572
             L A+PSYRL
Sbjct  496   LHAIPSYRL  504



>ref|XP_009605506.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=279

 Score =   204 bits (518),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = +3

Query  756   DLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLD  935
             ++QGLNK+L+  GK+V K+F  I+ EHE+DA++G  K +KD+VD+ML S +N   S+ +D
Sbjct  7     NVQGLNKQLKETGKAVQKVFDTIINEHEEDARDGSHKGSKDLVDVML-SHQNCPKSYSID  65

Query  936   LASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLP  1115
              A++KA+L DMIV ++DTS+ WIEW  AEI+++ RVM  LQEEL + VGL+RMVEE+DLP
Sbjct  66    RATMKAILSDMIVAAIDTSHTWIEWVFAEIVKHSRVMNKLQEELISVVGLDRMVEEQDLP  125

Query  1116  NLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
              LEYLE+V+KE+FRLHPVATLLVPRES+ED+ +NG++IP+K
Sbjct  126   KLEYLELVLKETFRLHPVATLLVPRESMEDVVINGYYIPRK  166


 Score =   192 bits (487),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   P+KSRVMINCWA+GHDP IWSDNVEEF PERF+ K+ D+RGHDFHLLPFGYGRR 
Sbjct  159   NGYYIPRKSRVMINCWALGHDPKIWSDNVEEFVPERFIGKNFDLRGHDFHLLPFGYGRRS  218

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+NLGLI VKLIV QL+HCFNW+LP  + P +LDMTE FG A+P+ Q+L+ +P+Y L
Sbjct  219   CPGMNLGLITVKLIVAQLVHCFNWDLPEGILPGDLDMTEKFGFAAPRAQNLLVIPTYCL  277



>gb|KHG20290.1| Cytochrome P450 protein [Gossypium arboreum]
Length=450

 Score =   300 bits (768),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 233/346 (67%), Gaps = 10/346 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPH++L  L+KKYGPIM ++LG VP VVVSSP  AE+ LKTHDA+FASRPK 
Sbjct  48    GNLHLLGMLPHQSLYRLAKKYGPIMSIRLGSVPTVVVSSPQVAEMFLKTHDAIFASRPKV  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
               +++I++  +G+AF  +GP+WR  +K    +L T +KIES+   R+  ++ + +S++ A
Sbjct  108   QVLQSISNSQRGIAFTEHGPYWRSVRKICNMQLFTTSKIESYAPTRKEVLMHFTESLKEA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNN-DNHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A  +E V+++ ++  +   +T KM+ G+       +L  +++E+  + G FN+AD++PFL
Sbjct  168   ATAKEVVNISKKLAEINAEMTLKMVLGSVKKYKEFNLNELIEELTKIAGVFNLADFVPFL  227

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSH  926
               FDLQG+    + LG+ +DK    I+K+H       +QK   D V  +L  +    +S+
Sbjct  228   GAFDLQGIKASTQTLGEKLDKALETIIKDH-------LQKKQDDFVGTLLTELNQTINSN  280

Query  927   K--LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVE  1100
                +D  SIKA+  DMIVG  DTS A +EW L+E++R PRVM  LQ+ELE+  G  R+VE
Sbjct  281   GDIMDRNSIKAITLDMIVGGFDTSAATLEWALSELIRQPRVMLKLQQELESIFGNKRIVE  340

Query  1101  EKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             E DLP LEYL+MV++E+ RLHP+A LL+PRES+EDI ++G++I KK
Sbjct  341   ENDLPKLEYLDMVVRETLRLHPIAPLLIPRESMEDIVIDGYYIAKK  386


 Score = 93.2 bits (230),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    KKSR++++ WAIG D ++WS+NVEEF PERF+  ++D+ GHDF L+PFG GRR+C
Sbjct  380   GYYIAKKSRLLVHIWAIGRDLNVWSNNVEEFSPERFIDCNIDLHGHDFALIPFGAGRRLC  439

Query  1399  PGVNLGLIN  1425
             PG  LG I+
Sbjct  440   PGKKLGYIS  448



>ref|XP_003615682.1| Cytochrome P450 [Medicago truncatula]
Length=464

 Score =   236 bits (603),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/348 (42%), Positives = 209/348 (60%), Gaps = 53/348 (15%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  LSKKYGPIM L+LG+VP +++SS  AAE  LKTHD VFASRPK+
Sbjct  48    GNLHILGKLPHRTLQSLSKKYGPIMSLQLGQVPTIIISSSKAAESFLKTHDIVFASRPKS  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + +  GSKG+ F+ YGP+WR  +KF T +LL+A+K+E  G +R+ E+   V +++ A
Sbjct  108   QGSELMLYGSKGIVFSDYGPYWRSVRKFCTLKLLSASKVEMSGPIRKEELSILVNTLKKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A   E V+++  V  LIE++ YK++FG S  +  DLK +VQ+ + LIGAFN+ADY+P+ K
Sbjct  168   ALVGEVVNVSEVVENLIEDIVYKLMFGRSKYEQFDLKNLVQQELVLIGAFNLADYVPWTK  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
                                             A N  +  +KD VD++L+ M        
Sbjct  228   --------------------------------AANVNKTHHKDFVDILLSIMHQTIDVEG  255

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               +  +D ++IKA+L DMIV ++DTS                   +L +E++N+VG  RM
Sbjct  256   EQNLVIDRSNIKAILLDMIVAAIDTS----------------ATSILMDEIQNEVGNKRM  299

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEEKDL  L YL+MV+ E+ RL+PVA LLVP +  E+I ++ +FI +K
Sbjct  300   VEEKDLKKLNYLDMVVDETLRLYPVAPLLVPPKCRENITIDDYFIKEK  347


 Score =   156 bits (395),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +1

Query  1234  KKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVNL  1413
             +K+R+M+N WAIG DP++WS+N EEF+P+RF+ K ++ +  +F  LPF YGRR CPG+ L
Sbjct  346   EKTRIMVNAWAIGRDPNVWSENAEEFYPKRFIEKKMNYQRQEFESLPFDYGRRRCPGIQL  405

Query  1414  GLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             GL  VKL++ Q +HCFNWEL + +SP  L+M E FGL  P+ QHL A+PSYRL
Sbjct  406   GLTTVKLVIAQFVHCFNWELSHNISPFNLNMEEKFGLTIPRAQHLHAIPSYRL  458



>ref|XP_006365796.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=482

 Score =   270 bits (691),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 217/347 (63%), Gaps = 8/347 (2%)
 Frame = +3

Query  210   GNLHQ-LGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPK  386
             GNLH  LG   H+ L+ ++KK+GPIM ++ G VP +V SSP AAEL LK HD  FA+RP 
Sbjct  43    GNLHMVLGKNLHQALHHIAKKHGPIMSMQFGLVPVIVASSPHAAELFLKKHDIAFANRPY  102

Query  387   NDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEA  566
             N A + IA   + + FA YGPHWR  +K    +LL+  KI SF  +R+ E+  +V  ++ 
Sbjct  103   NAAAQYIAYDHRDIVFAKYGPHWRNMRKLCKMKLLSNIKINSFRSMRKQELGIFVNFLKQ  162

Query  567   AAGGREAVDLTAEVGRLIENVTYKMLFGT----SNNDNHDLKLIVQEIVSLIGAFNIADY  734
             AA  R  VDL+A++  LI +++  M+FG        D    K I  E   L+ + NIA++
Sbjct  163   AASNRVEVDLSADLASLIVDMSCLMVFGKKYMEEEFDERGFKNIFYEASFLVASPNIAEF  222

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              PFL  FDLQG   R++ L K  D+ F +++ EH Q  +   Q   KD+VD M+  M++ 
Sbjct  223   FPFLSVFDLQGFIARMKDLAKIFDEFFEKVIDEHVQSKE---QNQAKDMVDTMMTIMQSG  279

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              +  K+D   +KA+L D+++ S D     I+W L+E++R+P+VMK LQ ELE  VG+NRM
Sbjct  280   EAEFKIDRRDVKAVLLDLLLASTDNVSIAIDWILSELLRHPKVMKKLQIELEQAVGINRM  339

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE DL  LEYL+MVI+E  RLHP +TLL P ES+ED  ++G  IPK
Sbjct  340   VEESDLERLEYLDMVIREGLRLHPPSTLLTPHESIEDCIVDGFDIPK  386


 Score =   122 bits (305),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK SR+ +N WAIG DP  W D  E+F PERF+  ++D+RGHDF LLPFG GRR C
Sbjct  381   GFDIPKGSRLFVNVWAIGRDPEAWPDP-EKFMPERFVDSNIDLRGHDFQLLPFGSGRRSC  439

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPN  1479
             PG+ LGL  V+L++ QL+HCF+WELPN
Sbjct  440   PGLQLGLTIVRLVLAQLVHCFDWELPN  466



>ref|XP_009629564.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=431

 Score =   244 bits (623),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 201/322 (62%), Gaps = 8/322 (2%)
 Frame = +3

Query  282   MYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRG  461
             MY++LG VPA+V SS  AAE +LKT+D +FASRP N+A + ++ G K M FA YGP+WR 
Sbjct  1     MYIQLGLVPAIVASSADAAEKVLKTYDHIFASRPHNEASQYMSYGQKNMIFAKYGPYWRN  60

Query  462   NKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKM  641
              +K     LL+  KI SF  +R+ E+   ++S++  A  R  VDL+A+V  L  ++T  M
Sbjct  61    MRKLCIVHLLSNHKINSFQSMRKQEVELLIESLKEQAHDRAVVDLSAKVTSLNASLTCLM  120

Query  642   LFGT----SNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDK  809
             +FG      + D    K +VQE+V   G  N+ D+ PFL   DLQGLN++L+ L K  D+
Sbjct  121   VFGKKYMDEDFDKRGFKAVVQEVVHFGGRPNLGDFFPFLGVIDLQGLNRKLKDLSKVFDE  180

Query  810   LFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDLASIKALLFDMIVGSVDT  989
                +I+ EH Q      QK  KD VD M+  M++  +  + D   IKA+L DM++ + DT
Sbjct  181   FLEKIIDEHVQSHD---QKQTKDFVDTMMEIMQSGEAEFQFDRQHIKAILVDMLIAATDT  237

Query  990   SYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPV  1169
             S   +EW L E++R+P VMK LQ+EL+  VG+ RMV+E DL N++YL+MVIKE  RLH +
Sbjct  238   SATSVEWILTELIRHPHVMKKLQKELDEVVGIERMVDESDLENMKYLDMVIKEGLRLHSI  297

Query  1170  ATLLVPRESLEDIELNGHFIPK  1235
               +L   E++ED  ++G  I K
Sbjct  298   VPVL-HHEAMEDCVVDGFHIQK  318


 Score =   148 bits (373),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G    K SR+MINC+AI  DP++W +  E+FFPERF+  SVDIRG DF LLPFG G+R C
Sbjct  313   GFHIQKGSRIMINCYAIQRDPNVWPEP-EKFFPERFVGSSVDIRGRDFQLLPFGSGKRSC  371

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ LG+  V+L+V QL+HCF+WEL N M P +LD+ E FG+ + K + L+A+P+YRL
Sbjct  372   PGMQLGITIVRLVVAQLVHCFDWELQNGMQPLDLDIDEQFGMVACKEKPLMAIPTYRL  429



>ref|XP_002310016.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
 gb|EEE90466.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
Length=497

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 189/409 (46%), Positives = 258/409 (63%), Gaps = 23/409 (6%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPH +L++L+KKYGPIMY++LG VP VVVSSP AAELILKT+D VFASRP+N
Sbjct  42    GSLHLLGKLPHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRN  101

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   K ++FAPYG +WR  +K  T ELL+  KI SF   R+ E+   +  I+ A
Sbjct  102   EAAKHISYEQKNLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDA  161

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +  R AVDL A+V  L  +++ +M+FG        D    K +  E++ L  +FN+ DY+
Sbjct  162   SRERVAVDLGAKVSSLSADISCRMVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYI  221

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P + P DLQGL KR++A+GK  D  F +I+ EH Q      +   KD VD+ML  + +  
Sbjct  222   PPIAPLDLQGLTKRMKAVGKVFDDFFEKIIDEHIQFKD---ENRTKDFVDVMLDFLGSEE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             + +++   +IKA++ DM+VGS+DTS   IEWTL+E++R+PRVMK +Q+ELE K+G++RMV
Sbjct  279   TEYRIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKKI--------ASHD  1253
             EE DL  LEYL MVIKE+FRLHPVA LL P ES+ED  ++G  IP+K            D
Sbjct  339   EESDLEGLEYLHMVIKEAFRLHPVAPLLGPHESMEDCTIDGFLIPQKTRVIVNVWAIGRD  398

Query  1254  KLL---GNRARPQHLVGQ----RGRVFS-REVHEQERGYPGA*LSSPAV  1376
             +      NR  P+   G     RGR F         RG PG  L    V
Sbjct  399   QSAWTDANRFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPGMHLGQTMV  447


 Score =   157 bits (396),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P+K+RV++N WAIG D S W+D    F PERF   ++D+RG DF LLPFG GRR C
Sbjct  379   GFLIPQKTRVIVNVWAIGRDQSAWTD-ANRFIPERFAGSNIDVRGRDFQLLPFGAGRRGC  437

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG++LG   V+ IV QL+HCF+WELPN M P ELDMTE FGL +P+  HL A P+YRL
Sbjct  438   PGMHLGQTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRL  495



>ref|XP_004143571.1| PREDICTED: cytochrome P450 71A1-like, partial [Cucumis sativus]
Length=414

 Score =   231 bits (590),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 125/306 (41%), Positives = 192/306 (63%), Gaps = 13/306 (4%)
 Frame = +3

Query  348   LKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLR  527
             LKTHD VFASRP   A K +A G K +AF+ YGP+WR  +K  T ELL++ K++SF  +R
Sbjct  1     LKTHDTVFASRPFVQASKYMAYGQKNLAFSQYGPYWRNLRKMCTLELLSSVKVKSFRSMR  60

Query  528   RGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQE  695
               E+  +V  +  AA  R  V+L++++  L  ++T  M+FG    D        K ++QE
Sbjct  61    MEELGLFVDYLRDAARKRVIVNLSSKICSLNTDMTCLMVFGKKYKDQEFDERGFKSVIQE  120

Query  696   IVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNK  875
              + ++ + N+ D++P +   DLQGL++R +A+ K  D+ F  I+ EH    ++  +   K
Sbjct  121   AMQIVASPNLGDFIPQIAVLDLQGLDRRSKAVSKIFDEFFERIIDEH---LESRYENKTK  177

Query  876   DIVDMMLASMKNPSSSHKLDLASIKA-----LLFDMIVGSVDTSYAWIEWTLAEIMRNPR  1040
             D VD+ML  M +  + ++++  SIK      L  DM+V ++DTS   I W + E++++P 
Sbjct  178   DFVDVMLEIMDSHGTEYQIE-RSIKESRRIWLTVDMLVAAMDTSATTIGWAIPELIKHPH  236

Query  1041  VMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNG  1220
             VMK +Q+EL+  VGL+R VEE DL +L+YL+MV+KE  RLHP A LLVP E+LED  ++G
Sbjct  237   VMKKMQDELQKVVGLDRKVEETDLDHLQYLDMVVKEILRLHPPAPLLVPHEALEDCIVDG  296

Query  1221  HFIPKK  1238
              +IPKK
Sbjct  297   FYIPKK  302


 Score =   156 bits (394),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSR+++N WAIG DP+ W D  E+FFPERF+   VD+RG DF L+PFG GRR C
Sbjct  296   GFYIPKKSRIIVNGWAIGRDPNFWIDP-EKFFPERFIGSQVDVRGKDFQLIPFGSGRRGC  354

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG+ +GL  V+L++ QL+HCF+WELPN   P ELDMTE FGL  P+ Q L+  P YRL
Sbjct  355   PGMQMGLTVVRLVIAQLVHCFDWELPNGTLPVELDMTEEFGLTCPRAQDLMVTPIYRL  412



>gb|AJD25257.1| cytochrome P450 CYP736A122 [Salvia miltiorrhiza]
Length=502

 Score =   245 bits (626),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 134/348 (39%), Positives = 214/348 (61%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H L + PH++L+ L++K+GPIMY + G +P ++VSSP+AAEL LKTHD +FA RP +
Sbjct  44    GHFHLLSSNPHQDLHRLARKHGPIMYTRFGSIPTIIVSSPSAAELFLKTHDLIFADRPHH  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A   +    + + F  YGP+WR  +K  T ELL+  +I+ F  +RR E++  V  +  A
Sbjct  104   EAAYYLGYEQRNIVFGRYGPYWRNMRKLCTLELLSGLRIDEFQPMRRAEIMRAVDGLRRA  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH-----DLKLIVQEIVSLIGAFNIADY  734
             A   E VD++A V  L+ ++   M+FG    D         K +++E   +    N+ DY
Sbjct  164   AEEGEVVDVSARVSGLVGDMNCLMVFGRKFVDRDLDQELGFKDVIEETTRVAAQPNLGDY  223

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              P + P DLQGLN+R+  L  + D     I+ +H +  +   +K +KD VD+M+  M++ 
Sbjct  224   FPLVAPLDLQGLNRRVERLSATFDGFLDMIIDDHVKKNEEEKEKKDKDFVDVMMGIMESG  283

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
             ++    D   +KA+L DM++G +DT+   ++W ++E+M+NP VMK LQ+E+E  VG+++M
Sbjct  284   AAGFDFDRRHVKAMLLDMLIGGIDTTSTAVDWIMSELMKNPTVMKKLQKEIEEVVGMDQM  343

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VE+  L +L+YL+ V+KES RLHPVA LL    +  D ++ G  IP K
Sbjct  344   VEKSHLSSLKYLDCVVKESLRLHPVAPLLA-HAAQGDCQVAGFDIPDK  390


 Score =   141 bits (355),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRV  1395
              G   P K+ V +N WAIG DP +W  N E F P+RF+  +VD RG DF LLPFG GRR 
Sbjct  383   AGFDIPDKTHVFVNVWAIGRDPHVWP-NPETFCPDRFLRSNVDFRGRDFQLLPFGSGRRS  441

Query  1396  CPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             CPG+ LGL  V+ +V QL+HCF+WELP+ M   ELDM E +G+   + +HL A+P+YRL
Sbjct  442   CPGLQLGLTIVRSVVAQLVHCFDWELPDGMLADELDMFEKYGMVITRAKHLRAIPTYRL  500



>ref|XP_007036499.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY21000.1| Cytochrome P450, putative [Theobroma cacao]
Length=511

 Score =   319 bits (817),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 236/348 (68%), Gaps = 5/348 (1%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPH+ L  L+K YGP+M ++LG VPAVV+SSP  AEL LKTHD +FA RP+ 
Sbjct  48    GNLHMLGKLPHQALYHLAKVYGPMMSIRLGTVPAVVISSPRFAELFLKTHDTIFAGRPRI  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
               V+  + G KGMAFA YG +WR  +K    +LL+A+KIES   +RR  +   V+S++  
Sbjct  108   QVVQVFSYGFKGMAFAGYGSYWRSVRKLYNVQLLSASKIESLAPMRREMVSLLVESLKKD  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             A  ++ V+L+ ++G LIE++T +M+ G    D  +LK +VQE+ SL GAFN+ADY+PFL 
Sbjct  168   AAAQKVVNLSEKLGALIEDMTLRMVIGHMKYDQFNLKELVQEVTSLAGAFNLADYVPFLG  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHK  929
               DLQGL  R++A   ++DK    I+ EHE    +  QK  +D VD+ML  +  P + H 
Sbjct  228   ALDLQGLRPRIKAASGALDKALENIIDEHELKNIHEQQKQQRDFVDLMLTMLNQPMNPHD  287

Query  930   -----LDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
                  +D  +IKA++ D+I G +DT+   IEW + E++RNPR M+ LQ EL++ VG+ R 
Sbjct  288   DPMYIVDRTTIKAIIVDLITGGLDTTTTTIEWAVTELIRNPRAMQHLQRELQSFVGIYRT  347

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             VEE DLP L YL+MV+KE+ RLHPVA LLVP ES+ED  ++G++IPKK
Sbjct  348   VEEIDLPKLTYLDMVVKETLRLHPVAPLLVPHESMEDTTIDGYYIPKK  395


 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  1186  PESRWKISS*TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFH  1365
             P    + ++  G   PKKSR+++N WAIG DP +WS+NVEEFFPERF+  ++D+RGHDF 
Sbjct  378   PHESMEDTTIDGYYIPKKSRILVNVWAIGRDPDVWSNNVEEFFPERFIDSNIDLRGHDFE  437

Query  1366  LLPFGYGRRVCPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQH  1545
             L+PFG GRR+CPG+ LGL  VK ++ QL+HCF+WELP+ M P ELD +E FGL+ P+  H
Sbjct  438   LIPFGAGRRMCPGMKLGLTTVKFVLAQLVHCFDWELPDGMLPEELDTSEKFGLSLPRSSH  497

Query  1546  LVAVPSYRLL  1575
             L A P YRLL
Sbjct  498   LYAKPIYRLL  507



>gb|EYU31073.1| hypothetical protein MIMGU_mgv1a004944mg [Erythranthe guttata]
Length=503

 Score =   247 bits (630),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 135/347 (39%), Positives = 215/347 (62%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+ H LG  PH++++ LS+K+GPIM+L+LG +P VVVSSPA AEL LKTHD VFA RP +
Sbjct  45    GHFHLLGKNPHQDMHRLSEKHGPIMHLRLGFLPTVVVSSPAGAELFLKTHDLVFAGRPLH  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K++    + +AF  YG +WR  +K  T  LL++ KI  F   R+ E+  +V S   A
Sbjct  105   QAAKHMVYDGRDIAFGQYGSYWRDIRKLCTLNLLSSHKINQFRHTRKAELSLFVGSFRRA  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN-----HDLKLIVQEIVSLIGAFNIADY  734
             A  REA+D++  +  L  ++    +FG    D+        K +++EI+ L+   N+ D+
Sbjct  165   ACQREALDVSKMITGLSWDMICMTVFGRKFADSDLDETKGFKSVIEEILQLVAIPNLGDF  224

Query  735   LPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP  914
              P++   DLQGL +R++ +  S D    +++++H  + +   +K  +D VD M+A M + 
Sbjct  225   FPYVGWLDLQGLTRRMKQVHNSFDGFLEKVIEDHGSNNQENTKKDARDFVDTMMAIMDSG  284

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
              +   LD   +KA+L DM++G  DT+    +W LAE++R+P++M  LQ+ELE  VG+ + 
Sbjct  285   EAGFDLDRRHVKAVLADMLIGGTDTTAVTTDWALAELIRHPQIMNKLQQELEQVVGMEQY  344

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             VEE  L  L+YL++VIKE+FRLHP+  LL   ++++D  ++   IPK
Sbjct  345   VEESHLEKLDYLDLVIKETFRLHPIVPLL-NHKAMQDCTVDEFHIPK  390


 Score =   137 bits (346),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK +RV++N  +I  DP++W +  E+F PERF+    D RG DF  +PFG GRR+CPG++
Sbjct  389   PKGTRVIVNLLSISRDPNVWQEP-EKFSPERFVGIDTDYRGMDFRFIPFGSGRRMCPGIH  447

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL +++L++ QL+HCF+WELPN  SP+EL+M E FGL + + +HL+A+P YRL
Sbjct  448   LGLTSLRLMLAQLIHCFDWELPNGTSPNELNMAEHFGLVTSRDEHLMAIPIYRL  501



>gb|KEH28165.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=427

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 170/348 (49%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLH LG LPHR L  LSKKYGPIM L+LG+VP +V+SS  AAE  LKTHD VFA+RPK 
Sbjct  48    GNLHILGKLPHRTLQSLSKKYGPIMSLQLGQVPTIVISSSKAAESFLKTHDIVFANRPKL  107

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
                + I+ G KG+AF+ Y P+WR  KK  T +LL+A+K+E  G +R  E+   V +++ A
Sbjct  108   IGAEIISYGCKGLAFSKYDPYWRSVKKLCTLKLLSASKVEKSGPIRTEELGILVNTLKKA  167

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
             +   E V+++  V  +IE++ YKM+ G    +  DLK +VQE ++LIGAFN+ADY+P+L 
Sbjct  168   SLVGEVVNVSEIVENVIEDIVYKMILGRGKYEQFDLKKLVQEGLALIGAFNLADYVPWLG  227

Query  750   PFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNP-----  914
              FDLQGL K  + + K++D+    I+ EHEQ A N  +  +KD VD++L+ M        
Sbjct  228   IFDLQGLTKSCKKVSKAIDEQLEVILTEHEQ-AANVNKTHHKDFVDILLSIMHQTIDVEG  286

Query  915   SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRM  1094
               +  +D  +IKA+L DMIV ++DTS   IEW L+E++R+PRVMK LQ+E++N+VG  R 
Sbjct  287   EQNLVIDRTNIKAILLDMIVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKRK  346

Query  1095  VEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             +EEKD+  L YL+MV+ E+ RL+PVA LLVPRES E   ++G+FI +K
Sbjct  347   IEEKDMKKLNYLDMVVDETLRLYPVAPLLVPRESRESTIIDGYFIKEK  394


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKS  1338
             G    +K+R+++N WAIG DP++WS+N EEF+PERF+ K+
Sbjct  388   GYFIKEKTRLIVNAWAIGRDPNVWSENAEEFYPERFIEKN  427



>ref|XP_008374965.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=622

 Score =   207 bits (528),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 171/305 (56%), Gaps = 59/305 (19%)
 Frame = +3

Query  339   ELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFG  518
             +L LKTHD +FA+RPK  A   +A G+K MAF  YGP+WR  +K    +LL  +KI+ F 
Sbjct  257   KLFLKTHDTIFANRPKLQASDYMAYGTKAMAFTEYGPYWRHIRKLCMLQLLCPSKIKGFA  316

Query  519   DLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEI  698
              LR+ E+   V+S++ AA   + VD + +                           V E+
Sbjct  317   PLRKEEVGLLVQSLKVAADAGDVVDFSEK---------------------------VGEL  349

Query  699   VSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKD  878
             V                             + K+ D++  +I+ +HEQ + +     +KD
Sbjct  350   VE---------------------------GITKTADQVLEKIIXDHEQVSGSEQGNHHKD  382

Query  879   IVDMMLASMKNP-----SSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRV  1043
              VD++L+S+  P        + L+  + KA+L DMI G+ DTS   I WTLAE++R+P+V
Sbjct  383   FVDVLLSSIHQPLNPNDEEVYMLERTNXKAILLDMIAGAXDTSATAIVWTLAELLRHPKV  442

Query  1044  MKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGH  1223
             MK LQEEL++ +G++RMVEE DLP L+YL MV+KES RLHPVA LLVP +S+EDI ++G+
Sbjct  443   MKRLQEELQSVIGMDRMVEESDLPKLDYLXMVVKESLRLHPVAPLLVPHQSMEDITVDGY  502

Query  1224  FIPKK  1238
              IPKK
Sbjct  503   HIPKK  507


 Score =   172 bits (435),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV IN W IG DPS+WSDNVEEF+PERFM+ +VD+RGHDF L+PFG GRR C
Sbjct  501   GYHIPKKSRVFINIWTIGRDPSVWSDNVEEFYPERFMNXNVDLRGHDFQLIPFGSGRRRC  560

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             P + LGL  V+L +G L+HCFNWELP+ M P +LDMTE F L+  K +HL+A+P+ RL
Sbjct  561   PAMQLGLTTVRLALGNLLHCFNWELPSGMLPKDLDMTEKFRLSLSKAKHLLAMPTCRL  618


 Score =   196 bits (497),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 134/185 (72%), Gaps = 0/185 (0%)
 Frame = +3

Query  210  GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
            GNLH LG LPHR+L  L+KKYGPIM ++LG +P +VVSSP AAEL LKTHD +FASRPK 
Sbjct  46   GNLHMLGDLPHRSLQNLAKKYGPIMSMRLGFIPTIVVSSPQAAELFLKTHDTIFASRPKL  105

Query  390  DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             A + ++ G+K MAF  YGP+WR  +K  T +LL  +KIE+   LRR E+   V+S++ A
Sbjct  106  QAFEYMSYGTKAMAFTEYGPYWRYIRKLCTLQLLCPSKIEASAPLRREEVGLLVQSLKVA  165

Query  570  AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLK  749
            A   E VDL+ +VG L+E +TY+M+ G   +D  DLK I+ E + LIGAFNI+DY+PFL 
Sbjct  166  AETDEVVDLSEKVGELVEGITYRMVLGRKKDDMFDLKGIIDEGMFLIGAFNISDYVPFLS  225

Query  750  PFDLQ  764
            PFDLQ
Sbjct  226  PFDLQ  230



>ref|XP_003627829.1| Cytochrome P450, partial [Medicago truncatula]
Length=591

 Score =   223 bits (568),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/416 (37%), Positives = 228/416 (55%), Gaps = 57/416 (14%)
 Frame = +3

Query  3     AIKHRNNLT*SCIAVKYENIVSLIMSSVGLALLSIFLATLWWFFRHRRAEESSksgrklp  182
             A + RNN   +       + +++IM  + + +L + LA+LW +   ++++E +   +++ 
Sbjct  23    APRQRNN---TLCKSNLNSPITVIMVLIYIPILLVSLASLWLWGSKKKSKEIATRSKRIT  79

Query  183   pgprplpiiGNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHD  362
                      G+L +LG  PHR+L++LS+KYGPIM+L+LG VP +VVSSP AAEL LKTHD
Sbjct  80    NF-------GSLLKLGPNPHRDLHKLSQKYGPIMHLRLGLVPIIVVSSPQAAELFLKTHD  132

Query  363   AVFASRPKNDAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMV  542
              VFASRP  +A KN   GS+ + F                     AKI SF  +R  E+ 
Sbjct  133   LVFASRPPIEAAKNHRLGSEELEFC-------------------HAKINSFKTMREQELD  173

Query  543   AWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLI  710
               +K +      R  VDL+ +V  L  +++ +M+ G    D+       K ++ E + L 
Sbjct  174   LLIKFLREKTNDRTKVDLSTKVSTLTADMSCRMVLGKKYTDDDLDEKGFKAVMLETMHLS  233

Query  711   GAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDM  890
                NI                       KS+   F +I+ EH Q   +      KD VD+
Sbjct  234   ATPNIE----------------------KSLMIFFDKIIDEHIQS--DNKDDKTKDFVDV  269

Query  891   MLASMKNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELE  1070
             ML  +    S ++++   IKA++ DM+ GS+DTS   IEW ++E+++NPRVMK +Q+ELE
Sbjct  270   MLGFVGTEESEYRIERNDIKAIMLDMLGGSMDTSATAIEWAISELLKNPRVMKNVQKELE  329

Query  1071  NKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
               VG+ R VEE DL  L+YLEMVIKES RLHPVA LL+P +SLED  +   FIPKK
Sbjct  330   TVVGMKRKVEESDLDKLKYLEMVIKESLRLHPVAPLLIPYQSLEDCMVEDLFIPKK  385


 Score =   153 bits (387),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSRV++N W+I  DP+ W+D  E+F+PERF   ++D++G DF L+PFG GRR CPG+ 
Sbjct  383   PKKSRVIVNAWSIMRDPNAWTDP-EKFWPERFEGNNIDVKGRDFQLIPFGSGRRGCPGLQ  441

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRLL*FADY  1590
             LGL  ++L+V QL+HCF+W+LPN M P +LDMTE FGL  P+  +L+A+P+YRL   A  
Sbjct  442   LGLTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEDFGLTMPRANNLIAIPAYRLFSLAFL  501

Query  1591  LI  1596
             L+
Sbjct  502   LL  503


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  210  GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRP  383
            G+L +LG  PHR+L++LS+KYGPIM+L+LG +P +VVSSP AAEL LKTHD VFASRP
Sbjct  524  GSLLKLGANPHRDLHQLSQKYGPIMHLRLGLIPTIVVSSPQAAELFLKTHDLVFASRP  581



>ref|XP_007159748.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31742.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=389

 Score =   306 bits (784),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 232/347 (67%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH+LG  PHR+L++L+ KYGP+MYL+LG VP VVVSSP AAEL LKTHD VFASRP +
Sbjct  37    GSLHKLGANPHRDLHQLALKYGPVMYLRLGFVPTVVVSSPQAAELFLKTHDLVFASRPPH  96

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K I+   + ++FA YG +WR  +K  T ELL+ +KI SF  +R  E+   VK +  A
Sbjct  97    EAAKYISWDQRNLSFAEYGSYWRNMRKMCTLELLSQSKINSFRSMRTEELDLLVKVLREA  156

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             A    AVDL+A+V  +  ++  +M+ G      + D    K ++QE + L    N+ DY+
Sbjct  157   ADVGAAVDLSAKVSTVSADMACRMVLGKKYMDRDLDEKGFKAVMQEGMHLSATPNMGDYI  216

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DLQGLNKR++ +GK  D  F +I+ EH Q  K   +   KD VD+ML  +    
Sbjct  217   PYIAALDLQGLNKRMKVVGKIFDDFFEKIIDEHMQSEKE--ENKTKDFVDVMLGFVGTEE  274

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++  +IKA++ DM+ GS+DTS   IEWTL+E+++NPRVMK LQ ELEN VG+ + V
Sbjct  275   SEYRIERPNIKAIMLDMLAGSMDTSATAIEWTLSELLKNPRVMKKLQVELENVVGMEKKV  334

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  LEYL+MVIKES RLHPVA LL+P +S ED  +   FIPKK
Sbjct  335   EESDLEKLEYLDMVIKESLRLHPVAPLLIPHQSTEDCMVGDFFIPKK  381



>ref|XP_010041191.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Eucalyptus 
grandis]
Length=400

 Score =   306 bits (784),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 227/347 (65%), Gaps = 6/347 (2%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL  LG  PH +L++L+KKYGP+MYL+LG VP +++SSP  AE  LKTHD +FASRP +
Sbjct  41    GNLPLLGKNPHHDLHKLAKKYGPLMYLRLGFVPTILISSPEVAEQFLKTHDLIFASRPPH  100

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A K+I+   + +AFAPYGP+WR  +K  T ELL+ AKI SF  +RR E+   V  ++ A
Sbjct  101   EAAKHISYEQRSLAFAPYGPYWRNIRKMCTLELLSNAKIYSFKSMRRDEVGLLVNFLKDA  160

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS----NNDNHDLKLIVQEIVSLIGAFNIADYL  737
             +    A+DL+A++  L  +++  M+FG        D    K +VQE++ L    NI DY+
Sbjct  161   SRDHMAIDLSAKISSLSADMSCLMVFGKKYMDREFDERGFKAVVQEVMVLTATPNIGDYV  220

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             PFL  FDLQGL KR++A+ +  D  F +I+ EH +  K   Q   KD VD+ML  M    
Sbjct  221   PFLASFDLQGLTKRMKAVSRVFDAFFEKIIDEHLETKKEEGQ--TKDFVDVMLGIMGLNE  278

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
               + +D   IKA++ DM+ GS+DTS   IEW +AE++++PR MK LQEELE   GLNR V
Sbjct  279   GEYHIDRPHIKAIILDMLAGSMDTSATAIEWAMAELIKHPRAMKKLQEELEKAAGLNRAV  338

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             EE DL  L+YL MVIKE+ RLHPVA LL+P E+ ED  +NG  IP K
Sbjct  339   EESDLEGLDYLHMVIKETMRLHPVAPLLLPHEATEDCTVNGFHIPYK  385



>ref|XP_010537436.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=454

 Score =   298 bits (764),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 233/350 (67%), Gaps = 9/350 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+LH LG LPH+ L  LS  YGPIM +KLG V  +VVSSP AAEL LKTHD VFA+RPK 
Sbjct  47    GHLHMLGELPHQTLTHLSNIYGPIMSIKLGGVRTIVVSSPRAAELFLKTHDHVFAARPKT  106

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K   +GSK +   PYG  WR  +K     LL ++KIE F  +R  E+   +  ++ A
Sbjct  107   QASKIFFNGSKAVTLTPYGSRWRNVRKLYVVHLLNSSKIEQFKPIRTEEIGVTMNRLKTA  166

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTS-NNDNHDLKLIVQEIVSLIGAFNIADYLPFL  746
             A   E V+++  +  L EN+ Y+M+FG   N+D+  LK +V+E VS+ G FNI+DY P L
Sbjct  167   AEKNEVVNVSKILIELFENLVYRMVFGRGKNDDDTRLKELVEEAVSISGVFNISDYFPLL  226

Query  747   KPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS---  917
              P DLQGL +R++ L +S + +F +I++EHEQ   +   K +KD VD++L S++N S   
Sbjct  227   APLDLQGLARRMKQLSQSTNIIFEKIIEEHEQQKDH-KSKDDKDFVDVLL-SLENQSMDP  284

Query  918   ---SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
                +S  +D + +K +L DM+  +++TS   IEW  +EI++NPRVMK LQEELE  +G +
Sbjct  285   QDKNSEIIDRSHVKVILLDMVGAALETSAKTIEWIFSEILKNPRVMKKLQEELETIIGTD  344

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             RMV+E DLP L YL+MVIKE  RLHP+  LLVP ES+ED+ ++G +IPKK
Sbjct  345   RMVQESDLPKLTYLDMVIKEGLRLHPIGPLLVPHESMEDVWVDGFYIPKK  394


 Score = 75.5 bits (184),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PKKSRV+IN W+I  D  +W DN EEF+PERF + ++DI+G DF L+PFG      
Sbjct  388   GFYIPKKSRVLINVWSIERDRGVWGDNTEEFYPERFENDNIDIQGLDFRLIPFGSDEEDV  447

Query  1399  P  1401
             P
Sbjct  448   P  448



>ref|XP_008793722.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=506

 Score =   246 bits (629),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/350 (40%), Positives = 214/350 (61%), Gaps = 9/350 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNLHQLG +PH +L  L+ KYGPI +L LG +P V+VSS   A+ +L+THD   +SRP+ 
Sbjct  47    GNLHQLGRMPHLSLQRLAHKYGPIFHLTLGHIPTVIVSSARTAKEVLRTHDLPLSSRPQL  106

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K +  G   +AF+PYG +WR  +K  T ELL+A ++ES+   R  E+   V+ I AA
Sbjct  107   HAAKQLFYGCTDIAFSPYGNYWRQVRKICTLELLSARRVESYRPARAAEVDQLVRRIAAA  166

Query  570   AGGRE-AVDLTAEVGRLIENVTYKMLFGT-----SNNDNHDLKLIVQEIVSLIGAFNIAD  731
             + G   AV+L+  +G     V  +  FG         D H  + +++E  +L+G F++AD
Sbjct  167   SSGPGGAVNLSRLLGLYANGVLCRAAFGREFVEGGEYDRHGFQKMLEEYQALLGGFSLAD  226

Query  732   YLPFLKPFD-LQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMK  908
             + P L+  + + G+ +RL    K  D  F EI++EH +  K    + +KD+VD++L   K
Sbjct  227   FYPSLEWVNAVTGMKRRLARTFKRFDCFFDEIIEEHRKRRKR--SEEDKDLVDVLLDIHK  284

Query  909   NPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLN  1088
             + S    L + ++KA++ DM     DT++  ++W + E++ NPR +K  Q+E+ + VG  
Sbjct  285   DGSLEMPLTMDNVKAIILDMFAAGTDTTFITLDWGMTELLMNPRALKRAQDEVRSIVGER  344

Query  1089  RMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             R V E DLP+L YL+ VIKE FR+HP A LLVPRES+E++ ++G+ IP K
Sbjct  345   RTVSEGDLPHLHYLKAVIKEIFRMHPPAPLLVPRESMEEVTIDGYQIPAK  394


 Score =   126 bits (316),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   P K+R+ +N WAIG DP  W  N + F PERF+  S+D +G DF LLPFG GRR C
Sbjct  388   GYQIPAKTRIFVNAWAIGRDPESWK-NPQVFEPERFLDSSIDFKGQDFELLPFGAGRRGC  446

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAV  1557
             P +  G+ ++++ + QL+H F+WELP+ + P  LDM E FG+   ++  LVAV
Sbjct  447   PAITFGMASIEIALAQLLHSFDWELPHGVKPEYLDMKEAFGITMHRIAELVAV  499



>ref|XP_003630097.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=457

 Score =   218 bits (556),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/392 (38%), Positives = 217/392 (55%), Gaps = 54/392 (14%)
 Frame = +3

Query  75    MSSVGLALLSIFLATLWWFFRHRRAEESSksgrklppgprplpiiGNLHQLGTLPHRNLN  254
             M  + + +L + LA+LW +   ++++E +   +++          G+L +LG  PHR+L+
Sbjct  1     MVLIYIPILLVSLASLWLWGSKKKSKEIATRSKRITNF-------GSLLKLGPNPHRDLH  53

Query  255   ELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAF  434
             +LS+KYGPIM+L+LG VP +VVSSP AAEL LKTHD VFASRP  +A KN   GS+ + F
Sbjct  54    KLSQKYGPIMHLRLGLVPIIVVSSPQAAELFLKTHDLVFASRPPIEAAKNHRLGSEELEF  113

Query  435   APYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGR  614
                                  AKI SF  +R  E+   +K +      R  VDL+ +V  
Sbjct  114   C-------------------HAKINSFKTMREQELDLLIKFLREKTNDRTKVDLSTKVST  154

Query  615   LIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRL  782
             L  +++ +M+ G    D+       K ++ E + L    NI                   
Sbjct  155   LTADMSCRMVLGKKYTDDDLDEKGFKAVMLETMHLSATPNIE------------------  196

Query  783   RALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDLASIKALLF  962
                 KS+   F +I+ EH Q   +      KD VD+ML  +    S ++++   IKA++ 
Sbjct  197   ----KSLMIFFDKIIDEHIQ--SDNKDDKTKDFVDVMLGFVGTEESEYRIERNDIKAIML  250

Query  963   DMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVI  1142
             DM+ GS+DTS   IEW ++E+++NPRVMK +Q+ELE  VG+ R VEE DL  L+YLEMVI
Sbjct  251   DMLGGSMDTSATAIEWAISELLKNPRVMKNVQKELETVVGMKRKVEESDLDKLKYLEMVI  310

Query  1143  KESFRLHPVATLLVPRESLEDIELNGHFIPKK  1238
             KES RLHPVA LL+P +SLED  +   FIPKK
Sbjct  311   KESLRLHPVAPLLIPYQSLEDCMVEDLFIPKK  342


 Score =   153 bits (386),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PKKSRV++N W+I  DP+ W+D  E+F+PERF   ++D++G DF L+PFG GRR CPG+ 
Sbjct  340   PKKSRVIVNAWSIMRDPNAWTDP-EKFWPERFEGNNIDVKGRDFQLIPFGSGRRGCPGLQ  398

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  ++L+V QL+HCF+W+LPN M P +LDMTE FGL  P+  +L+A+P+YRL
Sbjct  399   LGLTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEDFGLTMPRANNLIAIPAYRL  452



>gb|KEH15707.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=430

 Score =   233 bits (593),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/346 (42%), Positives = 211/346 (61%), Gaps = 48/346 (14%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             G+L +LG  PH +L++LS+KYGPIM+L+LG VP +VVSSP AAEL LKTHD +FASRP +
Sbjct  18    GSLLKLGANPHLDLHKLSQKYGPIMHLRLGLVPTIVVSSPQAAELFLKTHDLLFASRPPS  77

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
             +A                     G   F  Q+           D  +          EAA
Sbjct  78    EA---------------------GKLMFYNQK-----------DFMK----------EAA  95

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDN----HDLKLIVQEIVSLIGAFNIADYL  737
               G   VD++A+V  L  ++T +M+FG +  D        K +VQE+++L    NI+DY+
Sbjct  96    NDGT-TVDISAKVSTLTADMTCRMVFGKNYLDKGLYEKGFKAVVQELMNLAATPNISDYI  154

Query  738   PFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLASMKNPS  917
             P++   DL+GL+KR++ + K  D+   +I+ EH Q ++N      KD VD+ML  +    
Sbjct  155   PYIGALDLKGLSKRMKEISKIFDEFLEKIIDEHVQ-SQNKDDDKTKDFVDVMLDFVGTEQ  213

Query  918   SSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVGLNRMV  1097
             S ++++ ++IKA++ DM++G++DTS   IEWT++E+++NPRVMK +Q+ELE  VG+ R V
Sbjct  214   SEYRIERSNIKAIMMDMLIGAMDTSATSIEWTISELLKNPRVMKKVQKELETVVGMKRKV  273

Query  1098  EEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
             EE DL  LEYL +VIKES R+HPV  LLVP +S+ED  +   FIPK
Sbjct  274   EESDLDKLEYLNIVIKESLRIHPVVPLLVPHQSMEDCTVEEFFIPK  319


 Score =   138 bits (347),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK S +++N WAI  DP+ W+D  E+F+PERF   ++D+ GHDF L+PF  GRR CPG+ 
Sbjct  318   PKNSMIVVNAWAIMRDPNSWTDP-EKFWPERFEGNNIDVGGHDFQLIPFSSGRRGCPGLQ  376

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYR  1569
             LGL  V+L+V QL+HCF+++LPN M P +LDM E FG+   +  HL+A+P YR
Sbjct  377   LGLTMVRLVVAQLVHCFDFKLPNHMLPSDLDMAEAFGVTMRRANHLIAIPVYR  429



>ref|XP_004169555.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=429

 Score =   237 bits (605),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/316 (41%), Positives = 202/316 (64%), Gaps = 2/316 (1%)
 Frame = +3

Query  288   LKLGKvpavvvsspaaaELILKTHDAVFASRPKNDAVKNIADGSKGMAFAPYGPHWRGNK  467
             +KLG    +VVSSP AA+L LKTHD +FA+RP       ++   K +AF  +GP+W+  +
Sbjct  1     MKLGLQSTIVVSSPNAAKLFLKTHDPIFANRPVPQTSNQMSYDHKNIAFVQFGPYWQSMR  60

Query  468   KFATQELLTAAKIESFGDLRRGEMVAWVKSIEAAAGGREAVDLTAEVGRLIENVTYKMLF  647
             K  +  LLT++K+ SF  +RR E+   +  ++ AA     VDL++++  L  +V   MLF
Sbjct  61    KICSSHLLTSSKVNSFSSIRRQELGLLIHHLKEAARNHAIVDLSSKISSLTFDVICVMLF  120

Query  648   GTSNNDNHDLKLIVQEIVSLIGAFNIADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIV  827
             G    D  +L   ++E  SL GA N+ D+ PF+   DLQGL +R +A+ K VD     I+
Sbjct  121   GKKFVDK-ELTAAIREGTSLSGAPNLGDFFPFIAFLDLQGLGRRAKAVNKVVDGFLDMII  179

Query  828   KEHEQDAKNGVQKSNKDIVDMMLASMKNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIE  1007
             +E  +       +S++  VD+ML  +++    H++D ++IKA++FD+++G VD+S   I 
Sbjct  180   EERLEFKDKNKTESSELFVDVMLDLIRSEEMEHQIDRSNIKAVIFDLMIGGVDSSSTTII  239

Query  1008  WTLAEIMRNPRVMKLLQEELENKVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVP  1187
             W L+EI++NP+VMK +QEEL+  VGLN+MVEE  L  L+YL+M IKES R+HPV   L+P
Sbjct  240   WALSEIIKNPQVMKKIQEELKEVVGLNKMVEESHLNQLKYLDMTIKESLRIHPVIP-LIP  298

Query  1188  RESLEDIELNGHFIPK  1235
             R+S++D  +NG+ IPK
Sbjct  299   RKSIQDCNVNGYHIPK  314


 Score =   132 bits (332),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +1

Query  1216  TGTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGH--DFHLLPFGYGR  1389
              G   PK + ++IN WAIG DP  W +  ++F P+RF+   +D  G+  +F ++PFG GR
Sbjct  308   NGYHIPKNTDIIINDWAIGQDPCYWIEP-QKFNPDRFVDTQIDFIGNKNNFEMIPFGSGR  366

Query  1390  RVCPGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYR  1569
             R CPG+ LGL+ V++IV QL+HCF+WELPN + P ELDM+E FGL+ P+ Q+L  VP YR
Sbjct  367   RGCPGMQLGLVLVRMIVAQLVHCFDWELPNGVLPSELDMSEDFGLSCPRAQNLRVVPVYR  426

Query  1570  L  1572
             +
Sbjct  427   V  427



>ref|XP_002273390.1| PREDICTED: cytochrome P450 71A1-like [Vitis vinifera]
Length=511

 Score =   238 bits (606),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 202/351 (58%), Gaps = 11/351 (3%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL+ +G LPHR+++ELS+KYGPIM L+ G  P VV SS A A+L LKTHD  FASRPK 
Sbjct  45    GNLNLIGALPHRSIHELSQKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKT  104

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K        + ++PYGP+WR  +K    EL +A ++ES+  +R  E  + + S+   
Sbjct  105   AAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQ  164

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNH---------DLKLIVQEIVSLIGAFN  722
             +     VDL   +  +  NV  +M+ G    D +         + K ++ E+  L G  N
Sbjct  165   SNS--PVDLKDHLSTVSLNVISRMVLGKKYLDENVEGSIVTPEEFKKMLDELFLLSGVLN  222

Query  723   IADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQKSNKDIVDMMLAS  902
             I D +P++   DLQG  KR++ L K  D+    ++ EH    K       KD+VD++L  
Sbjct  223   IGDSIPWIDFLDLQGYVKRMKVLSKKFDRFLEHVLDEHNARRKGVENYVAKDMVDVLLQF  282

Query  903   MKNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELENKVG  1082
               +P+   KL+   +KA   D+I G  ++S   +EW ++E++R P +     EEL+  +G
Sbjct  283   ADDPTLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLRKPELFDKATEELDRVIG  342

Query  1083  LNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
               R VEEKD+PNL YL+ ++KE+ R+HPVA +LVPR S EDI++  + IPK
Sbjct  343   KERWVEEKDIPNLPYLDTIVKETMRMHPVAPMLVPRFSREDIKIADYDIPK  393


 Score =   131 bits (329),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  1231  PKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVCPGVN  1410
             PK +RV++N W IG DP IW D   EF PERF+ K++D++G DF LLPFG GRR+CPG +
Sbjct  392   PKDTRVLVNVWTIGRDPEIW-DQPNEFIPERFIGKNIDVKGQDFELLPFGTGRRMCPGYS  450

Query  1411  LGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             LGL  ++  +  L+H F W+LP  M P +L M E FGL++PK   LVA+   RL
Sbjct  451   LGLKVIQSSLANLLHGFKWKLPGDMKPGDLSMEEIFGLSTPKKIPLVAMAEPRL  504



>ref|XP_010086796.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB23806.1| Cytochrome P450 71A1 [Morus notabilis]
Length=514

 Score =   236 bits (601),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 208/354 (59%), Gaps = 13/354 (4%)
 Frame = +3

Query  210   GNLHQLGTLPHRNLNELSKKYGPIMYLKLGKvpavvvsspaaaELILKTHDAVFASRPKN  389
             GNL+ +G LPHR++ +LS+KYGPIM L  G  P VV SS   A++ LKTHD  F  RPK 
Sbjct  44    GNLNLIGPLPHRSIYDLSQKYGPIMQLWFGSFPVVVGSSVEMAKIFLKTHDLTFVGRPKI  103

Query  390   DAVKNIADGSKGMAFAPYGPHWRGNKKFATQELLTAAKIESFGDLRRGEMVAWVKSIEAA  569
              A K        + ++PYGP+WR  +K    EL +A +++S+  +RR EM A +K++   
Sbjct  104   AAGKYTTYNYSNITWSPYGPYWRQARKMCLMELFSARRLDSYEYIRREEMRALLKALFEF  163

Query  570   AGGREAVDLTAEVGRLIENVTYKMLFGTSNNDNHD---------LKLIVQEIVSLIGAFN  722
             +   + V L  ++  +  NV  +M+ G +  D  D          K ++ E+  L G  N
Sbjct  164   SKTEKLVLLKDQLSTVSLNVISRMVLGKNYTDGSDPNAVVSPDEFKKMLDELFLLSGVLN  223

Query  723   IADYLPFLKPFDLQGLNKRLRALGKSVDKLFLEIVKEHEQDAKNGVQ---KSNKDIVDMM  893
             I D +P+L   DLQG  KR++AL K  D+ FLE V +   + + GV+      +D+VD++
Sbjct  224   IGDSIPWLDFLDLQGYIKRMKALSKKWDR-FLEHVLDEHNERRKGVKDYVPHAQDMVDVL  282

Query  894   LASMKNPSSSHKLDLASIKALLFDMIVGSVDTSYAWIEWTLAEIMRNPRVMKLLQEELEN  1073
             L    +P+   KL+   +KA   D+I G  ++S   +EW ++E+++ P + K   EEL+ 
Sbjct  283   LQLADDPTLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLKKPEIFKKATEELDR  342

Query  1074  KVGLNRMVEEKDLPNLEYLEMVIKESFRLHPVATLLVPRESLEDIELNGHFIPK  1235
              +G  R VEEKD+ NL Y++ + KE+ RLHPVA +LVPR  L+DI++NG+ IPK
Sbjct  343   VIGRERWVEEKDIVNLPYIDAIAKETMRLHPVAPMLVPRFCLDDIKINGYDIPK  396


 Score =   132 bits (332),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = +1

Query  1219  GTSYPKKSRVMINCWAIGHDPSIWSDNVEEFFPERFMSKSVDIRGHDFHLLPFGYGRRVC  1398
             G   PK +RV+++ WAIG DPS+W DN  EF PERF+ K VD++G +F LLPFG GRR+C
Sbjct  391   GYDIPKDTRVLVSVWAIGRDPSLW-DNPNEFVPERFIGKDVDVKGQNFELLPFGSGRRMC  449

Query  1399  PGVNLGLINVKLIVGQLMHCFNWELPNKMSPHELDMTETFGLASPKVQHLVAVPSYRL  1572
             PG +LGL  ++  +  L+H F W LP  M   +LDM E FGL++PK   LVAV   RL
Sbjct  450   PGYSLGLKVIQSSLANLLHGFTWNLPPNMKREDLDMNEIFGLSTPKKIPLVAVAEPRL  507



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5262573346098