BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14408_g1_i1 len=658 path=[1:0-142 144:143-252 254:253-288
290:289-335 337:336-657]

Length=658
                                                                      Score     E

ref|XP_009762897.1|  PREDICTED: gibberellin-regulated protein 5-like    161   1e-46   
ref|XP_009803055.1|  PREDICTED: gibberellin-regulated protein 5-l...    159   8e-46   
ref|XP_009616241.1|  PREDICTED: gibberellin-regulated protein 5-like    157   4e-45   
ref|XP_009803054.1|  PREDICTED: gibberellin-regulated protein 5-l...    157   5e-45   
ref|XP_009592386.1|  PREDICTED: gibberellin-regulated protein 5-like    155   2e-44   
ref|XP_009607999.1|  PREDICTED: gibberellin-regulated protein 5-like    151   6e-43   
ref|XP_009797080.1|  PREDICTED: gibberellin-regulated protein 5-like    150   3e-42   
ref|XP_009613810.1|  PREDICTED: gibberellin-regulated protein 5-like    143   7e-40   
gb|EYU46338.1|  hypothetical protein MIMGU_mgv1a020071mg                119   2e-30   
ref|XP_010274082.1|  PREDICTED: gibberellin-regulated protein 12        118   9e-30   
emb|CBL95259.1|  gasa5 like protein                                     106   2e-25   
gb|AAA74480.1|  gibberellin-regulated                                   105   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197027.1|  gibberellin-regulated protein 4                       105   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871654.1|  hypothetical protein ARALYDRAFT_488368             104   1e-24   
gb|ABK22391.1|  unknown                                                 103   1e-24   Picea sitchensis
ref|XP_008224510.1|  PREDICTED: gibberellin-regulated protein 12-...    103   2e-24   
gb|KDO41153.1|  hypothetical protein CISIN_1g041400mg                   102   4e-24   
ref|XP_003618498.1|  Gibberellin-regulated protein                      102   4e-24   
ref|XP_004986740.1|  PREDICTED: gibberellin-regulated protein 12-...    101   9e-24   
gb|AGE15498.1|  GA-stimulated transcript-like protein 2                 102   1e-23   
ref|XP_006493084.1|  PREDICTED: gibberellin-regulated protein 12-...    101   1e-23   
ref|NP_001235994.1|  uncharacterized protein LOC100305480 precursor     101   2e-23   
ref|XP_010471557.1|  PREDICTED: gibberellin-regulated protein 6-like    100   2e-23   
emb|CDX70601.1|  BnaC03g06850D                                          101   2e-23   
ref|XP_006296776.1|  hypothetical protein CARUB_v10015821mg             100   2e-23   
ref|XP_009131454.1|  PREDICTED: gibberellin-regulated protein 4         100   3e-23   
gb|AGE15501.1|  GA-stimulated transcript-like protein 5                 100   3e-23   
ref|XP_007151230.1|  hypothetical protein PHAVU_004G028800g             100   3e-23   
gb|KDO50409.1|  hypothetical protein CISIN_1g033715mg                   100   4e-23   
ref|XP_006446220.1|  hypothetical protein CICLE_v10017244mg             100   5e-23   
ref|XP_009761199.1|  PREDICTED: gibberellin-regulated protein 4         100   5e-23   
ref|XP_006400040.1|  hypothetical protein EUTSA_v10015100mg           99.8    6e-23   
ref|XP_009126040.1|  PREDICTED: gibberellin-regulated protein 4-like  99.4    8e-23   
gb|ABQ42002.1|  gibberellin induced protein                           99.4    1e-22   Sonneratia caseolaris
ref|XP_011098626.1|  PREDICTED: gibberellin-regulated protein 4-like  99.0    1e-22   
ref|XP_009128056.1|  PREDICTED: gibberellin-regulated protein 6       98.6    1e-22   
ref|XP_006395777.1|  hypothetical protein EUTSA_v10005321mg           98.6    1e-22   
emb|CDY71845.1|  BnaAnng38970D                                        98.6    2e-22   
ref|NP_001149114.1|  GAST1 protein precursor                          99.4    2e-22   Zea mays [maize]
gb|ACF74297.1|  gibberellin-regulated protein                         98.6    2e-22   Arachis hypogaea [goober]
gb|AAV84588.1|  Gip1-like protein                                     98.2    2e-22   Populus tomentosa [Chinese white poplar]
ref|XP_010524331.1|  PREDICTED: gibberellin-regulated protein 4       98.2    2e-22   
ref|XP_006390402.1|  hypothetical protein EUTSA_v10019355mg           98.2    2e-22   
gb|ADX36135.1|  gibberellic acid-stimulated protein 1                 97.8    2e-22   
ref|XP_010510285.1|  PREDICTED: gibberellin-regulated protein 12-...  97.8    3e-22   
ref|XP_002442726.1|  hypothetical protein SORBIDRAFT_08g001840        98.6    3e-22   Sorghum bicolor [broomcorn]
gb|EYU34071.1|  hypothetical protein MIMGU_mgv1a016830mg              97.8    3e-22   
ref|XP_011035751.1|  PREDICTED: gibberellin-regulated protein 4       97.4    4e-22   
gb|AAC32128.1|  GASA5-like protein                                    97.4    5e-22   Picea mariana [black spruce]
gb|ABQ42004.1|  gibberellin induced protein                           97.4    5e-22   Sonneratia apetala
ref|XP_010416324.1|  PREDICTED: gibberellin-regulated protein 6       97.1    5e-22   
gb|AFW55883.1|  GAST1 protein                                         97.8    6e-22   
ref|XP_006828424.1|  hypothetical protein AMTR_s00060p00095260        96.7    6e-22   
ref|XP_003523021.1|  PREDICTED: gibberellin-regulated protein 4       97.1    7e-22   
ref|NP_001078587.1|  gibberellin-regulated protein 4                  95.9    9e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78620.1|  BnaA03g05320D                                        97.4    1e-21   
gb|ABQ42001.1|  gibberellin induced protein                           96.7    1e-21   Sonneratia alba
gb|ABQ42003.1|  gibberellin induced protein                           96.3    1e-21   Sonneratia ovata
gb|AFK43939.1|  unknown                                               95.9    1e-21   
ref|XP_004491797.1|  PREDICTED: gibberellin-regulated protein 4-like  95.9    2e-21   
ref|XP_003621217.1|  Gibberellin-regulated protein                    95.9    2e-21   
ref|XP_004978479.1|  PREDICTED: gibberellin-regulated protein 6-like  96.3    2e-21   
ref|XP_009106131.1|  PREDICTED: gibberellin-regulated protein 12-...  95.5    2e-21   
ref|XP_003544991.1|  PREDICTED: protein RSI-1-like                    95.5    2e-21   
ref|XP_007139576.1|  hypothetical protein PHAVU_008G041200g           95.5    2e-21   
gb|KDP27148.1|  hypothetical protein JCGZ_19847                       95.5    2e-21   
ref|XP_006288945.1|  hypothetical protein CARUB_v10002309mg           95.5    2e-21   
ref|XP_007227095.1|  hypothetical protein PRUPE_ppa025589mg           94.7    2e-21   
ref|XP_010246225.1|  PREDICTED: protein GAST1-like                    95.5    3e-21   
ref|XP_004489396.1|  PREDICTED: gibberellin-regulated protein 4-like  95.5    3e-21   
ref|NP_177605.2|  gibberellin-regulated protein 6                     95.1    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428457.1|  PREDICTED: gibberellin-regulated protein 6-like  95.1    3e-21   
ref|XP_006662142.1|  PREDICTED: gibberellin-regulated protein 12-...  95.1    3e-21   
ref|XP_006470710.1|  PREDICTED: protein GAST1-like                    95.1    3e-21   
ref|XP_009108078.1|  PREDICTED: gibberellin-regulated protein 12-...  95.1    4e-21   
ref|XP_010469795.1|  PREDICTED: gibberellin-regulated protein 12-...  94.7    4e-21   
emb|CDY46336.1|  BnaC01g30340D                                        94.7    4e-21   
ref|XP_002530088.1|  GAST1 protein precursor, putative                95.1    4e-21   Ricinus communis
ref|XP_008244953.1|  PREDICTED: protein GAST1-like                    95.1    4e-21   
ref|NP_001235155.1|  uncharacterized protein LOC100306189 precursor   94.4    5e-21   
ref|XP_006364599.1|  PREDICTED: gibberellin-regulated protein 6-like  94.4    5e-21   
ref|XP_004236040.1|  PREDICTED: gibberellin-regulated protein 6       94.4    5e-21   
ref|XP_010420181.1|  PREDICTED: gibberellin-regulated protein 4-like  94.4    6e-21   
ref|XP_002887551.1|  hypothetical protein ARALYDRAFT_895333           94.4    6e-21   
ref|XP_010673718.1|  PREDICTED: protein GAST1-like isoform X2         94.4    7e-21   
ref|XP_010469794.1|  PREDICTED: gibberellin-regulated protein 12-...  94.4    7e-21   
ref|XP_011080381.1|  PREDICTED: protein GAST1-like                    94.4    7e-21   
gb|ACM47319.1|  Gasa4-like protein                                    94.0    1e-20   Rosa x damascena [damask rose]
gb|AFK34043.1|  unknown                                               93.6    1e-20   
ref|XP_009419112.1|  PREDICTED: gibberellin-regulated protein 5-like  93.2    1e-20   
gb|AGL92232.1|  GASA-like protein GEG2                                93.6    1e-20   
ref|XP_006477453.1|  PREDICTED: gibberellin-regulated protein 6-like  93.6    1e-20   
ref|XP_010558231.1|  PREDICTED: protein GAST1                         94.0    1e-20   
gb|AAC32170.1|  GASA5-like protein                                    92.0    1e-20   Picea mariana [black spruce]
gb|AFH57279.1|  GASA-like protein                                     93.6    1e-20   
ref|XP_008649585.1|  PREDICTED: gibberellin-regulated protein 6-like  94.4    1e-20   
gb|AET00795.2|  GASA/GAST/Snakin                                      94.7    2e-20   
ref|XP_003617836.1|  Gibberellin induced protein                      94.7    2e-20   
gb|AES68406.2|  GASA/GAST/Snakin                                      94.7    2e-20   
ref|XP_010273304.1|  PREDICTED: uncharacterized protein LOC104608...    100   2e-20   
ref|XP_006295413.1|  hypothetical protein CARUB_v10024510mg           93.2    2e-20   
gb|KFK41905.1|  hypothetical protein AALP_AA2G187500                  92.4    2e-20   
ref|XP_010273303.1|  PREDICTED: uncharacterized protein LOC104608...    100   2e-20   
ref|XP_003598155.1|  Gibberellin induced protein                      94.7    2e-20   
ref|XP_004490815.1|  PREDICTED: protein RSI-1-like                    92.8    2e-20   
ref|XP_009614794.1|  PREDICTED: gibberellin-regulated protein 6       92.8    2e-20   
ref|XP_010038994.1|  PREDICTED: gibberellin-regulated protein 12      92.4    3e-20   
ref|NP_001240084.1|  uncharacterized protein LOC100787539 precursor   92.8    3e-20   
ref|XP_007212837.1|  hypothetical protein PRUPE_ppa020764mg           92.0    3e-20   
ref|XP_004517033.1|  PREDICTED: gibberellin-regulated protein 12-...  92.0    3e-20   
gb|KDP22135.1|  hypothetical protein JCGZ_25966                       92.8    3e-20   
ref|XP_010510284.1|  PREDICTED: gibberellin-regulated protein 12-...  92.4    3e-20   
ref|XP_002885614.1|  hypothetical protein ARALYDRAFT_898961           93.6    3e-20   
ref|XP_010673717.1|  PREDICTED: protein GAST1-like isoform X1         92.4    3e-20   
ref|XP_009781826.1|  PREDICTED: gibberellin-regulated protein 6-like  92.0    4e-20   
gb|AFW77815.1|  hypothetical protein ZEAMMB73_495748                  91.3    4e-20   
emb|CDP08494.1|  unnamed protein product                              92.0    5e-20   
ref|XP_010258349.1|  PREDICTED: gibberellin-regulated protein 6 i...  92.0    5e-20   
gb|AAG52379.1|AC011765_31  GAST1-like protein; 109761-110213          91.3    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337038.1|  PREDICTED: protein GAST1-like                    92.0    5e-20   
ref|NP_001235467.1|  uncharacterized protein LOC100500003 precursor   92.0    6e-20   
ref|XP_009587065.1|  PREDICTED: gibberellin-regulated protein 6-like  91.7    7e-20   
ref|XP_008344997.1|  PREDICTED: protein GAST1-like                    92.0    7e-20   
gb|AAQ57667.2|  Gasa4-like protein                                    91.7    7e-20   Pelargonium zonale
ref|XP_009775224.1|  PREDICTED: protein GAST1-like                    91.7    8e-20   
emb|CDY27104.1|  BnaA08g07420D                                        91.3    8e-20   
ref|XP_002284937.1|  PREDICTED: gibberellin-regulated protein 6       91.3    8e-20   Vitis vinifera
ref|XP_008659198.1|  PREDICTED: gibberellin-regulated protein 12      91.3    8e-20   
gb|KFK25767.1|  hypothetical protein AALP_AA8G157100                  91.7    8e-20   
ref|XP_010045037.1|  PREDICTED: protein GAST1-like                    91.7    9e-20   
gb|ACG30820.1|  GAST1 protein precursor                               92.4    9e-20   Zea mays [maize]
ref|XP_002881134.1|  gibberellin-regulated family protein             91.3    9e-20   
ref|XP_010464684.1|  PREDICTED: gibberellin-regulated protein 13-...  91.7    9e-20   
ref|XP_010481220.1|  PREDICTED: gibberellin-regulated protein 13-...  91.7    9e-20   
ref|XP_010258350.1|  PREDICTED: gibberellin-regulated protein 6 i...  90.9    1e-19   
ref|XP_010922895.1|  PREDICTED: gibberellin-regulated protein 6-like  91.3    1e-19   
ref|XP_010486614.1|  PREDICTED: gibberellin-regulated protein 13      91.7    1e-19   
gb|KHN48768.1|  Protein GAST1                                         90.1    1e-19   
dbj|BAF00966.1|  GAST1-like protein                                   90.1    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392373.1|  PREDICTED: protein GAST1 isoform X1              91.3    1e-19   
ref|XP_008240742.1|  PREDICTED: protein GAST1                         91.3    1e-19   
ref|XP_010481166.1|  PREDICTED: gibberellin-regulated protein 13-...  91.3    1e-19   
gb|EEC79111.1|  hypothetical protein OsI_19744                        92.0    1e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_010931460.1|  PREDICTED: gibberellin-regulated protein 6-like  90.9    1e-19   
ref|XP_004241582.1|  PREDICTED: gibberellin-regulated protein 6-like  90.9    1e-19   
ref|XP_010678520.1|  PREDICTED: gibberellin-regulated protein 6-like  90.5    1e-19   
gb|AGM20679.1|  GASA5                                                 90.5    1e-19   
ref|XP_006383339.1|  gibberellin-regulated protein 5                  90.5    2e-19   
ref|XP_004978341.1|  PREDICTED: gibberellin-regulated protein 6-like  90.1    2e-19   
ref|XP_006354781.1|  PREDICTED: gibberellin-regulated protein 6-like  90.5    2e-19   
gb|AFK37530.1|  unknown                                               90.1    2e-19   
ref|XP_009146866.1|  PREDICTED: gibberellin-regulated protein 13-...  90.9    2e-19   
ref|XP_010108998.1|  hypothetical protein L484_027195                 90.1    2e-19   
ref|XP_003613454.1|  Gibberellin induced protein                      90.1    2e-19   
ref|XP_011021371.1|  PREDICTED: protein RSI-1                         90.1    2e-19   
ref|XP_002467388.1|  hypothetical protein SORBIDRAFT_01g026925        90.9    2e-19   Sorghum bicolor [broomcorn]
emb|CAD10105.1|  Gip1-like protein                                    90.5    2e-19   Petunia x hybrida [garden petunia]
gb|EMT22883.1|  hypothetical protein F775_27923                       90.1    2e-19   
ref|XP_010091518.1|  hypothetical protein L484_015945                 90.5    2e-19   
emb|CDY00909.1|  BnaC05g42910D                                        90.5    2e-19   
emb|CDP03885.1|  unnamed protein product                              89.0    2e-19   
ref|XP_004493436.1|  PREDICTED: protein GAST1-like                    90.5    2e-19   
ref|NP_001148171.1|  GAST1 protein precursor                          91.3    2e-19   Zea mays [maize]
ref|NP_001150577.1|  LOC100284210 precursor                           91.3    2e-19   Zea mays [maize]
ref|XP_004489937.1|  PREDICTED: gibberellin-regulated protein 12-...  89.7    2e-19   
gb|AAW83819.1|  GASA2-like protein                                    90.5    2e-19   Pelargonium zonale
ref|XP_003519099.2|  PREDICTED: protein GAST1-like                    90.5    2e-19   
ref|XP_009123090.1|  PREDICTED: gibberellin-regulated protein 13-...  90.9    2e-19   
emb|CDP01621.1|  unnamed protein product                              89.7    2e-19   
ref|XP_010037169.1|  PREDICTED: gibberellin-regulated protein 6       90.1    2e-19   
ref|XP_006299108.1|  hypothetical protein CARUB_v10015247mg           89.4    3e-19   
emb|CDY22221.1|  BnaC01g38800D                                        90.5    3e-19   
ref|XP_006420919.1|  hypothetical protein CICLE_v10006668mg           89.0    3e-19   
ref|XP_010062256.1|  PREDICTED: gibberellin-regulated protein 5-like  89.7    3e-19   
ref|XP_006440597.1|  hypothetical protein CICLE_v10023012mg           89.7    3e-19   
ref|XP_010257391.1|  PREDICTED: gibberellin-regulated protein 6-like  89.7    3e-19   
ref|XP_008784232.1|  PREDICTED: gibberellin-regulated protein 6       90.1    3e-19   
ref|XP_009414179.1|  PREDICTED: gibberellin-regulated protein 5-l...  90.1    3e-19   
ref|XP_008807353.1|  PREDICTED: gibberellin-regulated protein 6-like  89.7    3e-19   
ref|XP_007141900.1|  hypothetical protein PHAVU_008G235300g           89.4    4e-19   
ref|XP_010532783.1|  PREDICTED: gibberellin-regulated protein 12      89.4    4e-19   
ref|XP_007215189.1|  hypothetical protein PRUPE_ppa013959mg           89.0    4e-19   
ref|XP_009347627.1|  PREDICTED: protein GAST1-like                    89.7    4e-19   
ref|XP_004299361.1|  PREDICTED: gibberellin-regulated protein 6-like  89.4    4e-19   
gb|KFK38405.1|  hypothetical protein AALP_AA3G108800                  89.7    4e-19   
ref|XP_004304306.1|  PREDICTED: gibberellin-regulated protein 4-like  89.4    5e-19   
ref|XP_009410471.1|  PREDICTED: gibberellin-regulated protein 6-like  90.1    5e-19   
gb|AGL92234.1|  GASA-like protein GEG4                                89.0    5e-19   
ref|XP_007209788.1|  hypothetical protein PRUPE_ppa013704mg           89.4    5e-19   
ref|XP_010414214.1|  PREDICTED: gibberellin-regulated protein 12-...  89.4    5e-19   
emb|CDY41324.1|  BnaA01g31950D                                        89.4    6e-19   
ref|NP_001234666.1|  protein RSI-1 precursor                          89.0    6e-19   
ref|XP_003625068.1|  Gibberellin induced protein                      89.4    6e-19   
ref|XP_011075384.1|  PREDICTED: protein GAST1-like                    89.4    6e-19   
ref|XP_009348406.1|  PREDICTED: gibberellin-regulated protein 12-...  89.0    6e-19   
ref|XP_008460555.1|  PREDICTED: protein RSI-1-like                    88.6    6e-19   
gb|AFK42462.1|  unknown                                               89.0    6e-19   
gb|AEC10958.1|  gibberellin induced protein                           89.4    6e-19   
gb|KHG09441.1|  Protein GAST1                                         89.4    7e-19   
ref|XP_008392374.1|  PREDICTED: protein GAST1 isoform X2              89.0    8e-19   
ref|XP_008393156.1|  PREDICTED: gibberellin-regulated protein 6       89.0    8e-19   
ref|XP_009339293.1|  PREDICTED: gibberellin-regulated protein 6-like  89.0    8e-19   
ref|XP_010672957.1|  PREDICTED: gibberellin-regulated protein 13-...  89.0    8e-19   
emb|CDY60168.1|  BnaAnng16620D                                        89.0    8e-19   
gb|KDP31251.1|  hypothetical protein JCGZ_11627                       89.0    8e-19   
ref|XP_010672958.1|  PREDICTED: gibberellin-regulated protein 13-...  89.0    8e-19   
ref|XP_007215190.1|  hypothetical protein PRUPE_ppa013959mg           88.2    8e-19   
ref|XP_004959452.1|  PREDICTED: gibberellin-regulated protein 6-like  88.6    8e-19   
gb|AGM38075.1|  putative gibberellin-regulated GAST1-like protein     88.6    9e-19   
ref|XP_007138184.1|  hypothetical protein PHAVU_009G187400g           88.6    9e-19   
ref|XP_002298301.2|  hypothetical protein POPTR_0001s26100g           89.4    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010908421.1|  PREDICTED: protein RSI-1-like                    87.8    1e-18   
ref|XP_009414177.1|  PREDICTED: gibberellin-regulated protein 5-l...  89.0    1e-18   
ref|XP_007162142.1|  hypothetical protein PHAVU_001G127700g           89.4    1e-18   
ref|XP_010937130.1|  PREDICTED: gibberellin-regulated protein 6       88.6    1e-18   
ref|XP_011045379.1|  PREDICTED: protein GAST1-like                    88.2    1e-18   
ref|NP_001176009.1|  Os10g0115550                                     88.6    1e-18   
gb|AFK49188.1|  unknown                                               88.6    1e-18   
emb|CDP12304.1|  unnamed protein product                              88.2    1e-18   
ref|XP_004962264.1|  PREDICTED: protein GAST1-like isoform X1         89.0    1e-18   
ref|XP_010236530.1|  PREDICTED: gibberellin-regulated protein 5-like  88.2    1e-18   
ref|NP_001063170.1|  Os09g0414900                                     88.2    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007028593.1|  Gibberellin-regulated family protein             88.2    2e-18   
ref|NP_001055385.1|  Os05g0376800                                     89.0    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008229202.1|  PREDICTED: protein RSI-1                         87.4    2e-18   
ref|XP_008800232.1|  PREDICTED: protein GAST1-like                    87.4    2e-18   
ref|XP_004962265.1|  PREDICTED: protein GAST1-like isoform X2         88.2    2e-18   
ref|XP_010538071.1|  PREDICTED: gibberellin-regulated protein 6       87.4    2e-18   
ref|XP_006655989.1|  PREDICTED: gibberellin-regulated protein 6-like  87.4    2e-18   
ref|NP_001237498.1|  uncharacterized protein LOC100306354 precursor   87.4    2e-18   
ref|XP_003554146.1|  PREDICTED: protein GAST1-like isoform 1          88.2    2e-18   
gb|EPS65179.1|  hypothetical protein M569_09600                       87.8    2e-18   
ref|XP_007216796.1|  hypothetical protein PRUPE_ppa023616mg           87.8    2e-18   
ref|XP_008800752.1|  PREDICTED: protein RSI-1-like                    87.0    2e-18   
gb|AGL92233.1|  GASA-like protein GEG3                                87.0    3e-18   
ref|XP_003616284.1|  GASA5-like protein                               87.0    3e-18   
gb|EPS67539.1|  gibberellin-regulated protein                         86.3    3e-18   
ref|XP_008788455.1|  PREDICTED: protein RSI-1-like                    86.7    3e-18   
ref|XP_004513860.1|  PREDICTED: gibberellin-regulated protein 14-...  89.0    3e-18   
ref|XP_006655260.1|  PREDICTED: gibberellin-regulated protein 14-...  88.2    4e-18   
gb|EAZ36571.1|  hypothetical protein OsJ_20910                        87.0    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938633.1|  PREDICTED: protein GAST1-like                    87.0    4e-18   
ref|XP_004517034.1|  PREDICTED: gibberellin-regulated protein 12-...  86.3    4e-18   
ref|XP_003613456.1|  Gibberellin-regulated protein                    86.3    5e-18   
ref|XP_002308912.2|  hypothetical protein POPTR_0006s04300g           86.7    5e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009383413.1|  PREDICTED: gibberellin-regulated protein 12      85.5    5e-18   
ref|XP_010646211.1|  PREDICTED: gibberellin-regulated protein 12-...  86.3    5e-18   
ref|XP_004140359.1|  PREDICTED: protein RSI-1-like                    86.7    6e-18   
ref|XP_002441006.1|  hypothetical protein SORBIDRAFT_09g018790        87.0    6e-18   Sorghum bicolor [broomcorn]
ref|XP_010056457.1|  PREDICTED: protein GAST1                         86.7    6e-18   
gb|EYU18662.1|  hypothetical protein MIMGU_mgv1a016553mg              86.7    6e-18   
ref|XP_004513859.1|  PREDICTED: gibberellin-regulated protein 14-...  87.8    7e-18   
ref|XP_006407600.1|  hypothetical protein EUTSA_v10021857mg           85.5    7e-18   
ref|XP_009793969.1|  PREDICTED: protein GAST1-like                    86.3    7e-18   
ref|XP_004158330.1|  PREDICTED: protein GAST1-like                    86.3    8e-18   
ref|XP_007034358.1|  Gibberellin-regulated family protein             86.7    8e-18   
gb|AAT42201.1|  gibberellin-stimulated protein                        85.9    1e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAD10104.1|  gibberellin induced protein 3                        85.9    1e-17   Petunia x hybrida [garden petunia]
gb|EAZ00446.1|  hypothetical protein OsI_22466                        85.9    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010685022.1|  PREDICTED: gibberellin-regulated protein 12-...  85.5    1e-17   
ref|XP_008355724.1|  PREDICTED: gibberellin-regulated protein 12-...  85.5    1e-17   
ref|XP_004147472.1|  PREDICTED: gibberellin-regulated protein 4-like  85.5    1e-17   
ref|XP_009619459.1|  PREDICTED: protein GAST1-like                    85.5    1e-17   
ref|XP_008239947.1|  PREDICTED: gibberellin-regulated protein 6       85.5    1e-17   
emb|CDP14204.1|  unnamed protein product                              85.5    1e-17   
gb|ACS68670.1|  gibberellin induced protein                           85.1    1e-17   Sonneratia alba
ref|XP_006421229.1|  hypothetical protein CICLE_v10006243mg           85.5    2e-17   
gb|EPS67879.1|  hypothetical protein M569_06897                       84.0    2e-17   
emb|CBI25690.3|  unnamed protein product                              85.1    2e-17   
ref|XP_003632726.1|  PREDICTED: protein GAST1                         85.1    2e-17   
ref|XP_003613435.1|  GAST1                                            84.7    2e-17   
gb|AAG43509.1|AF210049_1  gibberellin-induced protein 1               85.1    2e-17   Petunia x hybrida [garden petunia]
ref|XP_008464949.1|  PREDICTED: protein GAST1-like                    85.1    2e-17   
ref|XP_008443413.1|  PREDICTED: gibberellin-regulated protein 6       84.0    2e-17   
ref|XP_004965196.1|  PREDICTED: uncharacterized protein LOC101757...  87.4    2e-17   
ref|XP_006491553.1|  PREDICTED: protein GAST1-like                    85.1    2e-17   
gb|KDP26211.1|  hypothetical protein JCGZ_22457                       85.1    2e-17   
ref|XP_004965195.1|  PREDICTED: uncharacterized protein LOC101757...  87.0    2e-17   
ref|NP_001057346.1|  Os06g0266800                                     84.0    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006364638.1|  PREDICTED: protein RSI-1-like                    84.0    3e-17   
emb|CBI30071.3|  unnamed protein product                              84.3    3e-17   
ref|XP_002460210.1|  hypothetical protein SORBIDRAFT_02g024660        84.7    3e-17   
ref|XP_006827240.1|  hypothetical protein AMTR_s00010p00261380        84.3    3e-17   
ref|XP_002438216.1|  hypothetical protein SORBIDRAFT_10g009640        84.3    4e-17   
gb|AES96393.2|  GASA/GAST/Snakin                                      83.2    5e-17   
ref|XP_006482090.1|  PREDICTED: gibberellin-regulated protein 5-like  83.6    5e-17   
ref|XP_008658598.1|  PREDICTED: LOC100282417 isoform X1               84.0    5e-17   
ref|XP_007163834.1|  hypothetical protein PHAVU_001G268100g           83.2    6e-17   
gb|KGN59726.1|  hypothetical protein Csa_3G841990                     83.2    7e-17   
ref|XP_007163897.1|  hypothetical protein PHAVU_L007200g              83.2    7e-17   
ref|XP_006421228.1|  hypothetical protein CICLE_v10006243mg           82.8    7e-17   
ref|XP_009787829.1|  PREDICTED: protein GAST1-like                    83.2    8e-17   
ref|XP_011027306.1|  PREDICTED: protein GAST1-like                    83.6    8e-17   
emb|CAA60677.1|  gip1                                                 83.2    9e-17   
ref|XP_009410001.1|  PREDICTED: gibberellin-regulated protein 6-like  83.2    1e-16   
ref|XP_007034357.1|  Gibberellin-regulated family protein             83.2    1e-16   
ref|XP_006421227.1|  hypothetical protein CICLE_v10006243mg           82.4    1e-16   
ref|NP_001235028.1|  uncharacterized protein LOC100500485 precursor   83.6    1e-16   
gb|EMS62293.1|  hypothetical protein TRIUR3_16527                     82.8    1e-16   
ref|XP_006601874.1|  PREDICTED: gibberellin-regulated protein 12-...  82.0    2e-16   
gb|KHF97238.1|  Protein RSI-1                                         82.0    2e-16   
gb|EMT27427.1|  hypothetical protein F775_24525                       82.4    2e-16   
gb|EMT22213.1|  hypothetical protein F775_13483                       81.6    2e-16   
gb|ACG32788.1|  GAST1 protein precursor                               82.4    2e-16   
gb|ACG27426.1|  GAST1 protein precursor                               82.4    2e-16   
gb|ACG24561.1|  GAST1 protein precursor                               82.4    2e-16   
ref|NP_001148800.1|  LOC100282417 precursor                           82.4    2e-16   
ref|XP_003578115.1|  PREDICTED: gibberellin-regulated protein 12-...  82.4    2e-16   
ref|XP_002264339.1|  PREDICTED: gibberellin-regulated protein 4       82.0    2e-16   
ref|XP_002298694.2|  hypothetical protein POPTR_0001s32270g           80.9    2e-16   
ref|XP_011071640.1|  PREDICTED: gibberellin-regulated protein 4-like  82.0    2e-16   
ref|XP_002518090.1|  Gibberellin-regulated protein 4 precursor, p...  80.9    3e-16   
ref|XP_009589707.1|  PREDICTED: protein GAST1-like                    82.0    3e-16   
ref|XP_006338319.1|  PREDICTED: protein GAST1-like                    81.6    4e-16   
ref|XP_009403172.1|  PREDICTED: gibberellin-regulated protein 6-like  81.3    4e-16   
ref|XP_004232126.1|  PREDICTED: protein GAST1                         81.3    4e-16   
ref|XP_006843409.1|  hypothetical protein AMTR_s00053p00132370        80.1    5e-16   
emb|CDP19133.1|  unnamed protein product                              80.9    5e-16   
ref|XP_011071641.1|  PREDICTED: gibberellin-regulated protein 4-like  80.9    6e-16   
ref|XP_010248044.1|  PREDICTED: gibberellin-regulated protein 6-like  80.9    7e-16   
gb|ABF94978.1|  GAST1 protein precursor, putative                     80.5    7e-16   
ref|XP_009374587.1|  PREDICTED: gibberellin-regulated protein 12-...  80.9    8e-16   
ref|XP_006649745.1|  PREDICTED: gibberellin-regulated protein 12-...  80.5    8e-16   
ref|XP_006431148.1|  hypothetical protein CICLE_v10013454mg           80.1    1e-15   
ref|XP_003629688.1|  Gibberellin induced protein                      80.1    1e-15   
ref|XP_006351146.1|  PREDICTED: gibberellin-regulated protein 9-like  80.1    1e-15   
ref|XP_009383268.1|  PREDICTED: gibberellin-regulated protein 12-...  80.9    1e-15   
ref|XP_006416023.1|  hypothetical protein EUTSA_v10009207mg           79.7    1e-15   
ref|XP_006482595.1|  PREDICTED: gibberellin-regulated protein 4-like  79.7    2e-15   
ref|XP_010314649.1|  PREDICTED: gibberellin-regulated protein 1-like  79.7    2e-15   
ref|XP_008367840.1|  PREDICTED: gibberellin-regulated protein 12-...  79.7    2e-15   
ref|XP_009802479.1|  PREDICTED: protein RSI-1                         79.3    2e-15   
ref|XP_009590514.1|  PREDICTED: protein RSI-1-like                    79.0    2e-15   
ref|XP_003541683.1|  PREDICTED: gibberellin-regulated protein 12-...  79.0    2e-15   
ref|XP_010274741.1|  PREDICTED: protein RSI-1-like                    79.0    2e-15   
ref|XP_010469793.1|  PREDICTED: gibberellin-regulated protein 12-...  79.3    2e-15   
ref|XP_006358036.1|  PREDICTED: protein GAST1-like                    79.3    2e-15   
gb|EYU30907.1|  hypothetical protein MIMGU_mgv1a017014mg              79.0    3e-15   
ref|XP_004236562.1|  PREDICTED: protein GAST1-like                    79.3    3e-15   
ref|XP_002977665.1|  hypothetical protein SELMODRAFT_417581           79.0    3e-15   
ref|XP_002524960.1|  conserved hypothetical protein                   79.0    3e-15   
ref|XP_002979611.1|  hypothetical protein SELMODRAFT_419248           78.6    4e-15   
ref|XP_003613442.1|  GAST1                                            78.2    4e-15   
ref|XP_002870319.1|  predicted protein                                78.6    4e-15   
ref|XP_004250385.1|  PREDICTED: snakin-2-like                         79.3    4e-15   
ref|XP_008792485.1|  PREDICTED: gibberellin-regulated protein 5-like  78.6    4e-15   
gb|KDO72569.1|  hypothetical protein CISIN_1g040854mg                 78.6    5e-15   
ref|XP_006418799.1|  hypothetical protein EUTSA_v10003002mg           77.8    5e-15   
ref|XP_010558610.1|  PREDICTED: gibberellin-regulated protein 5       78.2    5e-15   
emb|CAD10106.1|  Gip1-like protein                                    78.2    5e-15   
ref|XP_010922909.1|  PREDICTED: gibberellin-regulated protein 12-...  78.2    6e-15   
ref|XP_009615077.1|  PREDICTED: protein RSI-1                         77.8    6e-15   
ref|XP_003563973.1|  PREDICTED: gibberellin-regulated protein 5-like  77.4    7e-15   
ref|XP_010492350.1|  PREDICTED: gibberellin-regulated protein 4-like  77.8    8e-15   
ref|XP_009797632.1|  PREDICTED: protein RSI-1-like                    77.0    1e-14   
ref|XP_008380555.1|  PREDICTED: gibberellin-regulated protein 12-...  77.4    1e-14   
gb|KHN24017.1|  Protein GAST1                                         75.9    1e-14   
ref|XP_007163594.1|  hypothetical protein PHAVU_001G247600g           77.0    1e-14   
ref|XP_002976786.1|  hypothetical protein SELMODRAFT_105504           75.9    2e-14   
ref|XP_008380554.1|  PREDICTED: gibberellin-regulated protein 12-...  77.0    2e-14   
ref|XP_006430565.1|  hypothetical protein CICLE_v10013200mg           76.6    2e-14   
ref|XP_004290947.1|  PREDICTED: peamaclein-like                       76.3    2e-14   
ref|XP_002973082.1|  hypothetical protein SELMODRAFT_99264            75.5    2e-14   
ref|XP_011099948.1|  PREDICTED: protein RSI-1-like                    76.3    2e-14   
ref|XP_009341013.1|  PREDICTED: gibberellin-regulated protein 4-like  76.6    2e-14   
ref|XP_002884344.1|  hypothetical protein ARALYDRAFT_317170           76.3    3e-14   
ref|XP_009369404.1|  PREDICTED: gibberellin-regulated protein 6       76.6    3e-14   
ref|XP_010673449.1|  PREDICTED: peamaclein-like                       75.9    3e-14   
ref|XP_008341575.1|  PREDICTED: gibberellin-regulated protein 4       76.3    3e-14   
gb|AHM24217.1|  GASR7                                                 75.9    3e-14   
dbj|BAJ89479.1|  predicted protein                                    75.9    3e-14   
ref|XP_002323857.1|  hypothetical protein POPTR_0017s11940g           75.9    3e-14   
gb|EMS56456.1|  hypothetical protein TRIUR3_28594                     75.9    4e-14   
gb|ABW89001.1|  GA-induced protein                                    75.9    4e-14   
gb|ABK22434.1|  unknown                                               75.9    4e-14   
gb|ABK25287.1|  unknown                                               75.9    4e-14   
emb|CAJ77893.1|  GASA                                                 75.9    4e-14   
ref|XP_007032998.1|  GAST1                                            75.5    4e-14   
ref|XP_002510126.1|  GAST1 protein precursor, putative                74.7    7e-14   
gb|ABK21371.1|  unknown                                               75.5    7e-14   
gb|KCW49802.1|  hypothetical protein EUGRSUZ_K03283                   74.7    7e-14   
gb|AAA98520.1|  GASA5                                                 74.7    7e-14   
gb|ABK21812.1|  unknown                                               75.5    8e-14   
ref|XP_006298867.1|  hypothetical protein CARUB_v10014986mg           74.7    8e-14   
gb|KHN21405.1|  Snakin-1                                              74.3    8e-14   
ref|XP_010066166.1|  PREDICTED: peamaclein-like                       74.3    8e-14   
ref|XP_006472264.1|  PREDICTED: snakin-1-like                         74.3    8e-14   
gb|ACG45047.1|  GAST1 protein precursor                               75.1    9e-14   
ref|XP_006433597.1|  hypothetical protein CICLE_v10002979mg           74.3    9e-14   
ref|NP_566186.1|  gibberellin-regulated protein 5                     74.3    9e-14   
ref|XP_008348072.1|  PREDICTED: gibberellin-regulated protein 6-like  74.7    1e-13   
ref|XP_009376270.1|  PREDICTED: gibberellin-regulated protein 4-like  74.7    1e-13   
gb|EEE58704.1|  hypothetical protein OsJ_10147                        75.1    1e-13   
ref|XP_006298856.1|  hypothetical protein CARUB_v10014971mg           74.3    1e-13   
gb|EEC74871.1|  hypothetical protein OsI_10763                        74.7    1e-13   
ref|XP_010443767.1|  PREDICTED: gibberellin-regulated protein 10-...  73.6    2e-13   
emb|CDY14668.1|  BnaC05g19250D                                        73.2    2e-13   
ref|NP_001236984.1|  uncharacterized protein LOC100500113             74.3    2e-13   
ref|XP_008224511.1|  PREDICTED: gibberellin-regulated protein 12-...  73.6    2e-13   
ref|XP_003550315.1|  PREDICTED: snakin-1                              73.6    2e-13   
ref|NP_001078130.1|  Gibberellin-regulated family protein             73.6    2e-13   
gb|AFT92001.1|  gibberellin-regulated protein                         73.2    2e-13   
gb|KFK37735.1|  hypothetical protein AALP_AA3G022800                  73.2    2e-13   
ref|XP_004509878.1|  PREDICTED: gibberellin-regulated protein 14-...  73.6    3e-13   
emb|CDP17256.1|  unnamed protein product                              73.2    3e-13   
ref|XP_010502522.1|  PREDICTED: gibberellin-regulated protein 5       73.2    3e-13   
gb|KFK39992.1|  hypothetical protein AALP_AA3G316000                  73.2    3e-13   
gb|ACU13365.1|  unknown                                               72.8    3e-13   
gb|ABK93160.1|  unknown                                               73.2    3e-13   
ref|XP_008230767.1|  PREDICTED: gibberellin-regulated protein 6-like  73.2    3e-13   
emb|CDP17251.1|  unnamed protein product                              73.2    4e-13   
ref|XP_006374850.1|  hypothetical protein POPTR_0014s02030g           72.8    4e-13   
ref|XP_008381340.1|  PREDICTED: protein RSI-1                         72.4    5e-13   
ref|XP_007215172.1|  hypothetical protein PRUPE_ppa013692mg           72.8    5e-13   
ref|XP_002283517.1|  PREDICTED: gibberellin-regulated protein 4       72.8    5e-13   
gb|AFT92002.1|  gibberellin-regulated protein                         72.0    5e-13   
ref|XP_010679570.1|  PREDICTED: peamaclein-like                       72.0    7e-13   
ref|XP_006416022.1|  hypothetical protein EUTSA_v10009582mg           72.0    7e-13   
ref|XP_008353837.1|  PREDICTED: protein RSI-1-like                    72.0    7e-13   
ref|XP_009144432.1|  PREDICTED: gibberellin-regulated protein 8-like  71.6    8e-13   
gb|ADE76246.1|  unknown                                               72.0    9e-13   
ref|XP_002973289.1|  hypothetical protein SELMODRAFT_99234            70.9    9e-13   
gb|ABK21133.1|  unknown                                               72.0    9e-13   
ref|XP_002982001.1|  hypothetical protein SELMODRAFT_115445           70.9    9e-13   
gb|EYU22941.1|  hypothetical protein MIMGU_mgv1a022909mg              71.6    9e-13   
ref|NP_180639.2|  gibberellin-regulated protein 12                    71.6    1e-12   
ref|XP_006346656.1|  PREDICTED: peamaclein-like                       70.5    1e-12   
ref|XP_011029030.1|  PREDICTED: peamaclein-like                       70.9    1e-12   
ref|XP_002531185.1|  RSI-1 protein precursor, putative                71.2    1e-12   
ref|XP_007145559.1|  hypothetical protein PHAVU_007G248900g           72.4    1e-12   
ref|XP_002285141.1|  PREDICTED: peamaclein                            70.9    2e-12   
ref|XP_006342570.1|  PREDICTED: gibberellin-regulated protein 1-like  71.2    2e-12   
ref|XP_010688303.1|  PREDICTED: peamaclein                            70.5    2e-12   
ref|XP_010105157.1|  hypothetical protein L484_003895                 71.2    2e-12   
ref|XP_010059861.1|  PREDICTED: peamaclein                            70.5    2e-12   
gb|EYU22850.1|  hypothetical protein MIMGU_mgv1a016408mg              71.2    2e-12   
ref|NP_181486.1|  gibberellin-regulated protein                       70.1    2e-12   
gb|AAC20716.1|  putative gibberellin-regulated protein                70.5    2e-12   
ref|XP_006281389.1|  hypothetical protein CARUB_v10027450mg           70.1    3e-12   
ref|XP_002883868.1|  gibberellin-regulated family protein             70.5    3e-12   
ref|XP_002986081.1|  hypothetical protein SELMODRAFT_123391           69.7    3e-12   
ref|XP_004252297.1|  PREDICTED: peamaclein                            70.1    3e-12   
ref|XP_009773391.1|  PREDICTED: peamaclein-like                       69.7    3e-12   
ref|XP_006417449.1|  hypothetical protein EUTSA_v10009615mg           69.7    3e-12   
ref|XP_007223838.1|  hypothetical protein PRUPE_ppa014086mg           69.7    4e-12   
ref|XP_010685204.1|  PREDICTED: peamaclein-like                       70.1    4e-12   
ref|XP_010491469.1|  PREDICTED: gibberellin-regulated protein 8-like  69.3    5e-12   
ref|XP_006346618.1|  PREDICTED: snakin-1-like                         69.3    5e-12   
ref|XP_006400907.1|  hypothetical protein EUTSA_v10015142mg           69.3    5e-12   
ref|XP_008441216.1|  PREDICTED: gibberellin-regulated protein 9       69.7    5e-12   
ref|XP_010100518.1|  hypothetical protein L484_027833                 74.7    5e-12   
gb|AFK41274.1|  unknown                                               69.3    6e-12   
ref|XP_006493083.1|  PREDICTED: gibberellin-regulated protein 12-...  69.3    6e-12   
gb|EYU29122.1|  hypothetical protein MIMGU_mgv1a017256mg              68.9    6e-12   
ref|XP_006420917.1|  hypothetical protein CICLE_v10006931mg           68.6    6e-12   
ref|XP_009798156.1|  PREDICTED: gibberellin-regulated protein 9-like  70.5    6e-12   
ref|XP_002965632.1|  hypothetical protein SELMODRAFT_84095            68.2    8e-12   
ref|XP_004138815.1|  PREDICTED: gibberellin-regulated protein 9-like  69.3    8e-12   
ref|XP_008237395.1|  PREDICTED: gibberellin-regulated protein 9       69.3    8e-12   
ref|XP_010556423.1|  PREDICTED: peamaclein                            68.9    9e-12   
ref|XP_004252296.1|  PREDICTED: peamaclein-like                       68.6    1e-11   
sp|P86888.1|PMLN_PRUPE  RecName: Full=Peamaclein; AltName: Allerg...  67.8    1e-11   
emb|CDX71072.1|  BnaC03g11560D                                        68.6    1e-11   
ref|XP_010458413.1|  PREDICTED: gibberellin-regulated protein 8-like  68.6    1e-11   
ref|XP_002989280.1|  hypothetical protein SELMODRAFT_129438           67.8    1e-11   
ref|NP_001240204.1|  uncharacterized protein LOC100788586 precursor   68.9    1e-11   
ref|XP_008780246.1|  PREDICTED: gibberellin-regulated protein 2-like  67.8    1e-11   
ref|XP_006606218.1|  PREDICTED: gibberellin-regulated protein 2-l...  68.6    1e-11   
ref|XP_010467977.1|  PREDICTED: gibberellin-regulated protein 5-like  68.9    1e-11   
gb|ACJ68116.1|  hypothetical protein                                  68.2    1e-11   
ref|XP_011069570.1|  PREDICTED: peamaclein                            68.2    1e-11   
ref|XP_009360284.1|  PREDICTED: peamaclein                            68.2    1e-11   
ref|XP_009404981.1|  PREDICTED: peamaclein-like                       68.2    1e-11   
ref|XP_010678522.1|  PREDICTED: gibberellin-regulated protein 6       68.2    1e-11   
ref|XP_009354123.1|  PREDICTED: peamaclein-like isoform X1            68.2    1e-11   
dbj|BAB08352.1|  unnamed protein product                              68.2    1e-11   
ref|XP_010062007.1|  PREDICTED: gibberellin-regulated protein 9       68.6    1e-11   
ref|XP_009604514.1|  PREDICTED: gibberellin-regulated protein 9-like  68.9    1e-11   
gb|KDO83921.1|  hypothetical protein CISIN_1g033656mg                 68.6    2e-11   
ref|XP_008360977.1|  PREDICTED: peamaclein                            67.8    2e-11   
ref|XP_010458411.1|  PREDICTED: gibberellin-regulated protein 8-like  67.8    2e-11   
ref|XP_002969375.1|  hypothetical protein SELMODRAFT_440818           68.2    2e-11   
ref|NP_568914.1|  gibberellin-regulated protein                       67.8    2e-11   
ref|XP_009591073.1|  PREDICTED: peamaclein-like                       67.8    2e-11   
ref|XP_002864654.1|  gibberellin-regulated family protein             67.8    2e-11   
gb|KHN14859.1|  Gibberellin-regulated protein 9                       67.0    2e-11   
ref|XP_010105475.1|  hypothetical protein L484_010255                 67.8    2e-11   
ref|XP_008377985.1|  PREDICTED: peamaclein                            67.4    2e-11   
ref|XP_009131966.1|  PREDICTED: gibberellin-regulated protein 10-...  67.4    2e-11   
ref|XP_004173361.1|  PREDICTED: gibberellin-regulated protein 9-like  67.4    2e-11   
gb|KCW68672.1|  hypothetical protein EUGRSUZ_F02269                   67.4    2e-11   
ref|XP_011074928.1|  PREDICTED: gibberellin-regulated protein 9       68.2    2e-11   
emb|CDY54472.1|  BnaA09g52760D                                        67.8    2e-11   
gb|EYU37603.1|  hypothetical protein MIMGU_mgv1a024675mg              67.4    3e-11   
gb|EYU25492.1|  hypothetical protein MIMGU_mgv1a017072mg              67.4    3e-11   
ref|XP_010271646.1|  PREDICTED: peamaclein-like                       67.4    3e-11   
ref|XP_006846942.1|  hypothetical protein AMTR_s00017p00002980        67.4    3e-11   
ref|XP_009354124.1|  PREDICTED: peamaclein-like isoform X2            67.0    3e-11   
ref|XP_007224623.1|  hypothetical protein PRUPE_ppa026867mg           66.6    4e-11   
ref|XP_010913495.1|  PREDICTED: snakin-2-like                         67.4    4e-11   



>ref|XP_009762897.1| PREDICTED: gibberellin-regulated protein 5-like [Nicotiana sylvestris]
Length=111

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRR  271
            MA+S R + T +L  VA L   +VS+A   FDA+LV KPPVGPTTCPVP +QC S C+ R
Sbjct  1    MAISKRSQATLLLSLVASLCFLEVSLAYRRFDASLVAKPPVGPTTCPVPTDQCSSACDHR  60

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CS TSH+ +CL+FCN CCNWC CVPPGT+G K+CCSCY DWKTQEGGPKCP
Sbjct  61   CSNTSHKNNCLLFCNKCCNWCQCVPPGTFGQKDCCSCYRDWKTQEGGPKCP  111



>ref|XP_009803055.1| PREDICTED: gibberellin-regulated protein 5-like isoform X2 [Nicotiana 
sylvestris]
Length=107

 Score =   159 bits (401),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
            ++T +LFF+A + +  VS+A   FDA+ + KPPVGPTTCPVP  QC S C++RCSATSH+
Sbjct  4    QFTLLLFFIASMWLIQVSLARQHFDASFLAKPPVGPTTCPVPTAQCSSACDQRCSATSHK  63

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             +CLMFCNMCCNWC CVPPGT+G KECCSCYNDWKT++G PKCP
Sbjct  64   NNCLMFCNMCCNWCQCVPPGTFGQKECCSCYNDWKTEQGTPKCP  107



>ref|XP_009616241.1| PREDICTED: gibberellin-regulated protein 5-like [Nicotiana tomentosiformis]
Length=107

 Score =   157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
            ++T +L F+A + +  VS+A   FDA+ + KPPVGPTTCPVP  QC S C++RCSATSH+
Sbjct  4    QFTLLLLFIASIGLIQVSLARQHFDASFLAKPPVGPTTCPVPTAQCSSACDQRCSATSHK  63

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             +CLMFCNMCCNWC CVPPGT+G KECCSCYNDWKT++G PKCP
Sbjct  64   NNCLMFCNMCCNWCQCVPPGTFGQKECCSCYNDWKTEQGTPKCP  107



>ref|XP_009803054.1| PREDICTED: gibberellin-regulated protein 5-like isoform X1 [Nicotiana 
sylvestris]
Length=107

 Score =   157 bits (396),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
            ++T +L F+A + +  VS+A   FDA+ + KPPVGPTTCPVP  QC S C++RCSATSH+
Sbjct  4    QFTLLLLFIASMWLIQVSLARQHFDASFLAKPPVGPTTCPVPTAQCSSACDQRCSATSHK  63

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             +CLMFCNMCCNWC CVPPGT+G KECCSCYNDWKT++G PKCP
Sbjct  64   NNCLMFCNMCCNWCQCVPPGTFGKKECCSCYNDWKTEQGTPKCP  107



>ref|XP_009592386.1| PREDICTED: gibberellin-regulated protein 5-like [Nicotiana tomentosiformis]
Length=107

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
            ++T +L F+A + +  VS+A   FDA+ + KPPVGPTTCPVP  QC S C++RCSATSH+
Sbjct  4    QFTLLLLFIASIGLIQVSLARQHFDASFLAKPPVGPTTCPVPTAQCSSACDQRCSATSHK  63

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             +CLMFCNMCCNWC CVPPGT+G KECCSCYN+WKT++G PKCP
Sbjct  64   NNCLMFCNMCCNWCQCVPPGTFGQKECCSCYNNWKTEQGTPKCP  107



>ref|XP_009607999.1| PREDICTED: gibberellin-regulated protein 5-like [Nicotiana tomentosiformis]
Length=111

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRR  271
            MA+S R + T +L  VA L   +VS+A   FDA+LV KPP+GP TCPVP +QC S CN R
Sbjct  1    MAISKRSQATLLLSLVASLCFIEVSLAYRRFDASLVGKPPIGPNTCPVPTDQCSSACNYR  60

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CS TSH+ +CL+FCN CCN C CVPPGT+G K+CCSCY  WKTQEGGPKCP
Sbjct  61   CSNTSHKNNCLLFCNKCCNRCQCVPPGTFGQKDCCSCYKGWKTQEGGPKCP  111



>ref|XP_009797080.1| PREDICTED: gibberellin-regulated protein 5-like [Nicotiana sylvestris]
Length=107

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
            ++T  L  +A + +  VS+A   FDA+ + KPPV PTTCPVP  QC S C++RCSATSH+
Sbjct  4    QFTLFLLLIASIWLIQVSLARQHFDASFLAKPPVCPTTCPVPTTQCSSACDQRCSATSHK  63

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             +CLMFCN+CCNWC CVPPGT+G KECCSCYNDWKT++G PKCP
Sbjct  64   NNCLMFCNICCNWCQCVPPGTFGQKECCSCYNDWKTEQGTPKCP  107



>ref|XP_009613810.1| PREDICTED: gibberellin-regulated protein 5-like [Nicotiana tomentosiformis]
 ref|XP_009803056.1| PREDICTED: gibberellin-regulated protein 5-like isoform X3 [Nicotiana 
sylvestris]
Length=93

 Score =   143 bits (361),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  LTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCC  325
            + +  VS+A   FDA+ + KPPVGPTTCPVP  QC S C++RCSATSH+ +CLMFCNMCC
Sbjct  1    MWLIQVSLARQHFDASFLAKPPVGPTTCPVPTAQCSSACDQRCSATSHKNNCLMFCNMCC  60

Query  326  NWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            NWC CVPPGT+G KECCSCYNDWKT++G PKCP
Sbjct  61   NWCQCVPPGTFGQKECCSCYNDWKTEQGTPKCP  93



>gb|EYU46338.1| hypothetical protein MIMGU_mgv1a020071mg [Erythranthe guttata]
Length=91

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 2/80 (3%)
 Frame = +2

Query  191  ALVLKPPVG--PTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGN  364
            +  L+PP+    TTC VP NQC S+CNRRCSATSH  +CL+FCN CCN CLCVPPGTYGN
Sbjct  12   SFSLRPPMPSPATTCAVPQNQCASQCNRRCSATSHLNNCLLFCNKCCNTCLCVPPGTYGN  71

Query  365  KECCSCYNDWKTQEGGPKCP  424
            KECC CYN+WKT+EGGPKCP
Sbjct  72   KECCPCYNNWKTKEGGPKCP  91



>ref|XP_010274082.1| PREDICTED: gibberellin-regulated protein 12 [Nelumbo nucifera]
Length=124

 Score =   118 bits (295),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = +2

Query  83   SKAMAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSEC  262
             K MA SSR    F+L F+AL+ V +VS+A P  +       P G     V    C  EC
Sbjct  12   EKIMAKSSRPSSVFLLIFLALMFVMEVSLAEPVDNGQNTTYHPEGAEG-SVRREDCPKEC  70

Query  263  NRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             RRCSATSH+K CL FCNMCC+ CLCVP GTYG+K  C CYN+WKTQ G PKCP
Sbjct  71   ARRCSATSHKKPCLFFCNMCCDKCLCVPSGTYGHKGECPCYNNWKTQRGTPKCP  124



>emb|CBL95259.1| gasa5 like protein [Pinus pinaster]
Length=108

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 5/105 (5%)
 Frame = +2

Query  125  ILFFVALLTVF-----DVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSH  289
            +L FV LLTVF     ++  A P  +    ++   G  +  +  ++CG  C+ RCSATSH
Sbjct  4    LLSFVVLLTVFALFIWNIEAALPYSNGGTWMEQKRGRGSGRLHPSECGGRCSYRCSATSH  63

Query  290  QKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            +K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  64   KKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  108



>gb|AAA74480.1| gibberellin-regulated [Arabidopsis thaliana]
Length=106

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            F+L  + L  +  + MA  G +     K   GP +  +   QC SEC+RRC  T + K+C
Sbjct  9    FLLTLIVLFMLQTMVMASSGSNVKWRQKR-YGPGS--LKRTQCPSECDRRCKKTQYHKAC  65

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            + FCN CC  CLCVPPG YGNK+ CSCYN+WKTQEGGPKCP
Sbjct  66   ITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP  106



>ref|NP_197027.1| gibberellin-regulated protein 4 [Arabidopsis thaliana]
 sp|P46690.2|GASA4_ARATH RecName: Full=Gibberellin-regulated protein 4; AltName: Full=GAST1 
protein homolog 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25909.1|AF360199_1 putative GASA4 protein [Arabidopsis thaliana]
 emb|CAA66909.1| GASA4 [Arabidopsis thaliana]
 emb|CAB89333.1| GASA4 [Arabidopsis thaliana]
 gb|AAK64106.1| putative GASA4 protein [Arabidopsis thaliana]
 gb|AAL14396.1| AT5g15230/F8M21_120 [Arabidopsis thaliana]
 gb|AED92132.1| gibberellin-regulated protein 4 [Arabidopsis thaliana]
Length=106

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            F+L  + L  +  + MA  G +     K   GP +  +   QC SEC+RRC  T + K+C
Sbjct  9    FLLTLIVLFMLQTMVMASSGSNVKWSQKR-YGPGS--LKRTQCPSECDRRCKKTQYHKAC  65

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            + FCN CC  CLCVPPG YGNK+ CSCYN+WKTQEGGPKCP
Sbjct  66   ITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP  106



>ref|XP_002871654.1| hypothetical protein ARALYDRAFT_488368 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47913.1| hypothetical protein ARALYDRAFT_488368 [Arabidopsis lyrata subsp. 
lyrata]
Length=106

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 63/101 (62%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            F+L  + L  +  + MA  G +     K      T  +   QC SEC+RRC  T + K+C
Sbjct  9    FLLALIVLFMLQTIVMASSGSNVNWSQKRY---GTGSLKRYQCPSECDRRCKKTQYHKAC  65

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            + FCN CC  CLCVPPG YGNK+ CSCYN+WKTQEGGPKCP
Sbjct  66   ITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP  106



>gb|ABK22391.1| unknown [Picea sitchensis]
 gb|ABK22466.1| unknown [Picea sitchensis]
 gb|ACN39986.1| unknown [Picea sitchensis]
Length=108

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            +R+    +L  V  L ++++  A P  +    ++   G  +  +  ++CG  C+ RCSAT
Sbjct  2    ARLLAFTVLVIVFALFIWNIEAALPYSNGDTWMQQKRGRGSGRLHPSECGGRCSYRCSAT  61

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            SH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  62   SHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  108



>ref|XP_008224510.1| PREDICTED: gibberellin-regulated protein 12-like [Prunus mume]
Length=107

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRR  271
            MA  S     F L F AL+   DV    PG  A   ++P  G  +  + A QCG  C  R
Sbjct  1    MARLSCFSTAFFLIF-ALICTIDVMAQSPG-RADGSVRPTGGEGS--LRAEQCGGACAYR  56

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CSATSH+  C+ FCNMCC  CLCVP GT+G+KE C CYN+WKT+EGGPKCP
Sbjct  57   CSATSHKNPCIEFCNMCCKKCLCVPSGTHGHKEECPCYNNWKTKEGGPKCP  107



>gb|KDO41153.1| hypothetical protein CISIN_1g041400mg [Citrus sinensis]
Length=95

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            +R+ ++ I   + L  VF V +A  G + +L  KP            QC S CN RCSAT
Sbjct  2    ARLSWSSIALVLFLSVVFAVEVANAGGEGSL--KP-----------EQCASACNYRCSAT  48

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            SH+  C+ FCNMCC  CLCVP GTYG+KE C CYN+WKT+EG PKCP
Sbjct  49   SHRNPCIEFCNMCCKKCLCVPSGTYGHKEECPCYNNWKTKEGTPKCP  95



>ref|XP_003618498.1| Gibberellin-regulated protein [Medicago truncatula]
 gb|AES74716.1| gibberellin-regulated family protein [Medicago truncatula]
Length=107

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALV-LKPPVGPTTCPVPANQCGSECNRRCSA  280
            +R+   FIL  +A+  +  V MA  G        K   GP +  + + QC S+C+RRC  
Sbjct  2    ARLVVVFILVLIAISMLQTVVMASHGHGGHHYNDKKKYGPGS--LKSYQCPSQCSRRCKN  59

Query  281  TSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            T + K C+ FC  CCN CLCVPPG YGNK  C CYN+WKTQ+GGPKCP
Sbjct  60   TQYHKPCMFFCQKCCNKCLCVPPGYYGNKAVCPCYNNWKTQQGGPKCP  107



>ref|XP_004986740.1| PREDICTED: gibberellin-regulated protein 12-like [Setaria italica]
Length=101

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 63/102 (62%), Gaps = 9/102 (9%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            + +LF +AL  V +VS  G           P G     VP  QC  +C+ RCSATSH+K 
Sbjct  9    SIVLFLLALAFVVEVSAGG--------FYKPAGAEG-SVPIEQCPDKCDYRCSATSHKKP  59

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CL FCN CC  CLCVP GTYGNKE C CYN+ K +EGGPKCP
Sbjct  60   CLFFCNYCCQKCLCVPSGTYGNKEECPCYNNMKNKEGGPKCP  101



>gb|AGE15498.1| GA-stimulated transcript-like protein 2 [Gossypium hirsutum]
 gb|KHG09539.1| Gibberellin-regulated 4 -like protein [Gossypium arboreum]
Length=106

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            +++  TF L  +A+  V  + MA  G           GP +  +   QC S+C RRCS T
Sbjct  2    AKLVATFFLALIAISMVQTLVMASHGHGGHHYDNKRYGPGS--LKPYQCPSQCTRRCSQT  59

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             + K C+ FC  CC  CLCVPPG YGNK+ C CYN+WKT+EGGPKCP
Sbjct  60   QYHKPCMFFCQKCCRTCLCVPPGYYGNKQVCPCYNNWKTKEGGPKCP  106



>ref|XP_006493084.1| PREDICTED: gibberellin-regulated protein 12-like [Citrus sinensis]
Length=95

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            +++ ++ I   + L  VF V +A  G + +L  KP            QC S CN RCSAT
Sbjct  2    AKLSWSSIALVLFLSVVFAVEVANAGGEGSL--KP-----------EQCASACNYRCSAT  48

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            SH+  C+ FCNMCC  CLCVP GTYG+KE C CYN+WKT+EG PKCP
Sbjct  49   SHRNPCIEFCNMCCKKCLCVPSGTYGHKEECPCYNNWKTKEGTPKCP  95



>ref|NP_001235994.1| uncharacterized protein LOC100305480 precursor [Glycine max]
 gb|ACU13162.1| unknown [Glycine max]
Length=110

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALV-LKPPVGPTTCPVPANQCGSECNR  268
            MAV++++    I+  +A+  +  V MA  G        K   GP +  + + QC S+C+R
Sbjct  1    MAVANKLLSVLIIALIAISMLQTVVMASHGHGGHHYNDKKKYGPGS--LKSFQCPSQCSR  58

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RC  T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  59   RCGKTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  110



>ref|XP_010471557.1| PREDICTED: gibberellin-regulated protein 6-like [Camelina sativa]
Length=101

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 65/112 (58%), Gaps = 12/112 (11%)
 Frame = +2

Query  89   AMAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNR  268
            A  ++S +  T I  F+ L T  D       +          GP +  + + QCG EC R
Sbjct  2    AKLITSLLYLTIIFSFIFLTTSKDAKYHPEKY----------GPGS--LKSYQCGGECTR  49

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCS T + K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  50   RCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>emb|CDX70601.1| BnaC03g06850D [Brassica napus]
Length=106

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            F+L  V    +  + MA  G       K   GP +  +  +QC  EC+RRCS T +  +C
Sbjct  9    FLLALVVFSLLQTMVMASSGSRVKYNPKR-YGPGS--LKRSQCPKECDRRCSQTQYHNAC  65

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            ++FCN CC  CLCVPPG YGNK+ CSCYN+WKTQEGGPKCP
Sbjct  66   ILFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP  106



>ref|XP_006296776.1| hypothetical protein CARUB_v10015821mg [Capsella rubella]
 gb|EOA29674.1| hypothetical protein CARUB_v10015821mg [Capsella rubella]
Length=91

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 63/101 (62%), Gaps = 13/101 (13%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            FI+ F+ L  +F    +  G + +L +              +C + CN RCSATSH+K C
Sbjct  4    FIVIFIVLSFLFATQFSNDGGEGSLTIA-------------ECPAACNVRCSATSHKKPC  50

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            L +CN CC  CLCVP GTYG+KE C CYN+WKTQEGGPKCP
Sbjct  51   LFYCNYCCKKCLCVPSGTYGHKEECPCYNNWKTQEGGPKCP  91



>ref|XP_009131454.1| PREDICTED: gibberellin-regulated protein 4 [Brassica rapa]
Length=106

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            F+L  +    +  + MA  G       K   GP +  +  +QC  EC+RRCS T +  +C
Sbjct  9    FLLALIVFSLLQTMVMASSGSRVKYNPKR-YGPGS--LKRSQCPKECDRRCSQTQYHNAC  65

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            ++FCN CC  CLCVPPG YGNK+ CSCYN+WKTQEGGPKCP
Sbjct  66   ILFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP  106



>gb|AGE15501.1| GA-stimulated transcript-like protein 5 [Gossypium hirsutum]
 gb|KHG02115.1| Gibberellin-regulated 4 -like protein [Gossypium arboreum]
Length=106

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            +++   F L  +A+  +  + +A  G       +   GP +  + + QC S+C+RRCS T
Sbjct  2    AKLVAAFFLALIAISMLQVMVLASHGHGGHHYDQKHYGPGS--LKSYQCPSQCSRRCSKT  59

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             + K C+ FC  CCN CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  60   QYHKPCMFFCQKCCNKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  106



>ref|XP_007151230.1| hypothetical protein PHAVU_004G028800g [Phaseolus vulgaris]
 gb|ESW23224.1| hypothetical protein PHAVU_004G028800g [Phaseolus vulgaris]
Length=110

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALV-LKPPVGPTTCPVPANQCGSECNR  268
            MAV++++   FI+  +A+  +  + +A  G        K   GP +  V + QC S+C R
Sbjct  1    MAVTAKLLSAFIIALIAISMLQTMVVASHGHGGHHYNDKKKYGPGS--VKSYQCPSQCTR  58

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+ GGPKCP
Sbjct  59   RCSRTQYHKPCMFFCQKCCMKCLCVPPGYYGNKAVCPCYNNWKTKRGGPKCP  110



>gb|KDO50409.1| hypothetical protein CISIN_1g033715mg [Citrus sinensis]
Length=113

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = +2

Query  122  FILFFVALLTVF--DVSMAGPGFDAALVL----KPPVGPTTCPVPANQCGSECNRRCSAT  283
             ++ FVAL+ V       AG G  A+ +     +P  G T   +   +C  +C+ RCSAT
Sbjct  7    LVVLFVALMLVLVAQNQAAGTGIAASQLQAQGNRPARGTTQGSLNHQECAPKCHYRCSAT  66

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            S++K CL FC  CC  CLCVP GTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  67   SYKKPCLFFCQKCCAKCLCVPAGTYGNKQTCPCYNNWKTKRGGPKCP  113



>ref|XP_006446220.1| hypothetical protein CICLE_v10017244mg [Citrus clementina]
 gb|ESR59460.1| hypothetical protein CICLE_v10017244mg [Citrus clementina]
Length=113

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = +2

Query  122  FILFFVALLTVF--DVSMAGPGFDAALVL----KPPVGPTTCPVPANQCGSECNRRCSAT  283
             ++ FVAL+ V       AG G  A+ +     +P  G T   +   +C  +C+ RCSAT
Sbjct  7    LVVLFVALMLVLVAQNQAAGTGIAASQLQAQGNRPARGTTQGSLNHQECAPKCDYRCSAT  66

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            S++K CL FC  CC  CLCVP GTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  67   SYKKPCLFFCQKCCAKCLCVPAGTYGNKQTCPCYNNWKTKRGGPKCP  113



>ref|XP_009761199.1| PREDICTED: gibberellin-regulated protein 4 [Nicotiana sylvestris]
Length=108

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  104  SRIEYTFILFFVA--LLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCS  277
            +++   F+L  VA  +L    ++++  G +A    K   GP +  + ++QC S+C RRC 
Sbjct  2    AKVRAFFLLAIVAISMLQAIVLAISQQGNEAHHSNKNRYGPGS--LKSSQCPSQCTRRCG  59

Query  278  ATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             T + K+C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  60   RTQYHKACIFFCQKCCRKCLCVPPGYYGNKALCPCYNNWKTKEGGPKCP  108



>ref|XP_006400040.1| hypothetical protein EUTSA_v10015100mg [Eutrema salsugineum]
 gb|ESQ41493.1| hypothetical protein EUTSA_v10015100mg [Eutrema salsugineum]
Length=102

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 64/102 (63%), Gaps = 3/102 (3%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            ++   F+  L VF +             K   GP +  +  +QC SECNRRCS T +  +
Sbjct  4    SYGALFLLALVVFSIFQTMVTASRGSQGKR-YGPGS--LKRSQCPSECNRRCSQTQYHNA  60

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C++FCN CC  CLCVPPG YGNK+ CSCYN+WKTQ+GGPKCP
Sbjct  61   CILFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQQGGPKCP  102



>ref|XP_009126040.1| PREDICTED: gibberellin-regulated protein 4-like [Brassica rapa]
 emb|CDX91001.1| BnaC02g05960D [Brassica napus]
 emb|CDX85557.1| BnaA02g02560D [Brassica napus]
Length=106

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            F+L  V    +  + MA  G       K   GP +  +  +QC  EC+RRCS T +  +C
Sbjct  9    FLLALVVFSLLQTMVMASSGSGGKYNPKR-YGPGS--LKRSQCPKECDRRCSQTQYHNAC  65

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            ++FCN CC  CLCVPPG YGNK+ CSCYN+WKTQ+GGPKCP
Sbjct  66   ILFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQQGGPKCP  106



>gb|ABQ42002.1| gibberellin induced protein [Sonneratia caseolaris]
Length=117

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 68/117 (58%), Gaps = 8/117 (7%)
 Frame = +2

Query  98   VSSRIEYTFILF----FVALLTVFDVSMAGPGFDAALV----LKPPVGPTTCPVPANQCG  253
            V +++    ILF    FV LL     S +G   +   +    +    G +   +   +CG
Sbjct  1    VMAKLASILILFAAFLFVLLLDETKASSSGVAANELQLQGRDINKMYGISEGSLRPQECG  60

Query  254  SECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
              C RRCSATS++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  61   PRCTRRCSATSYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  117



>ref|XP_011098626.1| PREDICTED: gibberellin-regulated protein 4-like [Sesamum indicum]
Length=106

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 66/104 (63%), Gaps = 5/104 (5%)
 Frame = +2

Query  122  FILFFVALLTVFDVSM---AGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
            F L FVALL +  + +   A    ++ L  K   GP +  + + QC S+C+RRCS T + 
Sbjct  5    FALVFVALLAISMLQIPVTAMASEESYLSNKSRYGPGS--LKSFQCPSQCSRRCSKTQYH  62

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  63   KPCMFFCQKCCRKCLCVPPGFYGNKAVCPCYNNWKTKEGGPKCP  106



>ref|XP_009128056.1| PREDICTED: gibberellin-regulated protein 6 [Brassica rapa]
Length=101

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 61/102 (60%), Gaps = 6/102 (6%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            T++LF   L +   ++M+            P       + + QCG EC RRCS T + K 
Sbjct  6    TYLLFITILFSFIFLTMSKE------TEYNPESYGAGSLKSYQCGGECTRRCSNTKYHKP  59

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  60   CMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|XP_006395777.1| hypothetical protein EUTSA_v10005321mg [Eutrema salsugineum]
 gb|ESQ33063.1| hypothetical protein EUTSA_v10005321mg [Eutrema salsugineum]
Length=104

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  134  FVALLTVFDVSMAGPGFDAALVLKPPVGPT----TCPVPANQCGSECNRRCSATSHQKSC  301
            F+A+  V +   A   F A  +  P   P        +    C   CN RCSATSH+ +C
Sbjct  4    FIAVFLVVNFLFATQCFHAEELESPSQAPGLQGGEGSLHIEDCPKACNYRCSATSHKSAC  63

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            LM+CN+CC  CLCVP GTYG+KE C CYN+WKT EGGPKCP
Sbjct  64   LMYCNLCCEKCLCVPSGTYGHKEECPCYNNWKTHEGGPKCP  104



>emb|CDY71845.1| BnaAnng38970D [Brassica napus]
Length=101

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 61/102 (60%), Gaps = 6/102 (6%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            T++LF   L +   ++M+            P       + + QCG EC RRCS T + K 
Sbjct  6    TYLLFITILFSFIFLTMSKE------TEYNPESYGAGSLKSYQCGGECTRRCSNTKYHKP  59

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  60   CMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|NP_001149114.1| GAST1 protein precursor [Zea mays]
 gb|ACG34244.1| GAST1 protein precursor [Zea mays]
Length=129

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            +QCG EC RRCS T H+K CL FCN CC  CLCVPPGTYGNKE C CYN+WKT++GGPKC
Sbjct  69   SQCGGECRRRCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKETCPCYNNWKTKKGGPKC  128

Query  422  P  424
            P
Sbjct  129  P  129



>gb|ACF74297.1| gibberellin-regulated protein [Arachis hypogaea]
Length=107

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVL-KPPVGPTTCPVPANQCGSECNRRCSATSHQK  295
             FIL  +A+  +  + MA  G    L   K   GP +  V + QC S+C+RRC  T + K
Sbjct  7    AFILALIAISMLQTMVMAANGQGGHLYDNKSQYGPGS--VKSYQCPSQCSRRCGKTQYHK  64

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  65   PCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  107



>gb|AAV84588.1| Gip1-like protein [Populus tomentosa]
 gb|AAV84589.1| Gip1-like protein [Populus tomentosa]
Length=106

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            +++   F+L  +A+  +  + +A  G       K   GP +  + + QC S+C RRCS T
Sbjct  2    AKLVAVFLLALIAISMLQTLVVASHGRGGHHQNKNQYGPGS--LKSFQCPSQCTRRCSKT  59

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  60   QYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  106



>ref|XP_010524331.1| PREDICTED: gibberellin-regulated protein 4 [Tarenaya hassleriana]
Length=106

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 3/102 (3%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
             F+L  + L  +  + MA          +   GP +  +  +QC  ECNRRC  T + K+
Sbjct  8    IFMLAIIVLSMLQTIVMASKATRGKWDPRR-YGPGS--LRRSQCPKECNRRCGNTQYHKA  64

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FCN CC  CLCVPPG YGNK+ CSCYN+WKT+EGGPKCP
Sbjct  65   CITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTKEGGPKCP  106



>ref|XP_006390402.1| hypothetical protein EUTSA_v10019355mg [Eutrema salsugineum]
 dbj|BAJ34528.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27688.1| hypothetical protein EUTSA_v10019355mg [Eutrema salsugineum]
Length=101

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            T++LF   L +   ++M+      A       GP +  + + QCG EC RRCS T + K 
Sbjct  6    TYLLFITILFSFTFLTMS----KEAEYHPERYGPGS--LKSYQCGGECTRRCSNTQYHKP  59

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC  CLCVPPG YGNK+ C CYN+WKTQ+GGPKCP
Sbjct  60   CMFFCQKCCAKCLCVPPGFYGNKQVCPCYNNWKTQQGGPKCP  101



>gb|ADX36135.1| gibberellic acid-stimulated protein 1 [Glycine soja]
 gb|KHN41076.1| Protein RSI-1 [Glycine soja]
Length=97

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 62/104 (60%), Gaps = 11/104 (11%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
             Y+ I+  ++LL +   S     +  +  L+P           + C  +C  RCSATSH+
Sbjct  5    SYSPIMVALSLLLLVTFSNVAEAYTRSGTLRP-----------SDCKPKCTYRCSATSHK  53

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            K C+ FC  CC  CLCVPPGTYGNK+ C CYN WKT+EGGPKCP
Sbjct  54   KPCMFFCQKCCAKCLCVPPGTYGNKQICPCYNSWKTKEGGPKCP  97



>ref|XP_010510285.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = +2

Query  134  FVALLTVFDVS---MAGPGFDAALVLKPPVGPTTCPVPAN------QCGSECNRRCSATS  286
               L+ +F VS   +A    +A  +  P   PT   +         +C +EC RRCSATS
Sbjct  1    MAKLIVLFIVSCLLLAIQFSNAEELESPGEAPTIYKMGGEGSLRPEECPAECQRRCSATS  60

Query  287  HQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            H+K CL FCN CCN CLCVP GTYG+KE C CYN+W+T+EGGPKCP
Sbjct  61   HKKPCLFFCNKCCNTCLCVPSGTYGHKEECPCYNNWRTKEGGPKCP  106



>ref|XP_002442726.1| hypothetical protein SORBIDRAFT_08g001840 [Sorghum bicolor]
 gb|EES16564.1| hypothetical protein SORBIDRAFT_08g001840 [Sorghum bicolor]
Length=127

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            +QCG EC RRCS T H+K CL FCN CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKC
Sbjct  67   SQCGGECKRRCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKDTCPCYNNWKTKRGGPKC  126

Query  422  P  424
            P
Sbjct  127  P  127



>gb|EYU34071.1| hypothetical protein MIMGU_mgv1a016830mg [Erythranthe guttata]
Length=105

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = +2

Query  116  YTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQK  295
            + F+L  +  +T+ ++ +           K   GP +  V + QC S+C RRCS T + K
Sbjct  5    FAFLLIALIAITMLEIPVMASLDGGIQASKIRYGPGS--VKSFQCPSQCTRRCSRTQYHK  62

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  63   PCMFFCQKCCRKCLCVPPGYYGNKSVCPCYNNWKTKEGGPKCP  105



>ref|XP_011035751.1| PREDICTED: gibberellin-regulated protein 4 [Populus euphratica]
Length=106

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            ++    F+L  +A+  +  + +A  G       K   GP +  + + QC S+C RRCS T
Sbjct  2    AKFVAVFLLALIAISMLQTLVVASHGRGGHHRNKNKYGPGS--LKSFQCPSQCTRRCSQT  59

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  60   QYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  106



>gb|AAC32128.1| GASA5-like protein [Picea mariana]
Length=110

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +2

Query  116  YTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPT-TCPVPANQCGSECNRRCSATSHQ  292
            +  +L  +  L ++++  A P  +    ++   G      +  ++CG  C+ RCSATSH+
Sbjct  7    FAVLLITIFALFIWNIEAALPHSNVDPFMEQKQGQYGEGSLRPSECGQRCSYRCSATSHK  66

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            K C+ FC  CC  CLCVPPGT+GNK+ C CYN+WKTQ+GGPKCP
Sbjct  67   KPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP  110



>gb|ABQ42004.1| gibberellin induced protein [Sonneratia apetala]
Length=117

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = +2

Query  89   AMAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLK-------PPVGPTTCPVPANQ  247
             MA  + I   F  F   LL   D + A     AA  L+          G +   +   +
Sbjct  1    VMAKLASILILFAAFLFVLL--LDETKASSSVVAANELQLQGRDINKMYGISEGSLRPQE  58

Query  248  CGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CG  C RRCSATS++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  59   CGPRCTRRCSATSYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  117



>ref|XP_010416324.1| PREDICTED: gibberellin-regulated protein 6 [Camelina sativa]
Length=101

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 65/112 (58%), Gaps = 12/112 (11%)
 Frame = +2

Query  89   AMAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNR  268
            A  ++S +  T I  F+ L T  +       +          GP +  + + QCG EC R
Sbjct  2    AKLITSLLCLTIIFSFIFLTTSKEAKYHPEKY----------GPGS--LKSYQCGGECTR  49

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCS T + K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  50   RCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>gb|AFW55883.1| GAST1 protein [Zea mays]
Length=129

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            +QCG EC RRCS T H+K CL FCN CC  CLCVPPGTYGNKE C CYN+WKT++GGPKC
Sbjct  69   SQCGGECRRRCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKETCPCYNNWKTKKGGPKC  128

Query  422  P  424
            P
Sbjct  129  P  129



>ref|XP_006828424.1| hypothetical protein AMTR_s00060p00095260 [Amborella trichopoda]
 gb|ERM95840.1| hypothetical protein AMTR_s00060p00095260 [Amborella trichopoda]
Length=91

 Score = 96.7 bits (239),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  ALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKE  370
             L +   V  +T  +  ++C  +C  RCSATSH+K CL FCN CC  CLCVPPGTYGNK+
Sbjct  14   VLAISSSVEGSTRRLRPSECSDKCQYRCSATSHKKPCLFFCNKCCAVCLCVPPGTYGNKQ  73

Query  371  CCSCYNDWKTQEGGPKCP  424
             C CYN+WKTQEG PKCP
Sbjct  74   SCPCYNNWKTQEGRPKCP  91



>ref|XP_003523021.1| PREDICTED: gibberellin-regulated protein 4 [Glycine max]
Length=106

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLK-PPVGPTTCPVPANQCGSECNRRCSATSHQK  295
             F +  +ALL +  ++      D+A  L     GP +  + ++QC SEC RRCS T + K
Sbjct  6    VFCVLLLALLGISMITTQVMATDSAYHLDGRNYGPGS--LKSSQCPSECTRRCSQTQYHK  63

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             C++FC  CC  CLCVPPG YGNK  C CYN+WKT+ GGPKCP
Sbjct  64   PCMVFCKQCCKRCLCVPPGYYGNKSVCPCYNNWKTKRGGPKCP  106



>ref|NP_001078587.1| gibberellin-regulated protein 4 [Arabidopsis thaliana]
 gb|AED92133.1| gibberellin-regulated protein 4 [Arabidopsis thaliana]
Length=83

 Score = 95.9 bits (237),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = +2

Query  167  MAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVP  346
            MA  G +     K   GP +  +   QC SEC+RRC  T + K+C+ FCN CC  CLCVP
Sbjct  1    MASSGSNVKWSQKR-YGPGS--LKRTQCPSECDRRCKKTQYHKACITFCNKCCRKCLCVP  57

Query  347  PGTYGNKECCSCYNDWKTQEGGPKCP  424
            PG YGNK+ CSCYN+WKTQEGGPKCP
Sbjct  58   PGYYGNKQVCSCYNNWKTQEGGPKCP  83



>emb|CDX78620.1| BnaA03g05320D [Brassica napus]
Length=140

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +2

Query  152  VFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNW  331
            +   S  G G     V   P       +  +QC  EC+RRCS T +  +C++FCN CC  
Sbjct  50   LLLASNHGYGLKWIRVKYNPKRYGPGSLKRSQCPKECDRRCSQTQYHNACILFCNKCCRK  109

Query  332  CLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CLCVPPG YGNK+ CSCYN+WKTQEGGPKCP
Sbjct  110  CLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP  140



>gb|ABQ42001.1| gibberellin induced protein [Sonneratia alba]
Length=117

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 68/117 (58%), Gaps = 8/117 (7%)
 Frame = +2

Query  98   VSSRIEYTFILF----FVALLTVFDVSMAGPGFDAALV----LKPPVGPTTCPVPANQCG  253
            V +++    ILF    FV LL   + S +    +   +    +    G +   +   +CG
Sbjct  1    VMAKLASILILFAAFLFVLLLEETEASSSVVAANELQLQGRDINKMYGISEGSLRPQECG  60

Query  254  SECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
              C RRCSATS++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  61   PRCTRRCSATSYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  117



>gb|ABQ42003.1| gibberellin induced protein [Sonneratia ovata]
Length=117

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +2

Query  89   AMAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLK-------PPVGPTTCPVPANQ  247
             MA  + I   F  F   LL   D + A     AA  L+          G +   +   +
Sbjct  1    VMAKLASILILFAAFLFVLL--LDETKASSSVVAANELQLQGRDINKMYGISEGSLRPQE  58

Query  248  CGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CG  C RRCSATS +K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  59   CGPRCTRRCSATSFKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  117



>gb|AFK43939.1| unknown [Lotus japonicus]
Length=96

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 61/104 (59%), Gaps = 12/104 (12%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
             Y+  L  ++LL +   S     + +A  L+P           + C  +C  RCSATSH+
Sbjct  5    SYSSFLIAISLLVLVTFSNVAEAYGSA-KLRP-----------SDCKPKCTYRCSATSHK  52

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            K C+ FC  CC  CLCVPPG YGNKE C CYN WKT+EGGPKCP
Sbjct  53   KPCMFFCQKCCAKCLCVPPGVYGNKEVCPCYNSWKTKEGGPKCP  96



>ref|XP_004491797.1| PREDICTED: gibberellin-regulated protein 4-like [Cicer arietinum]
Length=109

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVL-KPPVGPTTCPVPANQCGSECNRRCSATSHQK  295
            + IL  +A+  +  + MAG      L   K   GP +  +  N+C S+C+RRC  T + K
Sbjct  9    SLILALIAISMLQTLVMAGNDQGGHLYDNKRKYGPGSLNI--NECPSQCSRRCGKTQYHK  66

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             C+ FC  CC  CLCVPPG YGNK  C CYN+WKTQ+GGPKCP
Sbjct  67   PCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTQQGGPKCP  109



>ref|XP_003621217.1| Gibberellin-regulated protein [Medicago truncatula]
 gb|AES77435.1| gibberellin-regulated family protein [Medicago truncatula]
 gb|AFK44961.1| unknown [Medicago truncatula]
Length=109

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVL-KPPVGPTTCPVPANQCGSECNRRCSATSHQK  295
            + IL  +A+  +  + MAG      L   K   GP +  + + QC S+C+RRC  T + K
Sbjct  9    SLILALIAISMLQTLVMAGNDQGGHLYDNKSQYGPGS--LKSYQCPSQCSRRCGQTQYHK  66

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             C+ FC  CC  CLCVPPG YGNK  C CYN+WKTQ+GGPKCP
Sbjct  67   PCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTQQGGPKCP  109



>ref|XP_004978479.1| PREDICTED: gibberellin-regulated protein 6-like [Setaria italica]
 ref|XP_004978480.1| PREDICTED: gibberellin-regulated protein 6-like [Setaria italica]
Length=120

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = +2

Query  125  ILFFVALLTVFDV----SMAGPGF----DAALVLKPPVGPTTCPVPANQCGSECNRRCSA  280
             LF +AL +  ++     +AG       D     K         +  +QCG EC RRCS 
Sbjct  13   FLFLIALASAAEIIGSNGVAGEDLNSKGDDVDNHKGNNKDGKGNLKPSQCGGECRRRCSK  72

Query  281  TSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            T H+K CL FCN CC  CLCVPPGTYGNK+ C CYN+WKT+ GG KCP
Sbjct  73   THHKKPCLFFCNKCCAKCLCVPPGTYGNKDTCPCYNNWKTKRGGTKCP  120



>ref|XP_009106131.1| PREDICTED: gibberellin-regulated protein 12-like [Brassica rapa]
 emb|CDY18069.1| BnaA01g23300D [Brassica napus]
Length=104

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  134  FVALLTVFDVSMAGPGFDAALVLKPPVGPTT----CPVPANQCGSECNRRCSATSHQKSC  301
            F+ +L VF    A    +A  +        T      V    C + C+ RCSATSH+ +C
Sbjct  4    FITVLIVFSFLFATQFSNANELEYSSESIHTEGGEGSVKIGDCPAACDVRCSATSHKSAC  63

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            LM+CN CC  CLCVP GTYGNK+ C CYN+WKTQEGGPKCP
Sbjct  64   LMYCNQCCKKCLCVPSGTYGNKQECPCYNNWKTQEGGPKCP  104



>ref|XP_003544991.1| PREDICTED: protein RSI-1-like [Glycine max]
 gb|KHN39454.1| Protein RSI-1 [Glycine soja]
Length=97

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 60/104 (58%), Gaps = 11/104 (11%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
             Y+  +  ++LL +   S     +  +  L+P           + C   C  RCSATSH+
Sbjct  5    SYSPTMVALSLLLLVTFSNVAEAYTRSGTLRP-----------SDCKPRCTYRCSATSHK  53

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            K C+ FC  CC  CLCVPPGTYGNK+ C CYN WKT+EGGPKCP
Sbjct  54   KPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNSWKTKEGGPKCP  97



>ref|XP_007139576.1| hypothetical protein PHAVU_008G041200g [Phaseolus vulgaris]
 gb|ESW11570.1| hypothetical protein PHAVU_008G041200g [Phaseolus vulgaris]
Length=109

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 64/108 (59%), Gaps = 3/108 (3%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGF-DAALVLKPPVGPTTCPVPANQCGSECNRRCSA  280
            ++     IL  +A+  +  V MA  G  D     K   G  +  V + QC S+C+RRCS 
Sbjct  4    AKFFAAMILALIAISMLQTVVMAANGHGDHLNDNKSKYGSGS--VKSYQCPSQCSRRCSR  61

Query  281  TSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  62   TQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  109



>gb|KDP27148.1| hypothetical protein JCGZ_19847 [Jatropha curcas]
Length=107

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALV-LKPPVGPTTCPVPANQCGSECNRRCSA  280
            ++     +L F+A+  +  + MA  G        +   GP +  + ++QC S+C+RRCS 
Sbjct  2    AKFVALLLLAFIAISMLQTLVMASNGHGGHHYNDQKRYGPGS--LKSSQCPSQCSRRCSK  59

Query  281  TSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  60   TQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  107



>ref|XP_006288945.1| hypothetical protein CARUB_v10002309mg [Capsella rubella]
 gb|EOA21843.1| hypothetical protein CARUB_v10002309mg [Capsella rubella]
Length=107

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +2

Query  161  VSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLC  340
            + MAG G++  +   P        +   QC SECNRRC  T +  +C++FCN CC  CLC
Sbjct  22   MVMAG-GYNYPIKYDPKRYRQG-SLKITQCPSECNRRCKETQYHNACILFCNKCCRKCLC  79

Query  341  VPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            VPPG YGNK+ CSCYN+WKTQ+GGPKCP
Sbjct  80   VPPGYYGNKQVCSCYNNWKTQQGGPKCP  107



>ref|XP_007227095.1| hypothetical protein PRUPE_ppa025589mg, partial [Prunus persica]
 gb|EMJ28294.1| hypothetical protein PRUPE_ppa025589mg, partial [Prunus persica]
Length=80

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + A QCG  C  RCSATSH+  C+ FCNMCCN CLCVP GTYG+KE C CYN+WKT+EGG
Sbjct  17   LRAEQCGGACAYRCSATSHKNPCIEFCNMCCNKCLCVPSGTYGHKEECPCYNNWKTKEGG  76

Query  413  PKCP  424
            PKCP
Sbjct  77   PKCP  80



>ref|XP_010246225.1| PREDICTED: protein GAST1-like [Nelumbo nucifera]
Length=115

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 65/118 (55%), Gaps = 15/118 (13%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPV-----------GPTTCPVPANQC  250
             R +YT +L  V ++ +  + +      A    +PP            G T   +   +C
Sbjct  2    ERRQYTLMLCLVTMMLILLIEVQA----AKTTTEPPAAEPQSATFHMYGATQGSLQPQEC  57

Query  251  GSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
               C  RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  58   APRCTARCSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  115



>ref|XP_004489396.1| PREDICTED: gibberellin-regulated protein 4-like [Cicer arietinum]
Length=107

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%), Gaps = 3/108 (3%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALV-LKPPVGPTTCPVPANQCGSECNRRCSA  280
            +R+   FIL  +A   +  + MA  G        K   GP +  + + QC S C++RC  
Sbjct  2    ARLLVVFILVVIATSMLQTLVMASHGHGGHHYNDKRKYGPGS--LKSFQCPSRCSKRCKR  59

Query  281  TSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKTQ+GGPKCP
Sbjct  60   TQYHKPCMFFCQKCCRKCLCVPPGYYGNKAICPCYNNWKTQQGGPKCP  107



>ref|NP_177605.2| gibberellin-regulated protein 6 [Arabidopsis thaliana]
 sp|Q6NMQ7.1|GASA6_ARATH RecName: Full=Gibberellin-regulated protein 6; AltName: Full=GAST1 
protein homolog 6; Flags: Precursor [Arabidopsis thaliana]
 gb|AAS47605.1| At1g74670 [Arabidopsis thaliana]
 gb|AEE35620.1| gibberellin-regulated protein 6 [Arabidopsis thaliana]
Length=101

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 6/102 (6%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            T  L    L T   ++M+      A       GP +  + + QCG +C RRCS T + K 
Sbjct  6    TSFLLLTILFTFVCLTMS----KEAEYHPESYGPGS--LKSYQCGGQCTRRCSNTKYHKP  59

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  60   CMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|XP_010428457.1| PREDICTED: gibberellin-regulated protein 6-like [Camelina sativa]
Length=101

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 64/112 (57%), Gaps = 12/112 (11%)
 Frame = +2

Query  89   AMAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNR  268
            A  ++S +  T I   + L T  +       +          GP +  + + QCG EC R
Sbjct  2    AKLITSLLCLTIIFSLIFLTTSKEAEYHPEKY----------GPGS--LKSYQCGGECTR  49

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCS T + K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  50   RCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|XP_006662142.1| PREDICTED: gibberellin-regulated protein 12-like [Oryza brachyantha]
Length=104

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +2

Query  125  ILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCL  304
            I+FF+  ++ F V ++G    A   L    G  T      +C  +CN RCSATSH K+CL
Sbjct  10   IVFFLVAMS-FVVVVSGQKNGAIYHLFGGEGSVT----IEECPDKCNYRCSATSHTKACL  64

Query  305  MFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             +CN CC  CLCVP GTYGNKE C CYN+ KTQEG PKCP
Sbjct  65   TYCNYCCERCLCVPSGTYGNKEECPCYNNLKTQEGKPKCP  104



>ref|XP_006470710.1| PREDICTED: protein GAST1-like [Citrus sinensis]
Length=113

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 65/115 (57%), Gaps = 6/115 (5%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVL----KPPVGPTTCPVPANQCGSE  259
            MA   RI   F+   V L  V     AG G  A  +     +P  G T   +   +C  +
Sbjct  1    MARMLRIVVLFVALMVVL--VAQNQAAGTGIAAPQLQPQGNRPARGTTQGSLNPQECAPK  58

Query  260  CNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ RCSATS++K CL FC  CC  CLCVP GT GNK+ C CYN+WKT+ GGPKCP
Sbjct  59   CDYRCSATSYKKPCLFFCQKCCAKCLCVPAGTNGNKQTCPCYNNWKTKRGGPKCP  113



>ref|XP_009108078.1| PREDICTED: gibberellin-regulated protein 12-like [Brassica rapa]
Length=106

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 64/106 (60%), Gaps = 6/106 (6%)
 Frame = +2

Query  125  ILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTC------PVPANQCGSECNRRCSATS  286
            ++  + +LTVF +  A    +A  +      P          +  ++C   C+ RCSATS
Sbjct  1    MMKLIVVLTVFSLLFATQFSNADEIESTSEAPAIHMKGGPGSLTPDECPKACDFRCSATS  60

Query  287  HQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            HQK CL FCN CCN CLCVP GTYG+KE C CYN+ KT++GGPKCP
Sbjct  61   HQKQCLFFCNYCCNKCLCVPSGTYGHKEECPCYNNLKTKDGGPKCP  106



>ref|XP_010469795.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 9/106 (8%)
 Frame = +2

Query  122  FILFFVA-LLTVFDVS----MAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATS  286
             ++F V+ LL     S    +  PG +A  + K   G +  P    +C +EC RRCS TS
Sbjct  5    IVVFIVSCLLLAIQFSNAEELERPG-EAPAIYKMGRGGSLRP---EECPAECQRRCSETS  60

Query  287  HQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            H+K CL +CN CCN CLCVP GTYG+KE C CY++W+T+EGGPKCP
Sbjct  61   HKKPCLFYCNKCCNTCLCVPSGTYGHKEECPCYDNWRTKEGGPKCP  106



>emb|CDY46336.1| BnaC01g30340D [Brassica napus]
Length=104

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +2

Query  122  FILFFVALLTVF--DVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQK  295
            FI  ++    +F    S A    +++  +    G  +  V    C + C+ RCSATSH+ 
Sbjct  4    FITVWIVFSFLFATQFSNANELENSSESIHTEGGEGS--VKIGDCPAACDVRCSATSHKS  61

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            +CLM+CN CC  CLCVP GTYGNKE C CYN+WKTQEGGPKCP
Sbjct  62   ACLMYCNQCCKKCLCVPSGTYGNKEECPCYNNWKTQEGGPKCP  104



>ref|XP_002530088.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF32287.1| GAST1 protein precursor, putative [Ricinus communis]
Length=116

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 12/111 (11%)
 Frame = +2

Query  119  TFILFFVALLTVF---------DVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRR  271
            +F +F +AL+ +F         +     P  +++L   P  G T   +    CG +C RR
Sbjct  9    SFAMFVLALMLLFILESHASTSEAPAPQPQQNSSL---PKYGSTQGSLQPQDCGPQCTRR  65

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CS T + K C+ FC  CC  CLCVP GTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  66   CSKTQYHKPCMFFCQKCCAKCLCVPSGTYGNKQTCPCYNNWKTKRGGPKCP  116



>ref|XP_008244953.1| PREDICTED: protein GAST1-like [Prunus mume]
Length=112

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 67/110 (61%), Gaps = 5/110 (5%)
 Frame = +2

Query  110  IEYTFILFFVA--LLTVFDVSMAGPGFDAALVLKP---PVGPTTCPVPANQCGSECNRRC  274
             + +  +F VA  +L + + + A     +AL  +    P G T   +   +CG  C  RC
Sbjct  3    FKLSIFMFCVAALMLVLLEGNQASTVEISALQQQENYQPYGTTQGSLRPQECGPRCTTRC  62

Query  275  SATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            SAT+++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  63   SATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  112



>ref|NP_001235155.1| uncharacterized protein LOC100306189 precursor [Glycine max]
 gb|ACU14251.1| unknown [Glycine max]
Length=97

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 61/104 (59%), Gaps = 11/104 (11%)
 Frame = +2

Query  113  EYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQ  292
             Y+ I+  ++LL +   S     +  +  L+P           + C  +C  RCSATSH+
Sbjct  5    SYSPIMVALSLLLLVTFSNVAEAYTRSGTLRP-----------SDCKPKCTYRCSATSHK  53

Query  293  KSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            K C+ FC  CC  CLCVPPGTYGNK+ C  YN WKT+EGGPKCP
Sbjct  54   KPCMFFCQKCCAKCLCVPPGTYGNKQICPFYNSWKTKEGGPKCP  97



>ref|XP_006364599.1| PREDICTED: gibberellin-regulated protein 6-like [Solanum tuberosum]
Length=104

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = +2

Query  128  LFFVALLTVFDVSMAGPGFDAALVL-KPPVGPTTCPVPANQCGSECNRRCSATSHQKSCL  304
             F +AL+ +  V+      DA   L +   GP +  +   QC  +C RRCS T + K C+
Sbjct  7    FFLLALIAISMVATTALAADAQYHLDRSRYGPGS--LKPTQCLPQCTRRCSKTQYHKPCM  64

Query  305  MFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  65   FFCQKCCKTCLCVPPGFYGNKGVCPCYNNWKTKEGGPKCP  104



>ref|XP_004236040.1| PREDICTED: gibberellin-regulated protein 6 [Solanum lycopersicum]
Length=104

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = +2

Query  128  LFFVALLTVFDVSMAGPGFDAALVL-KPPVGPTTCPVPANQCGSECNRRCSATSHQKSCL  304
             F +AL+ +  V+      DA   L +   GP +  +   QC  +C RRCS T + K C+
Sbjct  7    FFLLALIAISMVATTALAADAQYHLDRSRYGPGS--LKPTQCLPQCTRRCSKTQYHKPCM  64

Query  305  MFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  65   FFCQKCCKTCLCVPPGFYGNKGVCPCYNNWKTKEGGPKCP  104



>ref|XP_010420181.1| PREDICTED: gibberellin-regulated protein 4-like [Camelina sativa]
 ref|XP_010453653.1| PREDICTED: gibberellin-regulated protein 4-like [Camelina sativa]
Length=107

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            +   QC SEC+RRC  T + K+C+ FCN CC  CLCVPPG YGNK+ C CYN+WKTQEGG
Sbjct  44   LKITQCPSECDRRCKQTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCGCYNNWKTQEGG  103

Query  413  PKCP  424
            PKCP
Sbjct  104  PKCP  107



>ref|XP_002887551.1| hypothetical protein ARALYDRAFT_895333 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63810.1| hypothetical protein ARALYDRAFT_895333 [Arabidopsis lyrata subsp. 
lyrata]
Length=101

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  134  FVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFC  313
            F+ L T+F   +       A       GP +  + + QCG +C RRC  T + K C+ FC
Sbjct  7    FLLLATIFFSFICLTMSKEAEYQPESYGPGS--LKSYQCGGQCTRRCGNTKYHKPCMFFC  64

Query  314  NMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
              CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  65   QKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|XP_010673718.1| PREDICTED: protein GAST1-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=110

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 65/112 (58%), Gaps = 3/112 (3%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLK-PPVGPTTCPVPANQCGSECNR  268
            MA+S  I  + +L+   +L V   + A        +     +G +   +   +CG  C  
Sbjct  1    MAMSRNI--SLLLYVTLMLIVLTANQAESQSSQPQIQSGHSMGASQGSLHPQECGPRCTM  58

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCSAT ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  59   RCSATQYKKPCLFFCQKCCAKCLCVPPGTYGNKQLCPCYNNWKTKRGGPKCP  110



>ref|XP_010469794.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 65/111 (59%), Gaps = 19/111 (17%)
 Frame = +2

Query  134  FVALLTVFDVS--MAGPGFDAALVLKPPVGPTTCPVPA------------NQCGSECNRR  271
               L+ VF VS  +    F  A  L+ P     C  PA             +C +EC RR
Sbjct  1    MAKLIVVFIVSCLLLAIQFSNAEELERP-----CEAPAIYKMGRGGSLRPEECPAECQRR  55

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CS TSH+K CL +CN CCN CLCVP GTYG+KE C CY++W+T+EGGPKCP
Sbjct  56   CSETSHKKPCLFYCNKCCNTCLCVPSGTYGHKEECPCYDNWRTKEGGPKCP  106



>ref|XP_011080381.1| PREDICTED: protein GAST1-like [Sesamum indicum]
Length=112

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +2

Query  98   VSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPP----VGPTTCPVPANQCGSECN  265
            +++++ + F L FVA + +     +     A+  L P      G +   +    C S+C 
Sbjct  1    MATKLAFLFYLLFVATI-LAQKQASSAAVPASDQLHPQGSLQYGTSEGSLRPQDCPSKCT  59

Query  266  RRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             RCS TS +K C++FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  60   YRCSKTSFKKPCMLFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  112



>gb|ACM47319.1| Gasa4-like protein [Rosa x damascena]
 gb|ACM47320.1| Gasa4-like protein [Rosa x damascena]
Length=108

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 61/102 (60%), Gaps = 2/102 (2%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
              IL  +A+  +  + MA  G           GP +  + + QC S+C RRCS T + K 
Sbjct  9    ALILSLLAISMLQSMVMANHGHGGHHKGNNQYGPGS--LKSYQCPSQCTRRCSQTQYHKP  66

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC+ CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  67   CMFFCQKCCSKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  108



>gb|AFK34043.1| unknown [Medicago truncatula]
 gb|KEH33468.1| gibberellin-regulated family protein [Medicago truncatula]
Length=103

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +2

Query  128  LFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLM  307
            + F+ALL +  ++      DAA       GP +  + + QC S+C RRC  T + K C+ 
Sbjct  7    VLFLALLCIAMITTQVMAKDAAQYGSGNYGPGS--LQSYQCPSQCTRRCGQTQYHKPCMF  64

Query  308  FCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            FC  CC  CLCVPPG YGNK  C CYN+WKT+ GGPKCP
Sbjct  65   FCQKCCAKCLCVPPGYYGNKSVCPCYNNWKTKRGGPKCP  103



>ref|XP_009419112.1| PREDICTED: gibberellin-regulated protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            ++C ++C+ RCSATSH+K CL FC  CC  CLCVPPGTYGNKE C CYN+WKT+EGGPKC
Sbjct  31   SECNNKCDFRCSATSHKKPCLFFCKECCATCLCVPPGTYGNKEACPCYNNWKTKEGGPKC  90

Query  422  P  424
            P
Sbjct  91   P  91



>gb|AGL92232.1| GASA-like protein GEG2 [Gerbera hybrid cultivar]
Length=100

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = +2

Query  128  LFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLM  307
             F V +L +  +SM      A    +   GP +  + ++QC  +C RRCS T + K C+ 
Sbjct  4    FFAVFVLALIAISMLQATVLAKGGRQNGFGPGS--LTSSQCPGQCIRRCSKTQYHKPCMF  61

Query  308  FCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            FC  CC  CLCVPPG YGNK+ C CYN+WKT+EGGPKCP
Sbjct  62   FCQKCCAKCLCVPPGFYGNKQVCPCYNNWKTKEGGPKCP  100



>ref|XP_006477453.1| PREDICTED: gibberellin-regulated protein 6-like [Citrus sinensis]
 gb|KDO55568.1| hypothetical protein CISIN_1g037011mg [Citrus sinensis]
Length=103

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            ++ +  F+L   AL   F +S+        L+     GP +  + + QC S+C RRCS T
Sbjct  2    AKAKLVFVLLVAAL---FSISIVMATETQNLLDTNGYGPGS--LKSYQCPSQCTRRCSQT  56

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+ GGPKCP
Sbjct  57   QYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTKSGGPKCP  103



>ref|XP_010558231.1| PREDICTED: protein GAST1 [Tarenaya hassleriana]
Length=119

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 64/119 (54%), Gaps = 8/119 (7%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPP--------VGPTTCPVPANQ  247
            MA   +     +  F+ L+ V   +       +  +L+PP         G T   +   +
Sbjct  1    MATKLQTSVFSVAVFMLLMLVQTHATDHSEAPSPQLLQPPQSNTNNSQYGTTQGSLQPQE  60

Query  248  CGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C   C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  61   CRGRCEGRCSRTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  119



>gb|AAC32170.1| GASA5-like protein [Picea mariana]
 gb|AAC32171.1| GASA5-like protein [Picea mariana]
Length=62

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            ++CG  C+ RCSATSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKC
Sbjct  2    SECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKC  61

Query  422  P  424
            P
Sbjct  62   P  62



>gb|AFH57279.1| GASA-like protein [Gossypium hirsutum]
 gb|AGE15503.1| GA-stimulated transcript-like protein 7 [Gossypium hirsutum]
 gb|KHG14864.1| Protein GAST1 [Gossypium arboreum]
Length=111

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRR  271
            MA S  I     L  + LL     S                G T   +   +CG  C +R
Sbjct  1    MAKSLVIVMLCFLLVIVLLGEIQASSPSQKQRQGNHGNGMYGATQGSLRPQECGPRCTQR  60

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  61   CSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQSCPCYNNWKTKRGGPKCP  111



>ref|XP_008649585.1| PREDICTED: gibberellin-regulated protein 6-like [Zea mays]
 gb|AFW77818.1| GAST1 protein [Zea mays]
Length=145

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 58/96 (60%), Gaps = 4/96 (4%)
 Frame = +2

Query  149  TVFDVSMAGPGFDAALVLKPP----VGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCN  316
            T  + S A P         PP    V P T  +  ++CG  C  RCSAT++QK CL FC 
Sbjct  50   TNTNASSAAPRPAKPSAFPPPMYGGVTPGTGSLQPHECGGRCAERCSATAYQKPCLFFCR  109

Query  317  MCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             CC  CLCVPPGTYGNK  C CYN+WKT+ GGPKCP
Sbjct  110  KCCAACLCVPPGTYGNKNTCPCYNNWKTKRGGPKCP  145



>gb|AET00795.2| GASA/GAST/Snakin [Medicago truncatula]
Length=149

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +C   C  RCS T H+K CL +C  CC  CLCVPPGTYGNKE C CY
Sbjct  77   PTDGTTEGSLKPEECAPRCEDRCSKTHHKKPCLFYCKYCCAKCLCVPPGTYGNKEVCPCY  136

Query  386  NDWKTQEGGPKCP  424
            NDWKT+EGGPKCP
Sbjct  137  NDWKTKEGGPKCP  149



>ref|XP_003617836.1| Gibberellin induced protein [Medicago truncatula]
Length=157

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +C   C  RCS T H+K CL +C  CC  CLCVPPGTYGNKE C CY
Sbjct  85   PTDGTTEGSLKPEECAPRCEDRCSKTHHKKPCLFYCKYCCAKCLCVPPGTYGNKEVCPCY  144

Query  386  NDWKTQEGGPKCP  424
            NDWKT+EGGPKCP
Sbjct  145  NDWKTKEGGPKCP  157



>gb|AES68406.2| GASA/GAST/Snakin [Medicago truncatula]
Length=154

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +C   C  RCS T H+K CL +C  CC  CLCVPPGTYGNKE C CY
Sbjct  82   PTDGTTEGSLKPEECAPRCEDRCSKTHHRKPCLFYCKYCCAKCLCVPPGTYGNKEVCPCY  141

Query  386  NDWKTQEGGPKCP  424
            NDWKT+EGGPKCP
Sbjct  142  NDWKTKEGGPKCP  154



>ref|XP_010273304.1| PREDICTED: uncharacterized protein LOC104608881 isoform X2 [Nelumbo 
nucifera]
Length=787

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +C   C  RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  718  GATQGSLHPQECAPRCTARCSATAYKKPCMFFCQKCCAECLCVPPGTYGNKQFCPCYNNW  777

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  778  KTKRGGPKCP  787



>ref|XP_006295413.1| hypothetical protein CARUB_v10024510mg [Capsella rubella]
 gb|EOA28311.1| hypothetical protein CARUB_v10024510mg [Capsella rubella]
Length=108

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 62/108 (57%), Gaps = 11/108 (10%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTC-------PVPANQCGSECNRRCSA  280
            FILFFV + ++    +    F  A   + PV             +   +C   C  RCSA
Sbjct  5    FILFFVLVSSL----LLATQFSNAEEFESPVEAPEIHKMGGEGSLRIEECPKACAYRCSA  60

Query  281  TSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            TSH+K CL FCN CC  CLCVP GTYG+KE C CYN+W T+EGGPKCP
Sbjct  61   TSHKKPCLFFCNKCCRKCLCVPSGTYGHKEECPCYNNWTTKEGGPKCP  108



>gb|KFK41905.1| hypothetical protein AALP_AA2G187500 [Arabis alpina]
Length=81

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QCG EC RRCS T ++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GG
Sbjct  18   LKSYQCGGECTRRCSNTKYRKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGG  77

Query  413  PKCP  424
            PKCP
Sbjct  78   PKCP  81



>ref|XP_010273303.1| PREDICTED: uncharacterized protein LOC104608881 isoform X1 [Nelumbo 
nucifera]
Length=810

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +C   C  RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  741  GATQGSLHPQECAPRCTARCSATAYKKPCMFFCQKCCAECLCVPPGTYGNKQFCPCYNNW  800

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  801  KTKRGGPKCP  810



>ref|XP_003598155.1| Gibberellin induced protein [Medicago truncatula]
Length=162

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +C   C  RCS T H+K CL +C  CC  CLCVPPGTYGNKE C CY
Sbjct  90   PTDGTTEGSLKPEECAPRCEDRCSKTHHRKPCLFYCKYCCAKCLCVPPGTYGNKEVCPCY  149

Query  386  NDWKTQEGGPKCP  424
            NDWKT+EGGPKCP
Sbjct  150  NDWKTKEGGPKCP  162



>ref|XP_004490815.1| PREDICTED: protein RSI-1-like [Cicer arietinum]
Length=95

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 63/109 (58%), Gaps = 14/109 (13%)
 Frame = +2

Query  98   VSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCS  277
            ++ R   +FI+  + LL  F       G   +  L+P           + C   C+ RCS
Sbjct  1    MALRCYSSFIVISLLLLVTFSNVAQAYG---SAKLRP-----------SDCKPRCSYRCS  46

Query  278  ATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            ATSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN WKT+EGGPKCP
Sbjct  47   ATSHKKPCMFFCQKCCATCLCVPPGTYGNKQVCPCYNTWKTREGGPKCP  95



>ref|XP_009614794.1| PREDICTED: gibberellin-regulated protein 6 [Nicotiana tomentosiformis]
 ref|XP_009783483.1| PREDICTED: gibberellin-regulated protein 6-like [Nicotiana sylvestris]
Length=104

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = +2

Query  128  LFFVALLTVFDVSMAGPGFDAALVLKPP-VGPTTCPVPANQCGSECNRRCSATSHQKSCL  304
             F +AL+ +  V+      DA   L     GP +  +  +QC  +C RRCS T + K C+
Sbjct  7    FFLLALVAISMVATTVLAADAQYHLDASRYGPGS--LKPSQCLPQCTRRCSKTQYHKPCM  64

Query  305  MFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             FC  CC  CLCVPPG YGNK  C CYN+WKTQ+GGPKCP
Sbjct  65   FFCQKCCKTCLCVPPGFYGNKGVCPCYNNWKTQQGGPKCP  104



>ref|XP_010038994.1| PREDICTED: gibberellin-regulated protein 12 [Eucalyptus grandis]
 gb|KCW48453.1| hypothetical protein EUGRSUZ_K02150 [Eucalyptus grandis]
Length=96

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
             QC + C+ RCSATSH+K CL FCNMCC  CLCVP GTYG+KE C CYN+WKT+EG PKC
Sbjct  36   EQCAAACDYRCSATSHRKPCLSFCNMCCAKCLCVPSGTYGHKEECPCYNNWKTKEGKPKC  95

Query  422  P  424
            P
Sbjct  96   P  96



>ref|NP_001240084.1| uncharacterized protein LOC100787539 precursor [Glycine max]
 gb|ACU19304.1| unknown [Glycine max]
 gb|ADX36136.1| gibberellic acid-stimulated protein 2 [Glycine soja]
Length=107

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 60/103 (58%), Gaps = 3/103 (3%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVL-KPPVGPTTCPVPANQCGSECNRRCSATSHQK  295
              IL  +A+  +  V MA       L   K   G  +  V   QC S+C+RRCS T + K
Sbjct  7    AMILALIAISMLQTVVMAANEQGGHLYDNKSKYGSGS--VKRYQCPSQCSRRCSQTQYHK  64

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  65   PCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  107



>ref|XP_007212837.1| hypothetical protein PRUPE_ppa020764mg [Prunus persica]
 gb|EMJ14036.1| hypothetical protein PRUPE_ppa020764mg [Prunus persica]
Length=95

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +2

Query  146  LTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCC  325
            L++F + +A       L+     G T   +   +CG  C  RCSAT+++K CL FC  CC
Sbjct  5    LSIFMLCVAA--LMLVLLEANQYGTTQGSLRPQECGPRCTTRCSATAYKKPCLFFCQKCC  62

Query  326  NWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
              CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  63   AKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  95



>ref|XP_004517033.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
             +C + C++RCSAT ++K+CL +CN+CC  CLCVP GTYG+KE C+CYN+WKT+EGGPKC
Sbjct  32   EECAAACDQRCSATQYKKACLTYCNLCCAKCLCVPSGTYGHKEECACYNNWKTKEGGPKC  91

Query  422  P  424
            P
Sbjct  92   P  92



>gb|KDP22135.1| hypothetical protein JCGZ_25966 [Jatropha curcas]
Length=115

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 12/114 (11%)
 Frame = +2

Query  110  IEYTFILFFVALLTVFDVSMAGPGFDAALVLKPP---------VGPTTCPVPANQCGSEC  262
            I    + F + +L + + + A   F+ A +L             G T   +   +CG  C
Sbjct  5    ISIVMLCFALIMLVLLEENQA---FNTAGILASQPQGKGKNAMYGATQGSLRPQECGPRC  61

Query  263  NRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
              RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  62   TTRCSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQYCPCYNNWKTKRGGPKCP  115



>ref|XP_010510284.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 61/105 (58%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  IEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSH  289
            ++    L   +LL     S A     +A V  P        +   +C   C+ RCSATSH
Sbjct  2    LKLIIFLMISSLLLATQFSNAEELDSSAEVPAPRKMGGEGSLRPEECPKACDYRCSATSH  61

Query  290  QKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            +K CL FCN CC  CLCVP GTYG+KE C CY++W+T+EGGPKCP
Sbjct  62   RKPCLFFCNKCCMKCLCVPSGTYGHKEECPCYDNWRTKEGGPKCP  106



>ref|XP_002885614.1| hypothetical protein ARALYDRAFT_898961 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61873.1| hypothetical protein ARALYDRAFT_898961 [Arabidopsis lyrata subsp. 
lyrata]
Length=149

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            FI+ F+    +F    +  G + +L +              QC + CN RCSATSH+K C
Sbjct  4    FIVIFIVFSFLFATQFSNEGGEGSLTI-------------GQCPAACNVRCSATSHKKPC  50

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPK  418
            L +CN CCN CLCVP GTYG+KE C CYN+WKTQEG  +
Sbjct  51   LFYCNYCCNKCLCVPSGTYGHKEECPCYNNWKTQEGSQR  89



>ref|XP_010673717.1| PREDICTED: protein GAST1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=111

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 4/113 (4%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVL--KPPVGPTTCPVPANQCGSECN  265
            MA+S  I  + +L+   +L V   + A        +       G +   +   +CG  C 
Sbjct  1    MAMSRNI--SLLLYVTLMLIVLTANQAESQSSQPQIQSGHSMQGASQGSLHPQECGPRCT  58

Query  266  RRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             RCSAT ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  59   MRCSATQYKKPCLFFCQKCCAKCLCVPPGTYGNKQLCPCYNNWKTKRGGPKCP  111



>ref|XP_009781826.1| PREDICTED: gibberellin-regulated protein 6-like [Nicotiana sylvestris]
Length=103

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            ++I   F+L   A+  +    +A  G           GP +  +  +QC  +C RRCS T
Sbjct  2    AKIVAVFLLALFAMSILATTVLATNGKHHH---SKKYGPGS--LNPSQCLPQCTRRCSKT  56

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             + K C+ FC  CCN CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  57   QYHKPCMFFCQKCCNKCLCVPPGFYGNKSVCPCYNNWKTKEGGPKCP  103



>gb|AFW77815.1| hypothetical protein ZEAMMB73_495748 [Zea mays]
Length=75

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  VGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYND  391
            V P T  +  ++CG  C  RCSAT++QK CL FC  CC  CLCVPPGTYGNK  C CYN+
Sbjct  5    VTPGTGSLQPHECGGRCAERCSATAYQKPCLFFCRKCCAACLCVPPGTYGNKNTCPCYNN  64

Query  392  WKTQEGGPKCP  424
            WKT+ GGPKCP
Sbjct  65   WKTKRGGPKCP  75



>emb|CDP08494.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
             F+L  +A      V ++        +     G     +   +CG+ C+ RCS T+++K 
Sbjct  12   AFVLLILAQNQASSVGLSISQHQPKALNARQYGIIEGSLRPQECGARCDTRCSKTAYKKP  71

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  72   CMSFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  113



>ref|XP_010258349.1| PREDICTED: gibberellin-regulated protein 6 isoform X1 [Nelumbo 
nucifera]
Length=105

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 62/105 (59%), Gaps = 15/105 (14%)
 Frame = +2

Query  137  VALLTVFDVSMAGPGFDAALVLKPPV---------GPTTCPVPANQCGSECNRRCSATSH  289
            + LL +F +SM     +A +VL             GP +  + + QC S+C RRCS T +
Sbjct  7    LMLLALFAISM----IEATMVLAKEAEYHLDSNRYGPGS--LKSYQCPSQCTRRCSKTQY  60

Query  290  QKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+ GGPKCP
Sbjct  61   HKPCMFFCQKCCRKCLCVPPGFYGNKGVCPCYNNWKTKRGGPKCP  105



>gb|AAG52379.1|AC011765_31 GAST1-like protein; 109761-110213 [Arabidopsis thaliana]
Length=80

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QCG +C RRCS T + K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GG
Sbjct  17   LKSYQCGGQCTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGG  76

Query  413  PKCP  424
            PKCP
Sbjct  77   PKCP  80



>ref|XP_009337038.1| PREDICTED: protein GAST1-like [Pyrus x bretschneideri]
Length=115

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 60/109 (55%), Gaps = 7/109 (6%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKP-------PVGPTTCPVPANQCGSECNRRCS  277
            +  +  VAL+ VF     G         +        P G T   +   +C   C  RCS
Sbjct  7    SIFMLCVALILVFLEPNQGASTVETSAFQQQRQGNHQPYGTTQGSLRPQECAPRCTSRCS  66

Query  278  ATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            AT+++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  67   ATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  115



>ref|NP_001235467.1| uncharacterized protein LOC100500003 precursor [Glycine max]
 gb|ACU14567.1| unknown [Glycine max]
Length=107

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 62/108 (57%), Gaps = 3/108 (3%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVL-KPPVGPTTCPVPANQCGSECNRRCSA  280
            ++     IL   A+  +  V MA       L   K   G  +  V + QC S+C+RRCS 
Sbjct  2    AKFFAAMILALFAISILQTVVMAANEQGGHLYDNKSKYGSGS--VKSYQCPSQCSRRCSQ  59

Query  281  TSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  60   TQYHKPCMFFCQKCCRTCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  107



>ref|XP_009587065.1| PREDICTED: gibberellin-regulated protein 6-like [Nicotiana tomentosiformis]
Length=103

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +2

Query  128  LFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLM  307
            + F+AL  +  ++      +         GP +  +  +QC  +C RRCS T + K C+ 
Sbjct  7    VLFLALFAMSILATTVLATNGKHHHSKKHGPGS--LNPSQCQPQCTRRCSKTQYHKPCMF  64

Query  308  FCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            FC  CCN CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  65   FCQKCCNKCLCVPPGFYGNKSVCPCYNNWKTKEGGPKCP  103



>ref|XP_008344997.1| PREDICTED: protein GAST1-like [Malus domestica]
Length=115

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +2

Query  209  PVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYN  388
            P G T   +   +C   C  RCSAT+++K CL FC  CC  CLCVPPGTYGNK+ C CYN
Sbjct  44   PYGTTQGSLRPQECAPRCTSRCSATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  103

Query  389  DWKTQEGGPKCP  424
            +WKT+ GGPKCP
Sbjct  104  NWKTKRGGPKCP  115



>gb|AAQ57667.2| Gasa4-like protein [Pelargonium zonale]
Length=106

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +2

Query  167  MAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVP  346
            MA  G     + K   GP +  + ++QC  EC RRCS T + K C+ FC  CC  CLCVP
Sbjct  23   MASNGELGQSLSKNRYGPGS--LKSSQCNPECTRRCSKTQYHKPCMFFCQKCCRKCLCVP  80

Query  347  PGTYGNKECCSCYNDWKTQEGGPKCP  424
            PG YGNK  C CYN+WKTQ+GGPKCP
Sbjct  81   PGFYGNKAVCPCYNNWKTQQGGPKCP  106



>ref|XP_009775224.1| PREDICTED: protein GAST1-like [Nicotiana sylvestris]
Length=112

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 62/112 (55%), Gaps = 3/112 (3%)
 Frame = +2

Query  98   VSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLK---PPVGPTTCPVPANQCGSECNR  268
            ++ ++     +  V  L    VS A    D  L  +      G +   +    C  +C  
Sbjct  1    MAGKLSIVLFVILVVFLAQNQVSRAKLVLDPKLQTQRNNQMYGVSQGSLHPQDCLPKCTY  60

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCS TS +K C+ FC  CC+ CLCVPPGTYGNK+ C CYN+WKT+EGGPKCP
Sbjct  61   RCSQTSFKKPCMFFCQKCCSKCLCVPPGTYGNKQTCPCYNNWKTKEGGPKCP  112



>emb|CDY27104.1| BnaA08g07420D [Brassica napus]
Length=105

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 61/103 (59%), Gaps = 6/103 (6%)
 Frame = +2

Query  134  FVALLTVFDVSMAGPGFDAALVLKPPVGPTTC------PVPANQCGSECNRRCSATSHQK  295
             + +LTVF +  A    +A  +      P          +  ++C   C+ RCSATSHQK
Sbjct  3    LIVVLTVFSLLFATQFSNADELESTSEAPAIHMKGGPGSLTPDECPKACDFRCSATSHQK  62

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             CL FCN CCN CLCVP GTYG+KE C CYN+ KT+EG PKCP
Sbjct  63   PCLFFCNYCCNKCLCVPSGTYGHKEECPCYNNLKTKEGEPKCP  105



>ref|XP_002284937.1| PREDICTED: gibberellin-regulated protein 6 [Vitis vinifera]
 emb|CBI15224.3| unnamed protein product [Vitis vinifera]
Length=104

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + +NQC S+C RRCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGG
Sbjct  41   LKSNQCPSQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPPGYYGNKAVCPCYNNWKTKEGG  100

Query  413  PKCP  424
            PKCP
Sbjct  101  PKCP  104



>ref|XP_008659198.1| PREDICTED: gibberellin-regulated protein 12 [Zea mays]
 tpg|DAA46650.1| TPA: hypothetical protein ZEAMMB73_484923 [Zea mays]
Length=105

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            VP  QC  +C+ RCSATS++K CL FCN CCN CLCVP GTYGNKE C CY++ KT++GG
Sbjct  42   VPIEQCPEKCDYRCSATSYKKPCLFFCNYCCNKCLCVPSGTYGNKEECPCYDNMKTKQGG  101

Query  413  PKCP  424
            PKCP
Sbjct  102  PKCP  105



>gb|KFK25767.1| hypothetical protein AALP_AA8G157100 [Arabis alpina]
Length=109

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 59/102 (58%), Gaps = 3/102 (3%)
 Frame = +2

Query  128  LFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTC---PVPANQCGSECNRRCSATSHQKS  298
            LF +AL+    +   G          P   P       + ++QC   C+ RC  T +  +
Sbjct  8    LFLLALIVFSMLQTMGEAAKYRGKWNPKWNPKNYGPGSLKSSQCPKACDTRCGDTKYINA  67

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CL+FCN CC  CLCVPPG YGNK+ CSCYN+WKT+EGGPKCP
Sbjct  68   CLLFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTKEGGPKCP  109



>ref|XP_010045037.1| PREDICTED: protein GAST1-like [Eucalyptus grandis]
 gb|KCW87192.1| hypothetical protein EUGRSUZ_B03715 [Eucalyptus grandis]
Length=116

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +2

Query  152  VFDVSMAGPGFD--AALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCC  325
            VF  + + P FD  A        G T   +    CG  C  RCSATS++K CL FC  CC
Sbjct  24   VFGSTESVPEFDVQARKGSHQTYGTTQGSLKPQDCGPRCTSRCSATSYKKPCLFFCQKCC  83

Query  326  NWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
              CLCVP GTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  84   AKCLCVPAGTYGNKQTCPCYNNWKTKRGGPKCP  116



>gb|ACG30820.1| GAST1 protein precursor [Zea mays]
Length=143

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +2

Query  149  TVFDVSMAGPGFDAALVLKPPV--GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMC  322
            T  + S A P    +   +PP+  G T   +  ++CG  C  RCSAT++QK CL FC  C
Sbjct  50   TNTNDSSAAPRPAKSSAFQPPMYGGVTPGSLQPHECGGRCAGRCSATAYQKPCLFFCRKC  109

Query  323  CNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C  CLCVPPGTYGNK  C CYN+WKT+ GGPKCP
Sbjct  110  CAACLCVPPGTYGNKNTCPCYNNWKTKLGGPKCP  143



>ref|XP_002881134.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57393.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=106

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGPT--TCPVPANQCGSECNRRCSATSHQK  295
             I+FFV    +F    +      +    P +  T     +   +C   C  RCSATSH+K
Sbjct  4    LIVFFVVSSLLFSTQFSNGEELESSADAPAIHKTGGEGSLRPEECPKACEIRCSATSHKK  63

Query  296  SCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             CL +CN CC+ CLCVP GTYG+KE C CY++W+T+EGGPKCP
Sbjct  64   PCLFYCNKCCSKCLCVPSGTYGHKEECPCYDNWRTKEGGPKCP  106



>ref|XP_010464684.1| PREDICTED: gibberellin-regulated protein 13-like [Camelina sativa]
Length=115

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  46   GTTEGSLQPQECGPRCGDRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNW  105

Query  395  KTQEGGPKCP  424
            KTQ GGPKCP
Sbjct  106  KTQTGGPKCP  115



>ref|XP_010481220.1| PREDICTED: gibberellin-regulated protein 13-like isoform X2 [Camelina 
sativa]
Length=120

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  51   GTTEGSLQPQECGPRCGDRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNW  110

Query  395  KTQEGGPKCP  424
            KTQ GGPKCP
Sbjct  111  KTQTGGPKCP  120



>ref|XP_010258350.1| PREDICTED: gibberellin-regulated protein 6 isoform X2 [Nelumbo 
nucifera]
Length=93

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 9/96 (9%)
 Frame = +2

Query  137  VALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCN  316
            + LL +F +SM     +         GP +  + + QC S+C RRCS T + K C+ FC 
Sbjct  7    LMLLALFAISMIEATMNR-------YGPGS--LKSYQCPSQCTRRCSKTQYHKPCMFFCQ  57

Query  317  MCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             CC  CLCVPPG YGNK  C CYN+WKT+ GGPKCP
Sbjct  58   KCCRKCLCVPPGFYGNKGVCPCYNNWKTKRGGPKCP  93



>ref|XP_010922895.1| PREDICTED: gibberellin-regulated protein 6-like [Elaeis guineensis]
Length=107

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  239  ANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPK  418
            + QC SEC+RRCS T + K C+ FC  CC  CLCVPPG YGNK+ CSCYN+WKT+ GGPK
Sbjct  46   SYQCPSECSRRCSRTQYHKPCMFFCQKCCRKCLCVPPGFYGNKQLCSCYNNWKTKRGGPK  105

Query  419  CP  424
            CP
Sbjct  106  CP  107



>ref|XP_010486614.1| PREDICTED: gibberellin-regulated protein 13 [Camelina sativa]
Length=124

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  55   GTTEGSLQPQECGPRCGDRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNW  114

Query  395  KTQEGGPKCP  424
            KTQ GGPKCP
Sbjct  115  KTQTGGPKCP  124



>gb|KHN48768.1| Protein GAST1, partial [Glycine soja]
Length=67

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
              CG  C  RCS T H+K CL FCN CC  CLCVPPGTYGNKE C CYN+WKT+ GGPKC
Sbjct  7    QDCGPRCEERCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKEVCPCYNNWKTKRGGPKC  66

Query  422  P  424
            P
Sbjct  67   P  67



>dbj|BAF00966.1| GAST1-like protein [Arabidopsis thaliana]
Length=78

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  245  QCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            +CG +C RRCS T + K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKCP
Sbjct  19   ECGGQCTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  78



>ref|XP_008392373.1| PREDICTED: protein GAST1 isoform X1 [Malus domestica]
Length=117

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 63/112 (56%), Gaps = 12/112 (11%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPVGP-----------TTCPVPANQCGSECNR  268
            F++FF+ +L  F +++     +A     P   P           T   +   +CG  C  
Sbjct  7    FVMFFLVIL-FFALTVENHQANATGTEAPAPQPQSSNNHTMNGITEGSLQPQECGPRCTT  65

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCS T ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  66   RCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  117



>ref|XP_008240742.1| PREDICTED: protein GAST1 [Prunus mume]
Length=116

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 65/117 (56%), Gaps = 8/117 (7%)
 Frame = +2

Query  89   AMAVSSRIEYTFILFFVALL-----TVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCG  253
            AMA + RI  + ++    ++     T+ +     P       +    G T   +   +CG
Sbjct  3    AMARTLRIVLSLVMLHFLIVENHATTITEAPAPQPQGSNNHTMN---GITEGSLQPQECG  59

Query  254  SECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
              C+ RCS T ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  60   PRCSTRCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  116



>ref|XP_010481166.1| PREDICTED: gibberellin-regulated protein 13-like isoform X1 [Camelina 
sativa]
Length=123

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  54   GTTEGSLQPQECGPRCGDRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNW  113

Query  395  KTQEGGPKCP  424
            KTQ GGPKCP
Sbjct  114  KTQTGGPKCP  123



>gb|EEC79111.1| hypothetical protein OsI_19744 [Oryza sativa Indica Group]
Length=152

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +CG  C  RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CY
Sbjct  80   PMYGVTPGSLRPQECGGRCAYRCSATAYRKPCMFFCQKCCASCLCVPPGTYGNKQSCPCY  139

Query  386  NDWKTQEGGPKCP  424
            NDWKT+ GGPKCP
Sbjct  140  NDWKTKRGGPKCP  152



>ref|XP_010931460.1| PREDICTED: gibberellin-regulated protein 6-like [Elaeis guineensis]
Length=107

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = +2

Query  149  TVFDVSMAGPGFDAALVL-KPPVGPT--TCPVPANQCGSECNRRCSATSHQKSCLMFCNM  319
              F + + G G +  + L K   G    +  + + QC  EC+RRCS T + K C+ FC  
Sbjct  13   ITFSMVLCGIGHEVEVELAKKSQGGRHGSGSLKSYQCPGECSRRCSRTQYHKPCMFFCQK  72

Query  320  CCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CC  CLCVPPG YGNK+ CSCYN+WKT+ GGPKCP
Sbjct  73   CCRKCLCVPPGFYGNKQVCSCYNNWKTKRGGPKCP  107



>ref|XP_004241582.1| PREDICTED: gibberellin-regulated protein 6-like [Solanum lycopersicum]
Length=104

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 57/91 (63%), Gaps = 4/91 (4%)
 Frame = +2

Query  152  VFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNW  331
            + +  MA  G       K   GP +  +  +QC  +C RRCS T + K C+ FC  CCN 
Sbjct  18   LANTVMAANGKHHHYAKK--YGPGS--LKPSQCLPQCTRRCSKTQYHKPCMFFCQKCCNK  73

Query  332  CLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CLCVPPGTYGNK  C CYN+WKT+EGGPKCP
Sbjct  74   CLCVPPGTYGNKAVCPCYNNWKTKEGGPKCP  104



>ref|XP_010678520.1| PREDICTED: gibberellin-regulated protein 6-like [Beta vulgaris 
subsp. vulgaris]
Length=97

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +2

Query  188  AALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNK  367
            A  VL    GP +  +  +QC  +C RRCS T + K C+ FC  CC  CLCVPPG YGNK
Sbjct  21   ATEVLAKNYGPGS--LKGSQCLGQCTRRCSRTQYHKPCMFFCQKCCRKCLCVPPGFYGNK  78

Query  368  ECCSCYNDWKTQEGGPKCP  424
            + C CYN+WKT+EGGPKCP
Sbjct  79   QVCPCYNNWKTKEGGPKCP  97



>gb|AGM20679.1| GASA5 [Populus tomentosa]
Length=95

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            ++C   CN RCSATSH+K C+ FC  CC  CLCVPPGTYGNKE C CYN+WKT+EG PKC
Sbjct  35   SECKPRCNYRCSATSHKKPCMFFCLKCCATCLCVPPGTYGNKETCPCYNNWKTKEGRPKC  94

Query  422  P  424
            P
Sbjct  95   P  95



>ref|XP_006383339.1| gibberellin-regulated protein 5 [Populus trichocarpa]
 gb|ERP61136.1| gibberellin-regulated protein 5 [Populus trichocarpa]
Length=95

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            ++C   CN RCSATSH+K C+ FC  CC  CLCVPPGTYGNKE C CYN+WKT+EG PKC
Sbjct  35   SECKPRCNYRCSATSHKKPCMFFCLKCCATCLCVPPGTYGNKETCPCYNNWKTKEGRPKC  94

Query  422  P  424
            P
Sbjct  95   P  95



>ref|XP_004978341.1| PREDICTED: gibberellin-regulated protein 6-like [Setaria italica]
Length=84

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  257  ECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            EC RRCS T H+K CL FCN CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  29   ECRRRCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKDTCPCYNNWKTKRGGPKCP  84



>ref|XP_006354781.1| PREDICTED: gibberellin-regulated protein 6-like [Solanum tuberosum]
Length=103

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            +QC  +C RRCS T + K C+ FC  CCN CLCVPPGTYGNK  C CYN+WKT+EGGPKC
Sbjct  43   SQCLPQCTRRCSKTQYHKPCMFFCQKCCNKCLCVPPGTYGNKAVCPCYNNWKTKEGGPKC  102

Query  422  P  424
            P
Sbjct  103  P  103



>gb|AFK37530.1| unknown [Lotus japonicus]
Length=92

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 63/107 (59%), Gaps = 16/107 (15%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            ++I   F+L       +  VS  G G      L+P            QC   C+ RCSAT
Sbjct  2    AKIVCGFLLMLAMTYAIQLVSAGGEG-----SLRP-----------EQCPGACDYRCSAT  45

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             ++K+CL +CN+CCN  LCVP GTYG+KE C CYNDWKT++GGPKCP
Sbjct  46   QYRKACLTYCNLCCNKRLCVPSGTYGHKEECPCYNDWKTKKGGPKCP  92



>ref|XP_009146866.1| PREDICTED: gibberellin-regulated protein 13-like [Brassica rapa]
Length=119

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  50   GTTEGSLKLQECGPRCGHRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNW  109

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  110  KTKLGGPKCP  119



>ref|XP_010108998.1| hypothetical protein L484_027195 [Morus notabilis]
 gb|EXC20638.1| hypothetical protein L484_027195 [Morus notabilis]
Length=97

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
              C  +C  RCSATSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+EGGPKC
Sbjct  37   QDCKPKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKEGGPKC  96

Query  422  P  424
            P
Sbjct  97   P  97



>ref|XP_003613454.1| Gibberellin induced protein [Medicago truncatula]
 gb|AES96412.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (59%), Gaps = 16/102 (16%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
             F+   V    + DV   G G      LKP            +C  +C+ RCS T+++K+
Sbjct  7    AFLFMLVTSFVIQDVYAGGEG-----SLKPA-----------ECAPKCDYRCSKTAYKKA  50

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CL +CN+CC  CLCVP GTYGNKE C CYN+WK ++GGPKCP
Sbjct  51   CLTYCNLCCAKCLCVPSGTYGNKEECPCYNNWKNKKGGPKCP  92



>ref|XP_011021371.1| PREDICTED: protein RSI-1 [Populus euphratica]
Length=95

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            ++C   CN RCSATSH+K C+ FC  CC  CLCVPPGTYGNKE C CYN+WKT+EG PKC
Sbjct  35   SECKPRCNYRCSATSHKKPCMFFCLKCCATCLCVPPGTYGNKETCPCYNNWKTKEGRPKC  94

Query  422  P  424
            P
Sbjct  95   P  95



>ref|XP_002467388.1| hypothetical protein SORBIDRAFT_01g026925 [Sorghum bicolor]
 gb|EER94386.1| hypothetical protein SORBIDRAFT_01g026925 [Sorghum bicolor]
Length=127

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 61/105 (58%), Gaps = 7/105 (7%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGP----GFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSH  289
             + FF+AL   F   +  P    G + +   + P           +C  +C  RCSATSH
Sbjct  26   LVYFFLALERSFRKQITKPISQKGRNGS---RNPSQLIFVSRACTECPDKCGYRCSATSH  82

Query  290  QKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            +K CL FCN CC  CLCVP GTYGNKE C CY++ KT+EGGPKCP
Sbjct  83   RKPCLFFCNYCCQKCLCVPSGTYGNKEECPCYDNLKTKEGGPKCP  127



>emb|CAD10105.1| Gip1-like protein [Petunia x hybrida]
Length=105

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = +2

Query  137  VALLTVFDVSMAGPGFDAALVLK-----PPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            + LL +F +SM      A+   K        GP +  +  +QC  +C RRCS T +  +C
Sbjct  7    IFLLALFVISMFATTVLASHDPKRGHHHKGYGPGS--LKPSQCLPQCTRRCSQTQYHNAC  64

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            ++FC  CCN CLCVPPG YGNK  C CYN+WKT+EGGPKCP
Sbjct  65   MLFCQKCCNKCLCVPPGFYGNKGVCPCYNNWKTKEGGPKCP  105



>gb|EMT22883.1| hypothetical protein F775_27923 [Aegilops tauschii]
 gb|AHM24218.1| GASR7 [Triticum aestivum]
Length=94

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  245  QCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            +C S+C+ RCS T ++K+CL +CN CC  CLCVPPGTYGNK  C CYN+WKT+EGGPKCP
Sbjct  35   ECPSKCSSRCSGTQYKKACLTYCNKCCATCLCVPPGTYGNKGACPCYNNWKTKEGGPKCP  94



>ref|XP_010091518.1| hypothetical protein L484_015945 [Morus notabilis]
 gb|EXB44688.1| hypothetical protein L484_015945 [Morus notabilis]
Length=111

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC SEC RRCS T + K C+ FC  CCN CLCVPPG YGNK  C CYN+WKT+ GG
Sbjct  48   LKSYQCPSECTRRCSKTQYHKPCMFFCQKCCNKCLCVPPGFYGNKAVCPCYNNWKTKRGG  107

Query  413  PKCP  424
            PKCP
Sbjct  108  PKCP  111



>emb|CDY00909.1| BnaC05g42910D [Brassica napus]
Length=119

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  50   GTTEGSLQLQECGPRCGHRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNW  109

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  110  KTKLGGPKCP  119



>emb|CDP03885.1| unnamed protein product [Coffea canephora]
Length=64

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  239  ANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPK  418
            A  CGSEC+RRCSATSH+  CL FCN CC  CLCVPP T+GNK+CC+CY + KT++G PK
Sbjct  3    ATGCGSECDRRCSATSHRNDCLWFCNSCCKKCLCVPPSTFGNKQCCACYGNRKTKKGTPK  62

Query  419  CP  424
            CP
Sbjct  63   CP  64



>ref|XP_004493436.1| PREDICTED: protein GAST1-like [Cicer arietinum]
Length=120

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 57/94 (61%), Gaps = 0/94 (0%)
 Frame = +2

Query  143  LLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMC  322
            +++  +     P  ++     P  G T   +   +CG  C+ RCS T ++K CL FC  C
Sbjct  27   VVSTVETPSPQPSKNSTTTQFPNHGITEGSLQPQECGPRCSNRCSNTQYKKPCLFFCQKC  86

Query  323  CNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  87   CAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  120



>ref|NP_001148171.1| GAST1 protein precursor [Zea mays]
 gb|ACG30044.1| GAST1 protein precursor [Zea mays]
Length=143

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = +2

Query  149  TVFDVSMAGPGFDAALVLKPPV--GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMC  322
            T  + S A P        +PP+  G T   +  ++CG  C  RCSAT++QK CL FC  C
Sbjct  50   TNTNDSSAAPRPAKPSAFQPPMYGGVTPGSLQPHECGGRCAGRCSATAYQKPCLFFCRKC  109

Query  323  CNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C  CLCVPPGTYGNK  C CYN+WKT+ GGPKCP
Sbjct  110  CAACLCVPPGTYGNKNTCPCYNNWKTKLGGPKCP  143



>ref|NP_001150577.1| LOC100284210 precursor [Zea mays]
 gb|ACG39629.1| GAST1 protein precursor [Zea mays]
 gb|ACG40227.1| GAST1 protein precursor [Zea mays]
Length=143

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = +2

Query  149  TVFDVSMAGPGFDAALVLKPPV--GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMC  322
            T  + S A P         PP+  G T   +  ++CG  C  RCSAT++QK CL FC  C
Sbjct  50   TNTNDSSAAPRPAKPSAFPPPMYGGVTPGSLQPHECGGRCAGRCSATAYQKPCLFFCRKC  109

Query  323  CNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C  CLCVPPGTYGNK  C CYN+WKT+ GGPKCP
Sbjct  110  CAACLCVPPGTYGNKNTCPCYNNWKTKRGGPKCP  143



>ref|XP_004489937.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 60/107 (56%), Gaps = 16/107 (15%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            +R      L FV    + DV   G G          + P  CP         C  RCSAT
Sbjct  2    ARFVCAIFLLFVMTFVIQDVYGGGEG---------SLRPQDCP-------GACAYRCSAT  45

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             ++K+CL +CN+CC  CLCVP GTYG+KE C CYN+W+T+EGGPKCP
Sbjct  46   QYKKACLTYCNLCCAKCLCVPSGTYGHKEECPCYNNWRTKEGGPKCP  92



>gb|AAW83819.1| GASA2-like protein [Pelargonium zonale]
Length=117

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C+ RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  48   GITEGSLQPQECGPRCSERCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQFCPCYNNW  107

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  108  KTKRGGPKCP  117



>ref|XP_003519099.2| PREDICTED: protein GAST1-like, partial [Glycine max]
Length=123

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +    CG  C  RCS T H+K CL FCN CC  CLCVPPGTYGNKE C CYN+W
Sbjct  54   GTTEGSLQPQDCGPRCEERCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKEVCPCYNNW  113

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  114  KTKRGGPKCP  123



>ref|XP_009123090.1| PREDICTED: gibberellin-regulated protein 13-like [Brassica rapa]
Length=128

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  59   GTTEGSLQPQECGPRCGDRCSNTKYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNNW  118

Query  395  KTQEGGPKCP  424
            KTQ GGPKCP
Sbjct  119  KTQLGGPKCP  128



>emb|CDP01621.1| unnamed protein product [Coffea canephora]
Length=98

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 62/112 (55%), Gaps = 15/112 (13%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVF-DVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNR  268
            MA+ +R      LF +  L VF   S    G++    L P             C   C  
Sbjct  1    MALGTRPCSNAGLFLIFSLLVFITFSSVAEGYNR---LHP-----------RDCSPRCTY  46

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCS TSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+EGGPKCP
Sbjct  47   RCSGTSHKKPCMFFCLKCCATCLCVPPGTYGNKQACPCYNNWKTKEGGPKCP  98



>ref|XP_010037169.1| PREDICTED: gibberellin-regulated protein 6 [Eucalyptus grandis]
 gb|KCW48837.1| hypothetical protein EUGRSUZ_K02472 [Eucalyptus grandis]
Length=105

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC  +C RRCS T ++K CL FCN CC  CLCVPPG YGNK+ C CYN+WKTQ+G 
Sbjct  42   LKSYQCAGQCQRRCSQTQYRKPCLFFCNKCCAKCLCVPPGYYGNKQVCPCYNNWKTQQGT  101

Query  413  PKCP  424
            PKCP
Sbjct  102  PKCP  105



>ref|XP_006299108.1| hypothetical protein CARUB_v10015247mg [Capsella rubella]
 gb|EOA32006.1| hypothetical protein CARUB_v10015247mg [Capsella rubella]
Length=83

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  233  VPAN-QCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEG  409
            +PA+  CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+WKTQ G
Sbjct  19   LPAHMHCGPRCGDRCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNNWKTQSG  78

Query  410  GPKCP  424
            GPKCP
Sbjct  79   GPKCP  83



>emb|CDY22221.1| BnaC01g38800D [Brassica napus]
Length=128

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  59   GTTEGSLQPQECGPRCGDRCSNTKYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNNW  118

Query  395  KTQEGGPKCP  424
            KTQ GGPKCP
Sbjct  119  KTQLGGPKCP  128



>ref|XP_006420919.1| hypothetical protein CICLE_v10006668mg, partial [Citrus clementina]
 gb|ESR34159.1| hypothetical protein CICLE_v10006668mg, partial [Citrus clementina]
Length=70

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  245  QCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            QC S CN RCSATSH+  C+ FCNMCC  CLCVP GTYG+KE C CYN+WKT+EG PKCP
Sbjct  11   QCESACNYRCSATSHRNPCIEFCNMCCKKCLCVPSGTYGHKEECPCYNNWKTKEGTPKCP  70



>ref|XP_010062256.1| PREDICTED: gibberellin-regulated protein 5-like [Eucalyptus grandis]
Length=93

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            + C ++C  RCSATSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+EGGPKC
Sbjct  33   SDCPNKCKFRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKEGGPKC  92

Query  422  P  424
            P
Sbjct  93   P  93



>ref|XP_006440597.1| hypothetical protein CICLE_v10023012mg [Citrus clementina]
 gb|ESR53837.1| hypothetical protein CICLE_v10023012mg [Citrus clementina]
Length=103

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 61/107 (57%), Gaps = 5/107 (5%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            ++ +  F+L   AL   F +S+         +     GP +  + + QC S+C RRCS T
Sbjct  2    AKAKLVFVLLVAAL---FSISIVMATETQNHLDTNGYGPGS--LRSYQCPSQCTRRCSQT  56

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
               K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+ GGPKCP
Sbjct  57   QFHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTKRGGPKCP  103



>ref|XP_010257391.1| PREDICTED: gibberellin-regulated protein 6-like [Nelumbo nucifera]
Length=107

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC S+C RRCS T + K C+ FC  CCN CLCVPPG YGNK  C CYN+WKT+ GG
Sbjct  44   LKSYQCPSQCTRRCSKTQYHKPCMFFCQKCCNKCLCVPPGFYGNKGVCPCYNNWKTKRGG  103

Query  413  PKCP  424
            PKCP
Sbjct  104  PKCP  107



>ref|XP_008784232.1| PREDICTED: gibberellin-regulated protein 6 [Phoenix dactylifera]
Length=113

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = +2

Query  194  LVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKEC  373
            L+ K   GP +  + +NQC S+C+RRCS T + K C+ FC  CC  CLCVPPG YGNK  
Sbjct  39   LLDKASYGPGS--LKSNQCPSQCSRRCSNTQYHKPCMFFCQKCCMKCLCVPPGFYGNKGV  96

Query  374  CSCYNDWKTQEGGPKCP  424
            C CYN+WKT+ GGPKCP
Sbjct  97   CPCYNNWKTKRGGPKCP  113



>ref|XP_009414179.1| PREDICTED: gibberellin-regulated protein 5-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=121

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 68/125 (54%), Gaps = 18/125 (14%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKP--PVGPTTCPVP---------  238
            M V +R+    IL  + +L    +   G     A   +P  P+GPT  P+          
Sbjct  1    MTVENRVA---ILLCMVVLHCLVIQAQG-RISLAPTAQPGNPLGPTPQPIKFPMYGATPG  56

Query  239  ---ANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEG  409
                 +C   C  RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ G
Sbjct  57   SLQPQECSGRCAGRCSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  116

Query  410  GPKCP  424
            GPKCP
Sbjct  117  GPKCP  121



>ref|XP_008807353.1| PREDICTED: gibberellin-regulated protein 6-like [Phoenix dactylifera]
Length=107

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            TF +    ++   +V +A              GP +  +   QC  EC+RRCS T + K 
Sbjct  14   TFSMVSCGIVHEVEVELAKKSQRGRY------GPGS--LKDYQCPGECSRRCSRTQYHKP  65

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC  CLCVPPG YGNK+ CSCYN+WKT+ GGPKCP
Sbjct  66   CMFFCQKCCRKCLCVPPGFYGNKQVCSCYNNWKTKRGGPKCP  107



>ref|XP_007141900.1| hypothetical protein PHAVU_008G235300g [Phaseolus vulgaris]
 gb|ESW13894.1| hypothetical protein PHAVU_008G235300g [Phaseolus vulgaris]
Length=97

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + A+ C   C  RCSATSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN WKT+EG 
Sbjct  34   LRASDCKGRCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQLCPCYNTWKTKEGR  93

Query  413  PKCP  424
            PKCP
Sbjct  94   PKCP  97



>ref|XP_010532783.1| PREDICTED: gibberellin-regulated protein 12 [Tarenaya hassleriana]
Length=104

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 3/101 (3%)
 Frame = +2

Query  125  ILFFVALLTVFDVSMA-GPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSC  301
            I+FF+ L  +  + ++ G  F +A ++K   G  +  +   QC   C  RCS TSH+K C
Sbjct  6    IVFFIVLSFLLVIQISNGEKFTSAKIIKTNGGEGS--LRPEQCQGACQVRCSETSHKKPC  63

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            + +CN CC  CLCVP G YG+KE C CY+  KT+EG PKCP
Sbjct  64   MFYCNYCCERCLCVPSGAYGHKEECPCYDSMKTKEGLPKCP  104



>ref|XP_007215189.1| hypothetical protein PRUPE_ppa013959mg [Prunus persica]
 gb|EMJ16388.1| hypothetical protein PRUPE_ppa013959mg [Prunus persica]
Length=89

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            ++C   C  RCSATSH+K C+ FC  CC  CLCVPPG YGNK+ C CYN+WKTQEG PKC
Sbjct  29   SECKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPPGVYGNKQVCPCYNNWKTQEGRPKC  88

Query  422  P  424
            P
Sbjct  89   P  89



>ref|XP_009347627.1| PREDICTED: protein GAST1-like [Pyrus x bretschneideri]
Length=116

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 11/111 (10%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPV----------GPTTCPVPANQCGSECNRR  271
            F++FF+ +L  F +++             P           G T   +   +CG  C  R
Sbjct  7    FVMFFLVML-FFALTVENHATTTGTEAPAPQPQSSNNHTMNGITEGSLQPQECGPRCTTR  65

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CS T ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  66   CSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  116



>ref|XP_004299361.1| PREDICTED: gibberellin-regulated protein 6-like [Fragaria vesca 
subsp. vesca]
Length=100

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + ++QC S+C RRCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKTQ+GG
Sbjct  37   LKSSQCPSQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGG  96

Query  413  PKCP  424
            PKCP
Sbjct  97   PKCP  100



>gb|KFK38405.1| hypothetical protein AALP_AA3G108800 [Arabis alpina]
Length=121

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  52   GTTEGSLQPQECGPRCGDRCSNTQYKKPCLFFCNKCCTACLCVPPGTYGNKQVCPCYNNW  111

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  112  KTKLGGPKCP  121



>ref|XP_004304306.1| PREDICTED: gibberellin-regulated protein 4-like [Fragaria vesca 
subsp. vesca]
Length=108

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC S+C RRCS T + K C+ FC  CC+ CLCVPPG YGNK  C CYN+WKT+EGG
Sbjct  45   LKSYQCPSQCTRRCSKTQYHKPCMFFCQKCCSKCLCVPPGFYGNKAVCPCYNNWKTKEGG  104

Query  413  PKCP  424
            PKCP
Sbjct  105  PKCP  108



>ref|XP_009410471.1| PREDICTED: gibberellin-regulated protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=136

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC  EC RRCS T + K C+ FC  CC  CLCVPPG YGNK+ CSCYN+WKT+ GG
Sbjct  73   LKSYQCPGECTRRCSRTQYHKPCMFFCQKCCRKCLCVPPGFYGNKQVCSCYNNWKTKRGG  132

Query  413  PKCP  424
            PKCP
Sbjct  133  PKCP  136



>gb|AGL92234.1| GASA-like protein GEG4 [Gerbera hybrid cultivar]
Length=96

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
              C  +C  RCSATSH+K C+ FC  CC  CLCVPPG YGNK+ C+CYN+WKTQEG PKC
Sbjct  36   QDCKGKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGVYGNKQTCACYNNWKTQEGKPKC  95

Query  422  P  424
            P
Sbjct  96   P  96



>ref|XP_007209788.1| hypothetical protein PRUPE_ppa013704mg [Prunus persica]
 gb|EMJ10987.1| hypothetical protein PRUPE_ppa013704mg [Prunus persica]
Length=107

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC S+C RRCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKTQ+GG
Sbjct  44   LKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKCLCVPPGYYGNKAVCPCYNNWKTQQGG  103

Query  413  PKCP  424
            PKCP
Sbjct  104  PKCP  107



>ref|XP_010414214.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
             +C   C  RCSATSH+K CL FCN CC  CLCVP GTYG+KE C CY++WKT+EGGPKC
Sbjct  46   EECPKACEYRCSATSHKKPCLFFCNKCCMKCLCVPSGTYGHKEECPCYDNWKTKEGGPKC  105

Query  422  P  424
            P
Sbjct  106  P  106



>emb|CDY41324.1| BnaA01g31950D [Brassica napus]
Length=111

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  VGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYND  391
             G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+
Sbjct  41   YGTTEGSLQPQECGPRCGDRCSNTKYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNN  100

Query  392  WKTQEGGPKCP  424
            WKTQ GGPKCP
Sbjct  101  WKTQLGGPKCP  111



>ref|NP_001234666.1| protein RSI-1 precursor [Solanum lycopersicum]
 sp|P47926.1|RSI1_SOLLC RecName: Full=Protein RSI-1; AltName: Full=TR132; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA20129.1| RSI-1 protein [Solanum lycopersicum]
 gb|AAA20130.1| RSI-1 protein [Solanum lycopersicum]
Length=96

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 56/102 (55%), Gaps = 14/102 (14%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            +F+L     L +   S    G++    L+P             C   C  RCSATSH+K 
Sbjct  9    SFLLLISMFLILLTFSNVVEGYNK---LRP-----------TDCKPRCTYRCSATSHKKP  54

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC  CLCVP G YGNK+ C CYN+WKTQEG PKCP
Sbjct  55   CMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP  96



>ref|XP_003625068.1| Gibberellin induced protein [Medicago truncatula]
 gb|ABD33300.1| Gibberellin regulated protein [Medicago truncatula]
 gb|AES81286.1| GASA/GAST/Snakin [Medicago truncatula]
Length=120

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 59/112 (53%), Gaps = 12/112 (11%)
 Frame = +2

Query  125  ILFFVALL------------TVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNR  268
            +LF V +L            +  +     P   +     P  G T   +   +CG  C  
Sbjct  9    VLFLVQMLLLPLQNHAEIVVSTVEAPAPQPSKSSGTNQFPNHGITEGSLQPQECGPRCTN  68

Query  269  RCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            RCS T ++K CL FCN CC  CLCVPPG YGNK+ C CYN+WKT+ GGPKCP
Sbjct  69   RCSNTQYKKPCLFFCNKCCAKCLCVPPGYYGNKQVCPCYNNWKTKRGGPKCP  120



>ref|XP_011075384.1| PREDICTED: protein GAST1-like [Sesamum indicum]
Length=114

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (57%), Gaps = 6/106 (6%)
 Frame = +2

Query  116  YTFILFFVAL---LTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATS  286
            +  I+F +A+    T+ +     P         P  G T   +   +CG  C  RCS T+
Sbjct  12   FLLIMFLLAVHNHATIVESPTPQPQPSGGF---PMYGATPGSLQPQECGRRCTTRCSKTA  68

Query  287  HQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             +K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  69   FKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  114



>ref|XP_009348406.1| PREDICTED: gibberellin-regulated protein 12-like [Pyrus x bretschneideri]
 ref|XP_009348408.1| PREDICTED: gibberellin-regulated protein 12-like [Pyrus x bretschneideri]
Length=108

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (59%), Gaps = 2/102 (2%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
            T +   +AL+   D+++A    +A  +  P        + +  C   C  RCS T+H+K 
Sbjct  9    TVLFVILALIFAIDIALAQKDQNAGAIDHP--NGERGSLRSEDCPEACKYRCSTTTHKKP  66

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ F   CC  CLCVP GTYG+KE C C+N+WKT+EGGPKCP
Sbjct  67   CMFFSMKCCAKCLCVPSGTYGHKEECPCHNNWKTKEGGPKCP  108



>ref|XP_008460555.1| PREDICTED: protein RSI-1-like [Cucumis melo]
Length=95

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            + C  +C+ RCSATSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKTQ+GGPKC
Sbjct  35   SDCKPKCSYRCSATSHRKPCMFFCQKCCAKCLCVPPGTYGNKQECPCYNNWKTQQGGPKC  94

Query  422  P  424
            P
Sbjct  95   P  95



>gb|AFK42462.1| unknown [Lotus japonicus]
Length=105

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 59/102 (58%), Gaps = 3/102 (3%)
 Frame = +2

Query  119  TFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKS  298
              +L  +A+  +    MA       L      GP +  + +N+C S+C RRC+ T + K 
Sbjct  7    VLLLALIAISMIATQVMAKENAQYHLD-SGNYGPGS--LKSNECPSQCTRRCAQTQYHKP  63

Query  299  CLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+ GGPKCP
Sbjct  64   CMFFCQKCCAKCLCVPPGYYGNKSVCPCYNNWKTKRGGPKCP  105



>gb|AEC10958.1| gibberellin induced protein [Camellia sinensis]
Length=113

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 7/106 (7%)
 Frame = +2

Query  125  ILFFVALLTVFDVSMAGPGFDAALVL------KPPVGPTTCPVPANQCGSECNRRCSATS  286
            IL FV +L +   ++    F+  L +          G T   +   +CG+ C  RC+ T+
Sbjct  9    ILCFVLMLGLLAENLQA-SFELQLQVFQLQGNNQMYGVTQGSLRPQECGARCTGRCAKTA  67

Query  287  HQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            ++K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  68   YKKPCMSFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  113



>gb|KHG09441.1| Protein GAST1 [Gossypium arboreum]
Length=119

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
             +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKC
Sbjct  59   QECGPRCGERCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKC  118

Query  422  P  424
            P
Sbjct  119  P  119



>ref|XP_008392374.1| PREDICTED: protein GAST1 isoform X2 [Malus domestica]
Length=116

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 11/111 (10%)
 Frame = +2

Query  122  FILFFVALLTVFDVSMAGPGFDAALVLKPPV----------GPTTCPVPANQCGSECNRR  271
            F++FF+ +L  F +++             P           G T   +   +CG  C  R
Sbjct  7    FVMFFLVIL-FFALTVENHANATGTEAPAPQPQSSNNHTMNGITEGSLQPQECGPRCTTR  65

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CS T ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKCP
Sbjct  66   CSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  116



>ref|XP_008393156.1| PREDICTED: gibberellin-regulated protein 6 [Malus domestica]
Length=107

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC S+C RRCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKTQ+GG
Sbjct  44   LKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGG  103

Query  413  PKCP  424
            PKCP
Sbjct  104  PKCP  107



>ref|XP_009339293.1| PREDICTED: gibberellin-regulated protein 6-like [Pyrus x bretschneideri]
Length=107

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC S+C RRCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKTQ+GG
Sbjct  44   LKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGG  103

Query  413  PKCP  424
            PKCP
Sbjct  104  PKCP  107



>ref|XP_010672957.1| PREDICTED: gibberellin-regulated protein 13-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=115

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  VGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYND  391
             G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+
Sbjct  45   YGSTPGSLQPQECGPRCATRCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQFCPCYNN  104

Query  392  WKTQEGGPKCP  424
            WKT+ GGPKCP
Sbjct  105  WKTKRGGPKCP  115



>emb|CDY60168.1| BnaAnng16620D [Brassica napus]
Length=120

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T +++ CL FCN CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  51   GTTEGSLQLRECGPRCGHRCSNTKYKEPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNW  110

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  111  KTKLGGPKCP  120



>gb|KDP31251.1| hypothetical protein JCGZ_11627 [Jatropha curcas]
Length=108

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + + QC SEC RRCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+ GG
Sbjct  45   LKSYQCPSECTRRCSKTQYHKPCMFFCQKCCTKCLCVPPGFYGNKSVCPCYNNWKTKRGG  104

Query  413  PKCP  424
            PKCP
Sbjct  105  PKCP  108



>ref|XP_010672958.1| PREDICTED: gibberellin-regulated protein 13-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=114

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  VGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYND  391
             G T   +   +CG  C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN+
Sbjct  44   YGSTPGSLQPQECGPRCATRCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQFCPCYNN  103

Query  392  WKTQEGGPKCP  424
            WKT+ GGPKCP
Sbjct  104  WKTKRGGPKCP  114



>ref|XP_007215190.1| hypothetical protein PRUPE_ppa013959mg [Prunus persica]
 gb|EMJ16389.1| hypothetical protein PRUPE_ppa013959mg [Prunus persica]
Length=94

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            ++C   C  RCSATSH+K C+ FC  CC  CLCVPPG YGNK+ C CYN+WKTQEG PKC
Sbjct  34   SECKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPPGVYGNKQVCPCYNNWKTQEGRPKC  93

Query  422  P  424
            P
Sbjct  94   P  94



>ref|XP_004959452.1| PREDICTED: gibberellin-regulated protein 6-like [Setaria italica]
Length=106

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRR  271
            MA++ R+    IL  VA+     ++      D  +      GP +  + + QC  EC RR
Sbjct  1    MALAGRL---LILLAVAMAKHEVLARGSDEHDDNVYKVSKGGPGS--IKSYQCSPECTRR  55

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            C  T ++K CL FCN C N CLCVP G YGNK  C CYN+WKT+ GGPKC
Sbjct  56   CGNTQYRKPCLFFCNKCYNTCLCVPSGYYGNKGECPCYNNWKTKRGGPKC  105



>gb|AGM38075.1| putative gibberellin-regulated GAST1-like protein [Stenocereus 
gummosus]
Length=99

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +2

Query  185  DAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGN  364
               ++ + P GP +  V  +QC  +C RRCS T + K C++FC  CC  C CVPPG YGN
Sbjct  22   STEVMARTPYGPGS--VKPSQCYGQCTRRCSKTQYHKPCMLFCQKCCRKCECVPPGFYGN  79

Query  365  KECCSCYNDWKTQEGGPKCP  424
            K+ C CYN+WKT+ GGPKCP
Sbjct  80   KQVCPCYNNWKTKRGGPKCP  99



>ref|XP_007138184.1| hypothetical protein PHAVU_009G187400g [Phaseolus vulgaris]
 gb|ESW10178.1| hypothetical protein PHAVU_009G187400g [Phaseolus vulgaris]
Length=112

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + ++QC SEC RRCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+ GG
Sbjct  49   LRSSQCPSECTRRCSQTQYHKPCMFFCQKCCRSCLCVPPGYYGNKSVCPCYNNWKTKRGG  108

Query  413  PKCP  424
            PKCP
Sbjct  109  PKCP  112



>ref|XP_002298301.2| hypothetical protein POPTR_0001s26100g, partial [Populus trichocarpa]
 gb|EEE83106.2| hypothetical protein POPTR_0001s26100g, partial [Populus trichocarpa]
Length=136

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  VGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYND  391
             G T   +   +C   C  RCSAT+++K CL FC  CC  CLCVPPGTYGNK+ C CYN+
Sbjct  66   YGATQGSLRPQECAPRCTTRCSATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQSCPCYNN  125

Query  392  WKTQEGGPKCP  424
            WKT+ GGPKCP
Sbjct  126  WKTKRGGPKCP  136



>ref|XP_010908421.1| PREDICTED: protein RSI-1-like [Elaeis guineensis]
Length=93

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            + C   C  RCSATSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+EGGPKC
Sbjct  33   SDCQPRCQYRCSATSHKKPCMFFCLKCCAQCLCVPPGTYGNKQVCPCYNNWKTKEGGPKC  92

Query  422  P  424
            P
Sbjct  93   P  93



>ref|XP_009414177.1| PREDICTED: gibberellin-regulated protein 5-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=132

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +C   C  RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CY
Sbjct  60   PMYGATPGSLQPQECSGRCAGRCSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCY  119

Query  386  NDWKTQEGGPKCP  424
            N+WKT+ GGPKCP
Sbjct  120  NNWKTKRGGPKCP  132



>ref|XP_007162142.1| hypothetical protein PHAVU_001G127700g [Phaseolus vulgaris]
 gb|ESW34136.1| hypothetical protein PHAVU_001G127700g [Phaseolus vulgaris]
Length=144

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +2

Query  176  PGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGT  355
            P  D      P  G T   +   +CG  C  RCS T ++K CL FC  CC  CLCVPPGT
Sbjct  62   PQPDKNTTHFPNRGITEGSLKPQECGPRCTGRCSNTQYKKPCLFFCQKCCAKCLCVPPGT  121

Query  356  YGNKECCSCYNDWKTQEGGPKCP  424
            YGNK+ C CYN+WKT+ GGPKCP
Sbjct  122  YGNKQVCPCYNNWKTKRGGPKCP  144



>ref|XP_010937130.1| PREDICTED: gibberellin-regulated protein 6 [Elaeis guineensis]
Length=113

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = +2

Query  194  LVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKEC  373
            L+ K   GP +  + ++QC S+C+RRCS T ++K C+ FC  CC  CLCVPPG YGNK  
Sbjct  39   LLDKASNGPGS--LKSSQCPSQCSRRCSKTQYRKPCMFFCQKCCMKCLCVPPGFYGNKSV  96

Query  374  CSCYNDWKTQEGGPKCP  424
            C CYN+WKT+ GGPKCP
Sbjct  97   CPCYNNWKTKRGGPKCP  113



>ref|XP_011045379.1| PREDICTED: protein GAST1-like [Populus euphratica]
Length=113

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  VGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYND  391
             G T   +   +C   C  RCSAT+++K CL FC  CC  CLCVPPGTYGNK+ C CYN+
Sbjct  43   YGATQGSLRPQECAPRCTTRCSATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQSCPCYNN  102

Query  392  WKTQEGGPKCP  424
            WKT+ GGPKCP
Sbjct  103  WKTKRGGPKCP  113



>ref|NP_001176009.1| Os10g0115550 [Oryza sativa Japonica Group]
 dbj|BAH94737.1| Os10g0115550 [Oryza sativa Japonica Group]
Length=117

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 5/97 (5%)
 Frame = +2

Query  125  ILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCL  304
            I+FF+  +T F V ++G   +A   L    G  T     N+C  +C+ RCSATSH   C+
Sbjct  10   IIFFLVAVT-FVVEVSGQKNEAVYHLFGGEGSLT----KNECPGKCSYRCSATSHTTVCM  64

Query  305  MFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGP  415
             +CN CC  CLCVP GTYGNKE C CYN+ KTQEG P
Sbjct  65   TYCNYCCERCLCVPSGTYGNKEECPCYNNMKTQEGKP  101



>gb|AFK49188.1| unknown [Lotus japonicus]
Length=118

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = +2

Query  140  ALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNM  319
            A + V  +    P         P  G T   +   +CG  C  RCS T ++K CL FCN 
Sbjct  24   AEIVVTPIEAPSPQPANNTAQFPNHGITEGSLQPQECGPRCANRCSNTQYKKPCLFFCNK  83

Query  320  CCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CC  CLCVPPG YGNK+ C CYN+WKT+ GGPKCP
Sbjct  84   CCAKCLCVPPGLYGNKQVCPCYNNWKTKRGGPKCP  118



>emb|CDP12304.1| unnamed protein product [Coffea canephora]
Length=103

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 63/109 (58%), Gaps = 9/109 (8%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            ++I    IL  +A+  V   +MA    D A   +  +          +CGS+C RRC  T
Sbjct  2    AKILCLVILALIAISMVATTAMANAHIDRARYGEGSL-------KGYECGSQCKRRCQKT  54

Query  284  --SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
              S  + C +FCN CC  CLCVPPG  GNK+ C+CYN+WKT++GGPKCP
Sbjct  55   RASLNQPCQLFCNKCCAKCLCVPPGYSGNKQVCACYNNWKTKKGGPKCP  103



>ref|XP_004962264.1| PREDICTED: protein GAST1-like isoform X1 [Setaria italica]
Length=133

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 8/81 (10%)
 Frame = +2

Query  206  PPVGPTTCP--------VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYG  361
            PP  PTT P        +   +CG  C  RCSAT+++K CL FC  CC  CLCVP GTYG
Sbjct  53   PPAQPTTFPTYGVTPGSLQPQECGGRCAARCSATAYRKPCLFFCRKCCAACLCVPAGTYG  112

Query  362  NKECCSCYNDWKTQEGGPKCP  424
            NK  C CY++WKT+ GGPKCP
Sbjct  113  NKASCPCYDNWKTKRGGPKCP  133



>ref|XP_010236530.1| PREDICTED: gibberellin-regulated protein 5-like [Brachypodium 
distachyon]
Length=116

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            VP  +C S+C  RCS TSH+K CL FCN CC  CLCVP GT GNKE C CYN+ KTQEG 
Sbjct  53   VPLQECPSKCEFRCSTTSHKKPCLFFCNYCCQKCLCVPSGTVGNKEECPCYNNMKTQEGK  112

Query  413  PKCP  424
            PKCP
Sbjct  113  PKCP  116



>ref|NP_001063170.1| Os09g0414900 [Oryza sativa Japonica Group]
 dbj|BAD28903.1| putative gibberellin-induced protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAF25084.1| Os09g0414900 [Oryza sativa Japonica Group]
 gb|EAZ09095.1| hypothetical protein OsI_31361 [Oryza sativa Indica Group]
 dbj|BAG86886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=112

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 63/115 (55%), Gaps = 7/115 (6%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTT----CPVPANQCGSE  259
            MA++ R+    +LF +ALL +           +       V   +      + + QC  +
Sbjct  1    MALAGRL---LVLFAIALLAISIAEHKALAKGSTSEHDDNVYQVSKGGQGSLKSYQCSPQ  57

Query  260  CNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            C  RCS T ++K CL FCN CCN CLCVP G YGNK  C CYN+WKT+ GGPKCP
Sbjct  58   CAYRCSQTQYKKPCLFFCNKCCNACLCVPSGLYGNKGECPCYNNWKTKRGGPKCP  112



>ref|XP_007028593.1| Gibberellin-regulated family protein [Theobroma cacao]
 gb|EOY09095.1| Gibberellin-regulated family protein [Theobroma cacao]
Length=114

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C  RCS T ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  45   GITQGSLHPQECGPRCTFRCSKTQYRKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNW  104

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  105  KTKRGGPKCP  114



>ref|NP_001055385.1| Os05g0376800 [Oryza sativa Japonica Group]
 gb|AAT93888.1| putative gibberellin-induced protein [Oryza sativa Japonica Group]
 gb|AAU10727.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17299.1| Os05g0376800 [Oryza sativa Japonica Group]
 dbj|BAG97829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63525.1| hypothetical protein OsJ_18341 [Oryza sativa Japonica Group]
Length=152

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +CG  C  RCSAT+++K C+ FC  CC  CLCV PGTYGNK+ C CY
Sbjct  80   PMYGVTPGSLRPQECGGRCAYRCSATAYRKPCMFFCQKCCASCLCVLPGTYGNKQSCPCY  139

Query  386  NDWKTQEGGPKCP  424
            NDWKT+ GGPKCP
Sbjct  140  NDWKTKRGGPKCP  152



>ref|XP_008229202.1| PREDICTED: protein RSI-1 [Prunus mume]
Length=94

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            ++C   C  RCSATSH+K C+ FC  CC  CLCVPPG YGNK+ C CYN+WKTQEG PKC
Sbjct  34   SECKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPPGVYGNKQVCPCYNNWKTQEGRPKC  93

Query  422  P  424
            P
Sbjct  94   P  94



>ref|XP_008800232.1| PREDICTED: protein GAST1-like [Phoenix dactylifera]
Length=100

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
             +C   C  RCSAT+++K C+ FC  CC+ CLCVPPGTYGNKE C CYN+WKT+ GGPKC
Sbjct  40   QECPGHCASRCSATAYKKPCMFFCQKCCSKCLCVPPGTYGNKEFCPCYNNWKTKRGGPKC  99

Query  422  P  424
            P
Sbjct  100  P  100



>ref|XP_004962265.1| PREDICTED: protein GAST1-like isoform X2 [Setaria italica]
Length=135

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 10/83 (12%)
 Frame = +2

Query  206  PPVGPTTCPVPA----------NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGT  355
            PP  PTT P  +           +CG  C  RCSAT+++K CL FC  CC  CLCVP GT
Sbjct  53   PPAQPTTFPTVSYGVTPGSLQPQECGGRCAARCSATAYRKPCLFFCRKCCAACLCVPAGT  112

Query  356  YGNKECCSCYNDWKTQEGGPKCP  424
            YGNK  C CY++WKT+ GGPKCP
Sbjct  113  YGNKASCPCYDNWKTKRGGPKCP  135



>ref|XP_010538071.1| PREDICTED: gibberellin-regulated protein 6 [Tarenaya hassleriana]
Length=103

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + ++QC S+C RRC  T + K C+ FC  CC  CLCVPPGT+GNK+ C CYN+WKT+ GG
Sbjct  40   LKSSQCPSQCIRRCGKTQYHKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTKRGG  99

Query  413  PKCP  424
            PKCP
Sbjct  100  PKCP  103



>ref|XP_006655989.1| PREDICTED: gibberellin-regulated protein 6-like [Oryza brachyantha]
Length=106

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  245  QCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            +C S+C  RCS T ++K+CL FCN CC  CLCVPPGTYGNK  C CYN+WKT+EGGPKCP
Sbjct  47   ECSSKCAGRCSNTQYKKACLTFCNKCCAACLCVPPGTYGNKGACPCYNNWKTKEGGPKCP  106



>ref|NP_001237498.1| uncharacterized protein LOC100306354 precursor [Glycine max]
 gb|ACU14488.1| unknown [Glycine max]
Length=106

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 55/101 (54%), Gaps = 2/101 (2%)
 Frame = +2

Query  128  LFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCP--VPANQCGSECNRRCSATSHQKSC  301
            L  V LL    +SM      A        G +  P  +  +QC SEC RRC  T + K C
Sbjct  6    LVCVLLLAFLGISMITTQVMATDSAHHLDGRSYGPGSLKTSQCPSECTRRCCQTQYHKPC  65

Query  302  LMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            + FC  CC  CLCVPPG YGNK  C CYN+WK + GGPKCP
Sbjct  66   MFFCQECCKVCLCVPPGYYGNKSVCPCYNNWKNKRGGPKCP  106



>ref|XP_003554146.1| PREDICTED: protein GAST1-like isoform 1 [Glycine max]
Length=137

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
             +CG  C  RCS T ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+WKT+ GGPKC
Sbjct  77   QECGPRCTARCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKC  136

Query  422  P  424
            P
Sbjct  137  P  137



>gb|EPS65179.1| hypothetical protein M569_09600 [Genlisea aurea]
Length=122

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +C   C  RCS T ++K CL FCN CC  CLCVPPGTYGNK+ C CYN W
Sbjct  53   GITQGSLHPQECDGRCAYRCSKTQYKKPCLFFCNKCCATCLCVPPGTYGNKQYCPCYNQW  112

Query  395  KTQEGGPKCP  424
            KT+EGGPKCP
Sbjct  113  KTKEGGPKCP  122



>ref|XP_007216796.1| hypothetical protein PRUPE_ppa023616mg [Prunus persica]
 gb|EMJ17995.1| hypothetical protein PRUPE_ppa023616mg [Prunus persica]
Length=114

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
            G T   +   +CG  C+ RCS T ++K CL FC  CC  CLCVPPGTYGNK+ C CYN+W
Sbjct  45   GITEGSLQPQECGPRCSTRCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNW  104

Query  395  KTQEGGPKCP  424
            KT+ GGPKCP
Sbjct  105  KTKRGGPKCP  114



>ref|XP_008800752.1| PREDICTED: protein RSI-1-like [Phoenix dactylifera]
Length=93

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  VGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYND  391
            VG     +  + C   C  RCSATSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+
Sbjct  23   VGSVHAGLKPSDCQPRCEFRCSATSHKKPCMFFCLKCCAQCLCVPPGTYGNKQACPCYNN  82

Query  392  WKTQEGGPKCP  424
            WKT+EGG KCP
Sbjct  83   WKTKEGGSKCP  93



>gb|AGL92233.1| GASA-like protein GEG3 [Gerbera hybrid cultivar]
Length=100

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            + ++QC  +C RRCS T + K C+ FC  CC  CLCVPPG YGNK+ C CYN+WKT+EGG
Sbjct  37   LTSSQCPGQCIRRCSKTQYHKPCMFFCQKCCAKCLCVPPGFYGNKQVCPCYNNWKTKEGG  96

Query  413  PKCP  424
            PKCP
Sbjct  97   PKCP  100



>ref|XP_003616284.1| GASA5-like protein [Medicago truncatula]
Length=96

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
              C   C  RCSATSH+K C+ FC  CC  CLCVPPG YGNK+ C CYN WKTQEG PKC
Sbjct  36   QDCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPPGVYGNKQVCPCYNSWKTQEGKPKC  95

Query  422  P  424
            P
Sbjct  96   P  96



>gb|EPS67539.1| gibberellin-regulated protein, partial [Genlisea aurea]
Length=78

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  233  VPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGG  412
            V   +C S+C+RRCS T + K C+ FC  CC  CLCVPPG YGNK  C CYN+WKT+EGG
Sbjct  15   VHTLECPSQCSRRCSKTQYHKPCMFFCQKCCRKCLCVPPGFYGNKAVCPCYNNWKTKEGG  74

Query  413  PKCP  424
            PKCP
Sbjct  75   PKCP  78



>ref|XP_008788455.1| PREDICTED: protein RSI-1-like [Phoenix dactylifera]
Length=93

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
            + C   C  RCS TSH+K C+ FC  CC  CLCVPPGTYGNK+ C CYN+WKT+EGGPKC
Sbjct  33   SDCQPRCQYRCSGTSHKKPCMFFCLKCCAQCLCVPPGTYGNKQVCPCYNNWKTKEGGPKC  92

Query  422  P  424
            P
Sbjct  93   P  93



>ref|XP_004513860.1| PREDICTED: gibberellin-regulated protein 14-like [Cicer arietinum]
Length=180

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +C   C+ RCS T H+K CL FC  CC  CLCVPPGTYGNKE C CY
Sbjct  108  PSHGTTEGSLKPEECSPRCDYRCSKTHHKKPCLFFCKKCCAECLCVPPGTYGNKEVCPCY  167

Query  386  NDWKTQEGGPKCP  424
            ++WKT+ G PKCP
Sbjct  168  DNWKTKRGTPKCP  180



>ref|XP_006655260.1| PREDICTED: gibberellin-regulated protein 14-like [Oryza brachyantha]
Length=151

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +CG  C  RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CY
Sbjct  79   PMYGVTPGSLRPQECGGRCAYRCSATAYRKPCMFFCQKCCASCLCVPPGTYGNKQSCPCY  138

Query  386  NDWKTQEGGPKCP  424
            + WKT+ GGPKCP
Sbjct  139  SGWKTKRGGPKCP  151



>gb|EAZ36571.1| hypothetical protein OsJ_20910 [Oryza sativa Japonica Group]
Length=106

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  245  QCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            +C  +C  RCS T ++K+CL FCN CC  CLCVPPGTYGNK  C CYN+WKT+EGGPKCP
Sbjct  47   ECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNWKTKEGGPKCP  106



>ref|XP_010938633.1| PREDICTED: protein GAST1-like [Elaeis guineensis]
Length=107

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +C   C  RCSAT+++K C+ FC  CC  CLCVPPGTYGNK+ C CY
Sbjct  35   PLYGTTQGSLQPQECPGRCTSRCSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCY  94

Query  386  NDWKTQEGGPKCP  424
            N+WKT+ GGPKCP
Sbjct  95   NNWKTKRGGPKCP  107



>ref|XP_004517034.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  ALVLKPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKE  370
            A  +K         +   +C + C  RCSAT ++++CL +CN+CC  CLCVP GTYG+KE
Sbjct  15   AFAIKDTYAGKEGSLRPKECATACALRCSATQYKEACLTYCNLCCAKCLCVPSGTYGHKE  74

Query  371  CCSCYNDWKTQEGGPKCP  424
             C CYN+WKT++GGPKCP
Sbjct  75   ECPCYNNWKTKKGGPKCP  92



>ref|XP_003613456.1| Gibberellin-regulated protein [Medicago truncatula]
 gb|AES96414.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 60/107 (56%), Gaps = 16/107 (15%)
 Frame = +2

Query  104  SRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRRCSAT  283
            +++   F+   V    + DV   G G      LKP            +C + C+ RCSAT
Sbjct  2    AKLVCAFLFMLVTSFVIQDVYAGGEG-----SLKP-----------EECSAACDVRCSAT  45

Query  284  SHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
             ++K+CL +CN CC  CLCVP GTYG+KE C CY + KT EGGPKCP
Sbjct  46   MYKKACLTYCNYCCAKCLCVPSGTYGHKEECPCYANLKTHEGGPKCP  92



>ref|XP_002308912.2| hypothetical protein POPTR_0006s04300g [Populus trichocarpa]
 gb|EEE92435.2| hypothetical protein POPTR_0006s04300g [Populus trichocarpa]
Length=116

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  203  KPPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSC  382
            +PP G T   +   +CG  C  RCS T+ +K C+ FC  CC  CLCVP GTYGNK+ C C
Sbjct  43   RPPYGTTQGSLNPQECGPRCTGRCSKTAFKKPCMFFCQKCCAKCLCVPAGTYGNKQSCPC  102

Query  383  YNDWKTQEGGPKCP  424
            YN+WKT+ GGPKCP
Sbjct  103  YNNWKTKRGGPKCP  116



>ref|XP_009383413.1| PREDICTED: gibberellin-regulated protein 12 [Musa acuminata subsp. 
malaccensis]
Length=73

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  NQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKC  421
             +C  +C  RCS TSH+K CL FC MCC  CLCVP GTYG+KE C CYN+WKT+EG PKC
Sbjct  13   EECAGKCEYRCSETSHKKPCLFFCKMCCAKCLCVPSGTYGHKEECPCYNNWKTKEGKPKC  72

Query  422  P  424
            P
Sbjct  73   P  73



>ref|XP_010646211.1| PREDICTED: gibberellin-regulated protein 12-like [Vitis vinifera]
Length=96

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 68/111 (61%), Gaps = 15/111 (14%)
 Frame = +2

Query  92   MAVSSRIEYTFILFFVALLTVFDVSMAGPGFDAALVLKPPVGPTTCPVPANQCGSECNRR  271
            MA SS ++  F+L  VA + + DVS+AG   + +L                +C   CN R
Sbjct  1    MAQSSNLQSIFLLLLVAFMLLVDVSIAGG--EGSLT-------------KAECPKACNYR  45

Query  272  CSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDWKTQEGGPKCP  424
            CS T +  +CL FCN+CC  CLCVP GTYG+KE C CYN+WKT+EGGPKCP
Sbjct  46   CSDTQYLNACLEFCNLCCQKCLCVPSGTYGHKEECPCYNNWKTKEGGPKCP  96



>ref|XP_004140359.1| PREDICTED: protein RSI-1-like [Cucumis sativus]
Length=122

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  215  GPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCYNDW  394
             P T     + C  +C+ RCSAT+H+K C+ FC  CC  CLCVP GTYGNK+ C CYN+W
Sbjct  53   APCTLSTLHSDCKPKCSYRCSATTHRKPCMFFCQKCCAKCLCVPSGTYGNKQECPCYNNW  112

Query  395  KTQEGGPKCP  424
            KTQ+GGPKCP
Sbjct  113  KTQQGGPKCP  122



>ref|XP_002441006.1| hypothetical protein SORBIDRAFT_09g018790 [Sorghum bicolor]
 gb|EES19436.1| hypothetical protein SORBIDRAFT_09g018790 [Sorghum bicolor]
Length=137

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G T   +   +CG  C  RCSAT+++K CL FC  CC  CLCVP GTYGNK  C CY
Sbjct  65   PMYGVTPGSLQPQECGGRCAARCSATAYRKPCLFFCRKCCATCLCVPAGTYGNKNTCPCY  124

Query  386  NDWKTQEGGPKCP  424
            N+WKT+ GGPKCP
Sbjct  125  NNWKTKRGGPKCP  137



>ref|XP_010056457.1| PREDICTED: protein GAST1 [Eucalyptus grandis]
 gb|KCW90091.1| hypothetical protein EUGRSUZ_A02289 [Eucalyptus grandis]
Length=114

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  206  PPVGPTTCPVPANQCGSECNRRCSATSHQKSCLMFCNMCCNWCLCVPPGTYGNKECCSCY  385
            P  G     +   +CG  C  RCS T ++K C+ FC  CC  CLCVPPGTYGNK+ C CY
Sbjct  42   PSYGAREGSLKPQECGPRCTGRCSKTQYKKPCMFFCQKCCAKCLCVPPGTYGNKQLCPCY  101

Query  386  NDWKTQEGGPKCP  424
            N+WKT+ GGPKCP
Sbjct  102  NNWKTKRGGPKCP  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947515357384