BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14350_g1_i1 len=1949 path=[1927:0-432 2360:433-1948]

Length=1949
                                                                      Score     E

ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             766   0.0      
emb|CDP02461.1|  unnamed protein product                                765   0.0      
ref|XP_009765874.1|  PREDICTED: L-ascorbate oxidase homolog             756   0.0      
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg                751   0.0      
ref|XP_011099223.1|  PREDICTED: L-ascorbate oxidase homolog             744   0.0      
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             719   0.0      
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             717   0.0      
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             717   0.0      
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             715   0.0      
emb|CBI18561.3|  unnamed protein product                                715   0.0      
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             712   0.0      Vitis vinifera
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             703   0.0      
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             703   0.0      
ref|XP_006466655.1|  PREDICTED: L-ascorbate oxidase homolog             701   0.0      
ref|XP_006425822.1|  hypothetical protein CICLE_v10027285mg             701   0.0      
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   699   0.0      
gb|KDO79346.1|  hypothetical protein CISIN_1g009171mg                   697   0.0      
ref|XP_010548381.1|  PREDICTED: L-ascorbate oxidase homolog             696   0.0      
ref|XP_002522339.1|  multicopper oxidase, putative                      692   0.0      Ricinus communis
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         692   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             691   0.0      
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         691   0.0      
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             689   0.0      
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             688   0.0      
ref|XP_010472357.1|  PREDICTED: L-ascorbate oxidase homolog             687   0.0      
ref|XP_010429313.1|  PREDICTED: L-ascorbate oxidase homolog             687   0.0      
ref|XP_010417106.1|  PREDICTED: L-ascorbate oxidase homolog             686   0.0      
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             684   0.0      
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             684   0.0      
ref|XP_007047151.1|  SKU5 similar 16                                    684   0.0      
emb|CDX72617.1|  BnaC07g46390D                                          684   0.0      
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    683   0.0      
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             683   0.0      
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog             682   0.0      
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         682   0.0      
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    681   0.0      
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             681   0.0      
ref|NP_195433.1|  protein SKU5 similar 15                               681   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             680   0.0      
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          679   0.0      
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             679   0.0      
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             679   0.0      
ref|XP_006285189.1|  hypothetical protein CARUB_v10006539mg             679   0.0      
ref|XP_002522337.1|  multicopper oxidase, putative                      679   0.0      Ricinus communis
ref|XP_009138463.1|  PREDICTED: L-ascorbate oxidase homolog             679   0.0      
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             677   0.0      
ref|XP_009140476.1|  PREDICTED: L-ascorbate oxidase homolog             677   0.0      
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    677   0.0      
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             676   0.0      
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             676   0.0      
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             676   0.0      
ref|XP_006296162.1|  hypothetical protein CARUB_v10025315mg             676   0.0      
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             675   0.0      
ref|XP_010437285.1|  PREDICTED: L-ascorbate oxidase homolog             675   0.0      
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    675   0.0      
emb|CDY42716.1|  BnaA03g53690D                                          675   0.0      
gb|KHN36198.1|  L-ascorbate oxidase like                                675   0.0      
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          675   0.0      
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     676   0.0      
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             674   0.0      
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             673   0.0      
ref|NP_565554.1|  protein SKU5 similar 16                               673   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   673   0.0      
emb|CDX75611.1|  BnaA01g00910D                                          672   0.0      
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             671   0.0      
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             671   0.0      
ref|XP_002869012.1|  hypothetical protein ARALYDRAFT_490933             671   0.0      
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    671   0.0      
ref|XP_002880518.1|  hypothetical protein ARALYDRAFT_320180             671   0.0      
ref|XP_009140392.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    671   0.0      
ref|XP_009140331.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    670   0.0      
ref|XP_010436233.1|  PREDICTED: L-ascorbate oxidase homolog             672   0.0      
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             669   0.0      
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    669   0.0      
ref|XP_006411943.1|  hypothetical protein EUTSA_v10024863mg             668   0.0      
gb|AGE09595.1|  SKU5-like protein                                       666   0.0      
gb|KHN42054.1|  L-ascorbate oxidase like                                667   0.0      
gb|KHG25743.1|  L-ascorbate oxidase                                     665   0.0      
gb|KEH20500.1|  multi-copper oxidase-like protein                       665   0.0      
gb|KEH20499.1|  multi-copper oxidase-like protein                       664   0.0      
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    664   0.0      
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   664   0.0      
gb|KHG07318.1|  L-ascorbate oxidase                                     664   0.0      
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             663   0.0      
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             662   0.0      Vitis vinifera
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             662   0.0      
emb|CBI18560.3|  unnamed protein product                                662   0.0      
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             661   0.0      
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             660   0.0      
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         660   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             660   0.0      
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             660   0.0      
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             659   0.0      
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               657   0.0      
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             657   0.0      
ref|XP_007155970.1|  hypothetical protein PHAVU_003G247800g             657   0.0      
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                655   0.0      
ref|XP_009619786.1|  PREDICTED: L-ascorbate oxidase homolog             654   0.0      
emb|CDP02462.1|  unnamed protein product                                654   0.0      
ref|XP_009769792.1|  PREDICTED: L-ascorbate oxidase homolog             654   0.0      
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             653   0.0      
emb|CDX69261.1|  BnaC01g01920D                                          652   0.0      
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             651   0.0      
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    652   0.0      
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             649   0.0      
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             649   0.0      
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             647   0.0      
emb|CAN72539.1|  hypothetical protein VITISV_028750                     645   0.0      Vitis vinifera
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             647   0.0      
emb|CAN72538.1|  hypothetical protein VITISV_028749                     648   0.0      Vitis vinifera
ref|XP_010680452.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0      
ref|XP_004148037.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0      
emb|CDX81353.1|  BnaC09g07640D                                          639   0.0      
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             638   0.0      
emb|CDY18626.1|  BnaA09g07690D                                          638   0.0      
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             638   0.0      
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             638   0.0      
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             637   0.0      
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             637   0.0      
ref|XP_008457817.1|  PREDICTED: L-ascorbate oxidase homolog             636   0.0      
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             633   0.0      
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             632   0.0      
emb|CDY01453.1|  BnaA07g12260D                                          626   0.0      
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             625   0.0      
ref|XP_002866726.1|  predicted protein                                  624   0.0      
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    624   0.0      
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             623   0.0      
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             621   0.0      
gb|AAM61328.1|  pectinesterase-like protein                             622   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             621   0.0      
ref|NP_569041.1|  protein SKU5 similar 17                               621   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAB08634.1|  pectinesterase like protein                            620   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             620   0.0      
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             619   0.0      
gb|KHM99211.1|  L-ascorbate oxidase like                                613   0.0      
emb|CDY43557.1|  BnaC02g16540D                                          609   0.0      
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             606   0.0      
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          604   0.0      
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             602   0.0      
emb|CDY12788.1|  BnaC07g16450D                                          602   0.0      
ref|XP_006657409.1|  PREDICTED: L-ascorbate oxidase homolog             584   0.0      
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  573   0.0      
emb|CDY67479.1|  BnaCnng55180D                                          572   0.0      
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             572   0.0      
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           572   0.0      
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             571   0.0      
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             571   0.0      
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             571   0.0      
emb|CDY35790.1|  BnaA08g04510D                                          571   0.0      
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             570   0.0      
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             569   0.0      
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             569   0.0      
gb|KEH30611.1|  multi-copper oxidase-like protein                       568   0.0      
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             568   0.0      
ref|XP_002524823.1|  multicopper oxidase, putative                      567   0.0      Ricinus communis
gb|KHG11003.1|  L-ascorbate oxidase                                     567   0.0      
gb|ABR18324.1|  unknown                                                 567   0.0      Picea sitchensis
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         567   0.0      
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             567   0.0      Vitis vinifera
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             567   0.0      
gb|KHN05478.1|  L-ascorbate oxidase like                                566   0.0      
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         566   0.0      
gb|AAL24296.1|  Unknown protein                                         566   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             566   0.0      
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             566   0.0      
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             566   0.0      
ref|NP_564479.1|  SKU5 similar 6                                        565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001058771.1|  Os07g0119400                                       565   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAF99833.1|AC008046_5  Putative pectinesterase                       565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528421.1|  multicopper oxidase, putative                      565   0.0      Ricinus communis
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             565   0.0      
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   563   0.0      
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             563   0.0      
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             562   0.0      
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    562   0.0      
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             562   0.0      
ref|XP_004955371.1|  PREDICTED: L-ascorbate oxidase homolog             561   0.0      
ref|XP_007041705.1|  SKU5 similar 5                                     561   0.0      
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         561   0.0      
gb|AGJ03718.1|  multicopper oxidase                                     561   0.0      
gb|ABK25092.1|  unknown                                                 560   0.0      Picea sitchensis
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543             560   0.0      
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg             560   0.0      
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             559   0.0      
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             558   0.0      
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             558   0.0      
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             558   0.0      
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             558   0.0      
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             558   0.0      
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             557   0.0      
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                    557   0.0      
ref|XP_002510630.1|  multicopper oxidase, putative                      557   0.0      Ricinus communis
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             557   0.0      
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             557   0.0      
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             557   0.0      
ref|XP_010500092.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
emb|CDP19581.1|  unnamed protein product                                556   0.0      
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   556   0.0      
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          556   0.0      Sorghum bicolor [broomcorn]
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
dbj|BAK04971.1|  predicted protein                                      556   0.0      
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         556   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             556   0.0      
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
gb|EPS74059.1|  hypothetical protein M569_00695                         555   0.0      
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             555   0.0      Populus trichocarpa [western balsam poplar]
gb|KEH40258.1|  multi-copper oxidase-like protein                       555   0.0      
gb|KEH36280.1|  multi-copper oxidase-like protein                       555   0.0      
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             555   0.0      
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             555   0.0      
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         555   0.0      
gb|KHG04142.1|  L-ascorbate oxidase                                     555   0.0      
emb|CDP10787.1|  unnamed protein product                                554   0.0      
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             554   0.0      
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             554   0.0      
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    554   0.0      
gb|KEH29685.1|  multi-copper oxidase-like protein                       553   0.0      
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g             554   0.0      
gb|AGT57427.1|  ascorbate oxidase                                       553   0.0      
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             553   0.0      
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             553   0.0      
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             553   0.0      
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog             553   0.0      
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             552   0.0      
gb|ACJ85585.1|  unknown                                                 552   0.0      Medicago truncatula
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             552   0.0      
emb|CDX73238.1|  BnaC06g36860D                                          552   0.0      
gb|KHG03845.1|  L-ascorbate oxidase                                     552   0.0      
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             552   0.0      
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             552   0.0      
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             552   0.0      
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             552   0.0      
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             551   0.0      
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    551   0.0      
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   551   0.0      
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
ref|XP_008665189.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         551   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
gb|KHN33820.1|  L-ascorbate oxidase like                                550   0.0      
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             550   0.0      
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             550   0.0      
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           550   0.0      
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             550   0.0      
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                550   0.0      
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             549   0.0      Populus trichocarpa [western balsam poplar]
gb|AFK35121.1|  unknown                                                 549   0.0      
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          549   0.0      
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             549   0.0      
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        549   0.0      
gb|KHG21949.1|  L-ascorbate oxidase                                     549   0.0      
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          548   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             548   0.0      
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             549   0.0      
emb|CDX87633.1|  BnaA07g32400D                                          548   0.0      
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604             548   0.0      
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             548   0.0      
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             547   0.0      
ref|NP_001058365.1|  Os06g0678800                                       547   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             548   0.0      
gb|KHG02352.1|  L-ascorbate oxidase                                     547   0.0      
gb|EAZ02087.1|  hypothetical protein OsI_24168                          547   0.0      
ref|NP_177743.1|  SKU5-like 5 protein                                   547   0.0      
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
gb|AAL09733.1|  At1g76160/T23E18_10                                     546   0.0      
gb|KGN62015.1|  hypothetical protein Csa_2G286480                       543   0.0      
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             545   0.0      
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             545   0.0      
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                545   0.0      
gb|AAM97070.1|  pectinesterase, putative                                545   0.0      
ref|XP_010431777.1|  PREDICTED: L-ascorbate oxidase homolog             545   0.0      
emb|CDP07321.1|  unnamed protein product                                545   0.0      
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog             545   0.0      
gb|EEC82126.1|  hypothetical protein OsI_26158                          545   0.0      
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             544   0.0      
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         544   0.0      
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   544   0.0      
gb|ACR38095.1|  unknown                                                 544   0.0      
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          544   0.0      
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             544   0.0      
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           543   0.0      
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             543   0.0      
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             543   0.0      
ref|XP_010101299.1|  L-ascorbate oxidase-like protein                   543   0.0      
gb|EEE67250.1|  hypothetical protein OsJ_24405                          543   0.0      
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             543   0.0      
gb|ACL53812.1|  unknown                                                 543   0.0      
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             543   0.0      
ref|NP_173604.1|  SKU5 similar 7 protein                                542   0.0      
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             542   0.0      
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             542   0.0      
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             542   0.0      
gb|KHF99853.1|  L-ascorbate oxidase                                     542   0.0      
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    542   0.0      
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    541   0.0      
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
dbj|BAJ91397.1|  predicted protein                                      541   0.0      
ref|XP_007014658.1|  SKU5 similar 13                                    542   0.0      
emb|CDY68834.1|  BnaCnng60730D                                          541   0.0      
emb|CAA65634.1|  PS60                                                   541   0.0      
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    541   0.0      
ref|NP_001147597.1|  LOC100281206 precursor                             541   0.0      
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                540   0.0      
ref|XP_003557661.2|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
ref|XP_002518462.1|  multicopper oxidase, putative                      540   0.0      
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         540   0.0      
ref|NP_195555.2|  protein SKU5 similar 9                                540   0.0      
ref|XP_006342102.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
dbj|BAK00459.1|  predicted protein                                      540   0.0      
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          539   0.0      
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             539   0.0      
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           539   0.0      
emb|CDY55201.1|  BnaCnng28410D                                          539   0.0      
gb|EMT24760.1|  L-ascorbate oxidase-like protein                        538   0.0      
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             539   0.0      
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             539   0.0      
emb|CDP04415.1|  unnamed protein product                                539   0.0      
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             539   0.0      
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             539   0.0      
ref|NP_173603.1|  SKU5 similar 8 protein                                539   0.0      
gb|ABK95805.1|  unknown                                                 538   0.0      
emb|CDP04133.1|  unnamed protein product                                539   0.0      
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             539   0.0      
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             538   0.0      
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             538   0.0      
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             538   0.0      
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             538   0.0      
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
ref|XP_007014661.1|  SKU5 similar 12                                    538   0.0      
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
gb|ABK25324.1|  unknown                                                 537   0.0      
ref|XP_004238406.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    537   0.0      
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             537   0.0      
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
gb|AAQ90182.1|  ntp101                                                  537   0.0      
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             536   1e-180   
ref|XP_007047154.1|  SKU5 similar 17 isoform 3                          531   1e-180   
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog             535   2e-180   
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             535   2e-180   
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      535   3e-180   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             535   3e-180   
ref|XP_002523382.1|  multicopper oxidase, putative                      535   3e-180   
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             535   4e-180   
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             535   4e-180   
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             536   4e-180   
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             535   4e-180   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          535   5e-180   
gb|KHF99506.1|  L-ascorbate oxidase                                     534   6e-180   
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog             534   7e-180   
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             534   7e-180   
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             534   7e-180   
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         534   8e-180   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             534   1e-179   
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    533   1e-179   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    533   2e-179   
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             533   2e-179   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             533   2e-179   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         533   2e-179   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             533   2e-179   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             533   2e-179   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             533   2e-179   
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    533   2e-179   
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             533   3e-179   
gb|KHG21048.1|  L-ascorbate oxidase                                     532   3e-179   
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    533   3e-179   
dbj|BAK07214.1|  predicted protein                                      533   3e-179   
dbj|BAC83966.1|  putative PS60                                          533   3e-179   
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog             532   3e-179   
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             533   4e-179   
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        533   4e-179   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    532   4e-179   
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog             532   5e-179   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    532   5e-179   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             532   5e-179   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             532   5e-179   
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             532   6e-179   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             531   6e-179   
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             531   6e-179   
tpg|DAA50670.1|  TPA: hypothetical protein ZEAMMB73_266087              533   6e-179   
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             532   7e-179   
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    532   7e-179   
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             532   7e-179   
emb|CDY54804.1|  BnaA06g40970D                                          535   7e-179   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             531   8e-179   
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             531   8e-179   
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             531   8e-179   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             531   1e-178   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             531   1e-178   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             530   1e-178   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             531   1e-178   
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog             531   1e-178   
gb|ACN50176.1|  pectinesterase                                          530   2e-178   
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog             530   2e-178   
emb|CDX82540.1|  BnaA03g32810D                                          531   2e-178   
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog             530   2e-178   
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog             531   2e-178   
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg             530   2e-178   
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             530   2e-178   
emb|CDM84722.1|  unnamed protein product                                531   2e-178   
dbj|BAL41449.1|  SKU5 similar 1                                         531   2e-178   
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    531   2e-178   
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    530   2e-178   
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             530   3e-178   
gb|ABI52585.1|  pollen-specific protein                                 531   3e-178   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   530   3e-178   
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             530   3e-178   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             530   3e-178   
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             530   4e-178   
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             530   4e-178   
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             530   5e-178   
emb|CDY68812.1|  BnaAnng28440D                                          526   5e-178   
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             529   6e-178   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             529   6e-178   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             529   6e-178   
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             529   7e-178   
emb|CAB37498.1|  putative pectinesterase                                529   7e-178   
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                529   8e-178   
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             528   9e-178   
emb|CDX79120.1|  BnaA01g11870D                                          528   1e-177   
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             532   1e-177   
emb|CAN83942.1|  hypothetical protein VITISV_013559                     528   1e-177   
emb|CDY43994.1|  BnaA05g25890D                                          529   1e-177   
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             528   1e-177   
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             528   2e-177   
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             528   2e-177   
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    528   2e-177   
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             528   2e-177   
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             528   2e-177   
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             528   2e-177   
ref|XP_002969915.1|  hypothetical protein SELMODRAFT_410532             527   2e-177   
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    528   3e-177   
emb|CDY23597.1|  BnaC05g39970D                                          528   3e-177   
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    527   3e-177   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             527   4e-177   
emb|CDX75708.1|  BnaC03g37910D                                          527   4e-177   
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                    527   4e-177   
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             527   5e-177   
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             527   5e-177   
emb|CDY64276.1|  BnaCnng43630D                                          529   5e-177   
emb|CDY56013.1|  BnaA08g29220D                                          527   6e-177   
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         527   6e-177   
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             527   6e-177   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             527   6e-177   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             527   7e-177   
ref|XP_002981392.1|  hypothetical protein SELMODRAFT_178788             526   7e-177   
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             526   8e-177   
ref|NP_193932.1|  protein SKU5 similar 4                                526   8e-177   
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             526   8e-177   
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             526   8e-177   
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             526   8e-177   
emb|CDX82897.1|  BnaC01g13470D                                          526   1e-176   
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             526   1e-176   
emb|CDY24188.1|  BnaC01g37680D                                          526   1e-176   
emb|CAN69061.1|  hypothetical protein VITISV_032605                     526   1e-176   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             526   1e-176   
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             526   1e-176   
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    525   2e-176   
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             526   2e-176   
ref|NP_001053555.1|  Os04g0561900                                       526   2e-176   
emb|CAB08077.1|  pectinesterase                                         524   2e-176   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             527   2e-176   
emb|CAH67167.1|  H0211B05.4                                             525   2e-176   
emb|CDY10549.1|  BnaC03g70650D                                          525   3e-176   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             525   3e-176   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             525   3e-176   
ref|XP_010555198.1|  PREDICTED: L-ascorbate oxidase homolog             525   3e-176   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             525   4e-176   



>ref|XP_009594575.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=536

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/527 (70%), Positives = 434/527 (82%), Gaps = 0/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
             FL FLLG +A    S+V AEDPY++  W V YG I+PLGVKQ+GILINGQFPGP +NV+T
Sbjct  6     FLHFLLGTVACLIASVVRAEDPYKYETWTVTYGQIAPLGVKQKGILINGQFPGPTLNVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+NV++ VINKLD+P+L TWNG+KQRKSSW DGVLGTNCPI PN+ WTY+MQMKDQIGT+
Sbjct  66    NDNVLITVINKLDDPLLITWNGVKQRKSSWQDGVLGTNCPIPPNSQWTYKMQMKDQIGTF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRAAGG+G LNI+ RSVIP+PYP+P   +TL+VSDWW TD+K L+++LD G 
Sbjct  126   TYFPSTLMHRAAGGFGGLNILARSVIPVPYPKPFEQFTLLVSDWWKTDNKVLKQRLDQGN  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
              FP P  LLINGR NS  FTG +G TY+FRVSNVG+TTSIN RIQ H LKLVEVEG+HTM
Sbjct  186   SFPFPDALLINGRPNSFKFTGMKGYTYLFRVSNVGLTTSINIRIQGHTLKLVEVEGAHTM  245

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+SLDIHVGQS  FLVTL+A+ KDYYIVAS+RF KP +TA+AILHY GS T     L
Sbjct  246   QEVYESLDIHVGQSMAFLVTLHANPKDYYIVASTRFTKPILTATAILHYQGSNTPASKPL  305

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QARTIRWNLTANAARPNPQG++HYGT+P+ RTLVL N+   I+G  R
Sbjct  306   PIGPTYHVHWSMKQARTIRWNLTANAARPNPQGAFHYGTVPVTRTLVLANSAGKINGKRR  365

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+NKVSY+NP TPLK+AD+ NIPGVF LN IKD PP GP V G SVF   LHD+ EI+F
Sbjct  366   YAINKVSYINPDTPLKIADFYNIPGVFQLNKIKDNPPPGPIVLGTSVFNFSLHDFTEIVF  425

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNEKT+QSYH DG DFWAVGYG G W+ T+R+KYNLVDAT+R T+QVYPNSW+ ILVSL
Sbjct  426   QNNEKTIQSYHFDGYDFWAVGYGPGQWNPTMRRKYNLVDATSRCTIQVYPNSWSTILVSL  485

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS++WPR YLGQ+ Y RVWN EHSLYTE D+PP+ +LCG
Sbjct  486   DNKGMWNLRSAIWPRRYLGQETYFRVWNTEHSLYTEYDIPPNAILCG  532



>emb|CDP02461.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/530 (72%), Positives = 434/530 (82%), Gaps = 3/530 (1%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L   LG+ A+   S V+AEDPYRF+ WV+ YG I+PLGVKQRGILINGQFPGP I+ IT
Sbjct  6     LLHICLGLSAWLSTSYVKAEDPYRFFTWVITYGQIAPLGVKQRGILINGQFPGPTISCIT  65

Query  1615  nenvivnviNKLDEPILFTW--NGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIG  1442
             N+N+IVNVINKLDEP L TW  +GIKQRK SW DGVLGTNCPI PN+NWTY+MQMKDQIG
Sbjct  66    NDNIIVNVINKLDEPFLITWLVHGIKQRKGSWEDGVLGTNCPIPPNSNWTYKMQMKDQIG  125

Query  1441  TYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDT  1262
             TY+Y+ ST +HRAAGG+G  NI+ RS+IP+PYP+P   +TL+VSDWWN D+K LQK LD 
Sbjct  126   TYNYYPSTLMHRAAGGFGGFNIVARSIIPIPYPKPYDEFTLLVSDWWNKDNKVLQKILDD  185

Query  1261  GKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             G PFP P GLLING   S  FTG +G TY+ RVSN+ + +SINFRIQ H L LVEVEGSH
Sbjct  186   GTPFPPPDGLLINGSPKSTKFTGIKGQTYLIRVSNLCLVSSINFRIQGHILVLVEVEGSH  245

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADV-KDYYIVASSRFVKPYMTASAILHYDGSVTKVP  905
             TMQD Y+SLD+H GQS+ FLVTL A + +DYYIVASSRF KP +TA+AILHYDGS T+  
Sbjct  246   TMQDSYESLDVHPGQSSTFLVTLRASILQDYYIVASSRFTKPLLTATAILHYDGSTTQPA  305

Query  904   GKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISG  725
             G LP  PAGQ HWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRT+VL N+   ISG
Sbjct  306   GPLPSGPAGQLHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTIVLANSAPQISG  365

Query  724   ITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
               RYALN VSYVNP+TPLKLAD+ NI GVF LNAIKD P + PA  GVSVFG+ LHDY+E
Sbjct  366   KKRYALNGVSYVNPSTPLKLADYFNISGVFVLNAIKDFPTSAPAAQGVSVFGITLHDYME  425

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             ++FQNNE  LQSYHL G DFWAVGYGGG W+ T+RK YNLVDATTR TVQVYPN WTAIL
Sbjct  426   VVFQNNENNLQSYHLAGFDFWAVGYGGGQWNITMRKLYNLVDATTRNTVQVYPNGWTAIL  485

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +S+DNKGMWNLRS +WPR YLGQ+ Y+RVWN+E SLYTE D+P + LLCG
Sbjct  486   ISMDNKGMWNLRSQIWPRRYLGQEAYMRVWNSERSLYTEYDIPDNALLCG  535



>ref|XP_009765874.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=536

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/527 (69%), Positives = 429/527 (81%), Gaps = 0/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
             FL FL G L     S+V AEDPY +  WVV YG I+PLGVKQRGILINGQFPGP +NV+T
Sbjct  6     FLHFLFGTLVCLIASVVRAEDPYVYKTWVVTYGQIAPLGVKQRGILINGQFPGPTLNVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+NV++ VINKLD+P+L TWNG+KQRKSSW DGVLGTNCPI PN+ WTY+MQMKDQIGT+
Sbjct  66    NDNVLITVINKLDDPLLITWNGVKQRKSSWQDGVLGTNCPIPPNSQWTYKMQMKDQIGTF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRAAGG+G LNI+ RSVIP+PYP+P   +TL+VSDWW TD+K L+++LD G 
Sbjct  126   TYFPSTLMHRAAGGFGGLNILARSVIPVPYPKPFDQFTLLVSDWWKTDNKVLKQRLDQGN  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
              FP P  LLINGR NS  FTG +G TY+ RVSNVG+TTSIN RIQ H L+LVEVEG+HTM
Sbjct  186   SFPFPDALLINGRANSFKFTGMKGYTYLLRVSNVGLTTSINIRIQGHTLRLVEVEGAHTM  245

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+SLDIHVGQS  FLVTL+A+ KDYYIVAS+RF K  +TA+AILHY GS T     L
Sbjct  246   QEVYESLDIHVGQSMAFLVTLHANPKDYYIVASTRFTKQILTATAILHYQGSNTPASKPL  305

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QARTIRWNLTANAARPNPQG++HYGT+P+ RTLVL N+   I+   R
Sbjct  306   PIGPTYHVHWSMKQARTIRWNLTANAARPNPQGAFHYGTVPVTRTLVLANSAGKINAKRR  365

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+NK+SY+NP TPLK+AD+ NIPGVF LN IKD PP GP V G SVF   LHD+ EI+F
Sbjct  366   YAMNKISYINPDTPLKIADFYNIPGVFQLNKIKDNPPPGPIVLGTSVFNFSLHDFTEIVF  425

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNEKT+QSYHLDG DFWAVGYG G W+ T+R+KYNLVDAT+R T+QVYP SW+ ILVSL
Sbjct  426   QNNEKTIQSYHLDGYDFWAVGYGPGQWNPTMRRKYNLVDATSRCTIQVYPKSWSTILVSL  485

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS++WPR YLGQ+ Y RVWN EHSLYTE D+PP+ +LCG
Sbjct  486   DNKGMWNLRSAIWPRRYLGQETYFRVWNTEHSLYTEYDIPPNAILCG  532



>gb|EYU44358.1| hypothetical protein MIMGU_mgv1a004238mg [Erythranthe guttata]
Length=538

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/536 (71%), Positives = 440/536 (82%), Gaps = 4/536 (1%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFF-CISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             MRQ  + FL F LG LA    +S V+AEDPY F NWVV+YG ISPL +KQRGILINGQFP
Sbjct  1     MRQ--AIFLHFFLGFLACLNTVSYVQAEDPYVFLNWVVEYGDISPLDIKQRGILINGQFP  58

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP INVITN+NVIVNV NKLDEP+LFTWNGIKQRK++W DGVLGTNCPI PN+NWTYRMQ
Sbjct  59    GPTINVITNDNVIVNVENKLDEPLLFTWNGIKQRKAAWQDGVLGTNCPIPPNSNWTYRMQ  118

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
             MKDQIGTY+YF ST LHRAAGG+G LNI+ RSVI +PYP+P    T++VSDWW  DHK L
Sbjct  119   MKDQIGTYNYFPSTLLHRAAGGFGGLNILARSVISVPYPKPYEELTVLVSDWWKKDHKDL  178

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             QK LD+G PFP P G+LING+ +S +F    G TY+FRVSNVG+TTSINFRIQNHKL LV
Sbjct  179   QKILDSGSPFPLPDGILINGKPHSTSFPVVPGQTYLFRVSNVGLTTSINFRIQNHKLLLV  238

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEGSHTMQ+ YDSLDIHVGQS+ FLVTL +D KDY+IVASSRF+KP +TASAIL+Y GS
Sbjct  239   EVEGSHTMQEVYDSLDIHVGQSSSFLVTLYSDPKDYFIVASSRFIKPVLTASAILNYQGS  298

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
                  G LP+ P  Q+H SM+QAR+IRWNLTANAARPNPQGSYHYGTI + RT+VLENT 
Sbjct  299   KNAASGPLPNAPIFQFHGSMKQARSIRWNLTANAARPNPQGSYHYGTIKVARTIVLENTA  358

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I G  RYA+N VSYVNP TPLKLAD+ NIPGV+TLN  KDTPP GPAV G  V G  L
Sbjct  359   AVIDGKLRYAINNVSYVNPDTPLKLADYFNIPGVYTLNTTKDTPPVGPAVLGTGVVGTTL  418

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKK-YNLVDATTRYTVQVYPN  383
             HD+VEI+FQN E +LQS+HLDG DFW+VG+G G W+S LR++ YNL DATTR+T+QVYP 
Sbjct  419   HDFVEIVFQNRESSLQSWHLDGNDFWSVGFGSGKWNSALRRRFYNLNDATTRHTIQVYPF  478

Query  382   SWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             SW+AILVSLDNKG+WNLRS+ WPR YLGQ++Y+RVWN+E S +TE  +P + LLCG
Sbjct  479   SWSAILVSLDNKGIWNLRSANWPRRYLGQELYVRVWNDEPSPFTEYGIPDNVLLCG  534



>ref|XP_011099223.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=535

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/527 (69%), Positives = 438/527 (83%), Gaps = 3/527 (1%)
 Frame = -2

Query  1786  FLLGVLAFFC-ISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
              +LG+LA    +S V AEDPY + NWVV+YG ISPL VKQRGILINGQFPGP +NV+TN+
Sbjct  5     IVLGILACLSLVSYVRAEDPYVYLNWVVEYGEISPLDVKQRGILINGQFPGPTVNVVTND  64

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             NVIVN+ NKLDEP+L TWNG+KQRK+SW DGVLGTNCPI PN+NWTY+MQMKDQIGT++Y
Sbjct  65    NVIVNLENKLDEPLLLTWNGVKQRKTSWQDGVLGTNCPIPPNSNWTYKMQMKDQIGTFTY  124

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F ST +HRAAGG+G  NI+ RSVIP+PYP+P   +T++VSDWW  DHK+LQ+ LD+G PF
Sbjct  125   FPSTLMHRAAGGFGGFNILARSVIPVPYPKPYEEFTVLVSDWWKKDHKELQQILDSGNPF  184

Query  1249  PSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
             P P G+LING+    +F    G TY+FRVSNVGMTTSINFRIQ H L+LVE EGSHTMQ+
Sbjct  185   PLPDGILINGKPRLTSFNVVPGQTYLFRVSNVGMTTSINFRIQGHTLRLVECEGSHTMQE  244

Query  1069  QYDSLDIHVGQSAGFLVTLNA-DVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
              Y+SLDIHVGQS+ FLVT+++ + KDY+IVAS+RF KP +TA+A+LHY GS +   G LP
Sbjct  245   MYESLDIHVGQSSSFLVTVHSHNPKDYFIVASTRFTKPILTATAVLHYQGSNSPASGPLP  304

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P    HWSM+QART+RWNLTANAARPNPQGS+HYGTI +VRT+VLEN+   I+G  RY
Sbjct  305   VAPTYHVHWSMKQARTVRWNLTANAARPNPQGSFHYGTIQVVRTIVLENSAAKINGKLRY  364

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
             A+NKVSY+NP TPLKLAD+ NIP VFTLN+IKD+PPAGPA  G SV G  LHD+VEI+FQ
Sbjct  365   AVNKVSYINPDTPLKLADYFNIPDVFTLNSIKDSPPAGPAALGTSVVGTTLHDFVEIVFQ  424

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKK-YNLVDATTRYTVQVYPNSWTAILVSL  356
             N+E T+QS+HLDG DFW VG+G G W++TLR++ YN  DA TRYTVQVYP SW+AILVSL
Sbjct  425   NSESTIQSWHLDGYDFWTVGFGSGKWNTTLRRRFYNYNDAPTRYTVQVYPYSWSAILVSL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS++WPR YLGQ++Y+RVWN+E SL+TE D+PP+ LLCG
Sbjct  485   DNKGMWNLRSAIWPRRYLGQELYVRVWNDERSLFTEYDIPPNALLCG  531



>ref|XP_007203632.1| hypothetical protein PRUPE_ppa003976mg [Prunus persica]
 gb|EMJ04831.1| hypothetical protein PRUPE_ppa003976mg [Prunus persica]
Length=537

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/533 (66%), Positives = 416/533 (78%), Gaps = 5/533 (1%)
 Frame = -2

Query  1804  PSGFLRFLLGVL---AFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGP  1634
             P+ FL FL+G+L   + FCI  + AEDPY +Y W V YG +SPLG+ Q+GILINGQFPGP
Sbjct  3     PTIFLHFLVGILVSLSAFCI--INAEDPYLYYTWTVTYGLVSPLGIPQKGILINGQFPGP  60

Query  1633  einvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMK  1454
              I  +TN+N+IVNVINKLDEP L TWNGIKQRK++W DGVLGTNCPI PNTNWTY+ Q K
Sbjct  61    TIEAVTNDNIIVNVINKLDEPFLITWNGIKQRKTTWQDGVLGTNCPIPPNTNWTYKFQAK  120

Query  1453  DQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQK  1274
             DQIGT++YF ST+LHRA GG+G  NI  RSVI +PYP P+  +TL+VSDW+   HK LQ+
Sbjct  121   DQIGTFNYFPSTKLHRAVGGFGGFNIAHRSVIAVPYPIPAGEFTLLVSDWYKNSHKVLQQ  180

Query  1273  QLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEV  1094
              LD+GK  P P GLLING   S  FTG++G TY FRVSNVG+ TSINFRIQ H + LVEV
Sbjct  181   TLDSGKTLPLPDGLLINGHHKSAIFTGEKGKTYKFRVSNVGIATSINFRIQGHTMTLVEV  240

Query  1093  EGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVT  914
             EG+HT+Q+ Y+SLD+H GQS   LVTL+  +KDY+I+ASSRF KP +  +  L Y GS T
Sbjct  241   EGAHTLQEVYESLDVHPGQSVAVLVTLHGSLKDYFIIASSRFTKPILATTGYLRYAGSNT  300

Query  913   KVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKEN  734
                G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPIVR LVL NT   
Sbjct  301   PASGPLPIGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPIVRRLVLANTAAK  360

Query  733   ISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHD  554
             I G  RYA+NK+SYV+P TPLKLADWLNIPGVF L+ IKDTP  GPAV G SV G  LHD
Sbjct  361   IGGKLRYAVNKISYVDPATPLKLADWLNIPGVFNLDTIKDTPTPGPAVFGASVVGTTLHD  420

Query  553   YVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWT  374
             +VEI+FQN E TLQS+HLDG  F+ VGYG G W   +R++YNLVD  +R+TVQVYP  W+
Sbjct  421   FVEIVFQNTEPTLQSWHLDGNSFYVVGYGSGNWTPDMRRRYNLVDGVSRHTVQVYPTGWS  480

Query  373   AILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             A+LVSLDNKGMWNLRS++W R YLGQQ+Y+RVWNNEHSL+TENDMP + LLCG
Sbjct  481   AVLVSLDNKGMWNLRSAIWSRRYLGQQLYVRVWNNEHSLFTENDMPLNALLCG  533



>ref|XP_004301852.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=537

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/531 (65%), Positives = 413/531 (78%), Gaps = 1/531 (0%)
 Frame = -2

Query  1804  PSGFLRFLLGVL-AFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPei  1628
             P+ FLRF LG L     + ++ AEDPYR++ W V YGTISPLGV Q+ ILINGQFPGP I
Sbjct  3     PTSFLRFFLGTLVGLSALCIINAEDPYRYFTWTVTYGTISPLGVPQQAILINGQFPGPTI  62

Query  1627  nvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQ  1448
               +TN+N++V+VINKLDEP L TWNGIKQRKS W DGVLGTNCPI PNT+W Y+ Q KDQ
Sbjct  63    EAVTNDNIVVDVINKLDEPFLITWNGIKQRKSVWQDGVLGTNCPIPPNTSWRYKFQTKDQ  122

Query  1447  IGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQL  1268
             IGT+SYF ST+ HR AGG+G  N+  RSVI +PYP P+  +T++VSDW+ T HK LQ++L
Sbjct  123   IGTFSYFPSTKFHRVAGGFGGFNVAHRSVIAVPYPIPTEEFTVLVSDWYKTSHKALQQKL  182

Query  1267  DTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEG  1088
             D+G P P P  LLING   S TF+G++G TY FR+SNVG+ TSINFRIQ H + LVEVEG
Sbjct  183   DSGIPLPLPDALLINGLHGSATFSGQRGKTYKFRISNVGIATSINFRIQGHTMTLVEVEG  242

Query  1087  SHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKV  908
             +HT+Q+ Y+SLD+H GQS G LVTL+  VKDY+IVASSRF KP +T + IL Y GS  K 
Sbjct  243   AHTLQEVYESLDVHPGQSVGVLVTLHGSVKDYFIVASSRFTKPILTTTGILRYAGSSIKA  302

Query  907   PGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENIS  728
              G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPIVRTLVL NT   I 
Sbjct  303   AGPLPVGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPIVRTLVLANTAAKIG  362

Query  727   GITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYV  548
             G  RYA+NK+SYV+P TPLKLADW NIPGVF LN+IKDTP  GPA  GVSV G  LHD+V
Sbjct  363   GKLRYAVNKISYVDPVTPLKLADWFNIPGVFNLNSIKDTPTPGPASLGVSVIGTALHDFV  422

Query  547   EIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAI  368
             E++FQN E TLQS+HLDG  F+ VGYG G W   +R++YNL DA  R+TVQVYP  W+A+
Sbjct  423   EVVFQNTEPTLQSWHLDGSSFYIVGYGSGNWTPDMRRRYNLADAVPRHTVQVYPYGWSAM  482

Query  367   LVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LVSLDNKGMWNLRS++W R YLGQQ+Y+RVWN+E S +TEND+P + L CG
Sbjct  483   LVSLDNKGMWNLRSAIWARRYLGQQLYIRVWNDEKSFFTENDIPQNALFCG  533



>ref|XP_008241558.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=537

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/533 (66%), Positives = 416/533 (78%), Gaps = 5/533 (1%)
 Frame = -2

Query  1804  PSGFLRFLLGVL---AFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGP  1634
             P+ FL FL+G+L   + FCI  + AEDPY +Y W V YG +SPLG+ Q+GILINGQFPGP
Sbjct  3     PTIFLHFLVGILVSLSAFCI--INAEDPYLYYTWTVTYGLVSPLGIPQKGILINGQFPGP  60

Query  1633  einvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMK  1454
              I  +TN+N+IVNVINKLDEP L TWNGIKQRK++W DGVLGTNCPI PNTNWTY+ Q K
Sbjct  61    TIEAVTNDNIIVNVINKLDEPFLITWNGIKQRKTTWQDGVLGTNCPIPPNTNWTYKFQAK  120

Query  1453  DQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQK  1274
             DQIGT++YF ST+LHRA GG+G  NI +RSVI +PYP P+  +TL+VSDW+   HK LQ+
Sbjct  121   DQIGTFNYFPSTKLHRAVGGFGGFNIAQRSVIAVPYPIPAGEFTLLVSDWYKNSHKVLQQ  180

Query  1273  QLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEV  1094
              LD+GK  P P GLLING   S  FTG++G TY FRVSNVG+ TSINFRIQ H + LVEV
Sbjct  181   TLDSGKTLPLPDGLLINGHHKSAIFTGEKGKTYKFRVSNVGIATSINFRIQGHTMTLVEV  240

Query  1093  EGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVT  914
             EG+HT+Q+ Y+SLD+H GQS   LVTL+  +KDY+I+ASSRF KP +  +  L Y GS T
Sbjct  241   EGAHTLQEVYESLDVHPGQSVAVLVTLHGSLKDYFIIASSRFTKPILATTGYLRYAGSNT  300

Query  913   KVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKEN  734
                G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPIVR LVL NT   
Sbjct  301   PASGPLPIGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPIVRRLVLANTAAK  360

Query  733   ISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHD  554
             I G  RYA+NK+SYV+P TPLKLADWLNIPGVF L  IKDTP  GPAV G SV G  LHD
Sbjct  361   IGGKLRYAVNKISYVDPETPLKLADWLNIPGVFNLGTIKDTPTPGPAVFGASVVGTTLHD  420

Query  553   YVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWT  374
             +VEI+FQN E TLQS+HLDG  F+ VGYG G W   +R++YNLVDA +R+TVQVYP  W+
Sbjct  421   FVEIVFQNTEPTLQSWHLDGYSFYVVGYGSGNWTPDMRRRYNLVDAVSRHTVQVYPTGWS  480

Query  373   AILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             A+LVSLDNKGMWNLRS++W R YLGQQ+Y+RVWNNEHSL+TE DMP + LLCG
Sbjct  481   AVLVSLDNKGMWNLRSAIWSRRYLGQQLYVRVWNNEHSLFTETDMPLNALLCG  533



>ref|XP_010263764.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
 ref|XP_010263765.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=539

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/528 (67%), Positives = 418/528 (79%), Gaps = 2/528 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISM-VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
             FL   +G LA   + + VEAEDPY+++ W V YGTISPLGV Q+GILINGQFPGP I+ +
Sbjct  8     FLNLFVGALACLRVFLLVEAEDPYKYFTWTVIYGTISPLGVPQQGILINGQFPGPRIDCV  67

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N++VNVINKLD+P L TWNG+KQRK+SW DGVLGTNCPI PN+N+TY  Q KDQIGT
Sbjct  68    TNDNIVVNVINKLDQPFLITWNGVKQRKNSWQDGVLGTNCPIPPNSNYTYHFQTKDQIGT  127

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             ++YF ST + RAAGG+G  NI  R  I +PYP P+  +TL+V DW+   HK LQ+ LD+G
Sbjct  128   FTYFPSTLMQRAAGGFGGFNIYARPGISIPYPIPTDEFTLLVGDWYKAGHKALQQTLDSG  187

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             K  P P GLLING  +S +FTG QG +YMFRVSNVG++TSINFRIQ H+LKLVEVEGSHT
Sbjct  188   KSLPFPSGLLINGHTSS-SFTGDQGKSYMFRVSNVGLSTSINFRIQGHRLKLVEVEGSHT  246

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +QD Y+SLD+HVGQS   LVTLN   KDYYIVAS+RF KP +T +AILHY  S T   G 
Sbjct  247   VQDFYESLDVHVGQSVAVLVTLNQPPKDYYIVASARFTKPILTTTAILHYSNSHTPASGP  306

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             LP  P    HWSM+QARTIRWNLTANAARPNPQGS+HYGTIP VRTLVL N+K  I+G  
Sbjct  307   LPIAPTYHIHWSMKQARTIRWNLTANAARPNPQGSFHYGTIPTVRTLVLANSKSQINGKL  366

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N+VSYVNPTTPLKLAD+ NIPGVF LN I+D P  GP   G SV G  LHD+VEII
Sbjct  367   RYAVNRVSYVNPTTPLKLADYFNIPGVFNLNTIQDKPTPGPVFLGTSVVGTALHDFVEII  426

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE ++QS+HLDG DFW VGYG G W    RK+YNL DATTR+TVQVYP SW+AILVS
Sbjct  427   FQNNETSIQSWHLDGYDFWVVGYGNGQWIPVNRKRYNLYDATTRHTVQVYPKSWSAILVS  486

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDNKGMWNLRS++W R YLGQ++Y+RVWNNE SLYTE D+PP+ L CG
Sbjct  487   LDNKGMWNLRSAIWDRRYLGQELYVRVWNNERSLYTEYDIPPNALRCG  534



>emb|CBI18561.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/533 (65%), Positives = 413/533 (77%), Gaps = 0/533 (0%)
 Frame = -2

Query  1813  RQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGP  1634
             R  P+ FL F  G LA   +  V AEDP R+Y W V YGTISPLG  Q+GILINGQFPGP
Sbjct  64    RMRPAIFLHFFFGTLACLSLLCVIAEDPSRYYTWTVTYGTISPLGSPQQGILINGQFPGP  123

Query  1633  einvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMK  1454
              I+ +TN+N+IV VINKLD+P L TWNGIKQRK+ W DG LGTNCPI PN+NWTY+ Q K
Sbjct  124   TIDCVTNDNIIVTVINKLDKPFLITWNGIKQRKTPWQDGTLGTNCPIPPNSNWTYKFQTK  183

Query  1453  DQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQK  1274
             DQIGTYSYF ST +HRAAGG+G  NI  RSVIP+PYP P   +TL+V DW+ + HK LQ 
Sbjct  184   DQIGTYSYFPSTLMHRAAGGFGGFNIASRSVIPIPYPIPVEEFTLLVGDWYKSSHKALQA  243

Query  1273  QLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEV  1094
             +LD+G P P P  LLING  +  TFTG++G TY FRVSNVG++TSINFRIQ H + LVEV
Sbjct  244   KLDSGIPLPLPNALLINGLPSGSTFTGEKGKTYKFRVSNVGISTSINFRIQAHTMTLVEV  303

Query  1093  EGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVT  914
             EG+HT+Q  YDSLD+HVGQS   LVTL+A VKDY+IVAS+RF KP +TA++ L Y GS T
Sbjct  304   EGAHTVQSVYDSLDVHVGQSVAVLVTLHATVKDYFIVASTRFTKPVLTATSFLKYAGSST  363

Query  913   KVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKEN  734
                  LP  P  Q HWSM QARTIR NLTANAARPNPQGS+HYGTIPI RTL+L N+   
Sbjct  364   PASEPLPIGPTYQIHWSMMQARTIRRNLTANAARPNPQGSFHYGTIPIQRTLILANSATK  423

Query  733   ISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHD  554
             I+G  RYA+N +SYVNP TPLKLAD+ NI GVF LN+IKDTPP+GPAV G SV G  LHD
Sbjct  424   INGTLRYAVNGISYVNPATPLKLADYYNISGVFKLNSIKDTPPSGPAVFGTSVIGTTLHD  483

Query  553   YVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWT  374
              +EI+FQNNE TLQS+HLDG  FW VG+G G W   +R++YNL DA +R+TVQVYPNSW+
Sbjct  484   LIEIVFQNNETTLQSWHLDGYTFWTVGFGSGQWTPDMRRRYNLADANSRHTVQVYPNSWS  543

Query  373   AILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             A+L SLDNKGMWNLRS++W R YLGQQ+Y+RVW+NE SL+TE D+P + L CG
Sbjct  544   AVLASLDNKGMWNLRSAIWSRQYLGQQLYIRVWSNETSLFTEYDVPDNALYCG  596



>ref|XP_002268020.2| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
Length=537

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/530 (66%), Positives = 412/530 (78%), Gaps = 0/530 (0%)
 Frame = -2

Query  1804  PSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPein  1625
             P+ FL F  G LA   +  V AEDP R+Y W V YGTISPLG  Q+GILINGQFPGP I+
Sbjct  3     PAIFLHFFFGTLACLSLLCVIAEDPSRYYTWTVTYGTISPLGSPQQGILINGQFPGPTID  62

Query  1624  vitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQI  1445
              +TN+N+IV VINKLD+P L TWNGIKQRK+ W DG LGTNCPI PN+NWTY+ Q KDQI
Sbjct  63    CVTNDNIIVTVINKLDKPFLITWNGIKQRKTPWQDGTLGTNCPIPPNSNWTYKFQTKDQI  122

Query  1444  GTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLD  1265
             GTYSYF ST +HRAAGG+G  NI  RSVIP+PYP P   +TL+V DW+ + HK LQ +LD
Sbjct  123   GTYSYFPSTLMHRAAGGFGGFNIASRSVIPIPYPIPVEEFTLLVGDWYKSSHKALQAKLD  182

Query  1264  TGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGS  1085
             +G P P P  LLING  +  TFTG++G TY FRVSNVG++TSINFRIQ H + LVEVEG+
Sbjct  183   SGIPLPLPNALLINGLPSGSTFTGEKGKTYKFRVSNVGISTSINFRIQAHTMTLVEVEGA  242

Query  1084  HTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVP  905
             HT+Q  YDSLD+HVGQS   LVTL+A VKDY+IVAS+RF KP +TA++ L Y GS T   
Sbjct  243   HTVQSVYDSLDVHVGQSVAVLVTLHATVKDYFIVASTRFTKPVLTATSFLKYAGSSTPAS  302

Query  904   GKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISG  725
               LP  P  Q HWSM QARTIR NLTANAARPNPQGS+HYGTIPI RTL+L N+   I+G
Sbjct  303   EPLPIGPTYQIHWSMMQARTIRRNLTANAARPNPQGSFHYGTIPIQRTLILANSATKING  362

Query  724   ITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
               RYA+N +SYVNP TPLKLAD+ NI GVF LN+IKDTPP+GPAV G SV G  LHD +E
Sbjct  363   TLRYAVNGISYVNPATPLKLADYYNISGVFKLNSIKDTPPSGPAVFGTSVIGTTLHDLIE  422

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             I+FQNNE TLQS+HLDG  FW VG+G G W   +R++YNL DA +R+TVQVYPNSW+A+L
Sbjct  423   IVFQNNETTLQSWHLDGYTFWTVGFGSGQWTPDMRRRYNLADANSRHTVQVYPNSWSAVL  482

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              SLDNKGMWNLRS++W R YLGQQ+Y+RVW+NE SL+TE D+P + L CG
Sbjct  483   ASLDNKGMWNLRSAIWSRQYLGQQLYIRVWSNETSLFTEYDVPDNALYCG  532



>ref|XP_009348089.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=539

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/534 (66%), Positives = 414/534 (78%), Gaps = 6/534 (1%)
 Frame = -2

Query  1804  PSGFLRFLLGV---LAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGP  1634
             P+ F+ F +G+   L+ FC   + AEDPY +Y W V YG ISPLGV Q+GILINGQFPGP
Sbjct  3     PTIFVHFFVGISVCLSSFC--SINAEDPYLYYTWTVTYGIISPLGVPQKGILINGQFPGP  60

Query  1633  einvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMK  1454
              I  +TN+NVIVNVINKLDEP L TWNGIKQRK++W DGVLGT CPI PNTNWTY+ Q K
Sbjct  61    NIEAVTNDNVIVNVINKLDEPFLITWNGIKQRKTTWQDGVLGTQCPIPPNTNWTYKFQTK  120

Query  1453  DQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQK  1274
             DQIGT+SYF ST+LHRAAGG+G  NI +RSVI +PYP P+   TL+V DW+ T HK+LQ+
Sbjct  121   DQIGTFSYFPSTKLHRAAGGFGGFNIAQRSVIAVPYPIPAGECTLLVGDWYKTGHKELQQ  180

Query  1273  QLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEV  1094
              LD+GK  P P GLLING L +  FTG++G TY FRVSNVG+ TSINFRIQ+H + LVEV
Sbjct  181   TLDSGKNLPLPDGLLINGLLKNAVFTGEKGKTYKFRVSNVGIATSINFRIQSHTMTLVEV  240

Query  1093  EGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVT  914
             EG+HT+Q+ Y+SLDIH GQS   LVT +  V DY+IVAS+RF KP +T + IL Y GS T
Sbjct  241   EGAHTLQEVYESLDIHPGQSVAVLVTPHGSVGDYFIVASTRFTKPILTTTGILRYAGSNT  300

Query  913   KVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKEN  734
                  LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIP+VR L+L NT   
Sbjct  301   PASKPLPIGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPVVRRLLLANTATK  360

Query  733   ISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHD  554
             + G  RYA+NKVSYV+P TPLKLADWLNIPGVF  N IKDTP  GPAV+G SV G  LHD
Sbjct  361   LDGKLRYAVNKVSYVDPETPLKLADWLNIPGVFNFNTIKDTPSPGPAVYGASVIGTALHD  420

Query  553   YVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGV-WDSTLRKKYNLVDATTRYTVQVYPNSW  377
             ++EI+FQN E TLQS+HLDG   + V YG    W S +R++YNLVDA  R+TVQVYP  W
Sbjct  421   FMEIVFQNTEATLQSWHLDGYSVYVVAYGHAANWTSAIRRRYNLVDAVPRHTVQVYPLGW  480

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             TA+LVSLDNKGMWNLRS++W + YLGQQ+Y+RVWNNEHSL+TENDMP +TL CG
Sbjct  481   TAVLVSLDNKGMWNLRSAIWSKRYLGQQLYIRVWNNEHSLFTENDMPLNTLHCG  534



>ref|XP_009347247.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=539

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/534 (65%), Positives = 414/534 (78%), Gaps = 6/534 (1%)
 Frame = -2

Query  1804  PSGFLRFLLGV---LAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGP  1634
             P+ F+ F +G+   L+ FC   + AEDPY +Y W V YGTISPLGV Q+GILINGQFPGP
Sbjct  3     PTIFVHFSVGISVCLSSFC--SINAEDPYLYYTWTVTYGTISPLGVPQKGILINGQFPGP  60

Query  1633  einvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMK  1454
              I  +TN+ VIVNVINKLDEP L TWNGIKQRK++W DGVLGT CPI PNTNWTY+ Q K
Sbjct  61    NIEAVTNDIVIVNVINKLDEPFLITWNGIKQRKTTWQDGVLGTQCPIPPNTNWTYKFQTK  120

Query  1453  DQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQK  1274
             DQIGT+SYF ST+LHRAAGG+G  N+ +RSVI +PYP P+   TL+V DW+ T HK+LQ+
Sbjct  121   DQIGTFSYFPSTKLHRAAGGFGGFNVAQRSVISVPYPIPAGECTLLVGDWYKTGHKELQQ  180

Query  1273  QLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEV  1094
              LD+GK  P P GLLING L +  FTG++G TY FRVSNVG+ TSINFRIQ+H + LVEV
Sbjct  181   TLDSGKNLPLPDGLLINGLLKNAVFTGEKGKTYKFRVSNVGIATSINFRIQSHTMTLVEV  240

Query  1093  EGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVT  914
             EG+HT+Q+ Y+SLDIH GQS   LVT +  V DY+IVAS+RF KP +T + IL Y GS T
Sbjct  241   EGAHTLQEVYESLDIHPGQSVAVLVTPHGSVGDYFIVASTRFTKPILTTTGILRYAGSNT  300

Query  913   KVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKEN  734
                  LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIP+VR L+L NT   
Sbjct  301   PASKPLPIGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPVVRRLLLANTATK  360

Query  733   ISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHD  554
             + G  RYA+NKVSYV+P TPLKLADWLNIPGVF  N IKDTP  GPAV+G SV G  LHD
Sbjct  361   LDGKLRYAVNKVSYVDPETPLKLADWLNIPGVFNFNTIKDTPSPGPAVYGASVIGTALHD  420

Query  553   YVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGV-WDSTLRKKYNLVDATTRYTVQVYPNSW  377
             +VEI+FQN E TLQS+HLDG   + V YG    W S +R++YNLVDA  R+TVQVYP  W
Sbjct  421   FVEIVFQNTEATLQSWHLDGYSVYVVAYGHAANWTSAIRRRYNLVDAVPRHTVQVYPLGW  480

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             TA+LVSLDNKGMWNLRS++W + YLGQQ+Y+RVWNNEHSL+TE+DMP +TL CG
Sbjct  481   TAVLVSLDNKGMWNLRSAIWSKRYLGQQLYIRVWNNEHSLFTESDMPLNTLHCG  534



>ref|XP_006466655.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
Length=541

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/530 (65%), Positives = 414/530 (78%), Gaps = 3/530 (1%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
             FL  L+G+LA  C+  V AEDPYR Y W V YGTISP GV Q+GILINGQFPGP I  +T
Sbjct  6     FLEILIGILACLCVFWVNAEDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPAIEAVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+IVN+INKLDEP L TWNG+KQR+++W DGVLGTNCPI PN+NWTY+ QMKDQIGT+
Sbjct  66    NDNIIVNLINKLDEPFLITWNGVKQRRTTWQDGVLGTNCPIPPNSNWTYKFQMKDQIGTF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWN--TDHKQLQKQLDT  1262
             +YF ST++HRA GG+GA+N+ +RSVI +PY  P   +TL+VSDW+   + HK LQK+L+ 
Sbjct  126   NYFPSTKVHRAFGGFGAVNVAQRSVISVPYHIPDGEFTLLVSDWFKNFSSHKALQKRLED  185

Query  1261  GKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             G P P P  LLING  NS++FTG++G TY FRVSNVG+ TSINFRIQ H L LVEVEG+H
Sbjct  186   GYPLPVPDALLINGHHNSLSFTGQKGKTYKFRVSNVGIATSINFRIQGHTLTLVEVEGAH  245

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPG  902
              +Q+ Y+S+DIHVGQS   +V ++   KDYYIVAS+RF KP +T +AILHYDGS T    
Sbjct  246   CLQESYESIDIHVGQSIAVIVAMHGPPKDYYIVASTRFTKPILTTTAILHYDGSNTPPSL  305

Query  901   KLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGI  722
              LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTI +VRT+VL N+   I+  
Sbjct  306   PLPIAPTYHIHWSMKQARTIRTNLTANAARPNPQGSFHYGTIKVVRTIVLANSATKINNK  365

Query  721   TRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTP-PAGPAVHGVSVFGLELHDYVE  545
              RYA+N +SYVNP TPLKLADW NIPGVF LN IKDTP P  PA  G SV    LHDYVE
Sbjct  366   LRYAVNGISYVNPITPLKLADWFNIPGVFDLNTIKDTPTPGAPAKLGASVIPTTLHDYVE  425

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             I+FQNNE ++QS+HLDG  F+ VGYG G W + +RK+YNL DA TR+TVQVYP SW+AI 
Sbjct  426   IVFQNNEASVQSWHLDGSSFYVVGYGSGTWTADIRKRYNLNDAITRHTVQVYPQSWSAIY  485

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +SLDNKGMWNLRS++W R YLGQ++YLRV N+E SL+TE D+PP+ L CG
Sbjct  486   ISLDNKGMWNLRSAIWERRYLGQELYLRVSNDERSLFTETDVPPNALFCG  535



>ref|XP_006425822.1| hypothetical protein CICLE_v10027285mg, partial [Citrus clementina]
 gb|ESR39062.1| hypothetical protein CICLE_v10027285mg, partial [Citrus clementina]
Length=554

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/530 (65%), Positives = 414/530 (78%), Gaps = 3/530 (1%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
             FL  L+G+LA  C+  V AEDPYR Y W V YGTISP GV Q+GILINGQFPGP I  +T
Sbjct  19    FLEILIGILACLCVFWVNAEDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPAIEAVT  78

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+IVN+INKLDEP L TWNG+KQR+++W DGVLGTNCPI PN+NWTY+ QMKDQIGT+
Sbjct  79    NDNIIVNLINKLDEPFLITWNGVKQRRTTWQDGVLGTNCPIPPNSNWTYKFQMKDQIGTF  138

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWN--TDHKQLQKQLDT  1262
             +YF ST++HRA GG+GA+N+ +RSVI +PY  P   +TL+VSDW+   + HK LQK+L+ 
Sbjct  139   NYFPSTKVHRAFGGFGAVNVAQRSVISVPYHIPDGEFTLLVSDWFKNFSSHKALQKRLED  198

Query  1261  GKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             G P P P  LLING  NS++FTG++G TY FRVSNVG+ TSINFRIQ H L LVEVEG+H
Sbjct  199   GYPLPVPDALLINGHHNSLSFTGQKGKTYKFRVSNVGIATSINFRIQGHTLTLVEVEGAH  258

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPG  902
              +Q+ Y+S+DIHVGQS   +V ++   KDYYIVAS+RF KP +T +AILHYDGS T    
Sbjct  259   CLQESYESIDIHVGQSIAVIVAMHGPPKDYYIVASTRFTKPILTTTAILHYDGSNTPPSL  318

Query  901   KLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGI  722
              LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTI +VRT+VL N+   I+  
Sbjct  319   PLPIAPTYHIHWSMKQARTIRTNLTANAARPNPQGSFHYGTIKVVRTIVLANSATKINNK  378

Query  721   TRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTP-PAGPAVHGVSVFGLELHDYVE  545
              RYA+N +SYVNP TPLKLADW NIPGVF LN IKDTP P  PA  G SV    LHDYVE
Sbjct  379   LRYAVNGISYVNPITPLKLADWFNIPGVFDLNTIKDTPTPGAPAKLGASVIPTTLHDYVE  438

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             I+FQNNE ++QS+HLDG  F+ VGYG G W + +RK+YNL DA TR+TVQVYP SW+AI 
Sbjct  439   IVFQNNEASVQSWHLDGSSFYVVGYGSGTWTADIRKRYNLNDAITRHTVQVYPQSWSAIY  498

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +SLDNKGMWNLRS++W R YLGQ++YLRV N+E SL+TE D+PP+ L CG
Sbjct  499   ISLDNKGMWNLRSAIWERRYLGQELYLRVSNDERSLFTETDVPPNALFCG  548



>ref|XP_010088984.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB37211.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=537

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/534 (64%), Positives = 413/534 (77%), Gaps = 2/534 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             MRQ  + FL F LG LA        AEDPYR+Y W V YGTISPLGV+Q+GILINGQFPG
Sbjct  1     MRQ--ATFLHFFLGTLACLSAFYANAEDPYRYYTWTVTYGTISPLGVQQKGILINGQFPG  58

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN+N+IVNVINKLDEP L TWNGIKQRK++W DGVLGTNCPI PN+NWTY+ Q 
Sbjct  59    PTIECVTNDNIIVNVINKLDEPFLITWNGIKQRKTAWQDGVLGTNCPIPPNSNWTYKFQT  118

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGT+ YF STQ+HRA+GG+G  N+  RSVI +PYP P+  +T++V DW+   HK+LQ
Sbjct  119   KDQIGTFFYFPSTQMHRASGGFGGFNVNHRSVIAVPYPIPAEEFTVLVGDWYKAGHKELQ  178

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             K+LD+G   P P GLLING  +  TFTG++G +Y FR+SNVG+ TSIN RIQ H + LVE
Sbjct  179   KKLDSGSSLPLPDGLLINGLPHHATFTGQKGKSYKFRISNVGIATSINVRIQGHTMVLVE  238

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEGSHT+Q+ Y+S+D+H GQS   LVT +  +KDY+IVAS+RF KP +TA+AIL Y GS 
Sbjct  239   VEGSHTIQEAYESIDVHPGQSLAVLVTCHNHIKDYFIVASTRFTKPVLTATAILRYGGST  298

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
             TK  G  P  P  Q  WS+ QART R NLTANAARPNPQGS+HYGTI I+RT+VL N++ 
Sbjct  299   TKAQGPWPIGPTYQLRWSLLQARTFRLNLTANAARPNPQGSFHYGTIKILRTIVLANSQA  358

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I G  RYA+N++SYV+P+TPLKLAD+L IPGVF LN IKDTP  GPA+ G SV    LH
Sbjct  359   KIGGKLRYAVNRISYVDPSTPLKLADYLKIPGVFKLNTIKDTPTPGPAILGTSVINTTLH  418

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSW  377
             D++EI+FQNNE  +QS+HL G  F+AVGYG   W    R+ YNL DA +R+TVQVYPNSW
Sbjct  419   DFIEIVFQNNEAAVQSWHLAGNSFYAVGYGARQWKPRRRRGYNLADAVSRHTVQVYPNSW  478

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +AILVSLDNKGMWNLRS++W R YLGQQ+Y+RVWN EHSL+TE D+PP+ L CG
Sbjct  479   SAILVSLDNKGMWNLRSAIWGRQYLGQQLYVRVWNTEHSLFTETDVPPNALYCG  532



>gb|KDO79346.1| hypothetical protein CISIN_1g009171mg [Citrus sinensis]
Length=541

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/530 (64%), Positives = 413/530 (78%), Gaps = 3/530 (1%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
             FL  L+G+LA  C+  V AEDPYR Y W V YGTISP GV Q+GILINGQFPGP I  +T
Sbjct  6     FLEILIGILACLCVFWVNAEDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPAIEAVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+IVN+INKLDEP L TWNG+KQR+++W DGVLGTNCPI PN+NWTY+ QMKDQIGT+
Sbjct  66    NDNIIVNLINKLDEPFLITWNGVKQRRTTWQDGVLGTNCPIPPNSNWTYKFQMKDQIGTF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWN--TDHKQLQKQLDT  1262
             +YF ST++HRA GG+GA+N+ +RSVI +PY  P   +TL+VSDW+   + HK LQK+L+ 
Sbjct  126   NYFPSTKVHRAFGGFGAVNVAQRSVISVPYHIPDGEFTLLVSDWFKNFSSHKALQKRLED  185

Query  1261  GKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             G   P P  LLING  NS++FTG++G TY FRVSNVG+ TSINFRIQ H L LVEVEG+H
Sbjct  186   GYSLPVPDALLINGHHNSLSFTGQKGKTYKFRVSNVGIATSINFRIQGHTLTLVEVEGAH  245

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPG  902
              +Q+ Y+S+DIHVGQS   +V ++   KDYYIVAS+RF KP +T +AILHYDGS T    
Sbjct  246   CLQESYESIDIHVGQSVAVVVAMHGPPKDYYIVASTRFTKPILTTTAILHYDGSNTPPSL  305

Query  901   KLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGI  722
              LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTI +VRT+VL N+   I+  
Sbjct  306   PLPIAPTYHIHWSMKQARTIRTNLTANAARPNPQGSFHYGTIKVVRTIVLANSATKINNK  365

Query  721   TRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTP-PAGPAVHGVSVFGLELHDYVE  545
              RYA+N +SYVNP TPLKLADW NIPGVF LN IKDTP P  PA  G SV    LHDYVE
Sbjct  366   LRYAVNGISYVNPITPLKLADWFNIPGVFDLNTIKDTPTPGAPAKLGASVIPTTLHDYVE  425

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             I+FQNNE ++QS+HLDG  F+ VGYG G W + +RK+YNL DA TR+TVQVYP SW+AI 
Sbjct  426   IVFQNNETSVQSWHLDGSSFYVVGYGSGTWTADIRKRYNLNDAITRHTVQVYPQSWSAIY  485

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             VSLDNKG+WNLRS++W R YLGQ++YLRV N+E SL+TE D+PP+ L CG
Sbjct  486   VSLDNKGVWNLRSAIWERRYLGQELYLRVSNDERSLFTETDVPPNALFCG  535



>ref|XP_010548381.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/528 (65%), Positives = 407/528 (77%), Gaps = 1/528 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  L+   AF     V +EDPY FY W V YGT SPLGV Q+ ILINGQFPGP I  IT
Sbjct  7     LLHCLICFFAFLAPVFVNSEDPYMFYTWTVTYGTRSPLGVPQQVILINGQFPGPPIEAIT  66

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N NV+VNVINKLDEP L TWNG+KQR++SW DGVLGTNCPILPN+NWTY+ Q+KDQIGTY
Sbjct  67    NNNVVVNVINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPILPNSNWTYQFQLKDQIGTY  126

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRA GG+GALNI +RSVI +PY +P   +TL+VSDW+   HK++Q++LD G 
Sbjct  127   TYFPSTAMHRAVGGFGALNINQRSVISIPYLQPDGDFTLLVSDWYKIGHKEMQRKLDAGI  186

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P GL+ING    + F G+QG TY FRVSNVG+  SINFRIQ H + L+EVEGSHT+
Sbjct  187   ALPLPDGLIINGVSKGLKFHGQQGKTYKFRVSNVGIAASINFRIQGHTMTLIEVEGSHTL  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
              + Y+SLD+HVGQS   LVTL A VKDY+IVAS+RF KP +T + IL Y GS T+    L
Sbjct  247   HEVYESLDVHVGQSVTVLVTLRAMVKDYFIVASTRFTKPVLTTTGILRYIGSKTRASRPL  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPIVRTLVL N    I+G  R
Sbjct  307   PIGPTYHVHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPIVRTLVLANAAAKINGKLR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTP-PAGPAVHGVSVFGLELHDYVEII  539
             Y +N VS+V+PTTPLKLADW NIPGVF L  IKD+P P GP+V G SV G+ LHD+VEI+
Sbjct  367   YTVNGVSHVDPTTPLKLADWFNIPGVFDLKTIKDSPVPGGPSVLGASVIGVALHDFVEIV  426

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQN E+++QS+H+DG   +AVGYG G W + +RK+YNLVDA  R+T QVYP SWTAILVS
Sbjct  427   FQNTERSVQSWHMDGTSAYAVGYGNGTWTAAMRKRYNLVDAVVRHTFQVYPLSWTAILVS  486

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE D+PP+ L CG
Sbjct  487   LDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTETDVPPNALYCG  534



>ref|XP_002522339.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF40023.1| multicopper oxidase, putative [Ricinus communis]
Length=540

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/537 (64%), Positives = 411/537 (77%), Gaps = 5/537 (1%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             MRQ  +  L F LG+LA      V+AEDPYRF+ W V YGTISPLGV QRGILINGQFPG
Sbjct  1     MRQ--ANILYFCLGLLALLSGICVKAEDPYRFFTWTVTYGTISPLGVPQRGILINGQFPG  58

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I+ +TN+N+IVNVINKLD P L TWNGIKQR+++W DGVLGTNCPI PN+NWTY+ Q 
Sbjct  59    PAIDCVTNDNIIVNVINKLDVPFLLTWNGIKQRRTTWQDGVLGTNCPIPPNSNWTYKFQT  118

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGT++YF S  LHR AGG+GA NI  RSVI +PYP P   +TL++ DW+ TD+K LQ
Sbjct  119   KDQIGTFNYFPSVGLHRVAGGFGAFNIQPRSVIAIPYPIPVEEFTLLIGDWFKTDYKVLQ  178

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             ++LD G   P P  LLING      FTG++G TY FRVSNVG+ TSINFRIQ H + LVE
Sbjct  179   QRLDQGLSLPLPDALLINGLHKDAIFTGEKGQTYKFRVSNVGIATSINFRIQGHPMVLVE  238

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEG+HTMQ+ Y+SLD+H GQS   LVTL+   KDYYIVAS+RF KP +T + IL Y GS 
Sbjct  239   VEGAHTMQELYESLDVHPGQSVTVLVTLHGSPKDYYIVASTRFTKPILTTTGILRYAGSN  298

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
             T     LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTI ++RT++L NT  
Sbjct  299   TPPSKPLPIGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIQVMRTIILANTAA  358

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I G  RYA+N +SYV+P+TPLKLADW +IPGVFTLN+IKD P    AV G SV G  LH
Sbjct  359   KIGGKLRYAVNGISYVDPSTPLKLADWFSIPGVFTLNSIKDAPTNATAVLGTSVIGTALH  418

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKK---YNLVDATTRYTVQVYP  386
             D+VE++FQN E T+QS+HLDG  F+ VGYG G+W   +RK+   YNL DA  R+TVQVYP
Sbjct  419   DFVELVFQNTESTVQSWHLDGSSFYVVGYGSGMWTPEVRKRRKLYNLNDAVPRHTVQVYP  478

Query  385   NSWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             NSW+A+LVSLDNKGMWNLRS++W R YLGQQ+Y+RVWNNEHSLYTE D+PP+ L CG
Sbjct  479   NSWSAVLVSLDNKGMWNLRSAIWARRYLGQQLYIRVWNNEHSLYTETDVPPNALFCG  535



>ref|XP_002310164.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE90614.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=537

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/534 (64%), Positives = 413/534 (77%), Gaps = 2/534 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             MRQ  +  L F +G+LAF   + V+AEDPYR+Y W V YGT + L + Q  ILINGQFPG
Sbjct  1     MRQ--ASILYFCVGILAFLSDTWVQAEDPYRYYTWTVTYGTRTVLDIPQTVILINGQFPG  58

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN+N+IVNVINKL+EP L TWNGIKQR++ W DGVLGTNCPI P +NWTY+ Q 
Sbjct  59    PNIECVTNDNIIVNVINKLNEPFLITWNGIKQRRTIWQDGVLGTNCPIPPGSNWTYKFQA  118

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGTY+YF +T +HRAAGG+G  NI  RSVI +PYP P A +TL++SDW+   H+ L+
Sbjct  119   KDQIGTYNYFPTTAMHRAAGGFGGFNIASRSVISIPYPIPVAEFTLLISDWYKAGHQALK  178

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             + LD GK  P P  LLING     +FTG++G TY FR+SN G++TSINFRIQ H L LVE
Sbjct  179   QNLDQGKALPVPDALLINGLSKGASFTGEKGQTYKFRISNAGISTSINFRIQGHTLILVE  238

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEGSHTMQ+ YDSLD+HVGQS   LV LN+ VKDY+IVASSRF KP +T +A+L Y GS 
Sbjct  239   VEGSHTMQEVYDSLDVHVGQSVTVLVKLNSAVKDYFIVASSRFTKPILTTTALLRYAGSN  298

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
             T     LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTI +V+  V  NT E
Sbjct  299   TPPSLPLPIGPTYHVHWSMKQARTIRLNLTANAARPNPQGSFHYGTINVVKRFVFANTAE  358

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I+G  RYA+N +SYV+P+TPL+LADW NIPGVF+LN +K TP   PAV G SV G ELH
Sbjct  359   KINGKLRYAVNGISYVDPSTPLQLADWYNIPGVFSLNTMKTTPVNTPAVLGTSVVGTELH  418

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSW  377
             D+VEI+FQNNE T+QS+HL G  F+ VGYG  VW+ ++RK+YNL+DA +R+TVQVYP +W
Sbjct  419   DFVEIVFQNNENTIQSWHLSGTSFYVVGYGDNVWNPSMRKRYNLLDAVSRHTVQVYPTAW  478

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             TAI VSLDNKGMWNLRS++WPR YLGQQ+Y+RVWNNE SL+TE+D PP+TL CG
Sbjct  479   TAIYVSLDNKGMWNLRSAIWPRRYLGQQLYVRVWNNERSLFTESDPPPNTLFCG  532



>ref|XP_011039229.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=537

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/534 (64%), Positives = 411/534 (77%), Gaps = 2/534 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             MRQ  +  L F +G+LA    + V+AEDPYR+Y W V YGT + L   Q  ILING+FPG
Sbjct  1     MRQ--ASILYFCVGILALLSDTWVQAEDPYRYYTWTVTYGTRTVLDRPQTVILINGRFPG  58

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN+N+IVNVINKL+EP L TWNGIKQR++SW DGVLGTNCPI P + WTY+ Q 
Sbjct  59    PNIECVTNDNIIVNVINKLNEPFLITWNGIKQRRTSWQDGVLGTNCPIPPGSTWTYKFQT  118

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGTYSYF ST +HRA GG+G  NI  RSVI +PYP P A +TL++SDW+   H+ L+
Sbjct  119   KDQIGTYSYFPSTAMHRAGGGFGGFNIASRSVISIPYPIPVAEFTLLISDWYRAGHQALK  178

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             + LD GK  P P  LLING     +FTG++G TY FR+SNVG++TSINFRIQ H L LVE
Sbjct  179   QNLDRGKALPVPDALLINGLSKGASFTGEKGKTYRFRISNVGISTSINFRIQGHTLTLVE  238

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEGSHTMQ+ Y+SLD+HVGQS   LV  N+ VKDYYIVASSRF KP +T +A+L Y GS 
Sbjct  239   VEGSHTMQEVYNSLDVHVGQSVTVLVKFNSAVKDYYIVASSRFTKPILTTTALLRYAGSN  298

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
             T     LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTI +V+TLVL NT E
Sbjct  299   TPPSLPLPIGPTYHVHWSMKQARTIRLNLTANAARPNPQGSFHYGTIKVVKTLVLANTAE  358

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I+G  RYA+N +SYV+P+TPLKLADW NIPGVF+LN++K TP   PAV G SV G ELH
Sbjct  359   KINGKLRYAVNGISYVDPSTPLKLADWYNIPGVFSLNSMKTTPVNTPAVLGTSVVGTELH  418

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSW  377
             D+VEI+FQNNE T+QS+HL G  F+ V YG  VW+ ++RK+YNL+DA +RYTVQVYP +W
Sbjct  419   DFVEIVFQNNENTIQSWHLSGTSFYVVAYGDNVWNPSMRKRYNLLDAVSRYTVQVYPTAW  478

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             TAI VSLDNKGMWNLRS++W R YLGQQ+Y+RVWN+E SLYTE D PP+TL CG
Sbjct  479   TAIYVSLDNKGMWNLRSAIWARRYLGQQLYVRVWNDERSLYTETDPPPNTLFCG  532



>gb|KDP31876.1| hypothetical protein JCGZ_12337 [Jatropha curcas]
Length=538

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/527 (64%), Positives = 409/527 (78%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
             FL   +G+L     S+V A+DPYR+Y W V YGTISPLG  Q+ ILINGQFPGP ++V+T
Sbjct  6     FLHIFVGLLVVLGASLVNADDPYRYYTWTVTYGTISPLGKPQQVILINGQFPGPRLDVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT+
Sbjct  66    NDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST  HRAAGGYG LN+  R  IP+P+  P   +TL++ DW+ TDHK LQ+ LD+GK
Sbjct  126   TYFPSTLFHRAAGGYGGLNVYERPKIPIPFANPDGDFTLLIGDWYTTDHKTLQESLDSGK  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P G+LING+ ++ TF G QG TYMFR+SNVG++TS+NFRIQ H LKLVEVEGSHT+
Sbjct  186   SLPFPDGVLINGQTHT-TFNGDQGKTYMFRISNVGLSTSLNFRIQGHTLKLVEVEGSHTL  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF K  +TA+A+LHY  S T   G L
Sbjct  245   QNIYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTKQVLTATAVLHYKNSQTPASGPL  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P GQYHWSMRQART RWNLTA+AARPNPQGSYHYG I   +T+VL N+   I+G  R
Sbjct  305   PAAPIGQYHWSMRQARTYRWNLTASAARPNPQGSYHYGKIIPTKTIVLANSAPLINGKKR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N+VSYVN  TPLKLAD+ NIPGVF++++I+  P  GPA    SV    LHD+VE+IF
Sbjct  365   YAVNRVSYVNADTPLKLADYFNIPGVFSVDSIQTLPSGGPAYIATSVIPNSLHDFVEVIF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE  +QS+HLDG DFW VGYG G W    R+ YNLVDA TR+T QVYPNSWTAILVSL
Sbjct  425   QNNEYAMQSWHLDGYDFWVVGYGNGQWTQNKRRMYNLVDALTRHTAQVYPNSWTAILVSL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWN+RS++W R YLGQQ+YLRVW  EHSL  E D+P + LLCG
Sbjct  485   DNQGMWNMRSAIWERQYLGQQLYLRVWTPEHSLANEYDIPNNVLLCG  531



>ref|XP_011013815.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=537

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/534 (64%), Positives = 411/534 (77%), Gaps = 2/534 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             MRQ  +  L F +G+LA    + V+AEDPYR+Y W V YGT + L   Q  ILING+FPG
Sbjct  1     MRQ--ASILYFCVGILALLSDTWVQAEDPYRYYTWTVTYGTRTVLDRPQTVILINGRFPG  58

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN+N+IVNVINKL+EP L TWNGIKQR++SW DGVLGTNCPI P +NWTY+ Q 
Sbjct  59    PNIECVTNDNIIVNVINKLNEPFLITWNGIKQRRTSWQDGVLGTNCPIPPGSNWTYKFQT  118

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGTY YF ST +H+A GG+G  NI  RSVI +PYP P A +TL++SDW+   H+ L+
Sbjct  119   KDQIGTYIYFPSTAMHKAGGGFGGFNIASRSVISIPYPIPVAEFTLLISDWYRAGHQALK  178

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             + LD GK  P P  LLING     +FTG++G TY FR+SNVG++TSINFRIQ H L LVE
Sbjct  179   QNLDRGKALPVPDALLINGLSKGASFTGEKGKTYRFRISNVGISTSINFRIQGHTLTLVE  238

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEGSHTMQ+ Y+SLD+HVGQS   LV  N+ VKDYYIVASSRF KP +T +A+L Y GS 
Sbjct  239   VEGSHTMQEVYNSLDVHVGQSVTVLVKFNSAVKDYYIVASSRFTKPILTTTALLRYAGSN  298

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
             T     LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTI +V+TLVL NT E
Sbjct  299   TPPSLPLPIGPTYHVHWSMKQARTIRLNLTANAARPNPQGSFHYGTIKVVKTLVLANTAE  358

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I+G  RYA+N +SYV+P+TPLKLADW NIPGVF+LN++K TP   PAV G SV G ELH
Sbjct  359   KINGKLRYAVNGISYVDPSTPLKLADWYNIPGVFSLNSMKTTPVNTPAVLGTSVVGTELH  418

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSW  377
             D+VEI+FQNNE T+QS+HL G  F+ V YG  VW+ ++RK+YNL+DA +RYTVQVYP +W
Sbjct  419   DFVEIVFQNNENTIQSWHLSGTSFYVVAYGDNVWNPSMRKRYNLLDAVSRYTVQVYPTAW  478

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             TAI VSLDNKGMWNLRS++W R YLGQQ+Y+RVWN+E SLYTE D PP+TL CG
Sbjct  479   TAIYVSLDNKGMWNLRSAIWARRYLGQQLYVRVWNDERSLYTETDPPPNTLFCG  532



>ref|XP_010028303.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55016.1| hypothetical protein EUGRSUZ_I00990 [Eucalyptus grandis]
Length=538

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/535 (64%), Positives = 409/535 (76%), Gaps = 3/535 (1%)
 Frame = -2

Query  1816  MRQPPSGFLR-FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             MRQ  + FL  FL+  LA+       AEDPYR++NW V YGTISPLGV Q+GILINGQFP
Sbjct  1     MRQ--ARFLHIFLVVSLAWLGAFFANAEDPYRYFNWEVTYGTISPLGVSQQGILINGQFP  58

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP I  ITN+N+++NV+NKLDEP L TW G++QRK+SW DGVLGT CPI P TNWTY+ Q
Sbjct  59    GPPIEAITNDNIVLNVVNKLDEPFLLTWKGVQQRKNSWQDGVLGTQCPIPPGTNWTYKFQ  118

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
             +KDQIGT+ YF S  L RA GG+GALNI +RSVIP+PYP P   +TL+V DW+ +DHK L
Sbjct  119   LKDQIGTFMYFPSIGLQRADGGFGALNIAQRSVIPIPYPTPFGEFTLLVGDWYKSDHKAL  178

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             Q+ LD G     P G++INGR N  TFTG++G TY FRVSNVG+ TSINFRIQ H + LV
Sbjct  179   QQTLDKGNLLHLPDGIIINGRPNGFTFTGQRGQTYKFRVSNVGIATSINFRIQGHNITLV  238

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEG HT+Q+ Y+SLD+HVGQS   LVTL    KDY++V SSRF KP + A+A+LHYDGS
Sbjct  239   EVEGCHTLQEVYESLDVHVGQSVTVLVTLQWSPKDYFVVCSSRFTKPILNATALLHYDGS  298

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
              T     LP  P  Q HWSM+QART+R NLTANAARPNPQGSYHYGTI + RTL+L N  
Sbjct  299   NTPASLPLPIGPTYQIHWSMKQARTLRTNLTANAARPNPQGSYHYGTIQVNRTLILANAP  358

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I+G  RY +N VSYV+P TPLKLAD+ NIPGVFTLN+IKDTPP+GP   G SV G  L
Sbjct  359   TKINGTLRYTVNNVSYVDPDTPLKLADYFNIPGVFTLNSIKDTPPSGPDALGTSVVGTTL  418

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             HD+VEIIFQN EK +QS+HLDG  F+ VGYG G W   +RK+YN+ DA +R TVQVYP S
Sbjct  419   HDFVEIIFQNTEKAIQSWHLDGYSFYTVGYGSGQWTPDMRKRYNMADAVSRDTVQVYPLS  478

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             W+AILVSLDNKGMWNLRS++W + YLGQQ+Y+RVWNNE S YTE D P + LLCG
Sbjct  479   WSAILVSLDNKGMWNLRSAIWSKQYLGQQLYIRVWNNEKSPYTEYDAPQNVLLCG  533



>ref|XP_010472357.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 404/527 (77%), Gaps = 3/527 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCIS---MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L+G L  +C S   MV AEDPY F+ W V YGT SPLGV Q+ ILINGQFPGP I  +T
Sbjct  8     LLVGFLLAYCFSSVFMVNAEDPYLFFTWTVTYGTRSPLGVPQQVILINGQFPGPAIEGVT  67

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N N++VNVINKLDEP L TWNGIKQRK SW DGVLGTNCPI PN+NWTY  Q+KDQIGTY
Sbjct  68    NNNIVVNVINKLDEPFLITWNGIKQRKMSWQDGVLGTNCPIQPNSNWTYHFQLKDQIGTY  127

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRA+G +GALN+ +RSVI +PYP+P A +TL+VSDW+   HK+L+++LD+G+
Sbjct  128   TYFASTSMHRASGAFGALNVNQRSVIFVPYPKPDADFTLLVSDWYKMGHKELRRRLDSGR  187

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P GLLING    + FTG+ G  Y FRVSNVG++TSINFRIQ H + LVEVEGSHT+
Sbjct  188   ALPLPDGLLINGASRGLVFTGQHGKIYRFRVSNVGISTSINFRIQGHMMTLVEVEGSHTL  247

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+SLDIHVGQS   LVTL A VKDY+IVAS+RF KP +T + IL Y GS  +    L
Sbjct  248   QEVYESLDIHVGQSVTVLVTLKAPVKDYFIVASTRFTKPVLTTTGILSYQGSKIRPSHPL  307

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RT VL N +  I+G  R
Sbjct  308   PMDPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPINRTFVLANGRARINGKLR  367

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N+VSYVNP TPLKLADW NIPGVF    I + P  GP++ G SVF + LH+YVE +F
Sbjct  368   YTVNRVSYVNPATPLKLADWFNIPGVFNFRTIMNIPTPGPSILGTSVFDVALHEYVEFVF  427

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE+++QS+HLDG   + VGYG G W+   R+ YNL+DA TR+T QVYP SWT+ILVSL
Sbjct  428   QNNERSIQSWHLDGTSAYVVGYGSGTWNIAKRRGYNLIDAVTRHTFQVYPMSWTSILVSL  487

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE++ P + L CG
Sbjct  488   DNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTESEPPANALFCG  534



>ref|XP_010429313.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 404/527 (77%), Gaps = 3/527 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCIS---MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L+G L+ +C S   MV AEDPY F+ W V YGT SPLGV Q+ ILINGQFPGP I   T
Sbjct  8     LLVGFLSAYCFSSVFMVNAEDPYLFFTWTVTYGTRSPLGVPQQVILINGQFPGPAIEGET  67

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N N++VNVINKLDEP L TWNGIKQRK SW DGVLGTNCPI PN+NWTY  Q+KDQIGTY
Sbjct  68    NNNIVVNVINKLDEPFLITWNGIKQRKMSWQDGVLGTNCPIQPNSNWTYHFQLKDQIGTY  127

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRA+G +GALN+ +RSVI +PYP+P A +TL+VSDW+   HK+L+++LD+G+
Sbjct  128   TYFASTSMHRASGAFGALNVNQRSVIFVPYPKPDADFTLLVSDWYKMGHKELRRRLDSGR  187

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P GLLING    + FTG+ G  Y FRVSNVG++TSINFRIQ H + LVEVEGSHT+
Sbjct  188   ALPLPDGLLINGASRGLVFTGQHGKIYRFRVSNVGISTSINFRIQGHMMTLVEVEGSHTL  247

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+SLDIHVGQS   LVTL A VKDY+IVAS+RF KP +T + IL Y GS  +    L
Sbjct  248   QEVYESLDIHVGQSVTVLVTLKAPVKDYFIVASTRFTKPVLTTTGILSYQGSKIRPSHPL  307

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RT VL N +  I+G  R
Sbjct  308   PMGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPINRTFVLANGRARINGKLR  367

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N+VSYVNP TPLKLADW NIPGVF    I + P  GP++ G SVF + LH+YVE +F
Sbjct  368   YTVNRVSYVNPATPLKLADWFNIPGVFNFKTIMNIPTPGPSILGTSVFDVALHEYVEFVF  427

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE+++QS+HLDG   + VGYG G W+   R+ YNL+DA TR+T QVYP SWT+ILVSL
Sbjct  428   QNNERSIQSWHLDGTSAYVVGYGSGTWNIAKRRGYNLIDAVTRHTFQVYPMSWTSILVSL  487

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE++ P + L CG
Sbjct  488   DNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTESEPPVNALFCG  534



>ref|XP_010417106.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 404/527 (77%), Gaps = 3/527 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCIS---MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L+G L  +C S   MV AEDPY F+ W V YGT SPLGV Q+ ILINGQFPGP I  +T
Sbjct  8     LLVGFLLAYCFSSVFMVNAEDPYLFFTWTVTYGTRSPLGVPQQVILINGQFPGPAIEGVT  67

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N N++VNVINKLDEP L TWNGIKQRK SW DGVLGTNCPI PN+NWTY  Q+KDQIGTY
Sbjct  68    NNNIVVNVINKLDEPFLITWNGIKQRKMSWQDGVLGTNCPIQPNSNWTYHFQLKDQIGTY  127

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRA+G +GALNI +RSVI +PYP+P A +TL+VSDW+   HK+L+++LD+G+
Sbjct  128   TYFASTSMHRASGAFGALNINQRSVIFVPYPKPDADFTLLVSDWYKMGHKELRRRLDSGR  187

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P GLLING    + FTG+ G  Y FRVSNVG++TSINFRIQ H + LVEVEGSHT+
Sbjct  188   ALPLPDGLLINGASRGLVFTGQHGKIYRFRVSNVGISTSINFRIQGHMMTLVEVEGSHTL  247

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+SLDIHVGQS   LVTL A VKDY+IVAS+RF KP +T + IL Y GS  +    L
Sbjct  248   QEVYESLDIHVGQSVTVLVTLKAPVKDYFIVASTRFTKPVLTTTGILSYQGSKIRPSHPL  307

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RT VL N +  I+G  R
Sbjct  308   PMDPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPINRTFVLANGRARINGKLR  367

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N+VSYVNP TPLKLADW NIPGVF    I + P  GP++ G SVF + LH+YVE +F
Sbjct  368   YTVNRVSYVNPATPLKLADWFNIPGVFNFRTIMNIPTPGPSILGTSVFDVALHEYVEFVF  427

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE+++QS+HLDG   + VGYG G W+   R+ YNL+DA T++T QVYP SWT+ILVSL
Sbjct  428   QNNERSIQSWHLDGTSAYVVGYGSGTWNMAKRRGYNLIDAVTKHTFQVYPMSWTSILVSL  487

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE++ P + L CG
Sbjct  488   DNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTESEPPVNALFCG  534



>ref|XP_010680456.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=537

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 401/527 (76%), Gaps = 0/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L FLLG+LAF  I  ++AE PYR+Y+W + YGTISPLGV QRGILINGQFPGP IN  T
Sbjct  6     ILSFLLGILAFSSIFGIQAESPYRYYDWEITYGTISPLGVPQRGILINGQFPGPTINCDT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+ + N+LDEP L TWNG+ QRK SW DGVLGTNCPI PN+NWTY MQ KDQIGTY
Sbjct  66    NDNLIITIYNRLDEPFLMTWNGVWQRKMSWQDGVLGTNCPIPPNSNWTYTMQSKDQIGTY  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
              YF ST +HR AGG+GA NI RR VI LPYPEP+  Y L+V DW+NTDHK LQ++LD G 
Sbjct  126   MYFPSTAMHRVAGGFGAFNIHRRPVIALPYPEPAGEYNLLVGDWYNTDHKVLQERLDKGF  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P+P GLLING  N+   TG++G TY+ RV+NVG+  SIN RIQ H +KLVEVEGSH +
Sbjct  186   DMPTPDGLLINGHPNNTVLTGEEGKTYLIRVANVGIMESINIRIQGHVMKLVEVEGSHVL  245

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+SLD+H GQS  FLVTL   VKDYYIVAS+RF +  + A+A+L Y+GS T     L
Sbjct  246   QEIYESLDVHPGQSLAFLVTLYGSVKDYYIVASTRFARTSIEATALLRYNGSNTDASLPL  305

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QART RWNLTANAARPNPQGSY YG I I +TL+L N+ + I G  R
Sbjct  306   PIGPTYHVHWSMKQARTFRWNLTANAARPNPQGSYRYGGIEITKTLILGNSVDQIDGKMR  365

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N VSYVNP TPLKLAD+ NI G+F LN  +  P AGP  +G +VFG+++HDY+EIIF
Sbjct  366   YGVNNVSYVNPETPLKLADYYNISGIFNLNTSRKEPAAGPMSYGTTVFGMDVHDYIEIIF  425

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE T QS+HLDG +F+ V +G   W   +R+KYNLVDA  R TVQVY +SWTA+LVSL
Sbjct  426   QNNEATTQSWHLDGHNFFVVAFGANEWSPDMRRKYNLVDAVWRSTVQVYRDSWTAVLVSL  485

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS++W R YLGQQVYLR WNNE SL TE+D+P + L CG
Sbjct  486   DNKGMWNLRSAIWHRQYLGQQVYLRAWNNEPSLRTESDIPTNALKCG  532



>ref|XP_008241557.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=539

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/527 (64%), Positives = 409/527 (78%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  + GVLA F +++V+AEDPY+FY W V YGT SPLGV Q+ ILINGQFPGP ++V+T
Sbjct  7     LLHLVCGVLAVFSVAVVKAEDPYKFYTWTVTYGTRSPLGVPQQVILINGQFPGPRLDVVT  66

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNC I PN+N+TY+ Q KDQIG+Y
Sbjct  67    NDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCAIPPNSNYTYKFQTKDQIGSY  126

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF STQLHRAAG +GA+NI  R  IP+P+P P   +TL+V DW+NT HK LQ+ LD+GK
Sbjct  127   TYFPSTQLHRAAGAFGAINIYERPRIPIPFPNPDGDFTLLVGDWYNTSHKALQQTLDSGK  186

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P G+LING+  S TFTG QG TYMFR+SNVG++TS+NFRIQ H LKLVEVEGSHT+
Sbjct  187   SLPFPAGVLINGQ-TSNTFTGDQGKTYMFRISNVGLSTSLNFRIQGHSLKLVEVEGSHTI  245

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF K  +TA+++LHY  S T V G +
Sbjct  246   QNTYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTKLVLTATSVLHYTNSHTPVSGPV  305

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q HWS++QART RWNLTANAARPNPQGSYHYG +   +T++L N+   I+   R
Sbjct  306   PAGPTYQIHWSVQQARTFRWNLTANAARPNPQGSYHYGKVTTTKTIILANSAPLINEKQR  365

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA N+VSYVNP TPLKLAD+ NIPGV++ ++I+  P +G A     V    LHD++EI+F
Sbjct  366   YAFNRVSYVNPDTPLKLADYFNIPGVYSSDSIQTVPSSGSAFIATPVVPASLHDFLEIVF  425

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE TLQS HLDG DFW VGYG G W +  R+ YNLVDA TR+T QVYPNSWT ILVSL
Sbjct  426   QNNENTLQSMHLDGYDFWVVGYGFGQWTAAKRRTYNLVDALTRHTAQVYPNSWTTILVSL  485

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWNLRS++W R YLGQQ YLRVWN   SL  E ++P +TLLCG
Sbjct  486   DNQGMWNLRSAIWERQYLGQQFYLRVWNPVRSLANEYNIPSNTLLCG  532



>ref|XP_007047151.1| SKU5 similar 16 [Theobroma cacao]
 gb|EOX91308.1| SKU5 similar 16 [Theobroma cacao]
Length=537

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/527 (64%), Positives = 412/527 (78%), Gaps = 0/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
             FL+FLLG+ A F +    AEDPYR+Y WV  YGT +PLGV Q+ ILIN QFPGP I  +T
Sbjct  6     FLQFLLGMFACFSVFCANAEDPYRYYTWVATYGTRAPLGVYQKVILINNQFPGPPIEAVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+NVIN+LDEP L TW+GIKQR++SW DGVLGTNCPI P++NWTY+ Q+KDQIGT+
Sbjct  66    NDNIIINVINQLDEPFLITWHGIKQRRTSWQDGVLGTNCPIPPHSNWTYKFQLKDQIGTF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
              Y+ ST LH+A GG+GALN+++RSVI +PYP P   +T++V DW+N   K L+++LD+G 
Sbjct  126   MYYPSTLLHKAIGGFGALNVMQRSVISIPYPAPDGEFTVLVGDWYNAGDKALKERLDSGL  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P GLLING   S TFTG++G TY FR+SNVG++TSINFRIQ H + L EVEGSH++
Sbjct  186   GLPLPDGLLINGVRRSSTFTGQRGKTYKFRISNVGISTSINFRIQGHAMTLTEVEGSHSL  245

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+S+DIH GQS   LV L A VKDYYIVAS+RF KP +T + IL Y GS T     L
Sbjct  246   QEVYESIDIHAGQSVAVLVQLQASVKDYYIVASTRFTKPILTTTGILRYGGSHTPASLPL  305

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWS++QARTIR NLTANAARPNPQGS+HYGTI +VRTLVL N K  I+G  R
Sbjct  306   PIGPTFHVHWSIKQARTIRSNLTANAARPNPQGSFHYGTIKVVRTLVLANAKTKINGKLR  365

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N +SYV+PTTPLKLA+W NIPGVF LN+IKD P +GPAV GVS+FG+ LHD+VEI+F
Sbjct  366   YAVNGMSYVDPTTPLKLAEWFNIPGVFKLNSIKDVPTSGPAVLGVSLFGITLHDFVEIVF  425

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QN E  +QS+HLDG  F+ VGYG G W    RK+YNLVDA +R+TVQVYP SWTAILVSL
Sbjct  426   QNTEAAIQSWHLDGSSFYVVGYGSGQWKPDSRKRYNLVDAISRHTVQVYPTSWTAILVSL  485

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS  W + YLGQQ YLRVWNNE SL+TE D+PP+ L CG
Sbjct  486   DNKGMWNLRSQDWSKRYLGQQCYLRVWNNEKSLFTETDIPPNALRCG  532



>emb|CDX72617.1| BnaC07g46390D [Brassica napus]
Length=541

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/535 (63%), Positives = 404/535 (76%), Gaps = 1/535 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCIS-MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             M+Q      +  +G L F+  S +V+AEDPY FY W V YGT SPLGV Q+ ILINGQFP
Sbjct  1     MKQSNLLLCKLFIGTLLFWLGSVLVKAEDPYLFYTWTVTYGTRSPLGVPQQVILINGQFP  60

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP I  +TN N++VN+INKLDEP L TWNGIKQR++SW DGVLGTNCPI PN+NWTY+ Q
Sbjct  61    GPAIEAVTNNNIVVNLINKLDEPFLITWNGIKQRRTSWQDGVLGTNCPIQPNSNWTYQFQ  120

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
             +KDQIGT++YF ST +HRA+G +GALNI +RSVI  PY  P   +TL+V+DW+   HK L
Sbjct  121   LKDQIGTFTYFASTSMHRASGAFGALNINQRSVITTPYLTPDGDFTLLVTDWFKLSHKDL  180

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             QK+LD G   P P  LLING    + FTG+QG TY FRVSNVG+ TSINFRIQNH + L+
Sbjct  181   QKRLDAGYALPLPDALLINGASKGLIFTGQQGKTYKFRVSNVGIATSINFRIQNHTMTLI  240

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEG+HT+Q+ Y+SLDIHVGQS   LVTL A V+DYYIVASSRF KP +  +A L Y GS
Sbjct  241   EVEGAHTLQESYESLDIHVGQSVTVLVTLKASVRDYYIVASSRFTKPILNTTASLRYLGS  300

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
                V G LP  P    HWSM+QARTIR NLTANAARPNPQGSYHYGTIPI RTLVL N  
Sbjct  301   KNAVSGPLPVGPTYHIHWSMKQARTIRMNLTANAARPNPQGSYHYGTIPINRTLVLANAA  360

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I G  RY +N++SY+NPTTPLKLADW NI GVF    I  TP  GPA  G SVF +EL
Sbjct  361   TMIYGKLRYTVNRISYINPTTPLKLADWYNISGVFDFKTILSTPTIGPAHFGTSVFDIEL  420

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             H++VEI+FQN+E+++QS+H+DG   + VG+G G W+ T+R +YNLVDA  R+T QVYP S
Sbjct  421   HEFVEIVFQNDERSIQSWHMDGTSAFLVGFGSGTWNETMRTRYNLVDAVARHTFQVYPLS  480

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WT+ILVSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE + P + L CG
Sbjct  481   WTSILVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEAEPPLNALYCG  535



>ref|XP_010255119.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=540

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/527 (62%), Positives = 412/527 (78%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  +LGVLA   + +V+AEDPY++Y W V YG ISPLGV Q+ ILINGQFPGP ++V+T
Sbjct  8     LLHLVLGVLACLSVPLVKAEDPYKYYTWTVTYGKISPLGVPQQVILINGQFPGPRLDVVT  67

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+++N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPILPN+N+TY+ Q KDQIG++
Sbjct  68    NDNIVLNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPILPNSNYTYKFQTKDQIGSF  127

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST LH+AAGGYG LN+ +R  IP+P+P+P   +TL++ DW+ T+HK LQ+ LD+GK
Sbjct  128   TYFPSTSLHKAAGGYGGLNVYQRPGIPIPFPKPDGDFTLLIGDWYKTNHKTLQQYLDSGK  187

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
             P P P GLLING+ ++ +F+G QG TYMFR+SNVG+++SINFRIQ H LKLVEVEGSHT+
Sbjct  188   PLPFPDGLLINGQAHT-SFSGDQGKTYMFRISNVGLSSSINFRIQGHTLKLVEVEGSHTI  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q  YDSLD+HVGQS   LVTLN   KDYYIVAS+RF    +T +A+LHY  S T V G+L
Sbjct  247   QIIYDSLDVHVGQSVAVLVTLNQSPKDYYIVASTRFTSTVLTTTAVLHYTNSHTPVSGQL  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P+ Q  WSM+QART RWNLTA+AARPNPQGS+HYG I   RT+VL N+   I+G  R
Sbjct  307   PSGPSYQIDWSMQQARTFRWNLTASAARPNPQGSFHYGQIKPSRTIVLANSAPQINGKQR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N+VSY+N  TPLKLAD+ NIPGVF+LN+I+  P  GPA+   +V    LH+++E++F
Sbjct  367   YAVNRVSYINSDTPLKLADYFNIPGVFSLNSIQTAPSGGPALLATAVMPASLHEFIEVVF  426

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE T+QS+HLDG DFW VGYG G W    R  YNL+D  TR+T QVYPNSWT I VSL
Sbjct  427   QNNENTIQSWHLDGYDFWVVGYGHGQWTPASRNGYNLIDTLTRHTAQVYPNSWTTIWVSL  486

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWNLRS++W R YLGQQ YLRVWN + +   E D+PP+ LLCG
Sbjct  487   DNQGMWNLRSAIWERQYLGQQFYLRVWNQDKTPANEYDIPPNALLCG  533



>ref|XP_008440238.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/528 (63%), Positives = 407/528 (77%), Gaps = 1/528 (0%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
             G LR + G LA   +S+V AE+PYRFY W V YGTISPLGV Q+ ILINGQFPGP++ V+
Sbjct  5     GLLRLIFGALALLSVSLVNAENPYRFYTWTVTYGTISPLGVPQQVILINGQFPGPKLEVV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+I+N+ NKLDEP+L TWNGIKQRK+SW DGV+GTNCPI PN+N+TY  Q KDQIG+
Sbjct  65    TNDNIILNLFNKLDEPLLLTWNGIKQRKNSWQDGVVGTNCPIPPNSNYTYSFQTKDQIGS  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             ++YF STQ H+AAGG+GALN+ +R  IP+PYP     +TL++ DW+ T HK LQ+ LD+G
Sbjct  125   FAYFPSTQFHKAAGGFGALNVYQRPRIPIPYPIQDGDFTLLIGDWYKTSHKSLQESLDSG  184

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
                P P G+LING+ +S TFTG QG TYMFR+SNVG++TS+NFRIQ HK+KLVEVEGSHT
Sbjct  185   GSLPLPDGVLINGQTHS-TFTGDQGKTYMFRISNVGLSTSLNFRIQGHKMKLVEVEGSHT  243

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDSLD+HVGQS   LVTL+   KDYYIVAS+RF K  +TA+A+LHY  S + V G 
Sbjct  244   LQNLYDSLDVHVGQSLSVLVTLDQAPKDYYIVASTRFTKTVLTATAVLHYSNSNSPVSGP  303

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             LP  P  +  WS++QART RWNLTANAARPNPQGS+HYG I   +T+VL  +   I+G  
Sbjct  304   LPAGPTTEVDWSVKQARTFRWNLTANAARPNPQGSFHYGKIIPTKTIVLATSAALINGKQ  363

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N+VSYVN  TPLKLAD+ NIPGVF++++++  P  GPA    SV    LHD+VEI+
Sbjct  364   RYAINRVSYVNSDTPLKLADYFNIPGVFSVDSLQSLPSDGPAFIATSVLPTALHDFVEIV  423

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE T+QS+HLDG DFW VGYG G W    R  YNLVDA TR+T QVYPNSWT ILVS
Sbjct  424   FQNNENTVQSFHLDGYDFWVVGYGYGQWSQDSRNSYNLVDALTRHTAQVYPNSWTTILVS  483

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRSS+W R YLGQQ YLRVW    SL  E ++P + LLCG
Sbjct  484   LDNQGMWNLRSSIWERQYLGQQFYLRVWTPTQSLANEYNIPSNALLCG  531



>ref|XP_009368021.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=539

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/534 (64%), Positives = 409/534 (77%), Gaps = 6/534 (1%)
 Frame = -2

Query  1804  PSGFLRFLLGV---LAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGP  1634
             P+ F+ F +G+   L+ FCI  ++AED Y ++ W V YGTI PLGV Q+GILINGQFPGP
Sbjct  3     PTTFVPFFVGIFVCLSSFCI--IDAEDRYLYFTWTVTYGTIFPLGVPQKGILINGQFPGP  60

Query  1633  einvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMK  1454
              I  +TN+N+IV+VIN LDEP L TWNGI+QRK++W DGVLGT CPI PNTNWTY+ Q K
Sbjct  61    NIEAVTNDNIIVDVINMLDEPFLITWNGIQQRKTTWQDGVLGTQCPIPPNTNWTYKFQTK  120

Query  1453  DQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQK  1274
             DQIGTYSYF ST+LHRAAGG+G  N+  RSVIP+PYP P   +TL+V DW+ T HK+LQ+
Sbjct  121   DQIGTYSYFPSTKLHRAAGGFGGFNVANRSVIPVPYPIPDGEFTLLVGDWYKTGHKELQQ  180

Query  1273  QLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEV  1094
              LD+GK  P P GLLING   +  FTG++G TY F+VSNVG+ TSINFRIQNH + LVEV
Sbjct  181   ILDSGKNLPLPDGLLINGLPENTVFTGEKGKTYKFKVSNVGIETSINFRIQNHTMTLVEV  240

Query  1093  EGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVT  914
             EG++T+Q+ Y+SLDIH GQS   LVTL   VKDYYIVAS+RF+KP +T +  L Y GS T
Sbjct  241   EGANTLQEVYESLDIHPGQSVAVLVTLYGSVKDYYIVASTRFIKPVLTTTGYLRYAGSNT  300

Query  913   KVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKEN  734
                  LP  P  Q HWSM+QARTIR NLTANAARPNPQGS+HYGTIP+VR L+L NT   
Sbjct  301   PASKPLPIGPTYQIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIPVVRRLLLANTATK  360

Query  733   ISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHD  554
             I G+ RYA+N VSYV+P TPL+LADWLNI GVF LN I+DTP  GPAV+G SV G  LHD
Sbjct  361   IDGMLRYAVNNVSYVDPETPLQLADWLNISGVFNLNTIQDTPTPGPAVYGASVIGTALHD  420

Query  553   YVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGV-WDSTLRKKYNLVDATTRYTVQVYPNSW  377
             +VEI+FQN E  LQS+HLDG   + VGYG    W   + + YNL DA  R+TVQVYP  W
Sbjct  421   FVEIVFQNTEPKLQSWHLDGYSAYVVGYGSAAKWTPNMTRGYNLDDAVPRHTVQVYPLGW  480

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             TA+LVSLDNKGMWNLRS++W + YLGQQ+Y+RVWNN  S+YTENDMP + LLCG
Sbjct  481   TAVLVSLDNKGMWNLRSAIWSKRYLGQQLYIRVWNNVRSVYTENDMPLNALLCG  534



>gb|KDP31875.1| hypothetical protein JCGZ_12336 [Jatropha curcas]
Length=536

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/529 (64%), Positives = 402/529 (76%), Gaps = 3/529 (1%)
 Frame = -2

Query  1792  LRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             L F  G+L       V+AEDPYR++ W V YGTISPLGV QRGILINGQFPGP I+ +TN
Sbjct  3     LYFCFGLLVLLSGISVKAEDPYRYFTWTVTYGTISPLGVPQRGILINGQFPGPTIDAVTN  62

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
             +N+IVNVINKLDEP L TWNGIKQR+++W DGVLGTNCPI  N+NWTY+ Q KDQIGT++
Sbjct  63    DNIIVNVINKLDEPFLITWNGIKQRRTTWQDGVLGTNCPIPSNSNWTYKFQNKDQIGTFN  122

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF S  L RAAGG+GA N+  RSVI +PYP P   +TL++SDW+ TD K LQ+QLD G  
Sbjct  123   YFPSIGLQRAAGGFGAFNVQSRSVIAIPYPIPVEEFTLLISDWYKTDFKVLQQQLDQGIA  182

Query  1252  FPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
              P P  LLING     TFTG++G TY FRVSNVG+ TSINFRIQ H + LVEVEG+HT+Q
Sbjct  183   LPLPDALLINGINKGATFTGEKGKTYKFRVSNVGIATSINFRIQGHTMTLVEVEGAHTLQ  242

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
             + Y+SLD+H GQS   LVTLN   +DYYIVAS+RF KP +T + IL Y GS T     LP
Sbjct  243   EAYESLDVHPGQSVAVLVTLNGSPRDYYIVASTRFTKPILTTTGILRYAGSTTPPSLPLP  302

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P    HWSM+QARTIR NLTANAARPNPQGS+HYGTI ++RT++L NT+  I G  RY
Sbjct  303   IGPTYHIHWSMKQARTIRLNLTANAARPNPQGSFHYGTIKVLRTIILANTEAKIGGKLRY  362

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
             A+N +SYV+P TPLKLADW NIPGVFTLN+IKD P    AV G  V G  LHD+VEI+FQ
Sbjct  363   AVNSISYVDPKTPLKLADWFNIPGVFTLNSIKDAPTNASAVLGNPVIGTTLHDFVEIVFQ  422

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKK---YNLVDATTRYTVQVYPNSWTAILV  362
             N E T QS+HLDG  F+ VGYG GVW   +RK+   YNL D   R+TVQVYPNSW+A+LV
Sbjct  423   NTETTTQSWHLDGYSFYVVGYGSGVWTPDVRKRKKLYNLNDGVPRHTVQVYPNSWSAVLV  482

Query  361   SLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             SLDNKGMWNLRS++W R YLG+Q+Y+RVWN+EHSLYTE D+P + L CG
Sbjct  483   SLDNKGMWNLRSAIWSRRYLGEQLYIRVWNDEHSLYTETDIPENALFCG  531



>ref|XP_004509174.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cicer arietinum]
 ref|XP_004509175.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cicer arietinum]
Length=541

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/517 (64%), Positives = 409/517 (79%), Gaps = 2/517 (0%)
 Frame = -2

Query  1762  FCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNK  1583
             F +  V+AEDPY+++ W V YGT+SPLG  Q+ ILINGQFPGP+++++TN NVI+N+INK
Sbjct  19    FNVPQVKAEDPYKYFTWTVTYGTLSPLGSPQQVILINGQFPGPQLDLVTNNNVILNLINK  78

Query  1582  LDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRA  1403
             LD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF STQLH+A
Sbjct  79    LDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGTYTYFPSTQLHKA  138

Query  1402  AGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLIN  1223
             AGG+GALN+  RSVIP+PYP P   +T ++ DW+ T HK L+  LD+GK    P GLLIN
Sbjct  139   AGGFGALNVYHRSVIPVPYPYPDGDFTFLIGDWYKTSHKALKASLDSGKSLAFPDGLLIN  198

Query  1222  GRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHV  1043
             G+ +S T  G QG TYMFR+SNVGM+TSINFRIQ H LKLVEVEGSH +Q+ YDSLD+HV
Sbjct  199   GQTHS-TINGDQGKTYMFRISNVGMSTSINFRIQGHTLKLVEVEGSHVIQNIYDSLDVHV  257

Query  1042  GQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWS  863
             GQSA  LVTLN   KDYYIVAS+RF K  +T +A+LHY  S +   G LP+PP+ QYHWS
Sbjct  258   GQSAAVLVTLNQSPKDYYIVASTRFSKRVLTTTALLHYSNSHSPASGPLPNPPSYQYHWS  317

Query  862   MRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNP  683
             ++QAR+ RWN TANAARPNPQGSYHYG I   +T++LEN+   I+G  RYA+NKVSY+N 
Sbjct  318   VKQARSFRWNQTANAARPNPQGSYHYGKITPTKTILLENSAPLINGKLRYAVNKVSYINS  377

Query  682   TTPLKLADWLNIPGVFTLNAIKDTPP-AGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSY  506
              TPLKLAD+ NIPG+F +++I+  P   GPA    SV    LHD++E++FQNNE+T+QS+
Sbjct  378   DTPLKLADYFNIPGIFNVDSIQSLPSNNGPAYVATSVLPTSLHDFIELVFQNNEETMQSW  437

Query  505   HLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRS  326
             HLDG DFW VGYG G W  T R+ YNLVDA TR+T QVYPNSWT ILVSLDN+GMWNLRS
Sbjct  438   HLDGYDFWVVGYGFGQWTPTKRRFYNLVDAMTRHTAQVYPNSWTTILVSLDNQGMWNLRS  497

Query  325   SVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             ++W R YLGQQ+YLRVW ++HSLY E D+P + LLCG
Sbjct  498   AIWERQYLGQQLYLRVWTDQHSLYNEYDIPTNVLLCG  534



>ref|XP_007204826.1| hypothetical protein PRUPE_ppa003926mg [Prunus persica]
 gb|EMJ06025.1| hypothetical protein PRUPE_ppa003926mg [Prunus persica]
Length=539

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 408/527 (77%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  + GVLA F +++V+AEDPY+FY W V YGT SPLGV Q+ ILINGQFPGP ++V+T
Sbjct  7     LLHLVCGVLAVFSVAVVKAEDPYKFYTWTVTYGTRSPLGVPQQVILINGQFPGPRLDVVT  66

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNC I PN+N+TY+ Q KDQIG+Y
Sbjct  67    NDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCAIPPNSNYTYKFQTKDQIGSY  126

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF STQLHRAAG +GA+NI  R  IP+P+P P   +TL+V DW+NT HK LQ+ LD+GK
Sbjct  127   TYFPSTQLHRAAGAFGAINIYERPRIPIPFPNPDGDFTLLVGDWYNTSHKALQQTLDSGK  186

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P G+LING+  S TFTG QG TYMFR+SNVG++TS+NFRIQ H LKLVEVEGSHT+
Sbjct  187   SLPFPAGVLINGQ-TSNTFTGDQGKTYMFRISNVGLSTSLNFRIQGHSLKLVEVEGSHTI  245

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF K  +TA+++LHY  S T V G +
Sbjct  246   QNTYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTKLVLTATSVLHYTNSHTPVSGPV  305

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q HWS++QART RWNLTANAARPNPQGSYHYG +   +T++L N+   I+   R
Sbjct  306   PAGPTYQIHWSVQQARTFRWNLTANAARPNPQGSYHYGKVTPTKTIILANSAPLINEKQR  365

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA N+VSYVNP TPLKLAD+ NIPGV++ ++I+  P +G       V    LHD++EI+F
Sbjct  366   YAFNRVSYVNPDTPLKLADYFNIPGVYSSDSIQTVPSSGSTFIATPVVPASLHDFLEIVF  425

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE TLQS HLDG DFW VGYG G W +  R+ YNLVDA TR+T QVYPNSWT ILVSL
Sbjct  426   QNNENTLQSMHLDGYDFWVVGYGFGQWTAAKRRTYNLVDALTRHTAQVYPNSWTTILVSL  485

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWNLRS++W R YLGQQ YLRVWN   SL  E ++P +TLLCG
Sbjct  486   DNQGMWNLRSAIWERQYLGQQFYLRVWNPVRSLANEYNIPSNTLLCG  532



>ref|NP_195433.1| protein SKU5 similar 15 [Arabidopsis thaliana]
 emb|CAB16759.1| pectinesterase like protein [Arabidopsis thaliana]
 emb|CAB80382.1| pectinesterase like protein [Arabidopsis thaliana]
 gb|AEE86760.1| protein SKU5 similar 15 [Arabidopsis thaliana]
Length=541

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/535 (63%), Positives = 402/535 (75%), Gaps = 1/535 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             M+Q      +  +G L +    +V AEDPY FY W V YGT SPLGV Q+ ILINGQFPG
Sbjct  1     MKQTNLLVCKLFIGALFWLGSVLVNAEDPYMFYTWTVTYGTRSPLGVPQQVILINGQFPG  60

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN N++VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q+
Sbjct  61    PAIEAVTNNNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQL  120

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWW-NTDHKQL  1280
             KDQIGTY+YF ST LHRA+G +GALNI +RSVI  PYP P   +TL+VSDW+ N  HK L
Sbjct  121   KDQIGTYTYFASTSLHRASGAFGALNINQRSVITTPYPTPDGDFTLLVSDWFSNMTHKDL  180

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             +K LD G   P P  LLING    + FTG+QG TY FRVSNVG+ TSINFRIQNH + L+
Sbjct  181   RKSLDAGSALPLPDALLINGVSKGLIFTGQQGKTYKFRVSNVGIATSINFRIQNHTMSLI  240

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEG+HT+Q+ Y+SLD+HVGQS   LVTL A V+DY+IVAS+RF KP +T +A L Y GS
Sbjct  241   EVEGAHTLQESYESLDVHVGQSMTVLVTLKASVRDYFIVASTRFTKPVLTTTASLRYQGS  300

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
                  G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RTLVL N  
Sbjct  301   KNAAYGPLPIGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLVLANAA  360

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I G  RY +N++SY+NPTTPLKLADW NI GVF    I  TP  GPA  G SV  +EL
Sbjct  361   TLIYGKLRYTVNRISYINPTTPLKLADWYNISGVFDFKTIISTPTTGPAHIGTSVIDVEL  420

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             H++VEI+FQN+E+++QS+H+DG   +AVGYG G W+ T+RK+YNLVDA  R+T QVYP S
Sbjct  421   HEFVEIVFQNDERSIQSWHMDGTSAYAVGYGSGTWNVTMRKRYNLVDAVPRHTFQVYPLS  480

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WT ILVSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE + P + L CG
Sbjct  481   WTTILVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEAEPPLNVLYCG  535



>ref|XP_009777142.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=538

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/524 (64%), Positives = 408/524 (78%), Gaps = 1/524 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
              + G+L F  +S+V+AED YR++ W   YGT SPLGV Q+ ILINGQFPGP++++ITNEN
Sbjct  9     LICGILVFGSVSVVKAEDAYRYFTWTATYGTASPLGVPQQIILINGQFPGPKLDLITNEN  68

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             VI+N+INKLDEP+L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ QMKDQIG+Y+YF
Sbjct  69    VILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQMKDQIGSYTYF  128

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              STQLHRA GG+GALNI  RSVIP+PY +P+  ++L++ DW+ + HK L++ LD+GK  P
Sbjct  129   PSTQLHRAVGGFGALNIYARSVIPVPYAKPAGDFSLLIGDWYKSSHKVLRQILDSGKSLP  188

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P GLLING+  S +FTG QG TYMFR+SNVG+  + NFRIQ HK+++VEVEGSH +Q  
Sbjct  189   FPSGLLINGQKQS-SFTGDQGKTYMFRISNVGLKNTFNFRIQGHKMRVVEVEGSHVIQSL  247

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             YDSLD+HVGQS   LVTL+   KDYYIVAS+RF +  +TA+A+LHY  S T V G +P  
Sbjct  248   YDSLDVHVGQSMSVLVTLDQPPKDYYIVASTRFTRTVLTATAVLHYSNSQTSVSGPMPSA  307

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             PAGQ HWSM QART RWNLTANAARPNPQG++HYG I I R+ VL N+   I+G  RYA+
Sbjct  308   PAGQMHWSMLQARTFRWNLTANAARPNPQGTFHYGKITISRSFVLANSAPLINGKLRYAV  367

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N+VSYVNP TPLKLAD  NIPGVF+LN+I+  P  G      +VF    HD++EI+FQNN
Sbjct  368   NRVSYVNPDTPLKLADHFNIPGVFSLNSIQTFPSDGSPYLATAVFPASHHDFIEIVFQNN  427

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E T+QS+HLDG DFW VG+G G W    R KYNLVDA TR+T QVYP SWTAILVSLDN+
Sbjct  428   EATMQSWHLDGYDFWVVGFGSGTWTQASRNKYNLVDAPTRHTTQVYPKSWTAILVSLDNQ  487

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS++W R YLGQQVYLRV+N   SL  E  +P + LLCG
Sbjct  488   GMWNLRSAMWDRQYLGQQVYLRVYNPTQSLANEYYIPTNALLCG  531



>ref|XP_007047152.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
 gb|EOX91309.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
Length=538

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/527 (63%), Positives = 407/527 (77%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              LR L GVLA   +S+V AEDPY +Y W V YGT S LGV Q+ ILIN QFPGP++ V+T
Sbjct  6     MLRLLFGVLAVLSVSLVNAEDPYLYYTWTVTYGTRSLLGVPQQVILINDQFPGPKLEVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N N+I+N+INKLD+P L TWNG+KQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG+Y
Sbjct  66    NNNIILNLINKLDQPFLLTWNGVKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGSY  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRAAGG+GALNI  RSVIP+PY  P   +TL++ DW+ T HK LQ+ LD+GK
Sbjct  126   TYFPSTLMHRAAGGFGALNIYHRSVIPIPYANPDGDFTLLIGDWYKTSHKTLQQTLDSGK  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P G+LING+  + TF+G+QG TYMFR+SNVG++TS+NFRIQ H +KLVEVEGSH +
Sbjct  186   SLPFPDGVLINGQTQT-TFSGEQGKTYMFRISNVGLSTSLNFRIQGHTMKLVEVEGSHVI  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF K  +TA+A+LHY  S T V G L
Sbjct  245   QNLYDSLDVHVGQSVTVLVTLNQPPKDYYIVASTRFTKTVLTATAVLHYTNSQTPVSGPL  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  PA QYHWSM+QART RWNLT+NAARPNPQGS+HYG I   +T+VL N+   I+G  R
Sbjct  305   PAAPAYQYHWSMQQARTYRWNLTSNAARPNPQGSFHYGKITTTKTIVLANSGSLINGKLR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N VS+VNP TPLKLAD+ NIPGVF++++I+D P  G A    SV    LHD++E++F
Sbjct  365   YTVNGVSFVNPDTPLKLADYFNIPGVFSMSSIQDLPSGGAATVATSVVPTSLHDFIEVVF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE T+QS+HLDG DFW VG+G G W    R+ YNL+DA TR+T QVYPNSWTAILVSL
Sbjct  425   QNNENTMQSWHLDGYDFWVVGFGSGQWAPKKRRTYNLIDALTRHTTQVYPNSWTAILVSL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWN+RS++W R YLGQQ YLRVW    S   E D+P + LLCG
Sbjct  485   DNQGMWNMRSAMWERQYLGQQFYLRVWTPVRSFANEYDIPSNVLLCG  531



>ref|XP_009594576.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=538

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/524 (63%), Positives = 406/524 (77%), Gaps = 1/524 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
              + G+L F  +S+V+AED YR++ W   YGT SPLGV Q+ ILINGQFPGP+++++TNEN
Sbjct  9     LICGILVFGSVSVVKAEDAYRYFTWTATYGTASPLGVPQQIILINGQFPGPKLDLVTNEN  68

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             VI+N+INKLDEP+L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ QMKDQIG+Y+YF
Sbjct  69    VILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQMKDQIGSYTYF  128

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              STQLHRA GG+GALNI  RSVIP+PY +P+  ++L++ DW+ + HK L++ LD+GK  P
Sbjct  129   PSTQLHRAVGGFGALNIYARSVIPVPYAKPAGDFSLLIGDWYKSSHKVLRQILDSGKSLP  188

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P GLLING+  S TFTG QG TYMFR+SNVG+  + NFRIQ HK+++VEVEGSH +Q  
Sbjct  189   FPSGLLINGQKQS-TFTGDQGKTYMFRISNVGLKNTFNFRIQGHKMRVVEVEGSHVIQSL  247

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             YDSLD+HVGQS   LVTL+   KDYYIVAS+RF +  +TA+A+LHY  S   V G +P  
Sbjct  248   YDSLDVHVGQSMSVLVTLDQPPKDYYIVASTRFTRTVLTATAVLHYSNSKASVSGPMPSA  307

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             PAGQ HWSM QART RWNLT NAARPNPQG++HYG I I RT VL N+   I+G  RYA+
Sbjct  308   PAGQMHWSMLQARTFRWNLTENAARPNPQGTFHYGKITISRTFVLANSAPLINGKLRYAV  367

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N+VSYVNP TPLKLAD  NIPGVF+LN+I+  P  G      +VF    HD++EI+FQNN
Sbjct  368   NRVSYVNPDTPLKLADHFNIPGVFSLNSIQTFPSDGSPYLATAVFPASHHDFIEIVFQNN  427

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E T+QS+HLDG DFW VG+G   W    R KYNLVDA TR+T QVYP SWTAILVSLDN+
Sbjct  428   EATMQSWHLDGYDFWVVGFGSRTWTQASRNKYNLVDAPTRHTTQVYPKSWTAILVSLDNQ  487

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS++W R YLGQQVYLRV+N   SL  E D+P + LLCG
Sbjct  488   GMWNLRSAMWDRQYLGQQVYLRVYNPTQSLANEYDIPTNALLCG  531



>ref|XP_004141928.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004157172.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=537

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/528 (63%), Positives = 406/528 (77%), Gaps = 1/528 (0%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
             G LR + G  A   +S+V AE+PYRFY W V YGTISPLGV Q+ ILINGQFPGP++ V+
Sbjct  5     GLLRLIFGAFALLSVSLVNAENPYRFYTWTVTYGTISPLGVPQQVILINGQFPGPKLEVV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+I+N+ NKLDEP+L TWNGIKQRK+SW DGV+GTNCPI  N+N+TY  Q KDQIG+
Sbjct  65    TNDNIILNLFNKLDEPLLLTWNGIKQRKNSWQDGVVGTNCPIPLNSNYTYSFQTKDQIGS  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             ++YF STQ H+AAGG+GALN+ +R  IP+PYP     +TL++ DW+ T+HK LQ+ LD+G
Sbjct  125   FAYFPSTQFHKAAGGFGALNVYQRPRIPIPYPIQDGDFTLLIGDWYKTNHKSLQESLDSG  184

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
                P P G+LING+ +S TFTG QG TYMFR+SNVG++TS+NFRIQ HK+KLVEVEGSHT
Sbjct  185   GSLPLPDGVLINGQTHS-TFTGDQGKTYMFRISNVGLSTSLNFRIQGHKMKLVEVEGSHT  243

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDSLD+HVGQS   LVTL+   KDYYIVAS+RF K  +TA+A+LHY  S + V G 
Sbjct  244   LQNLYDSLDVHVGQSLSVLVTLDQAPKDYYIVASTRFTKTVLTATAVLHYSNSNSPVSGP  303

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             LP  P  +  WS++QART RWNLTANAARPNPQGS+HYG I   +T+VL  +   I+G  
Sbjct  304   LPAGPTIEVDWSVKQARTFRWNLTANAARPNPQGSFHYGKIIPTKTIVLATSAALINGKQ  363

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N+VSYVN  TPLKLAD+ NIPGVF++++++  P  GPA    SV    LHD+VEI+
Sbjct  364   RYAINRVSYVNSDTPLKLADYFNIPGVFSVDSLQSLPSDGPAFIATSVLPTALHDFVEIV  423

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE T+QS+HLDG DFW VGYG G W    R  YNLVDA TR+T QVYPNSWT ILVS
Sbjct  424   FQNNENTVQSFHLDGYDFWVVGYGSGQWSQDSRNSYNLVDALTRHTAQVYPNSWTTILVS  483

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRSS+W R YLGQQ YLRVW    SL  E ++P + LLCG
Sbjct  484   LDNQGMWNLRSSIWERQYLGQQFYLRVWTQTQSLANEYNIPSNALLCG  531



>ref|XP_006285189.1| hypothetical protein CARUB_v10006539mg [Capsella rubella]
 gb|EOA18087.1| hypothetical protein CARUB_v10006539mg [Capsella rubella]
Length=540

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/534 (62%), Positives = 402/534 (75%), Gaps = 0/534 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             M+Q      +  +G L +    +V  EDPY FY W V YGT SPLGV Q+ ILINGQFPG
Sbjct  1     MKQTNLLLCKLFIGTLFWLGSVLVNGEDPYMFYTWTVTYGTRSPLGVPQQVILINGQFPG  60

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN N++VN+INKLDEP L TWNG+KQR+++W DGVLGTNCPI PN+NWTY+ Q+
Sbjct  61    PAIEAVTNNNIVVNLINKLDEPFLITWNGVKQRRTTWQDGVLGTNCPIQPNSNWTYQFQL  120

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGTY+YF ST +HRA+G +GALN+ +R+VI  PYP P   +TL+VSDW+   HK L+
Sbjct  121   KDQIGTYTYFASTWMHRASGAFGALNVNQRAVITTPYPTPDGDFTLLVSDWFKMSHKDLR  180

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             K+LD G   P P  LLING    + FTG+QG TY FR+SNVG+ TSINFRIQNH + L+E
Sbjct  181   KRLDAGYALPLPDALLINGASKGLVFTGRQGKTYKFRISNVGIATSINFRIQNHTMSLIE  240

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEG+HT+Q+ Y+SLD+HVGQS   LVTL A V+DY+IVAS+RF KP +T +A L Y GS 
Sbjct  241   VEGAHTLQESYESLDVHVGQSVTVLVTLKASVRDYFIVASTRFTKPVLTTTASLRYLGSK  300

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
                 G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RTLVL N   
Sbjct  301   NAAYGPLPIGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLVLANAAT  360

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I G  RY +N++SY+NPTTPLKLADW NI GVF    I  TP  GPA  G SV  +ELH
Sbjct  361   MIYGKLRYTVNRISYINPTTPLKLADWYNISGVFDFKTILSTPTTGPAHFGTSVIDVELH  420

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSW  377
             ++VEI+FQN+E+++QS+H+DG   +AVGYG G W+ T+RK+YNLVDA  R+T QVYP SW
Sbjct  421   EFVEIVFQNDERSIQSWHMDGTSAYAVGYGSGTWNVTMRKRYNLVDAVPRHTFQVYPLSW  480

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             T+ILVSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE D P + L CG
Sbjct  481   TSILVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEADPPLNVLYCG  534



>ref|XP_002522337.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF40021.1| multicopper oxidase, putative [Ricinus communis]
Length=539

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/528 (63%), Positives = 410/528 (78%), Gaps = 2/528 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFF-CISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
             FL  L  V A    +S+V A+DPYR+Y W V  GTISPLG  Q+ ILINGQFPGP ++V+
Sbjct  6     FLHLLFAVFAVLGTVSLVNADDPYRYYTWTVTDGTISPLGSPQQVILINGQFPGPRLDVV  65

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY++Q KDQIG+
Sbjct  66    TNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKLQTKDQIGS  125

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             ++YF ST LHRAAGGYG LN+  R  IP+P+P P   +TL+V DW+ TDHK LQ  LD+G
Sbjct  126   FTYFPSTLLHRAAGGYGGLNVYERPRIPIPFPNPDGDFTLLVGDWYKTDHKTLQASLDSG  185

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
                P P G+LING+ ++ TF+G QG TYM R+SNVG++TS+NFRIQ HK+KLVEVEGSHT
Sbjct  186   NSLPFPDGVLINGQTHT-TFSGDQGKTYMLRISNVGLSTSLNFRIQGHKMKLVEVEGSHT  244

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDSLD+HVGQS   LVTL+   KDYYIVAS+RF +  +TA+A+LHY  S T   G 
Sbjct  245   IQNIYDSLDVHVGQSVAVLVTLDQPPKDYYIVASTRFTRQVLTATAVLHYSNSQTPASGP  304

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             LP PP+G +HWSM+QART RWNLTA+AARPNPQGS+HYG I   +T+VL N+   I+G  
Sbjct  305   LPAPPSGLFHWSMQQARTYRWNLTASAARPNPQGSFHYGKIIPTKTIVLANSAPLINGKR  364

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N+VSYVN  TPLKLAD+ NIPGVF++++I+  P  GPA    SV    LHD+VE++
Sbjct  365   RYAVNRVSYVNADTPLKLADYFNIPGVFSVDSIQSLPSDGPAYVATSVLPTSLHDFVEVV  424

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE T+QS+HLDG DFW VGYG G W    R+ YNLVDA TR+T QVYP +WTAILVS
Sbjct  425   FQNNEYTMQSWHLDGYDFWVVGYGAGQWAPNKRRTYNLVDALTRHTAQVYPKAWTAILVS  484

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWN+RS++W R YLGQQ+YLRVW   HSL  E D+P + LLCG
Sbjct  485   LDNQGMWNMRSAIWERQYLGQQLYLRVWTQVHSLANEYDIPCNALLCG  532



>ref|XP_009138463.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=540

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/524 (63%), Positives = 400/524 (76%), Gaps = 0/524 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F+  +L +    +V+AEDPY FY W V YGT SPLGV Q+ ILINGQFPGP I  +TN N
Sbjct  11    FIGTLLVWLGSVLVKAEDPYLFYTWTVTYGTRSPLGVPQQVILINGQFPGPAIEAVTNNN  70

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             ++VN+INKLDEP L TWNGIKQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQIGT++YF
Sbjct  71    IVVNLINKLDEPFLITWNGIKQRRTSWQDGVLGTNCPIPPNSNWTYQFQLKDQIGTFTYF  130

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              ST +HRA+G +GALNI +RSVI  PY  P   +TL+V+DW+   HK L+K+LD G   P
Sbjct  131   ASTSMHRASGAFGALNINQRSVITTPYLTPDGDFTLLVTDWFKLSHKDLRKRLDAGYALP  190

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P  LLING    + FTG+QG TY FRVSNVG+ TSINFRIQNH L L+EVEG+HT+Q+ 
Sbjct  191   LPDALLINGASKGLIFTGQQGKTYKFRVSNVGIATSINFRIQNHTLTLIEVEGAHTLQES  250

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y+SLD+HVGQS   LVTL A V+DYYIVASSRF KP +  +A L Y GS   V G LP  
Sbjct  251   YESLDVHVGQSVTVLVTLKASVRDYYIVASSRFTKPVLNTTASLRYLGSKNAVYGPLPVG  310

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P    HWSM+QARTIR NLTANAARPNPQGSYHYGTIPI RTLVL N    + G  RY +
Sbjct  311   PTYHIHWSMKQARTIRMNLTANAARPNPQGSYHYGTIPINRTLVLANAATMLYGKLRYTV  370

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N++SY+NPTTPLKLADW NI GVF    I  TP  GPA  G SVF +ELH++VEI+FQN+
Sbjct  371   NRISYINPTTPLKLADWYNISGVFDFKTILSTPTIGPAHFGTSVFDIELHEFVEIVFQND  430

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E+++QS+H+DG   + VG+G G W+ T+RK+YNLVDA  R+T QVYP SWT+ILVSLDNK
Sbjct  431   ERSIQSWHMDGTSAFLVGFGSGTWNETMRKRYNLVDAVARHTFQVYPLSWTSILVSLDNK  490

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS +W R YLGQ++Y+RVWN+E SLYTE D P + L CG
Sbjct  491   GMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEADPPLNALYCG  534



>ref|XP_003517277.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=540

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/531 (63%), Positives = 410/531 (77%), Gaps = 3/531 (1%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinv  1622
             +G L  +  V+A   +S+V+AED Y+++ W V YGT+ PL   Q+ ILINGQFPGP +++
Sbjct  4     TGLLHLICLVIALVSVSLVQAEDAYKYFTWTVTYGTLYPLASPQQVILINGQFPGPRLDL  63

Query  1621  itnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIG  1442
             +TNENVI+N+INKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG
Sbjct  64    VTNENVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIG  123

Query  1441  TYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDT  1262
             TY+YF STQLH+AAGG+GALN+  RSVIP+PYP P   +TL+V DW+ T+HK L++ LD+
Sbjct  124   TYTYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTLRQTLDS  183

Query  1261  GKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             GK    P GLLING+ +S TFTG QG TYMFR+SNVG++TSINFRIQ H LKLVEVEGSH
Sbjct  184   GKSLAFPDGLLINGQAHS-TFTGNQGKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGSH  242

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPG  902
             T+Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +T +A+LHY  S +   G
Sbjct  243   TVQNLYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTETPLTTTAVLHYANSFSSALG  302

Query  901   KLPDPPAGQYH--WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENIS  728
              +P PP  +Y   WSM+QART RWNLTANAARPNPQGS+HYG I   + + L N+   I+
Sbjct  303   PVPAPPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIKLANSAPLIN  362

Query  727   GITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYV  548
             G  RYA+N VSYVNP TPLKLAD+ NIPGVF++N ++++P  GP   G SV    LHD++
Sbjct  363   GKLRYAVNSVSYVNPDTPLKLADYFNIPGVFSVNLLQNSPSNGPGYIGTSVLQTSLHDFI  422

Query  547   EIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAI  368
             E+IFQNNE T+QS+HLDG DFW +G+G G W    RK YNLVDA TR+T QVYP SWT I
Sbjct  423   EVIFQNNENTMQSWHLDGYDFWVIGHGFGQWTDASRKTYNLVDALTRHTAQVYPKSWTTI  482

Query  367   LVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LVSLDN+GMWNLRS++W R YLGQQ YLRVWN + SL  E D+P + LLCG
Sbjct  483   LVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNAQKSLANEYDIPNNVLLCG  533



>ref|XP_009140476.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
 emb|CDY38959.1| BnaA04g13800D [Brassica napus]
Length=539

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/527 (61%), Positives = 406/527 (77%), Gaps = 0/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              ++  L    F  + ++ AEDPYRF+ W V YGT SPLGV Q+ ILINGQFPGP I  +T
Sbjct  7     LIQVFLLAYCFGSVCVINAEDPYRFFTWTVTYGTRSPLGVPQQVILINGQFPGPPIEGVT  66

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N++VN+INK+DEP+L TWNGIKQR+ SW DGVLGT+CPI PN+NWTY  Q+KDQIGTY
Sbjct  67    NDNILVNLINKIDEPLLITWNGIKQRRMSWQDGVLGTSCPIQPNSNWTYHFQLKDQIGTY  126

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRA+G +GALN+ +RSVI +PY +P   +TL+VSDW+   HK L+K+LD+G+
Sbjct  127   TYFASTSMHRASGAFGALNVNQRSVIFVPYHKPDGDFTLLVSDWYKMGHKALRKRLDSGR  186

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P GLLING    + FTG+ G  Y FR+SNVG++TSINFRIQ H + LVEVEGSHT+
Sbjct  187   ALPLPDGLLINGASKGLAFTGEHGKFYRFRISNVGISTSINFRIQGHMMTLVEVEGSHTL  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             ++ Y+SLD+HVGQS   LVTL A VKDY+IVAS+RF KP +T SAILHY GS T+    L
Sbjct  247   EEVYESLDVHVGQSLTVLVTLKAPVKDYFIVASTRFTKPVLTTSAILHYKGSKTRPSRPL  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QARTIR NLTANAARPNPQG++HYGTIPI +TLVL N +  I+G  R
Sbjct  307   PIGPTYHIHWSMKQARTIRLNLTANAARPNPQGAFHYGTIPISQTLVLANARTKINGKLR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N+VSYVNPTTPLKLADW NIPGVF    IK+ P  GP++ G SV    LH+YVE +F
Sbjct  367   YTVNRVSYVNPTTPLKLADWYNIPGVFDFKTIKNIPTPGPSILGTSVLDFALHEYVEFVF  426

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE+++QS+H+DG + + VGYG G W+  +RK+YN VDA +R+T QVYP SWT++L SL
Sbjct  427   QNNERSIQSWHIDGTNAYVVGYGTGTWNVAMRKRYNYVDAVSRHTFQVYPMSWTSVLASL  486

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWN+RS +W R YLGQ++Y+RVWNNE SLYTE + P + L CG
Sbjct  487   DNKGMWNVRSQIWSRRYLGQELYVRVWNNERSLYTEAEPPLNALYCG  533



>ref|XP_010255117.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
 ref|XP_010255118.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=545

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/532 (62%), Positives = 412/532 (77%), Gaps = 6/532 (1%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  +LGVLA   + +V+AEDPY++Y W V YG ISPLGV Q+ ILINGQFPGP ++V+T
Sbjct  8     LLHLVLGVLACLSVPLVKAEDPYKYYTWTVTYGKISPLGVPQQVILINGQFPGPRLDVVT  67

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+++N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPILPN+N+TY+ Q KDQIG++
Sbjct  68    NDNIVLNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPILPNSNYTYKFQTKDQIGSF  127

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST LH+AAGGYG LN+ +R  IP+P+P+P   +TL++ DW+ T+HK LQ+ LD+GK
Sbjct  128   TYFPSTSLHKAAGGYGGLNVYQRPGIPIPFPKPDGDFTLLIGDWYKTNHKTLQQYLDSGK  187

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
             P P P GLLING+ ++ +F+G QG TYMFR+SNVG+++SINFRIQ H LKLVEVEGSHT+
Sbjct  188   PLPFPDGLLINGQAHT-SFSGDQGKTYMFRISNVGLSSSINFRIQGHTLKLVEVEGSHTI  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q  YDSLD+HVGQS   LVTLN   KDYYIVAS+RF    +T +A+LHY  S T V G+L
Sbjct  247   QIIYDSLDVHVGQSVAVLVTLNQSPKDYYIVASTRFTSTVLTTTAVLHYTNSHTPVSGQL  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P+ Q  WSM+QART RWNLTA+AARPNPQGS+HYG I   RT+VL N+   I+G  R
Sbjct  307   PSGPSYQIDWSMQQARTFRWNLTASAARPNPQGSFHYGQIKPSRTIVLANSAPQINGKQR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N+VSY+N  TPLKLAD+ NIPGVF+LN+I+  P  GPA+   +V    LH+++E++F
Sbjct  367   YAVNRVSYINSDTPLKLADYFNIPGVFSLNSIQTAPSGGPALLATAVMPASLHEFIEVVF  426

Query  535   QNNEKTLQSYHLDGQDFWAVGYGG-----GVWDSTLRKKYNLVDATTRYTVQVYPNSWTA  371
             QNNE T+QS+HLDG DFW VGYG      G W    R  YNL+D  TR+T QVYPNSWT 
Sbjct  427   QNNENTIQSWHLDGYDFWVVGYGECRYGHGQWTPASRNGYNLIDTLTRHTAQVYPNSWTT  486

Query  370   ILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             I VSLDN+GMWNLRS++W R YLGQQ YLRVWN + +   E D+PP+ LLCG
Sbjct  487   IWVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNQDKTPANEYDIPPNALLCG  538



>ref|XP_010028301.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 ref|XP_010028302.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55013.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
 gb|KCW55014.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
Length=538

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/528 (63%), Positives = 404/528 (77%), Gaps = 1/528 (0%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
             G +  +L  LA F  S V A+DPYRFY W V YGTI+PLGV Q+ ILINGQFPGP++ V+
Sbjct  5     GVISLILCFLAVFSASAVVADDPYRFYTWTVTYGTIAPLGVSQQVILINGQFPGPKLEVV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+++N+IN LD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TYR Q KDQIGT
Sbjct  65    TNDNIVLNLINNLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYRFQAKDQIGT  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             ++YF ST LH+AAGG+GA+N+  R  IP+P+P P+  +TL+  +W+ T HK LQ+ LD+G
Sbjct  125   FTYFPSTLLHKAAGGFGAINVYERPQIPIPFPTPAGDFTLLAGNWYKTGHKTLQQSLDSG  184

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             K  P P G+LING+  + TF+G QG TYMFR+SNVGM+TS+NFRIQ H LKLVEVEGSHT
Sbjct  185   KSLPFPDGILINGQART-TFSGDQGKTYMFRISNVGMSTSLNFRIQGHTLKLVEVEGSHT  243

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDS+D+HVGQS   LVTLN   KDYYIVAS+RF K  + A+A+LHY  S+T V G 
Sbjct  244   VQNMYDSIDVHVGQSMAVLVTLNQPPKDYYIVASTRFTKTVLNATAVLHYTNSLTPVSGP  303

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             LP  P  Q HWSM+QARTIRWNLTA+AARPNPQGSYHYG I I RT+VL N+   I+G  
Sbjct  304   LPAGPTYQKHWSMKQARTIRWNLTASAARPNPQGSYHYGKIAISRTIVLANSAPLINGKQ  363

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N VSY+N  TPLKLAD+ NI GVF+ N+++  P  G A    SV    LH+++EI+
Sbjct  364   RYAVNGVSYINSDTPLKLADYFNIAGVFSTNSLQSVPSGGSASLATSVMPASLHEFIEIV  423

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE  +QS+HLDG DFW VGYG G W    RK YNLVDA TR+T QVYP +WT+ILVS
Sbjct  424   FQNNENAVQSWHLDGYDFWVVGYGFGQWTPASRKIYNLVDAPTRHTAQVYPRAWTSILVS  483

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRS+ W R YLGQQ YLRVW  +HSL  E  +P + LLCG
Sbjct  484   LDNQGMWNLRSAAWERQYLGQQFYLRVWTPDHSLANEYGIPSNALLCG  531



>ref|XP_007156841.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
 gb|ESW28835.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
Length=540

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/529 (63%), Positives = 409/529 (77%), Gaps = 3/529 (1%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  L  V+A   +S+V+AED Y+FY W V YG +SPLG  Q+ ILINGQFPGP+++++T
Sbjct  6     LLHLLCFVIASVSVSLVQAEDAYKFYTWTVTYGNLSPLGSPQQVILINGQFPGPKLDLVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+NVI+N+INKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY
Sbjct  66    NDNVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTY  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             SYF STQLH+AAGG+G LN+  RSVIP+PY  P   +TL++ DW+ T+HK L++ LD+GK
Sbjct  126   SYFPSTQLHKAAGGFGGLNVYHRSVIPIPYQNPDGDFTLLIGDWYKTNHKTLRQTLDSGK  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
                 P GLLING+ +S TFTG QG TYMFR+SNVG++TSINFRIQ H LKLVEVEGSHT+
Sbjct  186   SIGLPDGLLINGQPHS-TFTGNQGKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGSHTI  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +T +A+LHY  S +   G +
Sbjct  245   QNIYDSLDVHVGQSVSLLVTLNQPPKDYYIVASTRFTETPLTTTAVLHYSNSFSSALGPV  304

Query  895   PDPPAGQYH--WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGI  722
             P  P  +Y   WSM+QART RWNLTANAARPNPQGS+HYG I   + + L N+  +I+G 
Sbjct  305   PPSPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIKLANSAPSINGK  364

Query  721   TRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEI  542
              RYA+N VSYVNP TPLKLAD+ NIPG+F++N +++TP +GP     SV    LHD++E+
Sbjct  365   LRYAVNSVSYVNPDTPLKLADYFNIPGIFSVNLLQNTPSSGPGYIATSVLPTSLHDFIEV  424

Query  541   IFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILV  362
             IFQNNE T+QS+HLDG DFW +GYG G W    RK YNLVDA TR+T QVYP SWTAILV
Sbjct  425   IFQNNENTMQSWHLDGYDFWVIGYGFGQWSDASRKTYNLVDALTRHTAQVYPKSWTAILV  484

Query  361   SLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             SLDN+GMWNLRS++W R YLGQQ YLRVWN + SL  E D+P + LLCG
Sbjct  485   SLDNQGMWNLRSAIWERQYLGQQFYLRVWNAQRSLANEYDIPNNVLLCG  533



>ref|XP_009366415.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/535 (62%), Positives = 407/535 (76%), Gaps = 2/535 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFC-ISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             M+Q     L  + GVLA F   S+V+AEDPY+FY W V YGT+SPLGV Q+ ILINGQFP
Sbjct  1     MKQKAGFLLHLVCGVLAVFLNSSVVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFP  60

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP ++V+TN+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q
Sbjct  61    GPTLDVVTNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQ  120

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
              KDQIG+++YF STQ H+AAGG+G +N+  R  IP+PYP P   +TL+  DW+NT HK L
Sbjct  121   TKDQIGSFTYFPSTQFHKAAGGFGGINVYARPRIPVPYPIPDGDFTLLAGDWYNTSHKAL  180

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             Q+ LD GK  P P G+LING   S TF+G QG TYMFR+SNVG++TS+NFRI+ HKLKLV
Sbjct  181   QQSLDFGKSLPFPSGVLINGH-TSNTFSGDQGKTYMFRISNVGLSTSLNFRIEGHKLKLV  239

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             E EGSH +Q+ YDSLDIHVGQS   LVT N   KDYYIVAS+RF +  +TA++++HY  S
Sbjct  240   ECEGSHPIQNLYDSLDIHVGQSVSVLVTFNQAPKDYYIVASTRFTRHVLTATSVIHYTNS  299

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
                V G +P  P  Q HWSM+QART RWNLTANAARPNPQGS+HYG +   +T+VL N+ 
Sbjct  300   HASVSGPVPAGPTYQRHWSMKQARTFRWNLTANAARPNPQGSFHYGHVTPTKTIVLANSA  359

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I+G  RYA N+VSYVNP TPLKLAD+ NIPGVF+LN+I+  P  G A  G  V  +  
Sbjct  360   PLINGKQRYAFNRVSYVNPDTPLKLADYFNIPGVFSLNSIQTVPSDGSAFVGAPVMPVSH  419

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             HD+VEI+FQNNE ++QS HLDG DFW VGYG G W    R+ YNLVDA TR+T QVYPNS
Sbjct  420   HDFVEIVFQNNENSVQSMHLDGYDFWVVGYGSGPWTPAKRRTYNLVDALTRHTAQVYPNS  479

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WT ILVSLDN+GMWNLRS++W R YLGQQ YLRVW+   SLY E ++P + LLCG
Sbjct  480   WTTILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWDPVQSLYNEYNIPSNALLCG  534



>ref|XP_006296162.1| hypothetical protein CARUB_v10025315mg [Capsella rubella]
 gb|EOA29060.1| hypothetical protein CARUB_v10025315mg [Capsella rubella]
Length=540

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/527 (62%), Positives = 402/527 (76%), Gaps = 3/527 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCIS---MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L+G L  +C S   +V AEDPY ++ W V YGT SPLGV Q+ ILINGQFPGP I  +T
Sbjct  7     LLVGFLLAYCFSSVFVVNAEDPYLYFTWTVTYGTRSPLGVPQQIILINGQFPGPAIEGVT  66

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N N++VNVINKLDEP L TWNGIKQR+ SW DGVLGTNCPI PN+NWTY  Q+KDQIGTY
Sbjct  67    NNNIVVNVINKLDEPFLITWNGIKQRRMSWQDGVLGTNCPIQPNSNWTYHFQLKDQIGTY  126

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
              YF ST +HRA+G +GALN+ +RSVI +PYP+P A +TL+VSDW+   HK+L++ LD+G+
Sbjct  127   VYFASTSMHRASGAFGALNVYQRSVIFVPYPKPDADFTLLVSDWYKMGHKELRRSLDSGR  186

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P GLLING    + FTG+ G  Y FR+SNVG++TSINFRIQ H + LVEVEGSHT+
Sbjct  187   ALPLPDGLLINGASKGLVFTGQHGKIYRFRISNVGISTSINFRIQGHMMTLVEVEGSHTL  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+SLDIHVGQS   LVTL A VKDY++VAS+RF KP +T + IL Y GS  +    L
Sbjct  247   QEVYESLDIHVGQSVTVLVTLKAPVKDYFVVASTRFTKPVLTTTGILSYQGSKIRPSHPL  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P    HWSM+QAR+IR NLTANAARPNPQGS+HYGTIPI RT VL N +  I+G  R
Sbjct  307   PIGPTYHIHWSMKQARSIRLNLTANAARPNPQGSFHYGTIPINRTFVLANGRATINGKLR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N+VSYVNPTTPLKLADW NIPGVF    + + P  GP++ G SVF + LH+YVE +F
Sbjct  367   YTVNRVSYVNPTTPLKLADWFNIPGVFNFRTMMNIPTPGPSILGTSVFDVALHEYVEFVF  426

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE+++QS+HLDG   + VGYG G W+   R+ YNLVDA +R+T QVYP SWT++LVSL
Sbjct  427   QNNERSIQSWHLDGTSAYVVGYGPGTWNLAKRRGYNLVDAVSRHTFQVYPMSWTSVLVSL  486

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE + P + L CG
Sbjct  487   DNKGMWNLRSQIWSRRYLGQELYVRVWNDERSLYTEAEPPINALFCG  533



>ref|XP_004509178.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=543

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/526 (62%), Positives = 402/526 (76%), Gaps = 2/526 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
               LG+LA +    V AED Y F+ W +  GTI PLGV Q GILINGQFPGP I+ ITN+N
Sbjct  9     IFLGILACWSALSVIAEDRYLFFTWEITNGTIFPLGVPQEGILINGQFPGPTIDAITNDN  68

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +++NVINKLD+  L TWNGIKQRK+SW DGVLGTNC I PNTNWTY+ Q+KDQIGTY+YF
Sbjct  69    IVINVINKLDDKFLITWNGIKQRKTSWQDGVLGTNCAIPPNTNWTYKFQLKDQIGTYTYF  128

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              +T++H+AAGG+G  NI +RSVI +PYP P   +TL+V DW+ T+H+ L++ LD GK  P
Sbjct  129   PTTKIHKAAGGFGGFNIQQRSVISIPYPAPDGEFTLLVGDWYKTNHRVLRRLLDLGKSLP  188

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P  LLING+ +   FTG+ G TY FRVSNVG+ TSINFRIQ H LKL+EVEG+HT+Q+ 
Sbjct  189   FPDALLINGQKDVAVFTGEAGKTYKFRVSNVGIATSINFRIQGHSLKLIEVEGAHTLQET  248

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y SLD+HVGQS   LVTL+  + DYYIVASSRF  P +T ++ L Y GS TK  G+LP  
Sbjct  249   YKSLDVHVGQSVTVLVTLDKSIGDYYIVASSRFTDPVLTTTSTLRYSGSNTKASGQLPIA  308

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P     WS++QARTIR NLTANAARPNPQGS+HYGTIP++R L L N+K  + G  RYA+
Sbjct  309   PTTDLDWSIKQARTIRLNLTANAARPNPQGSFHYGTIPVLRILQLANSKSIVKGKLRYAV  368

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAG--PAVHGVSVFGLELHDYVEIIFQ  533
             N +S++NP+TPLKLADW NIPGVF LN IKD P +   P   G SV GL LHD+ EIIFQ
Sbjct  369   NGISHINPSTPLKLADWFNIPGVFDLNTIKDFPSSSNNPIKLGTSVIGLTLHDFAEIIFQ  428

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             NNE T+QS+H+DG  F+ VGYG G+W S +R+ YNLVD  +R+TVQVYP SW+AI+VSLD
Sbjct  429   NNENTIQSWHMDGSSFYVVGYGNGIWTSKVRETYNLVDGVSRHTVQVYPKSWSAIMVSLD  488

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             NKGMWNLRS++W   YLGQ++YLRVWNNE SLYTE ++P + L CG
Sbjct  489   NKGMWNLRSAIWENRYLGQELYLRVWNNEQSLYTETNVPLNALFCG  534



>ref|XP_010437285.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=540

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/534 (61%), Positives = 401/534 (75%), Gaps = 0/534 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             M+Q      +  +G L      +V  EDPY FY W V YGT SPLGV Q+ ILINGQFPG
Sbjct  1     MKQTNLLLCKLFIGALFLLGSVLVNGEDPYMFYTWTVTYGTRSPLGVPQQVILINGQFPG  60

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN NV+VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q+
Sbjct  61    PPIEAVTNNNVVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQL  120

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGTY+YF ST +HRA+G +GALN+ +R+VI  PY  P   +TL+VSDW+   HK L+
Sbjct  121   KDQIGTYTYFASTSMHRASGAFGALNVNQRAVITTPYATPDGDFTLLVSDWFKMSHKDLR  180

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             K+LD G   P P  LLING    + FTG+QG TY FR+SNVG+ TSINFRIQNH + L+E
Sbjct  181   KRLDAGYALPLPDALLINGASKGLVFTGQQGKTYKFRISNVGIATSINFRIQNHTMSLIE  240

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEG+HT+Q+ Y+SLD+HVGQS   LVTL A V+DY+IVAS+RF KP +T +A L Y GS 
Sbjct  241   VEGAHTLQESYESLDVHVGQSLTVLVTLKASVRDYFIVASTRFTKPVLTTTASLRYLGSQ  300

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
                 G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RTLVL N   
Sbjct  301   NAAYGPLPIGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLVLANAAT  360

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I+G  RY +N++SY+NPTTPLKLADW NI GVF    I  TP  GPA  G SV  +ELH
Sbjct  361   MINGKLRYTVNRISYINPTTPLKLADWYNISGVFDFKTILSTPTIGPAHFGTSVIDVELH  420

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSW  377
             ++VEI+FQN+E+++QS+H+DG   + VGYG G W++T+R++YNLVDA  R+T QVYP SW
Sbjct  421   EFVEIVFQNDERSIQSWHMDGTSAYPVGYGSGTWNATMRRRYNLVDAVPRHTFQVYPLSW  480

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             T+ILVSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE + P + L CG
Sbjct  481   TSILVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEAEPPLNVLYCG  534



>ref|XP_004509176.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Cicer arietinum]
Length=547

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/523 (63%), Positives = 409/523 (78%), Gaps = 8/523 (2%)
 Frame = -2

Query  1762  FCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNK  1583
             F +  V+AEDPY+++ W V YGT+SPLG  Q+ ILINGQFPGP+++++TN NVI+N+INK
Sbjct  19    FNVPQVKAEDPYKYFTWTVTYGTLSPLGSPQQVILINGQFPGPQLDLVTNNNVILNLINK  78

Query  1582  LDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRA  1403
             LD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF STQLH+A
Sbjct  79    LDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGTYTYFPSTQLHKA  138

Query  1402  AGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLIN  1223
             AGG+GALN+  RSVIP+PYP P   +T ++ DW+ T HK L+  LD+GK    P GLLIN
Sbjct  139   AGGFGALNVYHRSVIPVPYPYPDGDFTFLIGDWYKTSHKALKASLDSGKSLAFPDGLLIN  198

Query  1222  GRLNSVTFTGKQG------STYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYD  1061
             G+ +S T  G QG       TYMFR+SNVGM+TSINFRIQ H LKLVEVEGSH +Q+ YD
Sbjct  199   GQTHS-TINGDQGYFLISGKTYMFRISNVGMSTSINFRIQGHTLKLVEVEGSHVIQNIYD  257

Query  1060  SLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPA  881
             SLD+HVGQSA  LVTLN   KDYYIVAS+RF K  +T +A+LHY  S +   G LP+PP+
Sbjct  258   SLDVHVGQSAAVLVTLNQSPKDYYIVASTRFSKRVLTTTALLHYSNSHSPASGPLPNPPS  317

Query  880   GQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNK  701
              QYHWS++QAR+ RWN TANAARPNPQGSYHYG I   +T++LEN+   I+G  RYA+NK
Sbjct  318   YQYHWSVKQARSFRWNQTANAARPNPQGSYHYGKITPTKTILLENSAPLINGKLRYAVNK  377

Query  700   VSYVNPTTPLKLADWLNIPGVFTLNAIKDTPP-AGPAVHGVSVFGLELHDYVEIIFQNNE  524
             VSY+N  TPLKLAD+ NIPG+F +++I+  P   GPA    SV    LHD++E++FQNNE
Sbjct  378   VSYINSDTPLKLADYFNIPGIFNVDSIQSLPSNNGPAYVATSVLPTSLHDFIELVFQNNE  437

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
             +T+QS+HLDG DFW VGYG G W  T R+ YNLVDA TR+T QVYPNSWT ILVSLDN+G
Sbjct  438   ETMQSWHLDGYDFWVVGYGFGQWTPTKRRFYNLVDAMTRHTAQVYPNSWTTILVSLDNQG  497

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWNLRS++W R YLGQQ+YLRVW ++HSLY E D+P + LLCG
Sbjct  498   MWNLRSAIWERQYLGQQLYLRVWTDQHSLYNEYDIPTNVLLCG  540



>emb|CDY42716.1| BnaA03g53690D [Brassica napus]
Length=540

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/524 (63%), Positives = 399/524 (76%), Gaps = 0/524 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F+  +L +    +V+AEDPY FY W V YGT SPLGV Q+ ILINGQFPGP I  +TN N
Sbjct  11    FIGTLLVWLGSVLVKAEDPYLFYTWTVTYGTRSPLGVPQQVILINGQFPGPAIEAVTNNN  70

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             ++VN+INKLDEP L TWNGIKQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQIGT++YF
Sbjct  71    IVVNLINKLDEPFLITWNGIKQRRTSWQDGVLGTNCPIPPNSNWTYQFQLKDQIGTFTYF  130

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              ST +HRA+G +GALNI +RSVI  PY  P   +TL+V+DW+   HK L+K+LD G   P
Sbjct  131   ASTSMHRASGAFGALNINQRSVITTPYLTPDGDFTLLVTDWFKLSHKDLRKRLDAGYALP  190

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P  LLING    + FTG+QG TY FRVSNVG+ TSINFRIQNH + L+EVEG+HT+Q+ 
Sbjct  191   LPDALLINGASKGLIFTGQQGKTYKFRVSNVGIATSINFRIQNHTMTLIEVEGAHTLQES  250

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y+SLD+HVGQS   LVTL A V+DYYIVASSRF KP +  +A L Y GS   V G LP  
Sbjct  251   YESLDVHVGQSVTVLVTLKASVRDYYIVASSRFTKPVLNTTASLRYLGSKNAVYGPLPVG  310

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P    HWSM+QARTIR NLTANAARPNPQGSYHYGTIPI RTLVL N    + G  RY +
Sbjct  311   PTYHIHWSMKQARTIRMNLTANAARPNPQGSYHYGTIPINRTLVLANAATMLYGKLRYTV  370

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N++SY+NPTTPLKLADW NI GVF    I  TP  GPA  G SVF +ELH++VEI+FQN+
Sbjct  371   NRISYINPTTPLKLADWYNISGVFDFKTILSTPTIGPAHFGTSVFDIELHEFVEIVFQND  430

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E+++QS+H+DG   + VG+G G W+ T+RK+YNLVDA  R+T QVYP SWT+ILVSLDNK
Sbjct  431   ERSIQSWHMDGTSAFLVGFGSGTWNETMRKRYNLVDAVARHTFQVYPLSWTSILVSLDNK  490

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS +W R  LGQ++Y+RVWN+E SLYTE D P + L CG
Sbjct  491   GMWNLRSQIWSRRNLGQELYVRVWNDEKSLYTEADPPLNALYCG  534



>gb|KHN36198.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/531 (63%), Positives = 409/531 (77%), Gaps = 3/531 (1%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinv  1622
             +G L  +  V+A   +S+V+AED Y+++ W V YGT+ PL   Q+ ILINGQFPGP +++
Sbjct  4     TGLLHLICLVIALVSVSLVQAEDAYKYFTWTVTYGTLYPLASPQQVILINGQFPGPRLDL  63

Query  1621  itnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIG  1442
             +TNENVI+N+INKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG
Sbjct  64    VTNENVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIG  123

Query  1441  TYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDT  1262
             TY+YF STQLH+AAGG+GALN+  RSVIP+PYP P   +TL+V DW+ T+HK L++ LD+
Sbjct  124   TYTYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTLRQTLDS  183

Query  1261  GKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             GK    P GLLING+ +S TFTG QG TYMFR+SNVG++TSINFRIQ H LKLVEVEGSH
Sbjct  184   GKSLAFPDGLLINGQAHS-TFTGNQGKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGSH  242

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPG  902
             T+Q+ YDSLD+HVGQS   LVTLN   KD YIVAS+RF +  +T +A+LHY  S +   G
Sbjct  243   TVQNLYDSLDVHVGQSVAVLVTLNQPPKDCYIVASTRFTETPLTTTAVLHYANSFSSALG  302

Query  901   KLPDPPAGQYH--WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENIS  728
              +P PP  +Y   WSM+QART RWNLTANAARPNPQGS+HYG I   + + L N+   I+
Sbjct  303   PVPAPPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIKLANSAPLIN  362

Query  727   GITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYV  548
             G  RYA+N VSYVNP TPLKLAD+ NIPGVF++N ++++P  GP   G SV    LHD++
Sbjct  363   GKLRYAVNSVSYVNPDTPLKLADYFNIPGVFSVNLLQNSPSNGPGYIGTSVLQTSLHDFI  422

Query  547   EIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAI  368
             E+IFQNNE T+QS+HLDG DFW +G+G G W    RK YNLVDA TR+T QVYP SWT I
Sbjct  423   EVIFQNNENTMQSWHLDGYDFWVIGHGFGQWTDASRKTYNLVDALTRHTAQVYPKSWTTI  482

Query  367   LVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LVSLDN+GMWNLRS++W R YLGQQ YLRVWN + SL  E D+P + LLCG
Sbjct  483   LVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNAQKSLANEYDIPNNVLLCG  533



>ref|XP_007047153.1| SKU5 similar 17 isoform 2 [Theobroma cacao]
 gb|EOX91310.1| SKU5 similar 17 isoform 2 [Theobroma cacao]
Length=539

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/528 (63%), Positives = 407/528 (77%), Gaps = 2/528 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              LR L GVLA   +S+V AEDPY +Y W V YGT S LGV Q+ ILIN QFPGP++ V+T
Sbjct  6     MLRLLFGVLAVLSVSLVNAEDPYLYYTWTVTYGTRSLLGVPQQVILINDQFPGPKLEVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N N+I+N+INKLD+P L TWNG+KQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG+Y
Sbjct  66    NNNIILNLINKLDQPFLLTWNGVKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGSY  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +HRAAGG+GALNI  RSVIP+PY  P   +TL++ DW+ T HK LQ+ LD+GK
Sbjct  126   TYFPSTLMHRAAGGFGALNIYHRSVIPIPYANPDGDFTLLIGDWYKTSHKTLQQTLDSGK  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P G+LING+  + TF+G+QG TYMFR+SNVG++TS+NFRIQ H +KLVEVEGSH +
Sbjct  186   SLPFPDGVLINGQTQT-TFSGEQGKTYMFRISNVGLSTSLNFRIQGHTMKLVEVEGSHVI  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF K  +TA+A+LHY  S T V G L
Sbjct  245   QNLYDSLDVHVGQSVTVLVTLNQPPKDYYIVASTRFTKTVLTATAVLHYTNSQTPVSGPL  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  PA QYHWSM+QART RWNLT+NAARPNPQGS+HYG I   +T+VL N+   I+G  R
Sbjct  305   PAAPAYQYHWSMQQARTYRWNLTSNAARPNPQGSFHYGKITTTKTIVLANSGSLINGKLR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N VS+VNP TPLKLAD+ NIPGVF++++I+D P  G A    SV    LHD++E++F
Sbjct  365   YTVNGVSFVNPDTPLKLADYFNIPGVFSMSSIQDLPSGGAATVATSVVPTSLHDFIEVVF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQ-VYPNSWTAILVS  359
             QNNE T+QS+HLDG DFW VG+G G W    R+ YNL+DA TR+T Q VYPNSWTAILVS
Sbjct  425   QNNENTMQSWHLDGYDFWVVGFGSGQWAPKKRRTYNLIDALTRHTTQVVYPNSWTAILVS  484

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWN+RS++W R YLGQQ YLRVW    S   E D+P + LLCG
Sbjct  485   LDNQGMWNMRSAMWERQYLGQQFYLRVWTPVRSFANEYDIPSNVLLCG  532



>gb|KCW55012.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
Length=591

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/528 (63%), Positives = 404/528 (77%), Gaps = 1/528 (0%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
             G +  +L  LA F  S V A+DPYRFY W V YGTI+PLGV Q+ ILINGQFPGP++ V+
Sbjct  58    GVISLILCFLAVFSASAVVADDPYRFYTWTVTYGTIAPLGVSQQVILINGQFPGPKLEVV  117

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+++N+IN LD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TYR Q KDQIGT
Sbjct  118   TNDNIVLNLINNLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYRFQAKDQIGT  177

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             ++YF ST LH+AAGG+GA+N+  R  IP+P+P P+  +TL+  +W+ T HK LQ+ LD+G
Sbjct  178   FTYFPSTLLHKAAGGFGAINVYERPQIPIPFPTPAGDFTLLAGNWYKTGHKTLQQSLDSG  237

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             K  P P G+LING+  + TF+G QG TYMFR+SNVGM+TS+NFRIQ H LKLVEVEGSHT
Sbjct  238   KSLPFPDGILINGQART-TFSGDQGKTYMFRISNVGMSTSLNFRIQGHTLKLVEVEGSHT  296

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDS+D+HVGQS   LVTLN   KDYYIVAS+RF K  + A+A+LHY  S+T V G 
Sbjct  297   VQNMYDSIDVHVGQSMAVLVTLNQPPKDYYIVASTRFTKTVLNATAVLHYTNSLTPVSGP  356

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             LP  P  Q HWSM+QARTIRWNLTA+AARPNPQGSYHYG I I RT+VL N+   I+G  
Sbjct  357   LPAGPTYQKHWSMKQARTIRWNLTASAARPNPQGSYHYGKIAISRTIVLANSAPLINGKQ  416

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N VSY+N  TPLKLAD+ NI GVF+ N+++  P  G A    SV    LH+++EI+
Sbjct  417   RYAVNGVSYINSDTPLKLADYFNIAGVFSTNSLQSVPSGGSASLATSVMPASLHEFIEIV  476

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE  +QS+HLDG DFW VGYG G W    RK YNLVDA TR+T QVYP +WT+ILVS
Sbjct  477   FQNNENAVQSWHLDGYDFWVVGYGFGQWTPASRKIYNLVDAPTRHTAQVYPRAWTSILVS  536

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRS+ W R YLGQQ YLRVW  +HSL  E  +P + LLCG
Sbjct  537   LDNQGMWNLRSAAWERQYLGQQFYLRVWTPDHSLANEYGIPSNALLCG  584



>ref|XP_010263761.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=538

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/527 (63%), Positives = 412/527 (78%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              LR +LGVLA   +S+V AEDPY++Y W V YGTI+PLGV Q+ ILINGQFPGP ++V+T
Sbjct  6     LLRLILGVLACLSVSLVNAEDPYKYYTWTVTYGTIAPLGVPQQAILINGQFPGPILDVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY
Sbjct  66    NDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGTY  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF STQLH+AAGGYG LN+  R  IP+P+P P+  +TL+V DW+ T+HK LQ  LD G+
Sbjct  126   TYFPSTQLHKAAGGYGGLNVYERPQIPIPFPNPAGDFTLLVGDWYKTNHKTLQHYLDLGR  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
             P P P GLLING+ ++ +F+G QG TYMFR+SN+G++TSINFRIQ H + LVEVEGSHT+
Sbjct  186   PLPFPDGLLINGQAHA-SFSGDQGKTYMFRISNMGLSTSINFRIQGHTIMLVEVEGSHTI  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +TA+A+LHY  S T V G +
Sbjct  245   QNIYDSLDVHVGQSVAVLVTLNQAPKDYYIVASTRFTRTVLTATAVLHYTNSQTPVSGPV  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q HWSM+QART RWNLTA+AARPNPQGSYHYG I   RT+ L N+   ++G  R
Sbjct  305   PPGPTYQIHWSMQQARTFRWNLTASAARPNPQGSYHYGKITTSRTIFLANSAPLVNGKQR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N+VSY+N  TPLKLAD+ NIPGVF+LN+I+  P  GPA    +V    LH+++E++F
Sbjct  365   YAINRVSYINSDTPLKLADYFNIPGVFSLNSIQTAPGGGPAYLATAVMPAFLHEFIEVVF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE T+QS+HLDG DFW VGYG G W    RK YNLVDA TR+T QVYP SWT IL+SL
Sbjct  425   QNNENTIQSWHLDGYDFWVVGYGRGQWTPASRKHYNLVDALTRHTAQVYPYSWTTILISL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWNLRS++W R YLGQ+ YLRVW+ + +   E D+PP+ LLCG
Sbjct  485   DNQGMWNLRSAIWARQYLGQEFYLRVWSPDKTPANEYDIPPNALLCG  531



>ref|XP_009348086.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/535 (62%), Positives = 404/535 (76%), Gaps = 2/535 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLA-FFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             M Q     L  + GVLA     S+V+AEDPY+FY W V YGT+SPLGV Q+ ILINGQFP
Sbjct  1     MEQKTGFLLHLVCGVLAVLLSSSVVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFP  60

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP ++V+TN+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q
Sbjct  61    GPRLDVVTNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQ  120

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
              KDQIG+++YF STQ H+AAGG+G +N+  R  IP+PYP P   +TL+  DW+ + HK L
Sbjct  121   TKDQIGSFTYFPSTQFHKAAGGFGGINVYARPRIPVPYPTPDGDFTLLAGDWYKSSHKAL  180

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             Q+ LD+GK  P P G+LING+  S TF+G QG TYMFR+SNVG++TS+NFRI+ HKLKLV
Sbjct  181   QQSLDSGKSLPFPAGVLINGQ-TSNTFSGDQGKTYMFRISNVGLSTSLNFRIEGHKLKLV  239

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             E EGSHT+Q+ YDSLDIHVGQS   LVTLN   KDYYIVAS+RF +  +TA+++LHY  S
Sbjct  240   ECEGSHTIQNSYDSLDIHVGQSVSVLVTLNQAPKDYYIVASTRFTRLVLTATSVLHYTNS  299

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
              T V G +P  P GQ HWSM QART RWNLTANAARPNPQGS+HYG +   +T+VL N+ 
Sbjct  300   HTSVSGPVPAGPTGQIHWSMEQARTFRWNLTANAARPNPQGSFHYGKVTPTKTIVLANSA  359

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I+G  RYA N+VSYVNP TP+KLAD+ NIPGVF+LN+I+  P  G A     V  +  
Sbjct  360   PLINGKQRYAFNRVSYVNPDTPVKLADYFNIPGVFSLNSIQTAPSDGSASLATPVMPVSH  419

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             HD++EI+FQNNEK++QS HLDG DFW VGYG G W    R  YNLVD  TR+T QVYPNS
Sbjct  420   HDFIEIVFQNNEKSVQSMHLDGYDFWVVGYGSGPWTPAKRTTYNLVDTLTRHTAQVYPNS  479

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WT IL SLDN+GMWNLRS++W R YLGQQ YLRVWN   +L  E  +P + LLCG
Sbjct  480   WTTILASLDNQGMWNLRSAIWERQYLGQQFYLRVWNPVQNLANEYTIPSNALLCG  534



>ref|NP_565554.1| protein SKU5 similar 16 [Arabidopsis thaliana]
 gb|AAC17097.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAM14869.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC07474.1| protein SKU5 similar 16 [Arabidopsis thaliana]
Length=541

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/518 (63%), Positives = 396/518 (76%), Gaps = 0/518 (0%)
 Frame = -2

Query  1768  AFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnvi  1589
              F  + ++ AEDPY F+ W V YGT SPLGV Q+ ILINGQFPGP I  +TN N++VNVI
Sbjct  16    CFSSVFVINAEDPYLFFTWTVTYGTRSPLGVPQQVILINGQFPGPPIEGVTNNNIVVNVI  75

Query  1588  NKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLH  1409
             NKLDEP L TWNGIKQRK SW DGVLGTNCPI P ++WTY  Q+KDQIGTY+YF ST +H
Sbjct  76    NKLDEPFLITWNGIKQRKMSWQDGVLGTNCPIQPKSSWTYHFQLKDQIGTYAYFASTSMH  135

Query  1408  RAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLL  1229
             RA+G +GALN+ +RSVI +PYP+P A +TL+VSDW+   HK+LQ++LD+ +  P P GLL
Sbjct  136   RASGAFGALNVNQRSVIFVPYPKPDADFTLLVSDWYKMGHKELQRRLDSSRALPPPDGLL  195

Query  1228  INGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDI  1049
             ING    + FTG+ G  Y FR+SNVG++TSINFRIQ H + LVEVEGSHT+Q+ Y+SLDI
Sbjct  196   INGASKGLVFTGQHGKIYRFRISNVGISTSINFRIQGHMMTLVEVEGSHTLQEVYESLDI  255

Query  1048  HVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYH  869
             HVGQS   LVTL A VKDY+IVAS+RF KP +T + IL Y GS  +    LP  P    H
Sbjct  256   HVGQSVTVLVTLKAPVKDYFIVASTRFTKPILTTTGILSYQGSKIRPSHPLPIGPTYHIH  315

Query  868   WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYV  689
             WSM+QARTIR NLTANAARPNPQGS+HYGTIPI RT VL N +  I+G  RY +N+VSYV
Sbjct  316   WSMKQARTIRLNLTANAARPNPQGSFHYGTIPINRTFVLANGRAMINGKLRYTVNRVSYV  375

Query  688   NPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQS  509
             NP TPLKLADW NIPGVF    I + P  GP++ G SVF + LH+YVE +FQNNE ++QS
Sbjct  376   NPATPLKLADWFNIPGVFNFKTIMNIPTPGPSILGTSVFDVALHEYVEFVFQNNEGSIQS  435

Query  508   YHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLR  329
             +HLDG   + VGYG G W+   R+ YNLVDA +R+T QVYP SWT+ILVSLDNKGMWNLR
Sbjct  436   WHLDGTSAYVVGYGSGTWNMAKRRGYNLVDAVSRHTFQVYPMSWTSILVSLDNKGMWNLR  495

Query  328   SSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             S +W R YLGQ++Y+RVWNNE SLYTE++ P + L CG
Sbjct  496   SQIWSRRYLGQELYVRVWNNEKSLYTESEPPVNVLFCG  533



>ref|XP_010109886.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXC24855.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=541

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/525 (64%), Positives = 399/525 (76%), Gaps = 1/525 (0%)
 Frame = -2

Query  1789  RFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
               + G+LA F +  V+A+DPYR+Y W V YGTISPLGV Q+ ILINGQFPGP + V+TN 
Sbjct  11    HLICGILAVFSVCDVKADDPYRYYTWTVTYGTISPLGVPQQVILINGQFPGPSLEVVTNN  70

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+I+N+INKLD+P L TWNGIKQRK+SW DGV GTNCPI PN+N+TY+ Q KDQIGT++Y
Sbjct  71    NIILNLINKLDQPFLLTWNGIKQRKNSWQDGVSGTNCPIPPNSNYTYKFQAKDQIGTFTY  130

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F ST  H+AAGG+GA NI +R  IP+PY  P   +TL++ DW+ T HK LQ  LD+GK  
Sbjct  131   FPSTLFHKAAGGFGAFNIYQRPRIPIPYSWPDGDFTLLIGDWYKTSHKALQGSLDSGKSL  190

Query  1249  PSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
             P P G+LING++ + TFTG QG TY FRVSNVG +TS NFRIQNH +KLVEVEGSHT+Q+
Sbjct  191   PFPDGILINGQV-TTTFTGDQGKTYKFRVSNVGFSTSFNFRIQNHTMKLVEVEGSHTIQN  249

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +TA AILHY  S T   G LP 
Sbjct  250   VYDSLDVHVGQSVAVLVTLNQAPKDYYIVASTRFSRSVLTAEAILHYSNSHTPASGPLPA  309

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
             PP    HWSM QART RWNLTANAARPNPQGSYHYG +PI + +VL ++   I+G  RYA
Sbjct  310   PPKYGLHWSMLQARTFRWNLTANAARPNPQGSYHYGKVPITKRIVLASSPAWINGKQRYA  369

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N+VSY+NP TPLKLAD  NIPGVF+ + I+  P  GPA    SV    LHD++EI+FQN
Sbjct  370   VNRVSYINPDTPLKLADHFNIPGVFSESTIQIQPSDGPAFVATSVILTSLHDFIEIVFQN  429

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
              E T+QS+HLDG DFW VGYG G W    R+ YNLVDA TR+T QVYP SWTAILVSLDN
Sbjct  430   TENTMQSWHLDGYDFWVVGYGSGQWTEAKRRTYNLVDALTRHTAQVYPKSWTAILVSLDN  489

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +GMWNLRS++W R YLGQQVYL+VWN  HSL  E D+P + LLCG
Sbjct  490   QGMWNLRSALWERQYLGQQVYLKVWNPVHSLANEYDIPSNVLLCG  534



>emb|CDX75611.1| BnaA01g00910D [Brassica napus]
Length=541

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/526 (62%), Positives = 399/526 (76%), Gaps = 1/526 (0%)
 Frame = -2

Query  1789  RFLLGVLAFFCISM-VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             +  +G L F+  S+ V AEDPY FY W V YGT SPLGV Q+ ILINGQFPGP I  +TN
Sbjct  10    KLFIGSLLFWLGSLLVSAEDPYLFYTWTVTYGTRSPLGVPQQVILINGQFPGPAIEAVTN  69

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
              N++VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQIGTY+
Sbjct  70    NNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQLKDQIGTYT  129

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF ST +HRA+G +GALNI +RSVI  PYP P   +TL+V+DW+   HK L+K+LD G  
Sbjct  130   YFASTSMHRASGAFGALNINQRSVITTPYPTPDGDFTLLVTDWFKMSHKDLRKRLDAGYA  189

Query  1252  FPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
              P   GLLING    + FTG+QG TY FRVSNVG+ TSINFRIQ+H + L+EVEG+HT+Q
Sbjct  190   LPLSDGLLINGVSKGLIFTGEQGKTYKFRVSNVGIATSINFRIQDHTMSLIEVEGAHTLQ  249

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
             + Y+SLD+HVGQS   LV L A V+DYYIVAS+RF KP +  +A L Y GS   V G LP
Sbjct  250   ETYESLDVHVGQSVTVLVNLKASVRDYYIVASTRFTKPILNTNASLRYLGSKNAVSGPLP  309

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RTL+L N    I G  RY
Sbjct  310   VGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLILANAATMIYGKLRY  369

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
              +N++SY+NP TPLKLADW NI GVF    +  TP  GPA  G SVF +ELH++VEIIFQ
Sbjct  370   TVNRISYINPETPLKLADWYNISGVFDFKTMLSTPTIGPAHFGTSVFDVELHEFVEIIFQ  429

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             N+E+++QS+H+DG   + VGYG G W+ T+RK+YNLVDA  R+T QVYP SWT+ILVSLD
Sbjct  430   NDERSIQSWHMDGTSAFLVGYGSGTWNVTMRKRYNLVDAVARHTFQVYPLSWTSILVSLD  489

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             NKGMWNLRS +W R YLGQ++Y+RVWN+E S+YTE   P + L CG
Sbjct  490   NKGMWNLRSQIWSRRYLGQELYVRVWNDEKSIYTEAYPPLNALYCG  535



>ref|XP_009347241.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/535 (61%), Positives = 403/535 (75%), Gaps = 2/535 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLA-FFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             M Q     L  + GVLA     S+V+AEDPY+FY W V YGT+SPLGV Q+ ILINGQFP
Sbjct  1     MEQKAGFLLHLVCGVLAVLLSTSVVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFP  60

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP ++V+TN+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q
Sbjct  61    GPRLDVVTNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQ  120

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
              KDQIG+++YF STQ H+AAGG+G +N+  R  IP+PYP P   +TL+  DW+ + HK L
Sbjct  121   TKDQIGSFTYFPSTQFHKAAGGFGGINVYARPRIPVPYPTPDGDFTLLAGDWYKSSHKAL  180

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             Q+ LD+GK  P P G+LING+  S T +G QG TYMFR+SNVG++TS+NFRI+ HKLKLV
Sbjct  181   QQSLDSGKSLPFPAGVLINGQ-TSNTVSGDQGKTYMFRISNVGLSTSLNFRIEGHKLKLV  239

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             E EGSHT+Q+ YDSLDIHVGQS   LVTLN   KDYYIVAS+RF +  +TA+++LHY  S
Sbjct  240   ECEGSHTIQNSYDSLDIHVGQSVSVLVTLNQAPKDYYIVASTRFTRLVLTATSVLHYTNS  299

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
              T V G +P  P GQ HWSM QART RWNLTANAARPNPQGS+HYG +   +T+VL N+ 
Sbjct  300   HTSVSGPVPAGPTGQIHWSMEQARTFRWNLTANAARPNPQGSFHYGKVTPTKTIVLANSA  359

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I+G  RYA N+VSYVNP TP+KLAD+ NIPGVF+LN+I+  P  G A     V  +  
Sbjct  360   PLINGKQRYAFNRVSYVNPDTPVKLADYFNIPGVFSLNSIQTAPSDGSASLATPVMPVSH  419

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             HD++EI+FQNNEK++QS HLDG DFW VGYG G W    R  YNLVD  TR+T QVYPNS
Sbjct  420   HDFIEIVFQNNEKSVQSMHLDGYDFWVVGYGSGPWTPAKRTTYNLVDTLTRHTAQVYPNS  479

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WT IL SLDN+GMWNLRS++W R YLGQQ YLRVWN   +L  E  +P + LLCG
Sbjct  480   WTTILASLDNQGMWNLRSAIWERQYLGQQFYLRVWNPVQNLANEYTIPSNALLCG  534



>ref|XP_010680450.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680451.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=538

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/524 (62%), Positives = 404/524 (77%), Gaps = 1/524 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
              + G++A   I++V+A+DPYRF+ W V YG I+PLGV Q+ ILINGQFPGP+++ +TN+N
Sbjct  9     LIFGIVALLSITIVKADDPYRFFTWTVTYGNIAPLGVSQQVILINGQFPGPKLDCVTNDN  68

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +++NVINKL+EP L TWNGIKQRK+SW DGVLGTNCPI PN N+TY  Q KDQIG+++YF
Sbjct  69    IVLNVINKLNEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNKNFTYIFQPKDQIGSFTYF  128

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              +  LHRAAGG+GALN+  R  IP+PYP P   +TL++ DW   + K L++ LD GK  P
Sbjct  129   PTIGLHRAAGGFGALNVYSRPRIPVPYPNPDGDFTLLIGDWHKPNFKTLERVLDAGKALP  188

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P GLLING+  S +FTG QG TY FRVSNVG++TS NFRIQ HKLK+VEVEGSH +Q+ 
Sbjct  189   FPDGLLINGQTRS-SFTGDQGKTYKFRVSNVGLSTSFNFRIQGHKLKVVEVEGSHVLQNL  247

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             YDS+D+HVGQS   LVTL+   KDYYIVAS+RF K  ++A+ +LHY  S  +V G LP  
Sbjct  248   YDSIDVHVGQSLSILVTLDQPPKDYYIVASTRFTKIVLSATGVLHYSNSGAQVSGPLPPA  307

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             PAG+ HWSM QART RWNLTANAARPNPQGS+HYGTIPI +T VL N+   I+G  R+A+
Sbjct  308   PAGELHWSMEQARTFRWNLTANAARPNPQGSFHYGTIPISKTFVLANSAPLINGKQRFAV  367

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N+VS++NP TPLKLAD+ NIPGVF+LN+I+ +P  G A  G SV     HD++E++FQN+
Sbjct  368   NQVSFINPDTPLKLADYFNIPGVFSLNSIQSSPSGGAARLGTSVLAASHHDFIEVVFQND  427

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QS+HLDG DFW VG+G G W    RK YNL DA TR+T QVYPNSWTAILVSLDN+
Sbjct  428   ENAMQSWHLDGYDFWVVGFGAGKWTQASRKGYNLKDALTRHTTQVYPNSWTAILVSLDNQ  487

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWN+RS++WPR YLGQQ+YLRVWN   SL  E + P + LLCG
Sbjct  488   GMWNVRSAMWPRQYLGQQLYLRVWNTAQSLANEYNPPSNLLLCG  531



>ref|XP_002869012.1| hypothetical protein ARALYDRAFT_490933 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45271.1| hypothetical protein ARALYDRAFT_490933 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/535 (62%), Positives = 400/535 (75%), Gaps = 1/535 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             M+Q      +  +G L +    +V AEDPY FY W V YGT  PLGV Q  ILINGQFPG
Sbjct  1     MKQTNLLLCKLFIGTLFWLGSVLVNAEDPYLFYTWTVTYGTRYPLGVPQEVILINGQFPG  60

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN N++VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q+
Sbjct  61    PAIEAVTNNNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQL  120

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWW-NTDHKQL  1280
             KDQIGTY+YF ST +HRA+G +GALNI +R+VI  PYP P   +TL+VSDW+ N  HK L
Sbjct  121   KDQIGTYTYFASTSMHRASGAFGALNINQRAVITTPYPTPDGDFTLLVSDWFSNMTHKDL  180

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             +K LD G   P P  LLING    + FTG+QG TY FRVSNVG+ TSINFRIQNH + L+
Sbjct  181   RKGLDAGSVLPLPDALLINGVSKGLIFTGQQGKTYKFRVSNVGIATSINFRIQNHTMSLI  240

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEG+HT+Q+ Y+SLD+HVGQS   LVTL A V+DY+IVAS+RF KP +T +A L Y GS
Sbjct  241   EVEGAHTLQESYESLDVHVGQSMTVLVTLKASVRDYFIVASTRFTKPVLTTTASLRYQGS  300

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
                  G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RT+VL N  
Sbjct  301   KNAAYGPLPIGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTIVLANAA  360

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I G  RY +N++SY+NPTTPLKLADW NI GVF    I  TP  GPA  G SV  +EL
Sbjct  361   TLIYGKLRYTVNRISYINPTTPLKLADWYNISGVFDFKTIISTPTTGPAHFGTSVINVEL  420

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             H++VEI+FQN+E+++QS+H+DG   +AVGYG G W+ T+RK+YNLVDA  R+T QVYP S
Sbjct  421   HEFVEIVFQNDERSIQSWHMDGTSAYAVGYGSGTWNVTMRKRYNLVDAVPRHTFQVYPLS  480

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WT+ILVSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E S YTE + P + L CG
Sbjct  481   WTSILVSLDNKGMWNLRSQIWLRRYLGQELYVRVWNDEKSPYTEAEPPLNALYCG  535



>ref|XP_003537368.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Glycine max]
 ref|XP_006590664.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Glycine max]
Length=537

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/536 (63%), Positives = 411/536 (77%), Gaps = 8/536 (1%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             MR+  +G L  L  V+A      V+AED Y++Y W V YGTISPLG  Q+ ILINGQFPG
Sbjct  1     MRR--TGLLHLLCLVIALVS---VQAEDAYKYYTWTVTYGTISPLGSPQQVILINGQFPG  55

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P ++++TNENVI+N+INKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q 
Sbjct  56    PRLDLVTNENVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQA  115

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGTY+YF STQLH+AAGG+GALN+  RSVIP+PYP P   +TL+V DW+ T+HK L+
Sbjct  116   KDQIGTYTYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTLR  175

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             + L++GKP   P GLLING+ +S TFTG  G TYMFR+SNVG +TSINFRIQ H LKLVE
Sbjct  176   QTLESGKPLAFPDGLLINGQAHS-TFTGNPGKTYMFRISNVGFSTSINFRIQGHTLKLVE  234

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEGSHT+Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +T +A+LHY  S 
Sbjct  235   VEGSHTVQNLYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTETPLTTTAVLHYANSF  294

Query  916   TKVPGKLPDPPAGQYH--WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENT  743
             +   G +P PP  +Y   WSM+QART RWNLTANAARPNPQGS+HYG I   + + L N+
Sbjct  295   SSALGPVPAPPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIKLANS  354

Query  742   KENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLE  563
                I+G  RYA+N VSYVNP TPLKLAD+ NIPG+F++N ++++P  GP   G SV    
Sbjct  355   APLINGKLRYAVNSVSYVNPDTPLKLADYFNIPGIFSVNLLQNSPSNGPGYIGTSVLQTS  414

Query  562   LHDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPN  383
             LHD++E+IFQNNE T+QS+HLDG DFW +G+G G W    RK YNLVDA TR+T QVYP 
Sbjct  415   LHDFIEVIFQNNENTMQSWHLDGYDFWVIGHGFGQWTDASRKTYNLVDALTRHTTQVYPK  474

Query  382   SWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             SWT ILVSLDN+GMWNLRS++W R YLGQQ YLRVW+ + SL  E D+P + LLCG
Sbjct  475   SWTTILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWDAQKSLANEYDIPNNVLLCG  530



>ref|XP_002880518.1| hypothetical protein ARALYDRAFT_320180 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56777.1| hypothetical protein ARALYDRAFT_320180 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/518 (63%), Positives = 396/518 (76%), Gaps = 0/518 (0%)
 Frame = -2

Query  1768  AFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnvi  1589
              F  + ++ AEDPY F+ W V YGT SPLGV Q+ ILINGQFPGP I  +TN N++VNVI
Sbjct  16    CFSSVFVINAEDPYLFFTWTVTYGTRSPLGVPQQVILINGQFPGPPIEGVTNNNIVVNVI  75

Query  1588  NKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLH  1409
             NKLDEP L TWNGIKQR+ SW DGVLGTNCPI P +NWTY  Q+KDQIGTY+YF ST +H
Sbjct  76    NKLDEPFLITWNGIKQRRMSWQDGVLGTNCPIQPKSNWTYHFQLKDQIGTYTYFASTSMH  135

Query  1408  RAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLL  1229
             RA+G +G LN+ +RSVI +PYP+P A +TL+V DW+   HK+L+++LD+G+  P P GLL
Sbjct  136   RASGAFGGLNVNQRSVIFVPYPKPDADFTLLVGDWYKMGHKELRRRLDSGRDLPPPDGLL  195

Query  1228  INGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDI  1049
             ING    + FTG+ G  Y FR+SNVG++TSINFRIQ H + LVEVEGSHT+Q+ Y+SLDI
Sbjct  196   INGASKGLVFTGQHGKIYRFRISNVGISTSINFRIQGHMMTLVEVEGSHTLQEVYESLDI  255

Query  1048  HVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYH  869
             HVGQS   LVTL A VKDY+IVAS+RF KP +T + IL Y GS  +    LP  P    H
Sbjct  256   HVGQSVTVLVTLKAPVKDYFIVASTRFTKPVLTTTGILSYQGSKIRPSHPLPIGPTYHIH  315

Query  868   WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYV  689
             WSM+QARTIR NLTANAARPNPQGS+HYGTIPI RT VL N + +I+G  RY +N+VSYV
Sbjct  316   WSMKQARTIRLNLTANAARPNPQGSFHYGTIPINRTFVLANGRASINGKLRYTVNRVSYV  375

Query  688   NPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQS  509
             NPTTPLKLADW NIPGVF    I + P  GP++ G SVF + LH+YVE +FQNNE ++QS
Sbjct  376   NPTTPLKLADWFNIPGVFNFKTILNIPTPGPSILGTSVFDVALHEYVEFVFQNNETSIQS  435

Query  508   YHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLR  329
             +HLDG   + VGYG G W+   R+ YNLVDA +R+T QVYP SWT+ILVSLDNKGMWNLR
Sbjct  436   WHLDGTSAYVVGYGSGTWNMANRRGYNLVDAVSRHTFQVYPKSWTSILVSLDNKGMWNLR  495

Query  328   SSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             S +W R YLGQ++Y+RVWN+E SLYTE + P + L CG
Sbjct  496   SQIWSRRYLGQELYVRVWNDERSLYTEAEPPVNALFCG  533



>ref|XP_009140392.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Brassica rapa]
Length=545

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/530 (62%), Positives = 402/530 (76%), Gaps = 5/530 (1%)
 Frame = -2

Query  1789  RFLLGVLAFFCISM-VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             +  +G L F+  S+ V AEDPY FY W V YGT SPLGV Q+ ILINGQFPGP I  +TN
Sbjct  10    KLFIGSLLFWLGSLLVSAEDPYLFYTWTVTYGTRSPLGVPQQVILINGQFPGPAIEAVTN  69

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
              N++VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQIGTY+
Sbjct  70    NNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQLKDQIGTYT  129

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF ST +HRA+G +GALNI +RSVI  PYP P   +TL+V+DW+   HK L+K+LD G  
Sbjct  130   YFASTSMHRASGAFGALNINQRSVITTPYPTPDGDFTLLVTDWFKMSHKDLRKRLDAGYA  189

Query  1252  FPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
              P   GLLING    + FTG+QG TY FRVSNVG+ TSINFRIQ+H + L+EVEG+HT+Q
Sbjct  190   LPLSDGLLINGVSKGLIFTGEQGKTYKFRVSNVGIATSINFRIQDHTMSLIEVEGAHTLQ  249

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
             + Y+SLD+HVGQS   LV L A V+DYYIVAS+RF KP +  +A L Y GS   V G LP
Sbjct  250   ETYESLDVHVGQSVTVLVNLKASVRDYYIVASTRFTKPILNTNASLRYLGSKNAVSGPLP  309

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RTL+L N    I G  RY
Sbjct  310   VGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLILANAATMIYGKLRY  369

Query  712   ALNKVSYVNPTTPLKLADWLNIPGV----FTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
              +N++SY+NP TPLKLADW NI GV    FT+  +  TP  GPA  G SVF +ELH++VE
Sbjct  370   TVNRISYINPETPLKLADWYNISGVWTRDFTIPTMLSTPTIGPAHFGTSVFDVELHEFVE  429

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             IIFQN+E+++QS+H+DG   + VGYG G W+ T+RK+YNLVDA  R+T QVYP SWT+IL
Sbjct  430   IIFQNDERSIQSWHMDGTSAFLVGYGSGTWNVTMRKRYNLVDAVARHTFQVYPLSWTSIL  489

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             VSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E S+YTE D P + L CG
Sbjct  490   VSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSIYTEADPPLNALYCG  539



>ref|XP_009140331.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Brassica rapa]
Length=546

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/531 (62%), Positives = 401/531 (76%), Gaps = 6/531 (1%)
 Frame = -2

Query  1789  RFLLGVLAFFCISM-VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             +  +G L F+  S+ V AEDPY FY W V YGT SPLGV Q+ ILINGQFPGP I  +TN
Sbjct  10    KLFIGSLLFWLGSLLVSAEDPYLFYTWTVTYGTRSPLGVPQQVILINGQFPGPAIEAVTN  69

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
              N++VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQIGTY+
Sbjct  70    NNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQLKDQIGTYT  129

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF ST +HRA+G +GALNI +RSVI  PYP P   +TL+V+DW+   HK L+K+LD G  
Sbjct  130   YFASTSMHRASGAFGALNINQRSVITTPYPTPDGDFTLLVTDWFKMSHKDLRKRLDAGYA  189

Query  1252  FPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
              P   GLLING    + FTG+QG TY FRVSNVG+ TSINFRIQ+H + L+EVEG+HT+Q
Sbjct  190   LPLSDGLLINGVSKGLIFTGEQGKTYKFRVSNVGIATSINFRIQDHTMSLIEVEGAHTLQ  249

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
             + Y+SLD+HVGQS   LV L A V+DYYIVAS+RF KP +  +A L Y GS   V G LP
Sbjct  250   ETYESLDVHVGQSVTVLVNLKASVRDYYIVASTRFTKPILNTNASLRYLGSKNAVSGPLP  309

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RTL+L N    I G  RY
Sbjct  310   VGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLILANAATMIYGKLRY  369

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAI-----KDTPPAGPAVHGVSVFGLELHDYV  548
              +N++SY+NP TPLKLADW NI GVF    +      +TP  GPA  G SVF +ELH++V
Sbjct  370   TVNRISYINPETPLKLADWYNISGVFDFKTMLERCQSNTPTIGPAHFGTSVFDVELHEFV  429

Query  547   EIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAI  368
             EIIFQN+E+++QS+H+DG   + VGYG G W+ T+RK+YNLVDA  R+T QVYP SWT+I
Sbjct  430   EIIFQNDERSIQSWHMDGTSAFLVGYGSGTWNVTMRKRYNLVDAVARHTFQVYPLSWTSI  489

Query  367   LVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LVSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E S+YTE D P + L CG
Sbjct  490   LVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSIYTEADPPLNALYCG  540



>ref|XP_010436233.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=583

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/534 (61%), Positives = 399/534 (75%), Gaps = 0/534 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             M+Q      +  +G L      +V  EDPY FY W V YGT SPLGV Q+ ILINGQFPG
Sbjct  1     MKQTNLLLCKLFIGALFLLGSVLVNGEDPYMFYTWTVTYGTRSPLGVPQQVILINGQFPG  60

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P I  +TN NV+VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q+
Sbjct  61    PPIEAVTNNNVVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQL  120

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGTY+YF ST +HRA G +GALN+ +R+VI  PY  P   +TL+VSDW+   HK L+
Sbjct  121   KDQIGTYTYFASTSMHRARGAFGALNVNQRAVITTPYATPDGDFTLLVSDWFKMSHKDLR  180

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             K+LD G   P P  LLING    + FTG+QG TY FR+SNVG+ TSINFRIQNH + L+E
Sbjct  181   KRLDAGYALPLPDALLINGASKGLVFTGQQGKTYKFRISNVGIATSINFRIQNHTMSLIE  240

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEG+HT+Q+ Y+SLD+HVGQS   LVTL A V+DY++VAS+RF KP +T +A L Y GS 
Sbjct  241   VEGAHTLQESYESLDVHVGQSLTVLVTLKASVRDYFMVASTRFTKPVLTTTASLRYLGSQ  300

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
                 G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RTLVL N   
Sbjct  301   NAAYGPLPIGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLVLANAAT  360

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I+G  RY +N++SY+NPTTPLKLADW NI GVF    I  TP  GPA  G SV  +ELH
Sbjct  361   MINGKLRYTVNRISYINPTTPLKLADWYNISGVFDFKTILSTPTIGPAHFGTSVIDVELH  420

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSW  377
             ++VEI+FQN+E+++QS+H+DG   + VGYG G W+ T+RK+YNLVDA  R+T QVYP SW
Sbjct  421   EFVEIVFQNDERSIQSWHMDGTSAYPVGYGSGTWNVTMRKRYNLVDAVPRHTFQVYPLSW  480

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             T+ILVSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE + P + L CG
Sbjct  481   TSILVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEAEPPLNVLYCG  534



>ref|XP_008338225.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=541

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/535 (61%), Positives = 402/535 (75%), Gaps = 2/535 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLA-FFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             M Q     L  + GVLA     S+V+AEDPY+FY W V YGT+SPLGV Q+ ILINGQFP
Sbjct  1     MEQKAGFLLHLVCGVLAVLLSSSVVKAEDPYKFYTWTVTYGTLSPLGVSQQVILINGQFP  60

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP ++V+TN+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q
Sbjct  61    GPRLDVVTNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQ  120

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
              KDQIG+++YF STQ H+AAGG+G +N+  R  IP+PYP P   +TL+  DW+   HK L
Sbjct  121   TKDQIGSFTYFPSTQFHKAAGGFGGINVYARPRIPVPYPTPDGDFTLLAGDWYKXSHKXL  180

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             Q+ LD+GK  P P G+LING+  S TF+G QG TYMFR+SNVG++ S+NFRI+ HKLKLV
Sbjct  181   QQSLDSGKSLPFPXGVLINGQ-TSNTFSGDQGKTYMFRISNVGLSASLNFRIEGHKLKLV  239

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             E EGSHT+Q+ YDSLDIHVGQS   LVTLN   KDY+IVAS+RF +  +TA+++LHY  S
Sbjct  240   ECEGSHTIQNMYDSLDIHVGQSVSVLVTLNQAPKDYHIVASTRFTRLVLTATSVLHYTNS  299

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
              T V G +P  P GQ HWSM QART RWNLTANAARPNPQGS+HYG +   +T+VL N+ 
Sbjct  300   HTSVSGPVPAGPTGQIHWSMEQARTFRWNLTANAARPNPQGSFHYGKVTPTKTIVLANSA  359

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I+G  RYA N+VSYVNP TP+KLAD+ NIPGVF+LN+I+ TP  G A     V  +  
Sbjct  360   PLINGKQRYAFNRVSYVNPDTPVKLADYFNIPGVFSLNSIQTTPSDGSASLATPVMPVSH  419

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             HD++EI+FQNNE ++QS HLDG DFW VGYG G W    R  YNLVD  TR+T QVYPNS
Sbjct  420   HDFIEIVFQNNENSVQSMHLDGYDFWVVGYGSGPWTPAKRTTYNLVDTLTRHTAQVYPNS  479

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WT IL SLDN+GMWNLRS++W R YLGQQ YLRVWN   +L  E  +P + LLCG
Sbjct  480   WTTILASLDNQGMWNLRSAIWERQYLGQQFYLRVWNPVQNLANEYTIPSNALLCG  534



>ref|XP_003550084.1| PREDICTED: L-ascorbate oxidase homolog isoform 1 [Glycine max]
 gb|KHN12130.1| L-ascorbate oxidase like [Glycine soja]
Length=544

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/527 (63%), Positives = 405/527 (77%), Gaps = 4/527 (1%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
              LG+LA + +  V AED Y+++ W +  GTI PLGV Q+GILINGQFPGP +  ITN+N+
Sbjct  10    FLGILACWGVLPVTAEDRYQYFTWEITNGTIYPLGVPQQGILINGQFPGPTVEAITNDNI  69

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             +VNVINKLDE  L TW+GIKQR++SW DGVLGTNCPI P +NWTY+ Q+KDQIGTY+YF 
Sbjct  70    LVNVINKLDEKFLITWSGIKQRRTSWQDGVLGTNCPIPPKSNWTYKFQVKDQIGTYTYFP  129

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             ST++H+AAGG+G  N+ +RSVI +PYP P   +TL++ DW+ T+HK L++ LD G+  P 
Sbjct  130   STKIHKAAGGFGGFNVAQRSVISIPYPAPDGEFTLLIGDWYKTNHKVLRRLLDAGRSLPY  189

Query  1243  PKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
             P  LLING+ ++  FTG+ G TY FRVSNVGM+TS NFRIQ H LK++EVEGSHT+Q+ Y
Sbjct  190   PDALLINGQKDAAVFTGEAGKTYKFRVSNVGMSTSFNFRIQGHLLKIIEVEGSHTIQESY  249

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKP-YMTASAILHYDGSVTKVPGKLPDP  887
             DSLD+HVGQS   LVTL+  + DY IVASSRF  P  +T +A L Y GS +K    LP  
Sbjct  250   DSLDVHVGQSVTVLVTLSGSISDYIIVASSRFTDPIVLTTTATLRYSGSNSKAQIPLPSG  309

Query  886   PA-GQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
             PA     WS++QARTIR NLTANAARPNPQGS+HYGTIP+ RTLVL N+K  I+G  RYA
Sbjct  310   PATNDVEWSIKQARTIRLNLTANAARPNPQGSFHYGTIPVQRTLVLANSKAIINGKLRYA  369

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTP-PAG-PAVHGVSVFGLELHDYVEIIF  536
             +N +S++NP TPLKLADW NIPGVF LN IKD P P G PA  G SV G  LHD+ EIIF
Sbjct  370   VNGISHINPNTPLKLADWFNIPGVFDLNTIKDVPSPQGTPAKLGTSVIGFTLHDFAEIIF  429

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE   QS+H+DG  F+ VGYG G+W    RK YNLVD  TR+TVQVYPNSW+AILVSL
Sbjct  430   QNNENYTQSWHMDGSSFYVVGYGNGLWIPDSRKTYNLVDGMTRHTVQVYPNSWSAILVSL  489

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS++WP+ YLGQ++YLRVWNNE S+YTE  +PP+ L CG
Sbjct  490   DNKGMWNLRSAIWPQRYLGQELYLRVWNNEQSVYTETLLPPNALFCG  536



>ref|XP_006411943.1| hypothetical protein EUTSA_v10024863mg [Eutrema salsugineum]
 gb|ESQ53396.1| hypothetical protein EUTSA_v10024863mg [Eutrema salsugineum]
Length=541

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/535 (61%), Positives = 399/535 (75%), Gaps = 1/535 (0%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCIS-MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             M+Q      +  +G L F+  S +V AEDPY FY W V YGT SPLGV Q+ ILINGQFP
Sbjct  1     MKQTNLLLCKLFIGTLLFWLGSVLVNAEDPYLFYTWTVTYGTRSPLGVPQQVILINGQFP  60

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP I  +TN N++VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q
Sbjct  61    GPAIEAVTNNNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQ  120

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
             +KDQIGTY+YF ST +HRA+G +GALNI +R VI  PYP P   +TL+VSDW+   HK L
Sbjct  121   LKDQIGTYTYFASTSMHRASGAFGALNINQRPVITTPYPTPDGDFTLLVSDWFKLSHKDL  180

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             +K+L+ G   P P  LLING    + FTG++G TY FRVSNVG+ TSINFRIQNH + L+
Sbjct  181   RKRLNAGYALPLPNALLINGVAKGLIFTGEKGKTYKFRVSNVGIATSINFRIQNHTMSLI  240

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEG+HT+Q+ Y+SLD+HVGQS   LVTL A V+DYYIVAS+RF KP +  +A L Y GS
Sbjct  241   EVEGAHTLQESYESLDVHVGQSVTVLVTLKASVRDYYIVASTRFTKPILNTTASLRYFGS  300

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
                V G LP  P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RT+VL N  
Sbjct  301   KNAVSGPLPIGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTIVLANAA  360

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I    RY +N++SY+NP TPLKLADW NI GVF    IK  P  GPA  G SV  +EL
Sbjct  361   TMIYKKLRYTVNRISYINPPTPLKLADWYNISGVFNFKTIKGIPTVGPARFGTSVIDVEL  420

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             H++VEI+FQN+E+++QS+H+DG   + V YG G W+ T+R++YNLVDA  R+T QVYP S
Sbjct  421   HEFVEIVFQNDERSIQSWHMDGTSAYPVAYGSGTWNVTMRRRYNLVDAVPRHTFQVYPLS  480

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WT ILVSLDNKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE + P + L CG
Sbjct  481   WTTILVSLDNKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEAEPPLNALYCG  535



>gb|AGE09595.1| SKU5-like protein, partial [Eucalyptus cladocalyx]
Length=517

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/513 (64%), Positives = 397/513 (77%), Gaps = 1/513 (0%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDE  1574
             S V A+DPYRFY W V YGTI+PLGV Q+ ILINGQFPGP++ V+TN+N+++N+INKLD+
Sbjct  2     SAVVADDPYRFYTWTVTYGTIAPLGVSQQVILINGQFPGPKLEVVTNDNIVLNLINKLDQ  61

Query  1573  PILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGG  1394
             P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY  Q KDQIGTY+YF ST LH+AAGG
Sbjct  62    PFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYSFQAKDQIGTYTYFPSTLLHKAAGG  121

Query  1393  YGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRL  1214
             +GA N+  R  IP+P+P P+  +TL+  DW+ T HK LQ+ LD+GK  P P G+LING+ 
Sbjct  122   FGATNVYERPHIPIPFPTPAGDFTLLAGDWYKTGHKTLQQSLDSGKSLPFPDGILINGQA  181

Query  1213  NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQS  1034
              S TF+G QG TYMFR+SNVGM+TS+NFRIQ H LKLVEVEGSHT+Q+ YDS+D+HVGQS
Sbjct  182   RS-TFSGDQGKTYMFRISNVGMSTSLNFRIQGHTLKLVEVEGSHTVQNMYDSIDVHVGQS  240

Query  1033  AGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQ  854
                LVTLN   KDYYIVAS+RF K  + A+A+LHY  S+T V G LP  P  Q HWSM+Q
Sbjct  241   LAVLVTLNQPPKDYYIVASTRFTKTVLNATAVLHYTNSLTPVSGPLPAGPTYQKHWSMKQ  300

Query  853   ARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTP  674
             ARTIRWNLTA+AARPNPQGS+HYG I I RT+VL N+   I+G  RYA+N VSY+N  TP
Sbjct  301   ARTIRWNLTASAARPNPQGSFHYGKIAISRTIVLANSAPLINGKRRYAVNGVSYINADTP  360

Query  673   LKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDG  494
             LKLAD+ NI GVF+ N+++  P  G A    SV    LH+++EI+FQN+E T+QS+HLDG
Sbjct  361   LKLADYFNIAGVFSTNSLQSVPSGGSASLATSVMPASLHEFIEIVFQNSENTVQSWHLDG  420

Query  493   QDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWP  314
              DFW VGYG G W    RK YNLVDA TR+T QVYP +WT+ILVSLDN+GMWNLRS+ W 
Sbjct  421   YDFWVVGYGFGQWTPASRKIYNLVDAPTRHTAQVYPRAWTSILVSLDNQGMWNLRSAAWE  480

Query  313   RNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             R YLGQQ YLRVW  +HSL  E  +P + LLCG
Sbjct  481   RQYLGQQFYLRVWTPDHSLANEYGIPSNALLCG  513



>gb|KHN42054.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/536 (63%), Positives = 410/536 (76%), Gaps = 8/536 (1%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPG  1637
             MR+  +G L  L  V+A      V+AED Y++Y W V YGTISPLG  Q+ ILINGQFPG
Sbjct  1     MRR--TGLLHLLCLVIALVS---VQAEDAYKYYTWTVTYGTISPLGSPQQVILINGQFPG  55

Query  1636  PeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQM  1457
             P ++++TNENVI+N+INKLDEP L TWNGIKQ K+SW DGVLGTNCPI PN+N+TY+ Q 
Sbjct  56    PRLDLVTNENVILNLINKLDEPFLLTWNGIKQWKNSWQDGVLGTNCPIPPNSNYTYKFQA  115

Query  1456  KDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQ  1277
             KDQIGTY+YF STQLH+AAGG+GALN+  RSVIP+PYP P   +TL+V DW+ T+HK L+
Sbjct  116   KDQIGTYTYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTLR  175

Query  1276  KQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             + L++GKP   P GLLING+ +S TFTG  G TYMFR+SNVG +TSINFRIQ H LKLVE
Sbjct  176   QTLESGKPLAFPDGLLINGQAHS-TFTGNPGKTYMFRISNVGFSTSINFRIQGHTLKLVE  234

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEGSHT+Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +T +A+LHY  S 
Sbjct  235   VEGSHTVQNLYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTETPLTTTAVLHYANSF  294

Query  916   TKVPGKLPDPPAGQYH--WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENT  743
             +   G +P PP  +Y   WSM+QART RWNLTANAARPNPQGS+HYG I   + + L N+
Sbjct  295   SSALGPVPAPPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIKLANS  354

Query  742   KENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLE  563
                I+G  RYA+N VSYVNP TPLKLAD+ NIPG+F++N ++++P  GP   G SV    
Sbjct  355   APLINGKLRYAVNSVSYVNPDTPLKLADYFNIPGIFSVNLLQNSPSNGPGYIGTSVLQTS  414

Query  562   LHDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPN  383
             LHD++E+IFQNNE T+QS+HLDG DFW +G+G G W    RK YNLVDA TR+T QVYP 
Sbjct  415   LHDFIEVIFQNNENTMQSWHLDGYDFWVIGHGFGQWTDASRKTYNLVDALTRHTTQVYPK  474

Query  382   SWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             SWT ILVSLDN+GMWNLRS++W R YLGQQ YLRVW+ + SL  E D+P + LLCG
Sbjct  475   SWTTILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWDAQKSLANEYDIPNNVLLCG  530



>gb|KHG25743.1| L-ascorbate oxidase [Gossypium arboreum]
Length=538

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/525 (63%), Positives = 403/525 (77%), Gaps = 1/525 (0%)
 Frame = -2

Query  1789  RFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
               + GVLA   +S+V AEDPY ++ W V YGT S LGV Q+ ILINGQFPGP+++V+TN 
Sbjct  8     HLVFGVLAVLGVSLVNAEDPYLYFTWTVTYGTRSILGVPQQVILINGQFPGPKLDVVTNN  67

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG+Y+Y
Sbjct  68    NIILNLINKLDQPFLMTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGSYTY  127

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F ST +HRAAGG+GALNII RSVIP+PY  P   +TL+V DW+  +HK LQ+ LD+GK  
Sbjct  128   FPSTLMHRAAGGFGALNIIHRSVIPIPYANPDGDFTLLVGDWFKANHKTLQQSLDSGKSM  187

Query  1249  PSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
             P P G+LING+  + TFTG QG TYMFR SNVG++TS+NFRIQ HK+KLVEVEGSH +Q+
Sbjct  188   PFPDGVLINGQTQA-TFTGDQGKTYMFRFSNVGLSTSLNFRIQGHKMKLVEVEGSHVIQN  246

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              YDSLD+HVGQS   LVTL+   K+YYIVAS+RF K  +TA+A LHY  S   V G +P 
Sbjct  247   LYDSLDVHVGQSITILVTLDQPPKNYYIVASTRFTKTVLTATAALHYANSNAPVSGPVPA  306

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              PA  + WSM QART RWNLT+NAARPNPQGS+HYGTI   +T+VL N+   I+G  RYA
Sbjct  307   APANGFDWSMEQARTYRWNLTSNAARPNPQGSFHYGTITPTKTIVLANSAPLINGKLRYA  366

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VSY+NP TPLKLAD+ NIPGVF+ N++ + P    A    SV    LHD++E++FQN
Sbjct  367   VNGVSYINPDTPLKLADYFNIPGVFSTNSLSELPSGRAATLATSVMATSLHDFIEVVFQN  426

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
             NE T+Q++HLDG DFW VG+G G W    RK YNLVDA TR+T QVYPNSWTAILVSLDN
Sbjct  427   NENTMQAWHLDGYDFWVVGFGSGQWTPDKRKSYNLVDALTRHTTQVYPNSWTAILVSLDN  486

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +GMWN+RS++W R YLGQQ YLRVWN   SL  E D+P + LLCG
Sbjct  487   QGMWNVRSTLWDRQYLGQQFYLRVWNPVRSLANEYDIPSNVLLCG  531



>gb|KEH20500.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=541

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/511 (64%), Positives = 404/511 (79%), Gaps = 2/511 (0%)
 Frame = -2

Query  1744  EAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPIL  1565
             +AED Y+++ W V YGT+SPLG  Q+ ILINGQFPGP+++++TNENV++N++NKLD+P L
Sbjct  25    QAEDGYKYFTWTVTYGTLSPLGTPQQVILINGQFPGPQLDLVTNENVVLNLVNKLDQPFL  84

Query  1564  FTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGA  1385
              TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF STQLH+AAGG+GA
Sbjct  85    LTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGTYTYFPSTQLHKAAGGFGA  144

Query  1384  LNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNSV  1205
             +N+  RSVI +PYP P   +TL++ DW+ T+HK L++ LD+GK    P GLLING+ +S 
Sbjct  145   INVYHRSVISVPYPYPDGDFTLLIGDWYKTNHKALRESLDSGKSLAFPDGLLINGQAHS-  203

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
             T  G QG TYMFR+SNVGM+TSINFRIQ H LKLVEVEGSH +Q+ YDSLD+HVGQSA  
Sbjct  204   TINGDQGKTYMFRISNVGMSTSINFRIQGHALKLVEVEGSHVIQNIYDSLDVHVGQSAAV  263

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             LVTLN   KDYYIVAS+RF +  +TA+A+LHY  S +   G LP PPA QYHWS+ QAR+
Sbjct  264   LVTLNQSPKDYYIVASTRFSRRILTATAVLHYTNSHSPASGPLPSPPAYQYHWSLIQARS  323

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKL  665
              RWNLTANAARPNPQGSYHYG I   +T+VL N+   I+G  RYA+NKVSYVN  TPLKL
Sbjct  324   FRWNLTANAARPNPQGSYHYGKITPTKTIVLANSAPLINGKLRYAVNKVSYVNSETPLKL  383

Query  664   ADWLNIPGVFTLNAIKDTPP-AGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             AD+ NIPG+F++++I+  P   GPA    SV    LHD+VE++FQN+E T+QS+HLDG D
Sbjct  384   ADYFNIPGIFSVDSIQSIPSNGGPAYVATSVLPTSLHDFVELVFQNDENTMQSWHLDGYD  443

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VGYG G W    R+ YNLVDA TR+T QVYPNSWT ILVSLDN+GMWNLRS++W R 
Sbjct  444   FWVVGYGFGQWTPARRRIYNLVDAPTRHTAQVYPNSWTTILVSLDNQGMWNLRSAIWERQ  503

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ+YLRVW ++ SL  E ++P + LLCG
Sbjct  504   YLGQQLYLRVWTDQRSLRNEYNIPTNVLLCG  534



>gb|KEH20499.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=540

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/524 (61%), Positives = 397/524 (76%), Gaps = 2/524 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
               G+LA +    V AED Y+F+ W +  GTI PLGV Q GILINGQFPGP I  ITN+N+
Sbjct  10    FFGILACWSAISVTAEDRYQFFTWEITKGTIFPLGVPQEGILINGQFPGPTIEAITNDNI  69

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             +VNVINKLD+  L TW+GIKQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQ+GTY+YF 
Sbjct  70    VVNVINKLDDKFLITWSGIKQRRTSWQDGVLGTNCPIPPNSNWTYKFQVKDQVGTYTYFP  129

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             ST++H+AAGG+G  NI +RS I +PYP P   +TL+V DW  T+HK L++ LD GK  P 
Sbjct  130   STKIHKAAGGFGGFNIAQRSTIAIPYPAPDGEFTLLVGDWSKTNHKVLRRLLDVGKSLPF  189

Query  1243  PKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
             P  LLING  ++  FTG+ G TY FRVSNVGM TSINFRIQ H LKL+EVEG+HT+Q+ Y
Sbjct  190   PDALLINGVKDNAVFTGEAGKTYKFRVSNVGMATSINFRIQGHSLKLIEVEGAHTLQETY  249

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
             +SLD+HVGQS   LVTL+  + DYYIVAS+RF  P +T +A L Y GS +K  G LP  P
Sbjct  250   ESLDVHVGQSMTVLVTLDKSIGDYYIVASTRFTNPILTTTATLRYSGSNSKASGLLPVGP  309

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
                  WS++QARTIR NLTANAARPNPQGS+HYGTIP++R L L N+K  ++G  RYA+N
Sbjct  310   T-DVEWSIKQARTIRLNLTANAARPNPQGSFHYGTIPVLRVLQLANSKSIVNGKLRYAVN  368

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVH-GVSVFGLELHDYVEIIFQNN  527
              +S++NP+TPLKLADW NIPG+F LN IKD P +  +V  G SV G  LHD+ EIIFQN+
Sbjct  369   GISHINPSTPLKLADWFNIPGIFDLNTIKDFPSSSKSVKLGTSVLGFTLHDFAEIIFQND  428

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E T+QS+H+DG  F+ VG+G G W   +R+ YNLVD  TRYT QVYPNSWT ILVSLDNK
Sbjct  429   ENTIQSWHMDGSSFYVVGFGKGKWTPDVRRTYNLVDGITRYTTQVYPNSWTTILVSLDNK  488

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS++W   YLGQ +Y+RVWNNE SLYTE ++P + L CG
Sbjct  489   GMWNLRSAIWENRYLGQDLYMRVWNNEQSLYTETNVPLNALFCG  532



>ref|XP_004511977.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cicer arietinum]
Length=538

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/529 (62%), Positives = 406/529 (77%), Gaps = 1/529 (0%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinv  1622
             +  +  L   LA   +S+V+AEDPY+FY W V YGT+SPLGV Q+ ILINGQFPGP +++
Sbjct  4     TSLIYLLCLALALVNVSLVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDL  63

Query  1621  itnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIG  1442
             +TN+NVI+N++NKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG
Sbjct  64    VTNDNVILNLVNKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIG  123

Query  1441  TYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDT  1262
             TY+YF ST++H+A+GG+G LN+  RSVIP+PYP P   +TL++ DW+ T HK L + LD+
Sbjct  124   TYTYFPSTKMHKASGGFGGLNVYHRSVIPIPYPNPDGDFTLLIGDWYKTSHKILSQSLDS  183

Query  1261  GKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             GK    P GLLING+++S TFTG QG TYMFR+SNVG++TSINFRIQ HKLKLVEVEGSH
Sbjct  184   GKSIGFPDGLLINGQVHS-TFTGDQGKTYMFRISNVGLSTSINFRIQGHKLKLVEVEGSH  242

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPG  902
             T+Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +  +A+LHY  S +   G
Sbjct  243   TIQNVYDSLDVHVGQSVAVLVTLNQVPKDYYIVASTRFTQTVLNTTAVLHYTNSHSPALG  302

Query  901   KLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGI  722
              LP PP  +Y WSM+QA T RWNLTANAARPNPQGS+HYG I   R + L N+   I+G 
Sbjct  303   PLPAPPVDKYDWSMKQAITYRWNLTANAARPNPQGSFHYGNITPTRRINLANSAPLINGK  362

Query  721   TRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEI  542
              RYA+N VSYVNP TPLKLAD+ NI G+F+ N+I+  P  GPA    SV    LHD++E+
Sbjct  363   LRYAVNSVSYVNPVTPLKLADYFNISGIFSDNSIQSNPSNGPAYIATSVLKTSLHDFIEV  422

Query  541   IFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILV  362
             +FQNNE T+QS+HLDG DFW +GYG G W    R  YNLVDA TR+T QVYPNSWT ILV
Sbjct  423   VFQNNENTMQSWHLDGYDFWVIGYGFGQWTDASRNTYNLVDALTRHTAQVYPNSWTTILV  482

Query  361   SLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             SLDN+GMWNLRS++W R YLGQQ+YLRVWN + +   E D+P + LLCG
Sbjct  483   SLDNQGMWNLRSAIWERQYLGQQLYLRVWNAQRTAANEYDIPSNALLCG  531



>ref|XP_003611825.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES94783.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=538

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/513 (64%), Positives = 397/513 (77%), Gaps = 3/513 (1%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDE  1574
             S+V+AED Y+FY W V YG +SPLG  Q+ ILINGQFPGP +++ITN NVI+N++NKLDE
Sbjct  22    SLVQAEDDYKFYTWTVTYGILSPLGTPQQVILINGQFPGPRLDLITNNNVILNLVNKLDE  81

Query  1573  PILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGG  1394
             P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTYSYF ST++H+AAGG
Sbjct  82    PFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTYSYFPSTKMHKAAGG  141

Query  1393  YGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRL  1214
             +G LN+ RRSVIP+PYP P   +TL++ DW+   HK L++ LD GK    P GLLING++
Sbjct  142   FGGLNVYRRSVIPIPYPNPDGDFTLLIGDWYKASHKVLRQSLDLGKSPGFPDGLLINGQV  201

Query  1213  NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQS  1034
             +S TFTG QG TYMFR+SNVG++TSINFRIQ H LKLVEVEGSHT+Q+ YDSLD+HVGQS
Sbjct  202   HS-TFTGNQGKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGSHTLQNVYDSLDVHVGQS  260

Query  1033  AGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQ  854
                LVTLN   KDYYIVAS+RF +  ++ +++LHY  S +   G LP PPA  Y WSM+Q
Sbjct  261   VSVLVTLNQPPKDYYIVASTRFTQTVLSTTSVLHYSNSRSSASGPLPAPPADNYDWSMKQ  320

Query  853   ARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTP  674
             ART RWNLTANAARPNPQGS+HYG I   + + L N+   I+G  RYA+N VSY+NP TP
Sbjct  321   ARTYRWNLTANAARPNPQGSFHYGKIIPTKRIYLANSAPLINGKLRYAVNSVSYINPDTP  380

Query  673   LKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDG  494
             LKLAD+ NIPG+  L  I+ TP  GPA    SV    LHD++E++FQNNE T+QS+HLDG
Sbjct  381   LKLADYFNIPGI--LGDIQTTPSNGPAHIATSVLRTSLHDFIEVVFQNNENTMQSWHLDG  438

Query  493   QDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWP  314
              DFW VGYG G W    R  YNLVDA TR+T QVYPNSWTAILVSLDN+GMWNLRS++W 
Sbjct  439   YDFWVVGYGSGQWTDASRSTYNLVDALTRHTAQVYPNSWTAILVSLDNQGMWNLRSAIWE  498

Query  313   RNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             R YLGQQ+YLRVWN + +   E D+P + LLCG
Sbjct  499   RQYLGQQLYLRVWNAQRTAANEYDIPNNALLCG  531



>gb|KHG07318.1| L-ascorbate oxidase [Gossypium arboreum]
Length=536

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/526 (63%), Positives = 405/526 (77%), Gaps = 4/526 (1%)
 Frame = -2

Query  1792  LRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             L  ++GVLA   +S+V AEDPY +Y W V YGT S LG  Q+ ILIN QFPGP+++V+TN
Sbjct  8     LHLIIGVLA---VSLVNAEDPYLYYTWTVTYGTRSILGFPQQVILINNQFPGPKLDVVTN  64

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
              N+I+N+INKLD+P L TWNG+KQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG+Y+
Sbjct  65    NNIILNLINKLDQPFLLTWNGVKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGSYT  124

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF ST +HRAAGG+GALNI  RSVIP+PY  P   +TL++ DW+ T HK LQ+ LD+GK 
Sbjct  125   YFPSTLMHRAAGGFGALNIYHRSVIPIPYANPDGDFTLLIGDWYKTSHKALQQTLDSGKS  184

Query  1252  FPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
              P P G+LING+  + TFTG+QG TYMFR+SNVG++TS+NFRIQ H +KLVEVEGSH +Q
Sbjct  185   LPFPHGVLINGQTKT-TFTGEQGKTYMFRISNVGLSTSLNFRIQGHSMKLVEVEGSHVIQ  243

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
             + YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +TA+A+LHY  S T V G LP
Sbjct  244   NLYDSLDVHVGQSVTVLVTLNQPPKDYYIVASTRFTRTVLTATAVLHYANSQTPVSGPLP  303

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               PA +YHWSM+QAR  RWNLT+NAARPNPQGS+HYG I   +T+VL N+   I+G  RY
Sbjct  304   AAPAYKYHWSMQQARIYRWNLTSNAARPNPQGSFHYGKITPTKTIVLANSVSYINGKLRY  363

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
             A+N VSYVN  TPLKLAD+ NIPG+F++NA++  P    A    SV    LHD++E++FQ
Sbjct  364   AVNGVSYVNADTPLKLADYFNIPGIFSMNAVQGVPSGVAATVATSVMPTNLHDFLEVVFQ  423

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             NNE T+QS+HLDG DFW VG+G G W    R+ YNLVDA TR+T QVYPNSWTAILVSLD
Sbjct  424   NNENTMQSWHLDGYDFWVVGFGSGQWTPKKRRTYNLVDALTRHTTQVYPNSWTAILVSLD  483

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+GMWN+RS+ W R YLGQQ YLRVWN   SL  E D+P + LLCG
Sbjct  484   NQGMWNMRSASWERQYLGQQFYLRVWNPVRSLANEYDIPSNVLLCG  529



>ref|XP_003550083.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN12128.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/514 (63%), Positives = 404/514 (79%), Gaps = 2/514 (0%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDE  1574
             S+VE ED Y++Y W V YG +SPLG  Q+ +LI+GQFPGP+++++TNENV++N++NKLDE
Sbjct  21    SLVEGEDAYKYYTWTVTYGILSPLGSPQQVVLIDGQFPGPQLDLVTNENVVLNLVNKLDE  80

Query  1573  PILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGG  1394
             P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q+KDQIGTY+YF ST LH+AAGG
Sbjct  81    PFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQVKDQIGTYTYFPSTSLHKAAGG  140

Query  1393  YGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRL  1214
             +G LN+  RSVIP+PYP P   +TL++ DW+ T+HK L++ LD+GK    P GLLING+ 
Sbjct  141   FGGLNVYHRSVIPVPYPYPDGDFTLLIGDWYKTNHKVLRESLDSGKSLAFPDGLLINGQA  200

Query  1213  NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQS  1034
             ++ T  G QG TYMFR+SNVGM+TSINFRIQ H LKLVE+EGSH +Q+ YD+LD+HVGQS
Sbjct  201   HT-TINGDQGKTYMFRISNVGMSTSINFRIQGHPLKLVEIEGSHIVQNTYDTLDVHVGQS  259

Query  1033  AGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQ  854
             A  LVTLN   KDYYIVAS+RF +  +TA+A+LHY  S +   G LP PP  QYHWS++Q
Sbjct  260   AAVLVTLNQPPKDYYIVASTRFSRKVLTATAVLHYSNSNSPASGPLPSPPIYQYHWSVKQ  319

Query  853   ARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTP  674
             ART RWNLTANAARPNPQGSYHYG I   +T+VL N+   I+G  RYA+NKVSYVN  TP
Sbjct  320   ARTYRWNLTANAARPNPQGSYHYGKITPTKTIVLSNSAPLINGKLRYAVNKVSYVNSDTP  379

Query  673   LKLADWLNIPGVFTLNAIKDTP-PAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLD  497
             LKLAD+ NIPG++++++I+  P  + PA    SV    LHD++E++FQNNE  +QS+HLD
Sbjct  380   LKLADYFNIPGIYSVDSIQTLPSESTPASIATSVVPTSLHDFIEVVFQNNENAMQSWHLD  439

Query  496   GQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVW  317
             G DFW VGYG G W    R+ YNLVDA TR+T QVYPN+WT ILVSLDN+GMWNLRS++W
Sbjct  440   GYDFWVVGYGFGQWTPAKRRTYNLVDALTRHTTQVYPNAWTTILVSLDNQGMWNLRSAIW  499

Query  316   PRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              R YLGQQ+YLRVW +E SL  E D+P + LLCG
Sbjct  500   ERQYLGQQLYLRVWTSERSLANEYDIPNNALLCG  533



>ref|XP_002270831.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
Length=536

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/520 (62%), Positives = 401/520 (77%), Gaps = 1/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +     + +V  EDPY++Y W V YGTISPLGV Q+ ILINGQFPGP + V+TN+N+I++
Sbjct  11    ICVLLGVFLVNGEDPYKYYTWTVTYGTISPLGVPQQVILINGQFPGPALEVVTNDNIILD  70

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             +INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST 
Sbjct  71    LINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTFTYFPSTL  130

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+GA+N+  R  IP+P+P+P+  +TL+V DW+ T HK LQ+ LD+GKP P P G
Sbjct  131   FHKAAGGFGAINVYERPRIPIPFPDPAGDFTLLVGDWYKTSHKTLQQTLDSGKPLPFPDG  190

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LING+ +S +F+G QG TYMFR+SNVG++TSINFRIQ H +KLVEVEGSHT+Q+ YDSL
Sbjct  191   VLINGQTSS-SFSGDQGKTYMFRISNVGLSTSINFRIQGHTMKLVEVEGSHTLQNTYDSL  249

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   LVTL+   KDYYIVAS+RF K  +TA+A+LHY  S T V G +P  P  Q
Sbjct  250   DVHVGQSIAVLVTLDQLPKDYYIVASTRFTKQILTATAVLHYTNSHTPVSGPVPAGPTYQ  309

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
              HWSM+QART RWNLTA+AARPNPQGS+HYG I   RT++L N+   ++G  RYA+N VS
Sbjct  310   IHWSMKQARTYRWNLTASAARPNPQGSFHYGKITPSRTIMLVNSAPRLNGKQRYAVNGVS  369

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             Y+N  TPLKLAD+ NIPGVF++N+I+D P  G +    SV     HD++E++FQNNE T+
Sbjct  370   YINADTPLKLADYFNIPGVFSVNSIQDLPSGGSSFLSTSVMAANHHDFIEVVFQNNENTI  429

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QS+HLDG DFW VGYG G W    RK YNL+DA TR+T QVYP SWT I VSLDN+GMWN
Sbjct  430   QSWHLDGYDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQVYPRSWTTIWVSLDNQGMWN  489

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +RS+VW R YLGQQ YLRV+N  HS   E D+P + LLCG
Sbjct  490   MRSAVWERQYLGQQFYLRVFNPVHSPANEYDIPKNALLCG  529



>ref|XP_006338228.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=538

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/528 (61%), Positives = 405/528 (77%), Gaps = 1/528 (0%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
                  + G+  F+ +S+V+AED Y+++ W   YGT+SPLGV Q+ ILINGQFPGP ++++
Sbjct  5     ALFHLICGIFIFWSVSVVKAEDTYKYFTWTATYGTLSPLGVPQQVILINGQFPGPRLDLV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+NVI+N+INKLDEP+L TWNGIKQRK+SW DGVLGTNCPI  N+N+TY+ Q KDQIG+
Sbjct  65    TNDNVILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPINSNYTYKFQTKDQIGS  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             Y+YF STQLHRA GG+GALN+  RSVI +PY +P+  ++L++ DW+ + HK L++ LD+G
Sbjct  125   YTYFPSTQLHRAVGGFGALNVYARSVISVPYAKPAGDFSLLIGDWYKSSHKVLRQILDSG  184

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             +  P P GLLING+  S TF+G QG TYMFR+SNVG+  SINFRIQ HK+++VEVEGSH 
Sbjct  185   RSLPYPNGLLINGQKQS-TFSGDQGKTYMFRISNVGLKNSINFRIQGHKMRVVEVEGSHV  243

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDSLD+HVGQS   LVTL+   KDYYIVAS+RF +   TA+++LHY  S T V G 
Sbjct  244   LQNFYDSLDVHVGQSMSVLVTLDQPPKDYYIVASTRFSRINFTATSVLHYTNSQTPVSGP  303

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             +P  PAGQ HWSM QART RWNLT+NAARPNPQGS+HYG I I RT V+ N+   I+G  
Sbjct  304   MPPAPAGQMHWSMLQARTFRWNLTSNAARPNPQGSFHYGKITISRTFVMANSAPLINGKL  363

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N VSYVNP TPLKLAD  NIPGVF LN+I+  P  G    G +VF    HD++EI+
Sbjct  364   RYAVNSVSYVNPDTPLKLADHFNIPGVFNLNSIQAYPSGGSPYLGTAVFPTSHHDFIEIV  423

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQN+E T+QS+HLDG DFW VG+G   W    R KYNLVDA TR+T QVYP SWTAILVS
Sbjct  424   FQNDEATMQSWHLDGYDFWVVGFGSDKWTQASRNKYNLVDALTRHTTQVYPKSWTAILVS  483

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRS++W R YLGQQVYLRV++   SL  E D+P + LLCG
Sbjct  484   LDNQGMWNLRSAMWDRQYLGQQVYLRVYDPTPSLANEYDIPTNALLCG  531



>emb|CBI18560.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/520 (62%), Positives = 401/520 (77%), Gaps = 1/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +     + +V  EDPY++Y W V YGTISPLGV Q+ ILINGQFPGP + V+TN+N+I++
Sbjct  10    ICVLLGVFLVNGEDPYKYYTWTVTYGTISPLGVPQQVILINGQFPGPALEVVTNDNIILD  69

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             +INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST 
Sbjct  70    LINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTFTYFPSTL  129

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+GA+N+  R  IP+P+P+P+  +TL+V DW+ T HK LQ+ LD+GKP P P G
Sbjct  130   FHKAAGGFGAINVYERPRIPIPFPDPAGDFTLLVGDWYKTSHKTLQQTLDSGKPLPFPDG  189

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LING+ +S +F+G QG TYMFR+SNVG++TSINFRIQ H +KLVEVEGSHT+Q+ YDSL
Sbjct  190   VLINGQTSS-SFSGDQGKTYMFRISNVGLSTSINFRIQGHTMKLVEVEGSHTLQNTYDSL  248

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   LVTL+   KDYYIVAS+RF K  +TA+A+LHY  S T V G +P  P  Q
Sbjct  249   DVHVGQSIAVLVTLDQLPKDYYIVASTRFTKQILTATAVLHYTNSHTPVSGPVPAGPTYQ  308

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
              HWSM+QART RWNLTA+AARPNPQGS+HYG I   RT++L N+   ++G  RYA+N VS
Sbjct  309   IHWSMKQARTYRWNLTASAARPNPQGSFHYGKITPSRTIMLVNSAPRLNGKQRYAVNGVS  368

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             Y+N  TPLKLAD+ NIPGVF++N+I+D P  G +    SV     HD++E++FQNNE T+
Sbjct  369   YINADTPLKLADYFNIPGVFSVNSIQDLPSGGSSFLSTSVMAANHHDFIEVVFQNNENTI  428

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QS+HLDG DFW VGYG G W    RK YNL+DA TR+T QVYP SWT I VSLDN+GMWN
Sbjct  429   QSWHLDGYDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQVYPRSWTTIWVSLDNQGMWN  488

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +RS+VW R YLGQQ YLRV+N  HS   E D+P + LLCG
Sbjct  489   MRSAVWERQYLGQQFYLRVFNPVHSPANEYDIPKNALLCG  528



>ref|XP_006425823.1| hypothetical protein CICLE_v10025326mg [Citrus clementina]
 ref|XP_006466654.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR39063.1| hypothetical protein CICLE_v10025326mg [Citrus clementina]
Length=539

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/518 (62%), Positives = 398/518 (77%), Gaps = 1/518 (0%)
 Frame = -2

Query  1768  AFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnvi  1589
             A   +++V+A+DPYRFY W V  GT+SPLGV Q  ILINGQFPGP ++V+TN+N+I+NVI
Sbjct  16    AALSVALVKADDPYRFYTWTVTSGTLSPLGVPQEVILINGQFPGPRLDVVTNDNIILNVI  75

Query  1588  NKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLH  1409
             NKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG+Y YF ST +H
Sbjct  76    NKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSYFYFPSTLMH  135

Query  1408  RAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLL  1229
             RAAGGYG +NI +R  IP+PYP     +TL++ DW+ T+HK L++ LD+GK  P P G+L
Sbjct  136   RAAGGYGGINIYQRPRIPIPYPIQDGDFTLLIGDWFKTNHKILRQTLDSGKSLPFPDGVL  195

Query  1228  INGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDI  1049
             ING+    TF G QG TYMFR+SNVG++TS NFRIQ H +KLVEVEGSHT+Q+ YDSLD+
Sbjct  196   INGQ-GHTTFNGDQGKTYMFRISNVGLSTSFNFRIQGHTMKLVEVEGSHTIQNIYDSLDV  254

Query  1048  HVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYH  869
             HVGQS   LVT N   KDYYIVAS+RF K  +TA+A+LHY  S +   G LP  P  + H
Sbjct  255   HVGQSVSVLVTFNQPPKDYYIVASTRFTKNVLTATAVLHYTNSHSPASGPLPTGPTYEIH  314

Query  868   WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYV  689
             WSM+QART RWNLTANAARPNPQGS+HYG I   RT+VL N+   I+G  RYA+N +SYV
Sbjct  315   WSMKQARTFRWNLTANAARPNPQGSFHYGKINTTRTIVLANSAPLINGKLRYAVNGISYV  374

Query  688   NPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQS  509
             N  TPLKLAD+ NIPG+F++N+I+  P  G +    SV  + LH+Y+E++FQNNEKT+QS
Sbjct  375   NSDTPLKLADYFNIPGIFSVNSIQSVPSGGASSVATSVMQVNLHEYIEVVFQNNEKTMQS  434

Query  508   YHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLR  329
             +HLDG DFW VGYG G W +  R+ YNL D  TR+T QVYP SWTAILVSLDN+GMWN+R
Sbjct  435   WHLDGYDFWVVGYGSGQWAAEKRRTYNLADTLTRHTAQVYPQSWTAILVSLDNQGMWNMR  494

Query  328   SSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             S++W R YLGQQ YL+VWN  HSL  E D+P + L+CG
Sbjct  495   SAIWERQYLGQQFYLKVWNAVHSLANEYDIPSNILVCG  532



>ref|XP_007155969.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
 gb|ESW27963.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
Length=543

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/511 (62%), Positives = 399/511 (78%), Gaps = 2/511 (0%)
 Frame = -2

Query  1744  EAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPIL  1565
             + ED Y++Y W V YGT+SPLG  Q+ ILINGQFPGP+++++TN+NV++N++NKLDEP L
Sbjct  25    QGEDSYKYYTWTVTYGTLSPLGTPQQVILINGQFPGPQLDLVTNDNVVLNLVNKLDEPFL  84

Query  1564  FTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGA  1385
              TWNGIKQRK+SW DGVLGTNCP+ PN N+TY+ Q KDQIGTY+YF ST LH+AAGG+G 
Sbjct  85    LTWNGIKQRKNSWQDGVLGTNCPVPPNANYTYKFQAKDQIGTYTYFPSTSLHKAAGGFGG  144

Query  1384  LNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNSV  1205
             LN+  RSVIP+PYP P   +TL++ DW+ T+HK L++ LD+G     P GLLING+ ++ 
Sbjct  145   LNVYHRSVIPVPYPYPDGDFTLLIGDWYKTNHKSLRESLDSGNSLAFPDGLLINGQAHT-  203

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
             T  G QG TYMFR+SNVGM+TSINFRIQ H LKLVE+EGSHT+Q+ YD+LD+HVGQSA  
Sbjct  204   TVNGDQGKTYMFRISNVGMSTSINFRIQGHTLKLVEIEGSHTLQNVYDTLDVHVGQSATV  263

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             LVTLN   KDYYIVAS+RF +   TA+A+LHY  S +   G LP PP  QYHWS++QART
Sbjct  264   LVTLNQPPKDYYIVASTRFSRKMFTATAVLHYSNSNSPASGPLPSPPIHQYHWSVKQART  323

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKL  665
              RWNLTANAARPNPQGSYHYG I   +T+VL N+   I+G  RY +NKVSYVNP TPLKL
Sbjct  324   YRWNLTANAARPNPQGSYHYGEITPTKTIVLSNSASLINGKLRYTVNKVSYVNPDTPLKL  383

Query  664   ADWLNIPGVFTLNAIKDTPPAG-PAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             AD+ NIPG++++++++  P    P+    SV   +LHD++E++FQNNE T QS+HLDG D
Sbjct  384   ADYFNIPGIYSVDSLQSLPSDNTPSSVATSVVPTDLHDFIEVVFQNNENTTQSWHLDGYD  443

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VGYG G W    R+ YNLVDA TR+T QVYPN+WT ILVSLDN+GMWNLRS++W R 
Sbjct  444   FWVVGYGFGEWTPAKRRTYNLVDALTRHTAQVYPNAWTGILVSLDNQGMWNLRSAMWERQ  503

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ+YLRVW +E SL  E D+P + LLCG
Sbjct  504   YLGQQLYLRVWTSERSLANEYDIPDNVLLCG  534



>ref|XP_002310162.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE90612.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=538

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/527 (61%), Positives = 399/527 (76%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  L GVLA    S+V A+DPYR+Y W V YGT+  L V Q+ ILINGQFPGP ++V+T
Sbjct  6     LLHLLCGVLAVLSASLVNADDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+N+ NKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG++
Sbjct  66    NDNIILNLFNKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST LHRAAGGYGA+NI  R  IP+P+P P   +TL++ DW+ T HK LQ  LD+GK
Sbjct  126   TYFPSTLLHRAAGGYGAINIYERPRIPIPFPVPDGDFTLLIGDWYKTSHKTLQAYLDSGK  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P G+LING+  S TF+G QG TYMFR+SN+GM+TS+NFRIQ H +KLVEVEGSHT+
Sbjct  186   TLPFPDGVLINGQTYS-TFSGDQGKTYMFRISNMGMSTSLNFRIQGHSMKLVEVEGSHTV  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYI+AS+RF +  +T +A+LHY  S T   G L
Sbjct  245   QNIYDSLDVHVGQSVAVLVTLNQAPKDYYIIASTRFNRKILTTTAVLHYSNSRTPASGPL  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P+  YH SM QART +WNLTA+AARPNPQGSYHYG I   +T+ L N+   I+G  R
Sbjct  305   PAAPSYGYHGSMMQARTYKWNLTASAARPNPQGSYHYGKITPTKTIELANSAPLINGKQR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N+VSY+N  TPLKLAD+  IPGVF++++I+ +P  G A    SV    LHD++E++F
Sbjct  365   YAVNRVSYINSDTPLKLADYFGIPGVFSVDSIESSPSGGAAFLSTSVMSANLHDFLEVVF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QN+EKT+QS+HLDG DFW +GYG G W S  R  YNLVDA TR+TVQVYP SWTAI VSL
Sbjct  425   QNDEKTMQSWHLDGYDFWVIGYGNGQWTSAKRSMYNLVDALTRHTVQVYPKSWTAIYVSL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWN+RS++W R YLGQQ YLRVW   HSL  E D+P + L CG
Sbjct  485   DNQGMWNMRSALWERQYLGQQFYLRVWTQVHSLANEYDIPSNALRCG  531



>ref|XP_004232058.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=538

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/528 (61%), Positives = 404/528 (77%), Gaps = 1/528 (0%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
                  + G+  F+ +S+V+AED Y+++ W   YGT+ PLGV Q+ ILINGQFPGP ++++
Sbjct  5     ALFHLICGIFIFWSVSLVKAEDTYKYFTWTATYGTLYPLGVPQQVILINGQFPGPRLDLV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+NVI+N+INKLDEP+L TWNGIKQRK+SW DGVLGTNCPI  N+N+TY+ Q KDQIG+
Sbjct  65    TNDNVILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPINSNYTYKFQTKDQIGS  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             Y+YF STQLHRA GG+GALN+  RSVIP+PY +P+  ++L++ DW+ + HK L++ LD+G
Sbjct  125   YTYFPSTQLHRAVGGFGALNVYARSVIPVPYAKPAGDFSLLIGDWYKSSHKVLRQILDSG  184

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             +  P P  LLING+  S TF+G QG TYMFR+SNVG+  SINFRIQ HK+++VE+EGSH 
Sbjct  185   RSLPYPNDLLINGQKQS-TFSGDQGKTYMFRISNVGLKNSINFRIQGHKMRVVEIEGSHV  243

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDSLD+HVGQS   LVTL+   KDYYIVAS+RF +   TA+++LHY  S T V G 
Sbjct  244   LQNFYDSLDVHVGQSMSVLVTLDQPPKDYYIVASTRFSRISFTATSVLHYTNSQTPVSGP  303

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             +P  P GQ HWSM QART RWNLT+NAARPNPQGS+HYG I I RT V+ N+   I+G  
Sbjct  304   VPPAPTGQMHWSMLQARTFRWNLTSNAARPNPQGSFHYGKITISRTFVMANSAPLINGKL  363

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N VSYVNP TPLKLAD  NIPGVF LN+I+  P  G    G +VF    HD++EI+
Sbjct  364   RYAVNSVSYVNPDTPLKLADHFNIPGVFNLNSIQAYPSGGSPNLGTAVFPTSHHDFIEIV  423

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQN+E T+QS+HLDG DFW VG+G G W    R KYNLVDA TR+T QVYP SWTAILVS
Sbjct  424   FQNDEATMQSWHLDGYDFWVVGFGSGKWTQASRNKYNLVDALTRHTTQVYPKSWTAILVS  483

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRS++W R YLGQQVYLRV++   SL  E D+P + LLCG
Sbjct  484   LDNQGMWNLRSAMWDRQYLGQQVYLRVYDPTPSLANEYDIPTNALLCG  531



>ref|XP_011039228.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=538

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/527 (61%), Positives = 399/527 (76%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  L GVLA    S+V A+DPYR+Y W V YGT+  L V Q+ ILINGQFPGP ++V+T
Sbjct  6     LLHLLCGVLAVLSASLVNADDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+N+ NKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG++
Sbjct  66    NDNIILNLFNKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST LHRAAGGYGA+NI  R  IP+P+P P   +TL++ DW+ T H+ L+  LD+G+
Sbjct  126   TYFPSTLLHRAAGGYGAINIYERPKIPIPFPVPDGDFTLLIGDWYKTSHQTLRAYLDSGR  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P G+LING+  S TF+G QG TYMFR+SNVGM+TS+NFRIQ H +KLVEVEGSHT+
Sbjct  186   TLPFPDGVLINGQTYS-TFSGDQGKTYMFRISNVGMSTSLNFRIQGHSMKLVEVEGSHTV  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYI+AS+RF +  +T +A+LHY  S T   G L
Sbjct  245   QNIYDSLDVHVGQSVAVLVTLNQSPKDYYIIASTRFNRKILTTTAVLHYSNSRTPASGPL  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P+  YH SM QART +WNLTA+AARPNPQGSYHYG I   +T+ L N+   I+G  R
Sbjct  305   PAAPSYGYHGSMMQARTYKWNLTASAARPNPQGSYHYGKITPTKTVALANSAPLINGKQR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N+VSY+N  TPLKLAD+  IPGVF++++I+ +P  G A    SV    LHD++E++F
Sbjct  365   YAVNRVSYINSDTPLKLADYFGIPGVFSVDSIESSPSGGAAFLSTSVMSANLHDFLEVVF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QN+EKT+QS+HLDG DFW +GYG G W S  R  YNLVDA TR+TVQVYP SWTAI VSL
Sbjct  425   QNDEKTMQSWHLDGYDFWVIGYGNGQWTSAKRSTYNLVDALTRHTVQVYPKSWTAIYVSL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWN+RS++W R YLGQQ YLRVW   HSL  E D+P + L CG
Sbjct  485   DNQGMWNMRSAIWERQYLGQQFYLRVWTQVHSLANEYDIPSNALRCG  531



>ref|XP_004300548.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=539

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/528 (63%), Positives = 410/528 (78%), Gaps = 2/528 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAF-FCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
              L+ L G LA     S+V+AEDPY+FY W V YGT+SPLGV Q+ ILINGQFPGP ++V+
Sbjct  6     LLQLLFGALAVVLSASVVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDVV  65

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT
Sbjct  66    TNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQPKDQIGT  125

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             ++YF ST+LHRAAGG+G LN+  R  IP+PYP P + +TL+V DW+   H+ LQK LD+G
Sbjct  126   FTYFPSTKLHRAAGGFGGLNVYSRPRIPIPYPIPESDFTLLVGDWYKASHQALQKSLDSG  185

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             K  P P GLLING+ +S TFTG QG TYMFRVSNVG++TS+NFRIQ HK+KLVE EGSHT
Sbjct  186   KSLPYPNGLLINGQASS-TFTGDQGKTYMFRVSNVGLSTSLNFRIQGHKMKLVECEGSHT  244

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
              Q+ YDSLD+HVGQS   L+TL+   KDYYIV S+RF +  +TA+A+LHY  S T V G 
Sbjct  245   QQNIYDSLDVHVGQSFSVLLTLDQPPKDYYIVTSTRFTRRVLTATAVLHYSNSHTSVSGP  304

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             +P  P  Q+HWSM+QART RWNLTANAARPNPQGSYHYG I   +T+VL ++   I+G  
Sbjct  305   VPAGPRYQFHWSMQQARTFRWNLTANAARPNPQGSYHYGQIVPTKTIVLASSAPLINGTL  364

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA N+VSYVNP TPLKLAD+ NIPGVF+ +AI+  P  GPA+    V     HD++EI+
Sbjct  365   RYAFNRVSYVNPDTPLKLADYFNIPGVFSFDAIQSVPSGGPAILATPVLPSSHHDFLEIV  424

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE+T+QS HLDG DFW VGYG G W    R+ YNLVDA TR+TVQV+PNSW+ ILVS
Sbjct  425   FQNNERTMQSVHLDGYDFWPVGYGSGQWQPAKRRTYNLVDALTRHTVQVFPNSWSTILVS  484

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRS++W R YLGQQ+YLRVWN   +L  E ++P + L+CG
Sbjct  485   LDNQGMWNLRSALWERQYLGQQLYLRVWNPTQNLANEYNIPSNALMCG  532



>gb|EYU39394.1| hypothetical protein MIMGU_mgv11b015886mg [Erythranthe guttata]
Length=539

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/527 (61%), Positives = 402/527 (76%), Gaps = 8/527 (2%)
 Frame = -2

Query  1774  VLAFFCISM-------VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
             +L FF +S+       V AEDPYRF+ W V YGT SPLG+ Q+ ILINGQFPGP ++ +T
Sbjct  6     LLLFFAVSIFASNWDIVNAEDPYRFFTWTVTYGTASPLGLSQQVILINGQFPGPSLDCVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+NVI+NV+NKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY
Sbjct  66    NDNVIINVVNKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTY  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST +H+A+GG+G++N+  R VI +PY +P+A +TL++ DW+   HK+LQK LD+GK
Sbjct  126   TYFPSTLVHKASGGFGSINVYARPVISVPYSKPAADFTLLIGDWYLKSHKELQKVLDSGK  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
             P PSP  +LINGR  S +FTG QG TYMFRVSNVG++ S NFRIQ HKLKLVEVEGSH +
Sbjct  186   PLPSPDAILINGRTRS-SFTGDQGKTYMFRVSNVGLSASFNFRIQGHKLKLVEVEGSHVI  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTL+  VKDYYI+AS++F+ P +TA A+LHY  S T V G  
Sbjct  245   QNMYDSLDVHVGQSVTVLVTLDQSVKDYYIIASTKFLTPVLTAVAVLHYTNSRTGVSGPT  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  +  WSM QAR+ RWNLT+NAARPNPQGS+HYG I   RT++L N+   I+G  R
Sbjct  305   PAGPTDEAAWSMDQARSFRWNLTSNAARPNPQGSFHYGNIKKSRTIILANSAAIINGKQR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             +A+N++SY N  TPLKLAD+ NI GVFTL++IK  PP GP     SV G  LH++VEI+F
Sbjct  365   FAVNQISYNNTDTPLKLADYFNITGVFTLDSIKSAPPGGPYTIATSVIGTSLHEFVEIVF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE+ +QS+HLDG DFW VG+G G W    R  YNLVDA TR+T QVYP SWTAILVSL
Sbjct  425   QNNEEIIQSWHLDGYDFWVVGFGMGQWTQVSRNGYNLVDAPTRHTTQVYPKSWTAILVSL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWNLRS+ W   YLGQQ+YLRV+N   SL  E ++P + LLCG
Sbjct  485   DNQGMWNLRSANWGGQYLGQQLYLRVYNPTKSLSNEYNIPTNALLCG  531



>ref|XP_011013814.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=538

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/527 (61%), Positives = 398/527 (76%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  L GVLA    S+V A+DPYR+Y W V YGT+  L V Q+ ILINGQFPGP ++V+T
Sbjct  6     LLHLLCGVLAVLSASLVNADDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDVVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+N+ NKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG++
Sbjct  66    NDNIILNLFNKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSF  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF ST LHRAAGGYGA+NI  R  IP+P+P P   +TL++ DW+ T H+ L+  LD+G+
Sbjct  126   TYFPSTLLHRAAGGYGAINIYERPKIPIPFPVPDGDFTLLIGDWYKTSHQTLRAYLDSGR  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P G+LING+  S TF+G QG TYMFR+SNVGM+TS+NFRIQ H +KLVEVEGSHT+
Sbjct  186   TLPFPDGVLINGQTYS-TFSGDQGKTYMFRISNVGMSTSLNFRIQGHSMKLVEVEGSHTV  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLD+HVGQS   LVTLN   KDYYI+AS+RF +  +T +A+LHY  S     G L
Sbjct  245   QNIYDSLDVHVGQSVAVLVTLNQAPKDYYIIASTRFNRKILTTTAVLHYSNSRPPASGPL  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P+  YH SM QART +WNLTA+AARPNPQGSYHYG I   +T+ L N+   I+G  R
Sbjct  305   PAAPSYGYHGSMMQARTYKWNLTASAARPNPQGSYHYGKITPTKTVALANSAPLINGKQR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N+VSY+N  TPLKLAD+  IPGVF++++I+ +P  G A    SV    LHD++E++F
Sbjct  365   YAVNRVSYINSDTPLKLADYFGIPGVFSVDSIESSPSGGAAFLSTSVMSANLHDFLEVVF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QN+EKT+QS+HLDG DFW +GYG G W S  R  YNLVDA TR+TVQVYP SWTAI VSL
Sbjct  425   QNDEKTMQSWHLDGYDFWVIGYGNGQWTSAKRSTYNLVDALTRHTVQVYPKSWTAIYVSL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWN+RS++W R YLGQQ YLRVW   HSL  E D+P + L CG
Sbjct  485   DNQGMWNMRSAIWERQYLGQQFYLRVWTQVHSLANEYDIPSNALRCG  531



>ref|XP_007155970.1| hypothetical protein PHAVU_003G247800g [Phaseolus vulgaris]
 gb|ESW27964.1| hypothetical protein PHAVU_003G247800g [Phaseolus vulgaris]
Length=544

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/527 (61%), Positives = 401/527 (76%), Gaps = 4/527 (1%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             +LGVLA++    V AED Y ++ W +  GTI PLG  Q GILINGQFPGP I  ITN+N+
Sbjct  10    VLGVLAWWGGLSVIAEDRYLYFTWEITNGTIYPLGFPQPGILINGQFPGPTIEAITNDNI  69

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             +VNVINKL+E  L TW+GIKQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQ+GTY+YF 
Sbjct  70    VVNVINKLEEKFLITWSGIKQRRTSWEDGVLGTNCPIPPNSNWTYKFQVKDQVGTYTYFP  129

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             ST++H+A GG+G  N+ +RSVI +PYPEP A +TL++ DW+ TDH+ L++ LD GK  P+
Sbjct  130   STKIHKAGGGFGGFNVAQRSVISIPYPEPDAEFTLLIGDWYKTDHRVLRRLLDIGKSLPN  189

Query  1243  PKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
             P  LLING+ N   F+G  G TY  RVSNVG++TS NFRIQ H LKL+EVEG+HT+ + Y
Sbjct  190   PDSLLINGQQNGAVFSGLAGKTYKLRVSNVGLSTSFNFRIQGHDLKLIEVEGAHTIMESY  249

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKP-YMTASAILHYDGSVTKVPGKLPD-  890
             +SLD+HVGQS   LVTL+    DY I+AS+RF  P  +T++A L Y GS TK P  LP  
Sbjct  250   NSLDVHVGQSVTVLVTLHGPTSDYAIIASTRFTGPSVLTSTATLRYAGSNTKAPIPLPQG  309

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
             PP     WSM QAR+IR NLTANAARPNPQGS+HYGTIP+VRTL+L N+K  I G  RYA
Sbjct  310   PPTNDVQWSMEQARSIRLNLTANAARPNPQGSFHYGTIPVVRTLLLANSKAIIDGKLRYA  369

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGP--AVHGVSVFGLELHDYVEIIF  536
             +N +S+VNP TPLKLADW NIPGVF L+ IKD PP+ P  A  G SV G  LHD+ EI+F
Sbjct  370   VNGISHVNPNTPLKLADWFNIPGVFDLHTIKDVPPSSPTLAKLGTSVIGFTLHDFAEIVF  429

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE  +QS+H+DG  F+ VGY  G+W    RK YNL+D  TR+TVQVYPNSW+AILVSL
Sbjct  430   QNNENYIQSWHMDGSSFYVVGYDNGLWTPDARKTYNLIDGVTRHTVQVYPNSWSAILVSL  489

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DNKGMWNLRS++W R YLG+++YLRVWNNE S+YTE  +PP+ L CG
Sbjct  490   DNKGMWNLRSAIWERRYLGEELYLRVWNNEQSVYTEALVPPNELYCG  536



>gb|EYU44359.1| hypothetical protein MIMGU_mgv1a004187mg [Erythranthe guttata]
 gb|EYU44360.1| hypothetical protein MIMGU_mgv1a004187mg [Erythranthe guttata]
Length=540

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/525 (62%), Positives = 399/525 (76%), Gaps = 3/525 (1%)
 Frame = -2

Query  1783  LLGVLAFFCISM--VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             L+ VL+F+  S+   +AED Y++Y W V YGT SPLG+ Q+ ILINGQFPGP +  +TNE
Sbjct  9     LVVVLSFWSSSVFVAKAEDDYKYYTWTVTYGTSSPLGLSQQVILINGQFPGPTLVSVTNE  68

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+I+NV+NKLD+P L TWNGIKQRK+SW DGVLGTNCPI  N N+TY+ QMKDQIG+Y+Y
Sbjct  69    NIILNVVNKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPSNGNFTYKFQMKDQIGSYTY  128

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F ST +HRAAGG+GALNI  RSVI +PYP+P   +TL+V DW+ T HK LQ+ LD+G P 
Sbjct  129   FPSTLMHRAAGGFGALNIYARSVISVPYPKPDGDFTLLVGDWFKTGHKGLQQTLDSGNPL  188

Query  1249  PSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
             P P G+LINGR  S +F+G QG TYMFRVSN+G++TS NFRIQ HKLKLVEVEGSH +Q+
Sbjct  189   PFPDGILINGRGRS-SFSGDQGKTYMFRVSNIGLSTSFNFRIQGHKLKLVEVEGSHVLQN  247

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              YDSLD+HVGQS   LVTLN   KDYYIVAS+RF +  +TA+A+LHY  S   V G  P 
Sbjct  248   IYDSLDVHVGQSITILVTLNQSPKDYYIVASTRFTQTVLTATAVLHYTNSQVPVSGPTPA  307

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  +  WS+ QAR+ RWNLTANAARPNPQGS+HYGTI   RT+VL N+   I+G  RYA
Sbjct  308   GPTNEIAWSIDQARSYRWNLTANAARPNPQGSFHYGTIVPTRTIVLANSAPVINGKQRYA  367

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VSY+N  TPLKLAD+ NIPGVF++N+I+  P    A    SV G   HD++E++ QN
Sbjct  368   VNGVSYINSDTPLKLADYYNIPGVFSVNSIQSAPSGSGASLATSVLGTSHHDFIEVVLQN  427

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
             +E  +QS+HLDG DFW VG+G G W    +K YNLVDA TR+T QVYPNSWTAILVSLDN
Sbjct  428   DENAIQSWHLDGYDFWVVGFGAGKWTQDSKKTYNLVDALTRHTTQVYPNSWTAILVSLDN  487

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +GMWN+RS++W R YLGQQ YLRV+N   SL  E D+P + LLCG
Sbjct  488   QGMWNMRSAIWGRQYLGQQFYLRVYNPTQSLANEYDIPTNALLCG  532



>ref|XP_009619786.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=538

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/527 (62%), Positives = 397/527 (75%), Gaps = 1/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L  L G+L F+ +S+V AED Y+++ W   YG  SPLGV Q+ ILINGQFPGP ++++T
Sbjct  6     LLHLLCGILVFWSVSVVNAEDDYKYFTWTATYGMASPLGVPQQVILINGQFPGPRLDLVT  65

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N NVI+N+INKLDEP+L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG+Y
Sbjct  66    NNNVILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGSY  125

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
             +YF STQLHRA GG+GALN+  RSVIP+PY  P   ++L++ DW+ T HK LQ+ LD+GK
Sbjct  126   TYFPSTQLHRAVGGFGALNVYARSVIPVPYANPDGDFSLLIGDWYKTSHKALQQILDSGK  185

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P  LLING+  S TF G QG TYMFR+SNVG+  +INFRIQ HK+KLVEVEGSH +
Sbjct  186   SLPFPDSLLINGQKQS-TFNGDQGKTYMFRISNVGLKNTINFRIQGHKMKLVEVEGSHVI  244

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDS D+HVGQS   LVTL+   KDYYIVAS+RF    +T +A+LHY  S T   G L
Sbjct  245   QNLYDSFDVHVGQSLSILVTLDQSPKDYYIVASTRFTTTVLTTTAVLHYTNSQTPTSGPL  304

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  PA Q+ WS+ QART RWNLT+NAARPNPQGS+HYG I   RT+VL N+   ISG  R
Sbjct  305   PAGPADQFQWSLMQARTFRWNLTSNAARPNPQGSFHYGKITPSRTIVLANSAPLISGKQR  364

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N VSYVN  TPLKLAD  NIPGVF+LN+I+  P A       SV    LH+++EI+F
Sbjct  365   YAVNSVSYVNADTPLKLADHFNIPGVFSLNSIQTVPNAASPSLATSVLPASLHEFLEIVF  424

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE T+QS+HLDG DFW +G+G G W    RK+YNLVDA TR+T QVYP SWTAI VSL
Sbjct  425   QNNEDTMQSWHLDGYDFWVIGFGSGTWSQDSRKEYNLVDALTRHTTQVYPKSWTAIYVSL  484

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN+GMWNLRSS+W R YLGQQVYLRV+N   SL  E D+P + LLCG
Sbjct  485   DNQGMWNLRSSMWDRQYLGQQVYLRVYNPTPSLANEYDIPTNALLCG  531



>emb|CDP02462.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/529 (62%), Positives = 406/529 (77%), Gaps = 3/529 (1%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCI-SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
              L  +  +LAF+   S+V AED YR+Y W V YGT SPLG  Q+ ILINGQFPGP+++++
Sbjct  6     MLYLVCAILAFWSSGSLVTAEDAYRYYTWTVTYGTASPLGFSQQVILINGQFPGPKLDLV  65

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+NVI+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCP+ PN+N+TY+ Q KDQIG+
Sbjct  66    TNDNVILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPVPPNSNYTYKFQAKDQIGS  125

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             Y+YF ST LH+ AG +GALNI +RSVI +PYP+P   +TL++ DW+  +HK LQ++LD G
Sbjct  126   YTYFPSTLLHKTAGAFGALNIWQRSVISIPYPKPVGDFTLLIGDWYKYNHKVLQQRLDAG  185

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             K  P P G+LING+ +  +F+G QG TYMFR+SNVG  TS+NFRIQNHKLKLVEVEGSH 
Sbjct  186   KNLPFPDGVLINGQAHP-SFSGDQGKTYMFRISNVGFKTSLNFRIQNHKLKLVEVEGSHV  244

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDSLD+HVGQSA  LVT +   KDYYIVAS+RF +  +TA+A+LHY  S T V G 
Sbjct  245   IQNTYDSLDVHVGQSATVLVTFDQPPKDYYIVASTRFTEKVLTATAVLHYTNSRTAVSGP  304

Query  898   LPDPPAGQ-YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGI  722
             LP  PA +   WS+ QA+T+RWNLTANAARPNPQGS+HYG I + +  VL N+   I+G 
Sbjct  305   LPAGPAPKDVQWSLNQAKTLRWNLTANAARPNPQGSFHYGKISVTKRFVLANSAPLINGK  364

Query  721   TRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEI  542
              R+A+N VSYVNP TPLKLAD  NIPGVF LN+I+ +P      +GVSV    LHD++EI
Sbjct  365   QRFAVNGVSYVNPDTPLKLADHFNIPGVFGLNSIESSPSGVSPHYGVSVLSTSLHDFMEI  424

Query  541   IFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILV  362
             +FQNNE++LQS+HLDG DFW VGYG G W    R  YNL DA TR+T QVYPNSWTAILV
Sbjct  425   VFQNNERSLQSWHLDGYDFWVVGYGAGQWTQASRATYNLEDALTRHTAQVYPNSWTAILV  484

Query  361   SLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             SLDN+GMWNLRS++W + YLGQQVYLRV+    SL  E D+P + LLCG
Sbjct  485   SLDNQGMWNLRSAIWEKQYLGQQVYLRVYTPTPSLANEYDIPTNVLLCG  533



>ref|XP_009769792.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=538

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/528 (62%), Positives = 400/528 (76%), Gaps = 1/528 (0%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
               L  L G+L F+ +S+V+AED Y+++ W   YG  SPLGV Q+ ILINGQFPGP ++++
Sbjct  5     ALLHLLCGILGFWSVSVVKAEDDYKYFTWTATYGMASPLGVSQQVILINGQFPGPRLDLV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN NVI+N+INKLDEP+L TW+GIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG+
Sbjct  65    TNNNVILNLINKLDEPLLLTWDGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGS  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             Y+YF STQLHRA GG+GALN+  RSVIP+PY +P   ++L++ DW+ T HK LQ+ LD+G
Sbjct  125   YTYFPSTQLHRAVGGFGALNVYARSVIPVPYAKPDGDFSLLIGDWYKTSHKALQQILDSG  184

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             K  P P  LLING+  S TF G QG TYMFR+SNVG+  +INFRIQ HK+KLVEVEGSH 
Sbjct  185   KSLPFPDDLLINGQKQS-TFNGDQGKTYMFRISNVGLKNTINFRIQGHKMKLVEVEGSHV  243

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDS D+HVGQS   LVTL+   KDYYIVAS+RF    +T +A+LHY  S T V G 
Sbjct  244   IQNLYDSFDVHVGQSLSILVTLDQPPKDYYIVASTRFTTTVLTTTAVLHYTNSQTAVSGP  303

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             +P  P  Q+ WS+ QART RWNLT+NAARPNPQGS+HYG I   RT+VL N+   ISG  
Sbjct  304   VPAGPPDQFQWSLMQARTFRWNLTSNAARPNPQGSFHYGKITPSRTIVLANSAPLISGKQ  363

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N VSYVNP TPLKLAD  NIPGVF+LN+I+  P A       SV    LH+++EI+
Sbjct  364   RYAVNSVSYVNPDTPLKLADHFNIPGVFSLNSIQTVPTAASPSLATSVLPASLHEFLEIV  423

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE T+QS+HLDG DFW +G+G G W    RK+YNLVDA TR+T QVYP SWTAI VS
Sbjct  424   FQNNEDTVQSWHLDGYDFWVIGFGSGTWMQDSRKEYNLVDALTRHTTQVYPKSWTAIYVS  483

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRS++W R YLGQQVYLRV+N   SL  E D+P + LLCG
Sbjct  484   LDNQGMWNLRSAIWDRQYLGQQVYLRVYNPTPSLANEYDIPTNALLCG  531



>ref|XP_004233429.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=539

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/528 (61%), Positives = 403/528 (76%), Gaps = 1/528 (0%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
                  L G+L F+ +S+V+AEDPY+++ W   YG  SPLG  Q+ ILINGQFPGP ++++
Sbjct  5     ALFHLLCGILIFWAVSVVKAEDPYKYFTWTATYGMASPLGTPQQVILINGQFPGPRLDLV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+++N+INKLDEP+L TWNGIKQRK+SW DGVLGTNCPI PN N+ Y+ Q KDQIG+
Sbjct  65    TNDNIVLNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPNRNYIYKFQPKDQIGS  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             Y+YF STQLHRAAGG+G LN+  RSVIP+PY +P+  ++L++ DW+ T HK L++ LD+G
Sbjct  125   YTYFPSTQLHRAAGGFGVLNVYARSVIPVPYAKPAGDFSLLIGDWYKTSHKVLRQILDSG  184

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             K  P P GLLING+  S TFTG QG TYMFR+SNVG+ T+INFRIQ HK+KLVEVEGSH 
Sbjct  185   KSLPFPDGLLINGQKQS-TFTGDQGKTYMFRISNVGLKTTINFRIQGHKMKLVEVEGSHV  243

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDS D+HVGQS   LVTL+   KDYYIVAS+RF    +T++++LHY  S T V G 
Sbjct  244   IQNLYDSFDVHVGQSLSILVTLDQSPKDYYIVASTRFTTTVLTSTSVLHYTNSQTPVSGP  303

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             +P  P  Q+ WS+ QARTIRWNLT+NAARPNPQGS+HYG I   RT++L N+   I+G  
Sbjct  304   VPAAPVNQFQWSLMQARTIRWNLTSNAARPNPQGSFHYGKITPSRTILLANSAPLINGKQ  363

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N +SY+NP TPLKLAD  NIPGVFTL++I+  P A       +V    LH+++EI+
Sbjct  364   RYAVNGISYINPDTPLKLADHFNIPGVFTLDSIRSAPTADSPHLATAVLPSSLHEFLEIV  423

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE T+QS+HLDG DFW VG+G G W    RK YNLVDA TR+T QVYP SWTAI VS
Sbjct  424   FQNNEDTMQSWHLDGYDFWVVGFGSGTWTQASRKGYNLVDALTRHTTQVYPKSWTAIYVS  483

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRS++W R YLGQQVYLRV+N   SL  E D+P + LLCG
Sbjct  484   LDNQGMWNLRSAMWDRQYLGQQVYLRVYNPTASLANEYDIPTNALLCG  531



>emb|CDX69261.1| BnaC01g01920D [Brassica napus]
Length=527

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/526 (61%), Positives = 393/526 (75%), Gaps = 15/526 (3%)
 Frame = -2

Query  1789  RFLLGVLAFFCIS-MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             +  +G L F+  S +V AEDPY FY W V YGT SPLGV Q+ ILINGQFPGP I  +TN
Sbjct  10    KLFIGSLLFWLGSVLVSAEDPYLFYTWTVTYGTRSPLGVPQQVILINGQFPGPPIEAVTN  69

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
              N++VN+INKLDEP L TWNG+KQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQIGTY+
Sbjct  70    NNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQLKDQIGTYT  129

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF ST +HRA+G +GALNI +RSVI  PYP P   +TL+V+DW+   HK L+K+LD G  
Sbjct  130   YFASTSMHRASGAFGALNINQRSVITTPYPTPDGDFTLLVTDWFKMSHKDLRKRLDAGYA  189

Query  1252  FPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
              P P  LLING    + FTG+QG TY FRVSNVG+ TSINFRIQ+H + L+EVEG+HT+Q
Sbjct  190   LPLPDALLINGVSKGLIFTGEQGKTYKFRVSNVGIATSINFRIQDHTMSLIEVEGAHTLQ  249

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
             + Y+SLD+HVGQS   LVTL A V+DYYIVAS+RF KP +  +A L Y GS   V G LP
Sbjct  250   ETYESLDVHVGQSVTVLVTLKASVRDYYIVASTRFTKPILNTTASLRYLGSKNAVSGPLP  309

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P    HWSM+QARTIR NLTANAARPNPQGS+HYGTIPI RTL+L N    I G  RY
Sbjct  310   VGPTYHIHWSMKQARTIRMNLTANAARPNPQGSFHYGTIPINRTLILANAATMIYGKLRY  369

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
              +N++SY+NP TPLKLAD               TP  GPA  G SVF +ELH++VEI+FQ
Sbjct  370   TVNRISYLNPATPLKLADC--------------TPTIGPAHFGTSVFDVELHEFVEIVFQ  415

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             N+E+++QS+H+DG   + VGYG G W+ T+RK+YNL DA  R+T QVYP SWT+ILVSLD
Sbjct  416   NDERSIQSWHMDGTSAFLVGYGSGTWNVTMRKRYNLSDAVARHTFQVYPLSWTSILVSLD  475

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             NKGMWNLRS +W R YLGQ++Y+RVWN+E SLYTE D P + L CG
Sbjct  476   NKGMWNLRSQIWSRRYLGQELYVRVWNDEKSLYTEVDPPLNALYCG  521



>ref|XP_009407426.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=533

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/528 (61%), Positives = 396/528 (75%), Gaps = 2/528 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVE-AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
              +R + GVL F   + V  A+DPYRF+ W V YG I PLGV+Q+GILINGQFPGP ++ +
Sbjct  1     MMRLVCGVLVFLAAAFVAGADDPYRFFTWTVTYGPIYPLGVQQQGILINGQFPGPRLDCV  60

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N++++VINKLDEP+L TWNGIKQRK+SW DGVLGTNCPILP+ N+TY+ Q KDQIG 
Sbjct  61    TNDNIVIDVINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPILPSGNFTYKFQTKDQIGG  120

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             ++YF ST + RAAGG+G+LN+ +R  IP+PY +P+  ++L+V DW+   HK LQK LD+G
Sbjct  121   FTYFPSTGMQRAAGGFGSLNVYQRPQIPVPYAKPADDFSLLVGDWYRASHKVLQKALDSG  180

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
                P P  LLING+     F G QG TY+FR+SNVGMTTSINFRIQ HK+KLVEVEGSHT
Sbjct  181   SSLPFPDDLLINGQ-KYTAFAGDQGKTYLFRISNVGMTTSINFRIQGHKMKLVEVEGSHT  239

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDSLDIHVGQS   LVTL+   KDYYIVAS+RF +  +TA+A+LHY  S + V G 
Sbjct  240   LQNIYDSLDIHVGQSLSVLVTLDQAPKDYYIVASTRFTRKVLTATAVLHYGNSNSPVSGP  299

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             +P  PA   HWSM+QART RWNLTA+AARPNPQGSYHYG I   R+++L N+   I G  
Sbjct  300   IPGGPAYGLHWSMKQARTFRWNLTASAARPNPQGSYHYGKITRSRSIMLANSAAVIGGKQ  359

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N VS+V P TPLKLAD  NI GVFT +++   P  G  V    V    LHD+VEII
Sbjct  360   RYAINGVSFVVPGTPLKLADDFNIAGVFTWDSLPIPPAGGSPVLSTPVVRFNLHDFVEII  419

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQN E T+Q++HLDG DFW VGYG G W   LR++YNLVDA TR+TVQVYPN W+AILVS
Sbjct  420   FQNTENTMQTWHLDGYDFWVVGYGSGKWTERLRRRYNLVDAVTRHTVQVYPNGWSAILVS  479

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN+GMWNLRS++W R YLGQQ Y+RVW  E S   E DMP + L CG
Sbjct  480   LDNQGMWNLRSAMWARQYLGQQFYIRVWTPEKSYANEYDMPANALRCG  527



>ref|XP_004511976.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cicer arietinum]
Length=559

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/550 (60%), Positives = 406/550 (74%), Gaps = 22/550 (4%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinv  1622
             +  +  L   LA   +S+V+AEDPY+FY W V YGT+SPLGV Q+ ILINGQFPGP +++
Sbjct  4     TSLIYLLCLALALVNVSLVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDL  63

Query  1621  itnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIG  1442
             +TN+NVI+N++NKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG
Sbjct  64    VTNDNVILNLVNKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIG  123

Query  1441  TYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDT  1262
             TY+YF ST++H+A+GG+G LN+  RSVIP+PYP P   +TL++ DW+ T HK L + LD+
Sbjct  124   TYTYFPSTKMHKASGGFGGLNVYHRSVIPIPYPNPDGDFTLLIGDWYKTSHKILSQSLDS  183

Query  1261  GKPFPSPKGLLINGRLNSVTFTGKQ---------------------GSTYMFRVSNVGMT  1145
             GK    P GLLING+++S TFTG Q                     G TYMFR+SNVG++
Sbjct  184   GKSIGFPDGLLINGQVHS-TFTGDQDRSTFQLYKFFFYQQFCTLFSGKTYMFRISNVGLS  242

Query  1144  TSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFV  965
             TSINFRIQ HKLKLVEVEGSHT+Q+ YDSLD+HVGQS   LVTLN   KDYYIVAS+RF 
Sbjct  243   TSINFRIQGHKLKLVEVEGSHTIQNVYDSLDVHVGQSVAVLVTLNQVPKDYYIVASTRFT  302

Query  964   KPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHY  785
             +  +  +A+LHY  S +   G LP PP  +Y WSM+QA T RWNLTANAARPNPQGS+HY
Sbjct  303   QTVLNTTAVLHYTNSHSPALGPLPAPPVDKYDWSMKQAITYRWNLTANAARPNPQGSFHY  362

Query  784   GTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPP  605
             G I   R + L N+   I+G  RYA+N VSYVNP TPLKLAD+ NI G+F+ N+I+  P 
Sbjct  363   GNITPTRRINLANSAPLINGKLRYAVNSVSYVNPVTPLKLADYFNISGIFSDNSIQSNPS  422

Query  604   AGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNL  425
              GPA    SV    LHD++E++FQNNE T+QS+HLDG DFW +GYG G W    R  YNL
Sbjct  423   NGPAYIATSVLKTSLHDFIEVVFQNNENTMQSWHLDGYDFWVIGYGFGQWTDASRNTYNL  482

Query  424   VDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTEN  245
             VDA TR+T QVYPNSWT ILVSLDN+GMWNLRS++W R YLGQQ+YLRVWN + +   E 
Sbjct  483   VDALTRHTAQVYPNSWTTILVSLDNQGMWNLRSAIWERQYLGQQLYLRVWNAQRTAANEY  542

Query  244   DMPPDTLLCG  215
             D+P + LLCG
Sbjct  543   DIPSNALLCG  552



>ref|XP_006360232.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=539

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/548 (59%), Positives = 407/548 (74%), Gaps = 13/548 (2%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
               L  L G+L F+ +S+++AEDPY+++ W   YG  S LG  Q+ ILINGQFPGP ++++
Sbjct  5     ALLHLLCGILIFWAVSVIKAEDPYKYFTWTATYGMASLLGTPQQVILINGQFPGPRLDLV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+++N+INKLDEP+L TWNGIKQRK+SW DGVLGTNCPI PN N+ Y+ Q KDQIG+
Sbjct  65    TNDNIVLNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPNRNYIYKFQPKDQIGS  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             Y+YF STQLHRAAGG+G LN+  RSVIP+PY +P+  ++L++ DW+ T HK L++ LD+G
Sbjct  125   YTYFPSTQLHRAAGGFGVLNVYARSVIPVPYAKPAGDFSLLIGDWYKTSHKALRQILDSG  184

Query  1258  KPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
             K  P P GLLING+  S TFTG QG TYMFR+SNVG+ T+INFRIQ HK+KLVEVEGSH 
Sbjct  185   KSLPFPDGLLINGQKQS-TFTGDQGKTYMFRISNVGLKTTINFRIQGHKMKLVEVEGSHV  243

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q+ YDS D+HVGQS   LVTL+   KDYYIVAS+RF    +T++++LHY  S T V G 
Sbjct  244   IQNLYDSFDVHVGQSLSILVTLDQSPKDYYIVASTRFTTTVLTSTSVLHYTNSQTPVSGP  303

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             +P  P  Q+ WS+ QARTIRWNLT+NAARPNPQGS+HYG I   RT++L N+   I+G  
Sbjct  304   VPAGPVNQFQWSLMQARTIRWNLTSNAARPNPQGSFHYGKITPSRTILLANSAPLINGKQ  363

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N +SY++P TPLKLAD  NIPGVFTL++I+  P A       +V    LH+++EI+
Sbjct  364   RYAVNGISYIHPDTPLKLADHFNIPGVFTLDSIRSAPTADSPHLATAVLPSSLHEFLEIV  423

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             FQNNE T+QS+HLDG DFW VG+G G W    RK YNLVDA TR+T QVYP SWTAI VS
Sbjct  424   FQNNEDTMQSWHLDGYDFWVVGFGSGTWTQASRKGYNLVDALTRHTTQVYPKSWTAIFVS  483

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCGkakls*akla*S  179
             LDN+GMWNLRS++W R YLGQQ YLRV+N   SL  E D+P + LLCG            
Sbjct  484   LDNQGMWNLRSAMWDRQYLGQQAYLRVYNPTSSLANEYDIPTNALLCG------------  531

Query  178   NEDTLKHP  155
               D L+HP
Sbjct  532   KADALRHP  539



>ref|XP_010558427.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=539

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/530 (60%), Positives = 395/530 (75%), Gaps = 2/530 (0%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFF-CISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPein  1625
             S  L  LLGV+A F  +  V+ +DPY++Y W V YG ISPLGV Q+ I INGQFPGP ++
Sbjct  4     SVMLHLLLGVMAVFGSVVKVKGDDPYKYYTWTVTYGIISPLGVPQQVIFINGQFPGPRLD  63

Query  1624  vitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQI  1445
             V+TN+N+I+N+INKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQI
Sbjct  64    VVTNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQI  123

Query  1444  GTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLD  1265
             GTY+YF ST  H+AAGGYGA+N+  R  IP+PYP P++ +TL++ DW+ T+H  LQ++LD
Sbjct  124   GTYTYFPSTAFHKAAGGYGAINVYARPRIPIPYPLPASDFTLLIGDWFKTNHNTLQQRLD  183

Query  1264  TGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGS  1085
             +G P   P GLLING+  + TFTG QG TYMFR+SNVG++TS N RIQ H +K+VEVEGS
Sbjct  184   SGTPLLYPDGLLINGQTQA-TFTGDQGKTYMFRISNVGLSTSFNLRIQGHTMKVVEVEGS  242

Query  1084  HTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVP  905
             H +Q  YDSLDIHVGQS   LVTLN   KDYYI+AS+RF +  ++ + +L Y  S     
Sbjct  243   HVIQTDYDSLDIHVGQSLSILVTLNQSPKDYYIMASTRFTRRVLSVTGLLRYSNSRAPAS  302

Query  904   GKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISG  725
             G LPDPP G+  WSMRQART RWNLTANAARPNPQGS+HYG I   +  V  N+   I+G
Sbjct  303   GSLPDPPPGELVWSMRQARTFRWNLTANAARPNPQGSFHYGKITPTKMFVFSNSAPLING  362

Query  724   ITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
               RYA+N VSY+N  TPLKLAD+ NI GVF+ NAI+  P   PA    SV    LHD++E
Sbjct  363   KQRYAVNGVSYLNSDTPLKLADYFNIAGVFSTNAIQRVPSNSPATVATSVVQTNLHDFIE  422

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             ++FQNNE+T+QS+HLDG DFW VG+G G W    R  YNL DA TR+T QVYPNSWTAIL
Sbjct  423   VVFQNNERTVQSWHLDGYDFWVVGFGSGQWTPAKRSLYNLKDALTRHTTQVYPNSWTAIL  482

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             VSLDN+GMWN+RS++W R YLGQQ YL+VWN   SL  E + P + LLCG
Sbjct  483   VSLDNQGMWNMRSAIWERQYLGQQFYLKVWNPIQSLANEYNPPDNLLLCG  532



>ref|XP_010908384.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=536

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/508 (62%), Positives = 392/508 (77%), Gaps = 1/508 (0%)
 Frame = -2

Query  1738  EDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPILFT  1559
             +DPYR++ W V YG ISPLGV+Q+GILINGQ+PGP ++ +TN+N++V+VINK+DEPIL T
Sbjct  24    DDPYRYFTWTVSYGPISPLGVQQQGILINGQYPGPRVDCVTNDNMVVSVINKIDEPILIT  83

Query  1558  WNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGALN  1379
             WNGIKQRK+SW DGVLGTNCPI P +N+TY+ Q KDQIG+++YFLST + RAAGG+GALN
Sbjct  84    WNGIKQRKNSWQDGVLGTNCPIPPGSNYTYKFQTKDQIGSFTYFLSTGMQRAAGGFGALN  143

Query  1378  IIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNSVTF  1199
             + +R  IP+PY  P   ++L+V DW+   HK LQ+ LD+G+  P P GLLING     +F
Sbjct  144   VYQRPQIPVPYAPPDGDFSLLVGDWYKASHKALQQTLDSGRSLPFPDGLLINGAQQFASF  203

Query  1198  TGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGFLV  1019
             TG QG TY+FR+SNVG+ TSINFRIQ H++KLVEVEGSHT+Q+ YDSLDIHVGQS   LV
Sbjct  204   TGDQGKTYLFRISNVGLMTSINFRIQGHQMKLVEVEGSHTLQNIYDSLDIHVGQSLAVLV  263

Query  1018  TLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQARTIR  839
             TL+   KDY+IVAS+RF +  +TA+ ILHY  S +   G LP PP    H SMRQARTIR
Sbjct  264   TLDQPPKDYFIVASTRFTRKVLTATGILHYSNSNSPASGPLP-PPLRNPHISMRQARTIR  322

Query  838   WNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKLAD  659
             WNLTA+AARPNPQGSYHYGTIP  R+LVL+N+   I+G  RYA+N VS+V P TPLKLAD
Sbjct  323   WNLTASAARPNPQGSYHYGTIPRTRSLVLKNSAPLINGKQRYAVNGVSFVVPDTPLKLAD  382

Query  658   WLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQDFWA  479
               NI G+FT ++I    P G AV G  V    LHD++EI+FQN E T+Q++HLDG DFW 
Sbjct  383   NFNIAGIFTWDSIPIPAPEGSAVLGTPVMRFNLHDFIEIVFQNTEHTMQTWHLDGYDFWV  442

Query  478   VGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRNYLG  299
             VGYG G W    R++YNL+DA TR+TVQVYPN W+AILVSLDN+GMWNLRS++W R YLG
Sbjct  443   VGYGAGNWTEKFRRRYNLIDAVTRHTVQVYPNGWSAILVSLDNQGMWNLRSAMWGRQYLG  502

Query  298   QQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             QQ Y+RVW +E S   E D+P + L CG
Sbjct  503   QQFYIRVWTSEKSYANEYDIPSNALRCG  530



>emb|CAN72539.1| hypothetical protein VITISV_028750 [Vitis vinifera]
Length=503

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/516 (62%), Positives = 383/516 (74%), Gaps = 17/516 (3%)
 Frame = -2

Query  1804  PSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPein  1625
             P+ FL F  G LA   +  V AEDP R+Y W V YGTISPLG  Q+GILINGQFPGP I+
Sbjct  3     PAIFLHFFFGTLACLSLLCVIAEDPSRYYTWTVTYGTISPLGSPQQGILINGQFPGPTID  62

Query  1624  vitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQI  1445
              +TN+N+IV VINKLD+P L TWNGIKQRK+ W DG LGTNCPI PN+NWTY+ Q KDQI
Sbjct  63    CVTNDNIIVTVINKLDKPFLITWNGIKQRKTPWQDGTLGTNCPIPPNSNWTYKFQTKDQI  122

Query  1444  GTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLD  1265
             GTYSYF ST +HRAAGG+G  NI  RSVIP+PYP P   +TL+V DW+N+ HK LQ +LD
Sbjct  123   GTYSYFPSTLMHRAAGGFGGFNIASRSVIPIPYPIPVEEFTLLVGDWYNSSHKALQAKLD  182

Query  1264  TGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGS  1085
             +G P P P  LLING  +  TFTG++G TY FRVSNVG++TSINFRIQ H + LVEVEG+
Sbjct  183   SGIPLPLPNALLINGLPSGSTFTGEKGKTYKFRVSNVGISTSINFRIQAHTMTLVEVEGA  242

Query  1084  HTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVP  905
             HT+Q  YDSLD+HVGQS   LVTL+A VKDY+IVAS+RF KP +TA++ L Y GS T   
Sbjct  243   HTVQXVYDSLDVHVGQSVAVLVTLHATVKDYFIVASTRFTKPVLTATSFLKYAGSSTPAS  302

Query  904   GKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISG  725
               LP  P  Q HWSM QARTIR NLTANAARPNPQGS+HYGTIPI RTL+L N+   I+G
Sbjct  303   EPLPIGPTYQIHWSMMQARTIRRNLTANAARPNPQGSFHYGTIPIQRTLILANSATKING  362

Query  724   ITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
               RYA+N +SYVNP TPLKLAD+ NI                 +V G SV G  LHD +E
Sbjct  363   TLRYAVNGISYVNPATPLKLADYYNI-----------------SVFGTSVIGTTLHDLIE  405

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             I+FQNNE TLQS+HLDG  FW VG+G G W   +R++YNL DA +R+TVQVYPNSW+A+L
Sbjct  406   IVFQNNETTLQSWHLDGYTFWTVGFGSGQWTPDMRRRYNLADANSRHTVQVYPNSWSAVL  465

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSL  257
              SLDNKGMWNLRS++W R YLGQQ+Y++     + L
Sbjct  466   ASLDNKGMWNLRSAIWSRQYLGQQLYIKSMEQRNEL  501



>ref|XP_011085509.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
 ref|XP_011085510.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
 ref|XP_011085511.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/518 (61%), Positives = 396/518 (76%), Gaps = 1/518 (0%)
 Frame = -2

Query  1768  AFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnvi  1589
             AF+ + +V+AED Y++Y W V YGT SPLG  Q+ ILINGQFPGP ++ +TN+N+I+N+I
Sbjct  14    AFWSVWVVKAEDAYKYYTWTVTYGTASPLGPSQQVILINGQFPGPRLDTVTNDNIILNLI  73

Query  1588  NKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLH  1409
             NKLD+P L TWNGIKQRK+SW DG+LGTNC I PN+N+TY+ Q KDQIG+Y+YF ST +H
Sbjct  74    NKLDQPFLLTWNGIKQRKNSWQDGMLGTNCAIPPNSNYTYKFQTKDQIGSYTYFPSTLMH  133

Query  1408  RAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLL  1229
             RAAGG+G LNI  RSVIP+PY +P+  ++L++ DW+ ++HK LQ+ LD+GKP P P G+L
Sbjct  134   RAAGGFGVLNIYARSVIPVPYAKPAGDFSLLIGDWYKSNHKALQQVLDSGKPLPFPDGIL  193

Query  1228  INGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDI  1049
             ING+  S +F+G QG TYMFRVSN+G++TS NFRIQ HKLKLVEVEGSH +Q+ YDSLD+
Sbjct  194   INGQSRS-SFSGDQGKTYMFRVSNLGLSTSFNFRIQGHKLKLVEVEGSHVLQNMYDSLDV  252

Query  1048  HVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYH  869
             HVGQS   LVTL+   KDYYIVAS+RF K  +TA A+LHY  S   + G +P  P     
Sbjct  253   HVGQSVTVLVTLDQSPKDYYIVASTRFTKTVLTAIAVLHYTNSRAAISGPVPSGPTDDIA  312

Query  868   WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYV  689
             WSM QAR+ RWNLT+NAARPNPQGS+HYG I   RT+VL N+   I+G  RYA+N  S++
Sbjct  313   WSMDQARSYRWNLTSNAARPNPQGSFHYGKITTSRTIVLANSAPIINGKQRYAINGNSFI  372

Query  688   NPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQS  509
             N  TPLKLAD+ NIPGVF++N+I+  P         SV G  LH+++E++FQNNE T+QS
Sbjct  373   NSDTPLKLADYFNIPGVFSINSIQTAPSDSSNKLATSVMGASLHEFIEVVFQNNEDTIQS  432

Query  508   YHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLR  329
             +HLDG DFW VG+G G W    RK YNLVDA TR+T QVYP SWTAILVSLDN+GMWNLR
Sbjct  433   WHLDGYDFWVVGFGTGQWTQASRKAYNLVDALTRHTTQVYPKSWTAILVSLDNQGMWNLR  492

Query  328   SSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             S++W R YLGQQ YLRV+N   SL  E D+P + LLCG
Sbjct  493   SAMWGRQYLGQQFYLRVYNPTPSLANEYDIPNNALLCG  530



>emb|CAN72538.1| hypothetical protein VITISV_028749 [Vitis vinifera]
Length=592

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/537 (59%), Positives = 400/537 (74%), Gaps = 18/537 (3%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +     + +V  EDPY++Y W V YGTISPLGV Q+ ILINGQFPGP + V+TN+N+I++
Sbjct  50    ICVLLGVFLVNGEDPYKYYTWTVTYGTISPLGVPQQVILINGQFPGPALEVVTNDNIILD  109

Query  1594  viNKLDEPILFTW-----------------NGIKQRKSSWTDGVLGTNCPILPNTNWTYR  1466
             +INKLD+P L T                  NGIKQRK+SW DGVLGTNCPI PN+N+TY+
Sbjct  110   LINKLDQPFLLTCILEKCHGLTRACLFTTRNGIKQRKNSWQDGVLGTNCPIPPNSNYTYK  169

Query  1465  MQMKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHK  1286
              Q KDQIGT++YF ST  H+AAGG+GA+N+  R  IP+P+P+P+  +TL+V DW+ T HK
Sbjct  170   FQTKDQIGTFTYFPSTLFHKAAGGFGAINVYERPRIPIPFPDPAGDFTLLVGDWYKTSHK  229

Query  1285  QLQKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLK  1106
              LQ+ LD+GKP P P G+LING+ +S +F+G QG TYMFR+SNVG++TSINFRIQ H +K
Sbjct  230   TLQQTLDSGKPLPFPDGVLINGQTSS-SFSGDQGKTYMFRISNVGLSTSINFRIQGHTMK  288

Query  1105  LVEVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYD  926
             LVEVEGSHT+Q+ YDSLD+HVGQS   LVTL+   KDYYIVAS+RF K  +TA+A+LHY 
Sbjct  289   LVEVEGSHTLQNTYDSLDVHVGQSIAVLVTLDQLPKDYYIVASTRFTKQILTATAVLHYT  348

Query  925   GSVTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLEN  746
              S T V G +P  P  Q HWSM+QART RWNLTA+AARPNPQGS+HYG I   RT++L N
Sbjct  349   NSHTPVSGPVPAGPTYQIHWSMKQARTYRWNLTASAARPNPQGSFHYGKITPSRTIMLXN  408

Query  745   TKENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGL  566
             +   ++G  RYA+N VSY+N  TPLKLAD+ NIPGVF++N+I+D P  G +    SV   
Sbjct  409   SAPRLNGKQRYAVNGVSYINXDTPLKLADYFNIPGVFSVNSIQDLPSGGSSFLSTSVMAA  468

Query  565   ELHDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYP  386
               HD++E++FQNNE T+QS+HLDG DFW VGYG G W    RK YNL+DA TR+T QVYP
Sbjct  469   NHHDFIEVVFQNNENTIQSWHLDGYDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQVYP  528

Query  385   NSWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              SWT I VSLDN+GMWN+RS+VW R YLGQQ YLRV+N  HS   E D+P + LLCG
Sbjct  529   RSWTTIWVSLDNQGMWNMRSAVWERQYLGQQFYLRVFNPVHSPANEYDIPKNALLCG  585



>ref|XP_010680452.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680453.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680454.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680455.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=542

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/520 (63%), Positives = 395/520 (76%), Gaps = 5/520 (1%)
 Frame = -2

Query  1759  CISMVEAEDPYRFYNWVVQYGTISPLGV-KQRGILINGQFPGPeinvitnenvivnviNK  1583
              IS ++AE PYR+Y W + Y  I P     QRGILINGQFPGP I+  TN+N+IV +IN 
Sbjct  18    SISGIQAESPYRYYTWRLSYAWIYPGNFGPQRGILINGQFPGPTIDCNTNDNIIVTIINL  77

Query  1582  LDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRA  1403
             L EP L TWNG+ QRK+SW DGVLGTNCPI    N+TY+MQ+KDQIGTY YF ST + RA
Sbjct  78    LGEPFLMTWNGVWQRKNSWQDGVLGTNCPIPSRGNYTYKMQVKDQIGTYMYFPSTLMQRA  137

Query  1402  AGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLIN  1223
             +GG+G +N+ RRSVIPLPY EP+  ++ ++ DW+ TDHK LQK+LD G   P P GLLIN
Sbjct  138   SGGFGIINVRRRSVIPLPYAEPAGEFSFLIGDWYKTDHKVLQKRLDYGYGMPMPDGLLIN  197

Query  1222  GRLNSVT---FTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLD  1052
             G     T   +TG+ G TY+FRV N G+ TSIN RIQ+H +KLVEVEGSH +Q+ YDSLD
Sbjct  198   GLQTDSTDRVYTGEVGKTYLFRVVNGGIMTSINIRIQSHTMKLVEVEGSHVLQEIYDSLD  257

Query  1051  IHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQY  872
             IH GQS  FLVTLN ++KDYYIVAS+RF +P  T++AILHYDGS  +  G +PDPPA + 
Sbjct  258   IHPGQSLSFLVTLNGEIKDYYIVASTRFTRPIHTSTAILHYDGSNIRPSGPVPDPPAYEL  317

Query  871   HWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSY  692
             H SM+QARTIR NLTANAARPNPQGS+ YG I I +T++L N+ E I+G   Y +N +SY
Sbjct  318   HGSMKQARTIRRNLTANAARPNPQGSFRYGEINITKTIILGNSAEKINGKLHYGVNNISY  377

Query  691   VNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQ  512
             VNPTTPLKLAD+ NI GVF LN  +D P  GP V G +VFGL LHD+VEIIF NNEKT Q
Sbjct  378   VNPTTPLKLADYYNISGVFNLNTSRDKPTPGPMVQGTAVFGLALHDFVEIIFHNNEKTTQ  437

Query  511   SYHLDGQDFWAVGYGG-GVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             S+HLDG +F+ VGYGG   W   +RK YN++DA +R TVQVY NSWTA+LVSLDNKGMWN
Sbjct  438   SWHLDGYNFFVVGYGGTSEWSPKMRKSYNMMDAVSRSTVQVYRNSWTAVLVSLDNKGMWN  497

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LRS++W R YLGQQVYLRVWN+E SL TEN++PP+   CG
Sbjct  498   LRSAIWHRQYLGQQVYLRVWNDEPSLTTENEIPPNVRKCG  537



>ref|XP_004148037.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004161722.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/526 (62%), Positives = 397/526 (75%), Gaps = 5/526 (1%)
 Frame = -2

Query  1780  LGVLAFF-CISM--VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             LG++    C S+  V AEDPYR++ + V YGT +PLG  Q+ IL+NGQFP P+I  +TN+
Sbjct  12    LGIIVLLVCCSLGWVNAEDPYRYFTFQVTYGTRAPLGFNQKVILVNGQFPAPKIECVTND  71

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+IVNVINKLDEP LFTW+G+KQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQIGT++Y
Sbjct  72    NIIVNVINKLDEPFLFTWSGVKQRRTSWQDGVLGTNCPIPPNSNWTYKFQVKDQIGTFTY  131

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F S    RA+GG+GA  I  RSVI  PYP P+A   L++SDW+NTDHK L+K+LD+G   
Sbjct  132   FPSINFQRASGGFGAFVIQPRSVITTPYPIPAAEVDLLISDWYNTDHKTLRKKLDSGILL  191

Query  1249  PSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
             P P  LLING+  S+T T K+G TY  R+SNVG+ TSINFRIQ H + LVEVEG+HT+Q+
Sbjct  192   PLPNRLLINGQ-PSLTLTLKKGLTYKLRISNVGIATSINFRIQGHLMTLVEVEGAHTVQE  250

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKP-YMTASAILHYDGSVTKVPGKLP  893
              Y+SLDIH GQSA  LV+LN   KDYY V SSRF KP  +T   IL Y+GS       LP
Sbjct  251   VYESLDIHPGQSAAVLVSLNNLPKDYYFVVSSRFTKPTILTTVGILRYEGSSIPPSKPLP  310

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P  Q HWSM+QARTIR NLTANAARPNPQGS+HYG I +VR L+LEN+   I G  R 
Sbjct  311   IGPTYQLHWSMKQARTIRLNLTANAARPNPQGSFHYGNITVVRRLILENSLRKIKGALRC  370

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
             A+N VSYV+P TPLKLADW  I GVF      D P + PA+ GVSV  + LHD+VEI+FQ
Sbjct  371   AVNSVSYVDPPTPLKLADWFKIDGVFDFKTFTDVPTSRPAMLGVSVVNITLHDFVEIVFQ  430

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             NNE T+Q++H DG  F+ VGYG GVW   +RK+YNLVD  +R+TVQVYP SWTAILVSLD
Sbjct  431   NNENTVQAWHFDGTSFYVVGYGSGVWSYKMRKRYNLVDGISRHTVQVYPRSWTAILVSLD  490

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             NKGMWNLRS++W RNYLGQQ+Y+RVWN+E SLYTE D+PP+ L CG
Sbjct  491   NKGMWNLRSTIWWRNYLGQQLYVRVWNDEKSLYTETDIPPNALKCG  536



>emb|CDX81353.1| BnaC09g07640D [Brassica napus]
Length=541

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/512 (61%), Positives = 388/512 (76%), Gaps = 1/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG I PLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  24    IVKGESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  83

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+
Sbjct  84    FLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGF  143

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P   +TL++SDW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  144   GAINVYARPRIPIPYPLPVEDFTLLISDWFKTNHKTLQQRLDSGGVLPFPDGVLINGQTQ  203

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             + TFTG QG TYMFR+SNVG +++ NFRIQ H +K+VEVEGSH MQ  YDSLD+HVGQS 
Sbjct  204   T-TFTGDQGKTYMFRISNVGSSSTFNFRIQGHTMKVVEVEGSHVMQTDYDSLDVHVGQSL  262

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYYIVAS+RFV+  ++ +A+L Y  S     G +P  P G+  WSMRQA
Sbjct  263   SLLVTLNQSPKDYYIVASTRFVRSNLSVTALLRYSNSGVPASGDMPPLPPGELVWSMRQA  322

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  323   RTFRWNLTANAARPNPQGSFHYGKINTTKSFVFSNSAPLINGKQRYAVNGVSYVNSDTPL  382

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD  NIPGVF+ +AI+  P   PA    SV    LHD++EI+FQNNEK +QS+HLDG 
Sbjct  383   KLADHFNIPGVFSTSAIQSVPSNSPATVATSVVKASLHDFLEIVFQNNEKAVQSWHLDGY  442

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R+ YNLVDA TR+T QVYPNSWTAILVSLDN+GMWN+RS++W R
Sbjct  443   DFWVVGFGSGQWTPAKRQLYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWER  502

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              YLGQQ YL+VW+   SL  E + P + LLCG
Sbjct  503   QYLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  534



>ref|XP_010070498.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW59310.1| hypothetical protein EUGRSUZ_H01991 [Eucalyptus grandis]
Length=538

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/525 (61%), Positives = 399/525 (76%), Gaps = 1/525 (0%)
 Frame = -2

Query  1789  RFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             R +  VLA    S+  A+DPYRFY W V YGTISPLGV Q+ ILINGQFPGP ++V+TN+
Sbjct  8     RQICAVLALLGASLAMADDPYRFYTWTVTYGTISPLGVPQQVILINGQFPGPRLDVVTND  67

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+++N+INKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY  Q KDQIG+Y+Y
Sbjct  68    NLVLNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYIFQPKDQIGSYTY  127

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F ST LH+AAGGYGALN+ +R+ IP+PYP P   +TL++ DW+ T HK L++ LD+GK  
Sbjct  128   FPSTALHKAAGGYGALNVYQRAPIPIPYPPPDGDFTLLIGDWFKTSHKTLRQTLDSGKSL  187

Query  1249  PSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
             P P G++ING+  + TF G QG TY FR+SNVG++TS+NFRIQ+H LKL+EVEGSHT+Q+
Sbjct  188   PFPDGVIINGQPQA-TFAGDQGKTYKFRISNVGLSTSLNFRIQSHTLKLIEVEGSHTVQN  246

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              YDSLD+HVGQS   LVTLN   KDYY+VAS+RF K  +TA+AILHY  S + V G LP 
Sbjct  247   IYDSLDVHVGQSVTVLVTLNQPPKDYYVVASTRFTKTVLTATAILHYSNSHSSVSGPLPA  306

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  +  WSM+QART RWNLTANAARPNPQGS+HYG I   RT+VL N+   I+G  RYA
Sbjct  307   GPTIEVDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPSRTIVLANSAPLINGKQRYA  366

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N  S++N  TPLKLAD+ NIPGVF  ++++ +P  G      SV    LHD++EI+FQN
Sbjct  367   VNGASFINADTPLKLADYFNIPGVFRTDSLQTSPSGGSPSIATSVIPASLHDFIEIVFQN  426

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
             NE T+QS+HLDG DFW VGYG G W    R  YNLVD  TR+T QVYPNSWT+I +SLDN
Sbjct  427   NENTVQSWHLDGYDFWVVGYGNGQWTPASRSSYNLVDTLTRHTAQVYPNSWTSIYMSLDN  486

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +GMWN+RS++W R YLGQQ YLRVWN   SL  E ++P + LLCG
Sbjct  487   QGMWNVRSAIWERQYLGQQFYLRVWNPVQSLANEYNIPSNALLCG  531



>emb|CDY18626.1| BnaA09g07690D [Brassica napus]
Length=541

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/512 (61%), Positives = 388/512 (76%), Gaps = 1/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG I PLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  24    IVKGESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  83

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+
Sbjct  84    FLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGF  143

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P   +TL++ DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  144   GAINVYARPRIPIPYPLPVEDFTLLIGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  203

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             + TFTG QG TYMFR+SNVG++++ NFRIQ H +K+VEVEGSH MQ  YDSLD+HVGQS 
Sbjct  204   T-TFTGDQGKTYMFRISNVGLSSTFNFRIQGHTMKVVEVEGSHVMQTDYDSLDVHVGQSL  262

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYYIVAS+RFV+  ++ +A+L Y  S     G++P  P G+  WSMRQA
Sbjct  263   SLLVTLNQSPKDYYIVASTRFVRSNLSVTALLRYSNSGVPASGEMPPLPPGELVWSMRQA  322

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  323   RTFRWNLTANAARPNPQGSFHYGKINTTKSFVFSNSAPLINGKQRYAVNGVSYVNSDTPL  382

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD  NIPGVF+ +AI+  P   PA    SV    LHD++EI+FQNNEK +QS+HLDG 
Sbjct  383   KLADHFNIPGVFSTSAIQSVPSNSPATVATSVVRASLHDFLEIVFQNNEKAVQSWHLDGY  442

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  YNLVDA TR+T QVYPNSWTAILVSLDN+GMWN+RS+VW R
Sbjct  443   DFWVVGFGSGQWTPAKRPLYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAVWER  502

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              YLGQQ YL+VW+   SL  E + P + LLCG
Sbjct  503   QYLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  534



>ref|XP_009112343.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/512 (61%), Positives = 387/512 (76%), Gaps = 1/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG I PLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  24    IVKGESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  83

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+
Sbjct  84    FLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGF  143

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P   +TL++ DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  144   GAINVYARPRIPIPYPLPVEDFTLLIGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  203

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             + TFTG QG TYMFR+SNVG++++ NFRIQ H +K+VEVEGSH MQ  YDSLD+HVGQS 
Sbjct  204   T-TFTGDQGKTYMFRISNVGLSSTFNFRIQGHTMKVVEVEGSHVMQTDYDSLDVHVGQSL  262

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYYIVAS+RFV+  ++ +A+L Y  S     G +P  P G+  WSMRQA
Sbjct  263   SLLVTLNQSPKDYYIVASTRFVRSNLSVTALLRYSNSGVPASGDMPPLPPGELVWSMRQA  322

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  323   RTFRWNLTANAARPNPQGSFHYGKINTTKSFVFSNSAPLINGKQRYAVNGVSYVNSDTPL  382

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD  NIPGVF+ +AI+  P   PA    SV    LHD++EI+FQNNEK +QS+HLDG 
Sbjct  383   KLADHFNIPGVFSTSAIQSVPSNSPATVATSVVKASLHDFLEIVFQNNEKAVQSWHLDGY  442

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  YNLVDA TR+T QVYPNSWTAILVSLDN+GMWN+RS+VW R
Sbjct  443   DFWVVGFGSGQWTPAKRPLYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAVWER  502

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              YLGQQ YL+VW+   SL  E + P + LLCG
Sbjct  503   QYLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  534



>ref|XP_009381277.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/533 (59%), Positives = 393/533 (74%), Gaps = 3/533 (1%)
 Frame = -2

Query  1804  PSGFLRFLLGVLAFFCISM--VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPe  1631
             PS  +  L G L F   +   V A+DPYR++ W V YG ISPLG  Q+GILI+GQFPGP 
Sbjct  9     PSSTMTLLCGALVFLVAAALGVRADDPYRYFTWTVTYGPISPLGAPQQGILIDGQFPGPR  68

Query  1630  invitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKD  1451
             ++ +TN+N+I+NVIN++DEP+L TWNGIKQRK+SW DGVLGTNCPI P  N+TY+ Q KD
Sbjct  69    LDCVTNDNIIINVINQIDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPKGNFTYKFQTKD  128

Query  1450  QIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQ  1271
             QIGT++YF ST L RAAGG+GALN+  R  IP+PY  P+  ++L+V DW+ T HK LQK 
Sbjct  129   QIGTFTYFPSTGLQRAAGGFGALNVYSRPRIPVPYAPPAGDFSLLVGDWYKTSHKALQKT  188

Query  1270  LDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVE  1091
             LD+G P P P GLLING   + +F G QG TY+FRVSNVG+ TSINFRIQ+HK+KLVEVE
Sbjct  189   LDSGGPLPFPDGLLINGAEKTSSFAGDQGKTYLFRVSNVGLMTSINFRIQSHKMKLVEVE  248

Query  1090  GSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTK  911
             GSHT+Q+ YDSLD+HVGQS   LVTL+   +DYYIVAS+RF +  + A+ +LHY    + 
Sbjct  249   GSHTLQNDYDSLDVHVGQSLSVLVTLDQVPRDYYIVASTRFTRKVLVATGVLHYSNCNSG  308

Query  910   VPGKLPDPPA-GQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKEN  734
             + G +P+ P    +HWSM QART RWNLTA+AARPNPQGSYHYG I   R++ L N+   
Sbjct  309   LAGPVPEGPGTAGFHWSMLQARTFRWNLTASAARPNPQGSYHYGNITRTRSIDLANSAAV  368

Query  733   ISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHD  554
             ISG  RYA+N VS+V P TPLKLAD  NI GVFT + I   P A PAV G  V    LHD
Sbjct  369   ISGKQRYAVNGVSFVVPDTPLKLADNFNITGVFTWDTIPIPPSAAPAVPGTPVLRFNLHD  428

Query  553   YVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWT  374
             ++E+IF N E T Q++HLDG DFW VGYG G W   LRK+YNL+DA TR+TVQVYP+ W+
Sbjct  429   FIEVIFHNAENTTQTWHLDGHDFWVVGYGSGKWTPELRKRYNLIDAITRHTVQVYPSGWS  488

Query  373   AILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             AILVSLDN+G WNLRS++W R Y GQQ+Y+RVW +E S   E D+P + L CG
Sbjct  489   AILVSLDNQGTWNLRSAMWARQYTGQQLYIRVWTSEKSYSNEYDIPHNALFCG  541



>ref|XP_011099220.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
 ref|XP_011099222.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=539

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/530 (60%), Positives = 396/530 (75%), Gaps = 3/530 (1%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVK-QRGILINGQFPGPein  1625
             +G L FL  +LAF+ +S+  AED Y++Y W V YGT   LG + Q+ ILINGQFPGP + 
Sbjct  4     AGLLSFL-AILAFWSVSVARAEDAYKYYTWTVTYGTKWVLGPEDQQIILINGQFPGPTLE  62

Query  1624  vitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQI  1445
              +TN+N+I+NV+NKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQI
Sbjct  63    AVTNDNIILNVVNKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQI  122

Query  1444  GTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLD  1265
             G+Y+YF ST++HRAAGG+GALNI  RSVIP+PY +P+  +TL++ DW++  H++LQK LD
Sbjct  123   GSYTYFPSTRMHRAAGGFGALNIYARSVIPVPYAKPAGDFTLLIGDWYHGGHQRLQKILD  182

Query  1264  TGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGS  1085
             +GKP P P G LI+   +  TFTG QG TYMFR+SN+G++TS NFRIQ HKLKLVEVEGS
Sbjct  183   SGKPLPFPDGFLIHSH-DGPTFTGDQGKTYMFRISNIGLSTSFNFRIQGHKLKLVEVEGS  241

Query  1084  HTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVP  905
             H +Q+ YDSLD+HVGQS   LVTL+  V+DYY+VAS+RF      A+A++HY  S   V 
Sbjct  242   HVLQNMYDSLDVHVGQSVTVLVTLDQSVRDYYVVASTRFTDTVYGATAVVHYSNSEIPVS  301

Query  904   GKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISG  725
                PD P  +  WS+ QAR+ RWNLT+NAARPNPQGS+HYG I   RT+VL N+   I  
Sbjct  302   APAPDGPTTEVEWSIDQARSFRWNLTSNAARPNPQGSFHYGKIKPSRTIVLANSAPIIKR  361

Query  724   ITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
               RYA+N VS++N  TPLKLAD+ NI GVF LN+I   P    A    +V G  LH+++E
Sbjct  362   KQRYAVNGVSHINSHTPLKLADYFNISGVFLLNSIPSAPSGSGAKLTKAVMGASLHEFIE  421

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             ++FQNNE TLQS+HLDG DFW VG+G G W    RK YNLVDA TR+T QVYP SWTAIL
Sbjct  422   VVFQNNEDTLQSWHLDGYDFWVVGFGSGQWTQASRKTYNLVDALTRHTTQVYPKSWTAIL  481

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             VSLDN+GMWN+RS++W R YLGQQ YLRV+N   SL  E ++P + LLCG
Sbjct  482   VSLDNQGMWNMRSAIWGRQYLGQQFYLRVYNPTQSLANEYNIPSNALLCG  531



>ref|XP_008792598.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=538

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/535 (61%), Positives = 400/535 (75%), Gaps = 4/535 (1%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFCISMVE-AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             MR P S  L  +LG +AF  ++ V  AEDPYR++ W V +G ISPLGV+Q+GILINGQFP
Sbjct  1     MRTPSSPPL--VLGAMAFLALAFVATAEDPYRYFTWTVTHGPISPLGVQQQGILINGQFP  58

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GP I+ +TN+N+IV+VINK+DEPIL TWNGIKQRK+SW DGVLGTNCPI P +N+TY+ Q
Sbjct  59    GPRIDCVTNDNMIVDVINKIDEPILITWNGIKQRKNSWQDGVLGTNCPIPPGSNYTYKFQ  118

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
              KDQIG+++YFLST + RAAGG+GALN+ +R  IP+PY +P   ++L+V DW+   HK L
Sbjct  119   TKDQIGSFTYFLSTGMQRAAGGFGALNVYQRPQIPVPYAKPDGDFSLLVGDWYKAGHKAL  178

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             Q+ LD+G+  P P GLLING     +F+G QG TY+FRVSNVG+ TSINFRIQ H++KLV
Sbjct  179   QQTLDSGRSLPFPDGLLINGAQQFTSFSGDQGKTYLFRVSNVGLMTSINFRIQGHQMKLV  238

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEGSHT+Q+ YDSLDIHVGQS   LVTL+   KDYYIV S+RF +  +TA+ +LHY  S
Sbjct  239   EVEGSHTLQNIYDSLDIHVGQSLAVLVTLDQPPKDYYIVTSTRFTRRVLTATGVLHYSNS  298

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
                 P     PP    H SMRQARTIRWNLTA+AARPNPQGSYHYGTI   R+LVL+N+ 
Sbjct  299   -NSPPSGPLPPPLRNPHISMRQARTIRWNLTASAARPNPQGSYHYGTITRTRSLVLKNSA  357

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               I+G  RYA+N VS+V P TPLKLAD  NIPG+FT ++I    P G AV G  V    L
Sbjct  358   PLINGKQRYAVNGVSFVVPDTPLKLADNFNIPGIFTWDSIPIPAPEGSAVLGTPVMRFNL  417

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
             HD++EI+FQN E ++QS+HLDG DFW VGYG G W    R++YNL+DA TR+TVQVYP  
Sbjct  418   HDFIEIVFQNTEDSMQSWHLDGYDFWVVGYGAGNWTEKFRRRYNLIDAVTRHTVQVYPKG  477

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             W+AI VSLDN+GMWNLRS++W R YLGQQ Y RVW  E S   E D+P + L CG
Sbjct  478   WSAIFVSLDNQGMWNLRSAMWGRQYLGQQFYNRVWTLEKSFSNEYDIPSNALRCG  532



>ref|XP_008457817.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=539

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/525 (62%), Positives = 392/525 (75%), Gaps = 4/525 (1%)
 Frame = -2

Query  1780  LGVLAFF-CISM--VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             LG++  + C S+  V  EDPYR+Y + V YGT +PLGV Q+ IL+NGQFP P+I   TN+
Sbjct  11    LGIMIIWVCCSLGWVNGEDPYRYYTFQVTYGTRAPLGVAQKVILVNGQFPAPKIECATND  70

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+IVNVINKLDEP LFTW+G+KQR++SW DGVLGTNCPI PN+NWTY+ Q+KDQIGT++Y
Sbjct  71    NIIVNVINKLDEPFLFTWSGVKQRRTSWQDGVLGTNCPIPPNSNWTYKFQVKDQIGTFTY  130

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F S    RA+GG+GA  I  RSVI  PYP P A   L++ DW++TDHK L+KQLD+G   
Sbjct  131   FPSINFQRASGGFGAFVIQPRSVITTPYPLPHAEIDLLIGDWYDTDHKTLRKQLDSGVLL  190

Query  1249  PSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
             P PK LLING+ +S T   K+G TY  R+SNVG+ TSINFRIQ H + LVEVEG+HT+QD
Sbjct  191   PLPKRLLINGQPSS-TLILKKGLTYKLRISNVGIATSINFRIQGHLMTLVEVEGAHTVQD  249

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              Y+SLDIH GQSA  LV+LN   KDYY V SSRF KP +T   IL Y+GS       LP 
Sbjct  250   VYESLDIHPGQSAAVLVSLNRLPKDYYFVVSSRFTKPILTTVGILRYEGSSIPPSKPLPI  309

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  Q HWSM+QARTIR NLTANAARPNPQGS+HYG I +VR L+L+N+   I G  R A
Sbjct  310   GPTYQLHWSMKQARTIRLNLTANAARPNPQGSFHYGNITVVRRLILKNSLTKIKGAVRCA  369

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VSYV+P TPLKLADW  I GVF      D P   PA+ GVSV  + LHD+VEI+FQN
Sbjct  370   VNNVSYVDPPTPLKLADWFKIGGVFDFKTFTDIPTPRPAMLGVSVVNITLHDFVEIVFQN  429

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
             +E T+Q++H DG  F+ VGYG G W   +RK+YNLVD  +R+TVQVYP SWTAILVSLDN
Sbjct  430   DENTVQAWHFDGTSFYVVGYGSGDWSYKMRKRYNLVDGISRHTVQVYPRSWTAILVSLDN  489

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             KGMWNLRS++W RNYLGQQ+Y+RVWN+E SLYTE D+P + L CG
Sbjct  490   KGMWNLRSTIWWRNYLGQQLYVRVWNDEKSLYTEADIPLNALKCG  534



>ref|XP_010547509.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/515 (60%), Positives = 381/515 (74%), Gaps = 1/515 (0%)
 Frame = -2

Query  1759  CISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKL  1580
              +  V  +DPY++Y W   YG ISPLGV Q+ ILINGQFPGP ++++TN+N+++N+INKL
Sbjct  21    SVVTVRGDDPYKYYTWTATYGIISPLGVPQQVILINGQFPGPRLDLLTNDNIVLNLINKL  80

Query  1579  DEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAA  1400
             D+P L TWNGIKQRK+SW DGVLGTNCP+ PN+N+TY+ Q KDQIGTYSYF ST +H+AA
Sbjct  81    DQPFLLTWNGIKQRKNSWQDGVLGTNCPVPPNSNFTYKFQTKDQIGTYSYFPSTAMHKAA  140

Query  1399  GGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLING  1220
             GGYGA+NI  R  IP+PY  P+A +TL++ DW+ ++HK LQ++LD+G P P P G+LING
Sbjct  141   GGYGAINIYARPRIPIPYTLPTADFTLLIGDWFKSNHKTLQQRLDSGSPLPFPDGILING  200

Query  1219  RLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVG  1040
             +  + TFTG QG+TYM R+SNVG++TS NFRIQ H +KLVEVEGSH +Q  YDSLDIHVG
Sbjct  201   QTQT-TFTGDQGNTYMLRISNVGLSTSFNFRIQGHTMKLVEVEGSHVIQTDYDSLDIHVG  259

Query  1039  QSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSM  860
             QS   LVTLN   KDYYIVAS+RF +   + + +L Y  S     G LP  P G   WSM
Sbjct  260   QSLSVLVTLNQSPKDYYIVASTRFTRSVFSVTGLLRYSNSRVPASGSLPASPPGGLVWSM  319

Query  859   RQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPT  680
             RQART RWNLTANAARPNPQGS+HYG I   +  V  N+   I+G  RYA+N VSYVN  
Sbjct  320   RQARTFRWNLTANAARPNPQGSFHYGKITPTKMFVFSNSAPLINGKQRYAVNGVSYVNSD  379

Query  679   TPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHL  500
             TP KLAD+  I GVF+ N+I+  P   PA    SV    LHD++E++FQNNE  +QS+HL
Sbjct  380   TPPKLADYFGIAGVFSTNSIQSVPSNSPATVATSVVQTSLHDFIEVVFQNNENAMQSWHL  439

Query  499   DGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSV  320
             DG DFWAVG+G G W    R  YNL DA TR+T QVYPNSWTAILVSLDN+GMWN+RS+V
Sbjct  440   DGYDFWAVGFGSGQWTPAKRSLYNLEDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAV  499

Query  319   WPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             W R YLGQQ YL+VWN   SL  E + P + LLCG
Sbjct  500   WERQYLGQQFYLKVWNPVQSLANEYNPPDNLLLCG  534



>ref|XP_006393891.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
 gb|ESQ31177.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
Length=544

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/512 (60%), Positives = 385/512 (75%), Gaps = 1/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  27    IVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  86

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGV+GTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+
Sbjct  87    FLLTWNGIKQRKNSWQDGVMGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGF  146

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P A +TL++ DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  147   GAINVYARPGIPIPYPLPVADFTLLIGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  206

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             S TFTG QG  YMFR+SNVG ++S NFRIQ H +K+VEVEGSH +Q+ YDSLD+HVGQS 
Sbjct  207   S-TFTGDQGKAYMFRISNVGSSSSFNFRIQGHTMKVVEVEGSHVIQNDYDSLDVHVGQSL  265

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYYIVAS+RFV+  ++ + +L Y  S     G LP  P G+  WSMRQA
Sbjct  266   SVLVTLNQSPKDYYIVASTRFVRSKLSVTGLLRYSNSRVPASGDLPALPPGELVWSMRQA  325

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT +WNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  326   RTFKWNLTANAARPNPQGSFHYGKIITTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPL  385

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVF+ N+I+  P   PA    SV    LHD++EI+FQNNEK++QS+HLDG 
Sbjct  386   KLADHFKIEGVFSTNSIQSVPSNSPATVATSVVQASLHDFLEIVFQNNEKSMQSWHLDGY  445

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W  + R  YNL DA TR+T QVYPNSWTAILVSLDN+GMWN+RS++W R
Sbjct  446   DFWVVGFGSGQWTPSKRPLYNLADALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWER  505

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ YL+VW+   SL  E + P + LLCG
Sbjct  506   QYSGQQFYLKVWDPVQSLANEYNPPDNLLLCG  537



>emb|CDY01453.1| BnaA07g12260D [Brassica napus]
Length=545

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/511 (60%), Positives = 383/511 (75%), Gaps = 1/511 (0%)
 Frame = -2

Query  1747  VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPI  1568
             V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P 
Sbjct  29    VKGESPYKFYTWTVTYGVISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPF  88

Query  1567  LFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYG  1388
             L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+G
Sbjct  89    LLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFG  148

Query  1387  ALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNS  1208
             A+NI  R  IP+PYP P A +TL++ DW+ T+HK LQ++LD+G   PSP G+LING+  +
Sbjct  149   AINIYARPRIPIPYPLPVADFTLLIGDWFKTNHKTLQERLDSGGVLPSPDGMLINGQTQT  208

Query  1207  VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAG  1028
              TFTG QG TYM R+SNVG +++ NFRIQ H +++VEVEGSH +Q+ Y+SLD+HVGQS  
Sbjct  209   -TFTGDQGKTYMLRISNVGSSSTFNFRIQGHTMQVVEVEGSHVLQNVYESLDVHVGQSLS  267

Query  1027  FLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQAR  848
              LVTLN   KDYYIVA+SR+    ++ + +L Y  S     G +P PP     WS+ QAR
Sbjct  268   VLVTLNQPSKDYYIVATSRYTTSKLSVTGLLRYSNSGVPASGDMPPPPPEDLDWSLNQAR  327

Query  847   TIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLK  668
             + RWNLTANAARPNPQGS+HYGTI   ++ V  N+   I+G  RYA+N VSYVN  TPLK
Sbjct  328   SFRWNLTANAARPNPQGSFHYGTITPTKSFVFSNSAPLINGKQRYAVNGVSYVNSDTPLK  387

Query  667   LADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             LAD  NIPGVF+ NAI+  P + P     SV    LHD++E++FQNNE+++QS+HLDG D
Sbjct  388   LADHFNIPGVFSTNAIQRVPSSSPVTVATSVVQASLHDFLEVVFQNNEESMQSWHLDGYD  447

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VG+G G W    R  YNLVDA TR+T QVYP SWTAILVSLDN+GMWN+RS++W R 
Sbjct  448   FWVVGFGSGQWTPEQRPLYNLVDALTRHTTQVYPKSWTAILVSLDNQGMWNMRSAIWERQ  507

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ YL+VW+   SL  E + P + LLCG
Sbjct  508   YLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  538



>ref|XP_006393890.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
 gb|ESQ31176.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
Length=542

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/512 (60%), Positives = 384/512 (75%), Gaps = 3/512 (1%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  27    IVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  86

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGV+GTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+
Sbjct  87    FLLTWNGIKQRKNSWQDGVMGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGF  146

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P A +TL++ DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  147   GAINVYARPGIPIPYPLPVADFTLLIGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  206

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             S TFTG QG  YMFR+SNVG ++S NFRIQ H +K+VEVEGSH +Q+ YDSLD+HVGQS 
Sbjct  207   S-TFTGDQGKAYMFRISNVGSSSSFNFRIQGHTMKVVEVEGSHVIQNDYDSLDVHVGQSL  265

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYYIVAS+RFV+  ++ + +L Y  S     G LP  P G+  WSMRQA
Sbjct  266   SVLVTLNQSPKDYYIVASTRFVRSKLSVTGLLRYSNSRVPASGDLPALPPGELVWSMRQA  325

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT  WNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  326   RT--WNLTANAARPNPQGSFHYGKIITTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPL  383

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVF+ N+I+  P   PA    SV    LHD++EI+FQNNEK++QS+HLDG 
Sbjct  384   KLADHFKIEGVFSTNSIQSVPSNSPATVATSVVQASLHDFLEIVFQNNEKSMQSWHLDGY  443

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W  + R  YNL DA TR+T QVYPNSWTAILVSLDN+GMWN+RS++W R
Sbjct  444   DFWVVGFGSGQWTPSKRPLYNLADALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWER  503

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ YL+VW+   SL  E + P + LLCG
Sbjct  504   QYSGQQFYLKVWDPVQSLANEYNPPDNLLLCG  535



>ref|XP_002866726.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42985.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=543

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/512 (60%), Positives = 379/512 (74%), Gaps = 1/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  26    IVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  85

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT+ YF ST  H+AAGG+
Sbjct  86    FLLTWNGIKQRKNSWQDGVLGTNCPIQPNSNFTYKFQTKDQIGTFHYFPSTAFHKAAGGF  145

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P+A +TL+V DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  146   GAINVYARPGIPIPYPLPTADFTLLVGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  205

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             S TF+G QG TYMFR+SNVG+++S NFRIQ H +K+VEVEGSH +Q  YDSLDIHVGQS 
Sbjct  206   S-TFSGDQGKTYMFRISNVGLSSSFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSL  264

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   +DYYIVAS+RFV+  ++   +L Y  S     G  P  P G+  WSMRQA
Sbjct  265   AVLVTLNQSPRDYYIVASTRFVRSKVSVMGLLRYSNSRVPASGDQPALPPGELVWSMRQA  324

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  325   RTFRWNLTANAARPNPQGSFHYGMITPTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPL  384

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVF+ NAI+  P   P     SV    LHD++EI+FQNNEK++QS+HLDG 
Sbjct  385   KLADHFGISGVFSTNAIQSVPSNSPPTVATSVVQTSLHDFLEIVFQNNEKSMQSWHLDGY  444

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  YNLVDA TR+T QVYP SWT ILVSLDN+GMWN+RS++W R
Sbjct  445   DFWVVGFGSGQWTPAKRSLYNLVDALTRHTTQVYPKSWTTILVSLDNQGMWNMRSAIWER  504

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ YL+VWN   SL  E + P +   CG
Sbjct  505   QYSGQQFYLKVWNPVQSLANEYNPPDNLQFCG  536



>gb|KFK28370.1| hypothetical protein AALP_AA8G506600 [Arabis alpina]
Length=544

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/511 (60%), Positives = 379/511 (74%), Gaps = 1/511 (0%)
 Frame = -2

Query  1747  VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPI  1568
             V+ E PY++Y W V YG ISPLGV Q+ ILINGQFPGP ++V+TN+N+I+N+INKLD+P 
Sbjct  28    VKGESPYKYYTWTVTYGIISPLGVPQQVILINGQFPGPTLDVVTNDNIILNLINKLDQPF  87

Query  1567  LFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYG  1388
             L TWNGIKQRK+SW DGVLGTNCPI PNTN+TY+ Q KDQIGTY+YF ST  H+AAGG+G
Sbjct  88    LLTWNGIKQRKNSWQDGVLGTNCPIQPNTNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFG  147

Query  1387  ALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNS  1208
             A+N+  R  IP+PYP P + +TL++ DW+ T+HK LQ++LD+G   P P GLLING+  +
Sbjct  148   AINVYSRPGIPIPYPLPVSDFTLLIGDWFKTNHKTLQQKLDSGGILPFPDGLLINGQTQT  207

Query  1207  VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAG  1028
              TFTG QG TYM R+SNVG+ +S N RIQ H +K+VEVEGSH +Q  YDSLDIHVGQS  
Sbjct  208   -TFTGDQGKTYMLRISNVGLASSFNLRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSLA  266

Query  1027  FLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQAR  848
              LVTL+   KDYYIVAS+RFV+  ++   +L Y  S     G  P  P G+  WSMRQAR
Sbjct  267   VLVTLSQTPKDYYIVASTRFVRSNLSVMGLLRYSNSRVPASGDPPALPPGELVWSMRQAR  326

Query  847   TIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLK  668
             T RWNLTANAARPNPQGS+HYGTI   ++ V  N+   I+G  RYA+N VSYVN  TPLK
Sbjct  327   TFRWNLTANAARPNPQGSFHYGTITPTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPLK  386

Query  667   LADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             LAD  NI GVF+ +AI+  P   P     SV    LH+++EI+FQNNEK++QS+HLDG D
Sbjct  387   LADHFNIAGVFSTSAIQSVPSNSPTTVATSVVQANLHEFLEIVFQNNEKSMQSWHLDGYD  446

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VG+G G W    R  YNLVDA TR+T QVYPNSWT ILVSLDN+GMWN+RS++W R 
Sbjct  447   FWVVGFGSGQWTPAKRPLYNLVDALTRHTTQVYPNSWTTILVSLDNQGMWNMRSAIWERQ  506

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             Y GQQ YL+VWN   SL  E + P + LLCG
Sbjct  507   YAGQQFYLKVWNPVQSLSNEYNPPDNLLLCG  537



>ref|XP_009103469.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=545

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/511 (59%), Positives = 382/511 (75%), Gaps = 1/511 (0%)
 Frame = -2

Query  1747  VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPI  1568
             V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P 
Sbjct  29    VKGESPYKFYTWTVTYGVISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPF  88

Query  1567  LFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYG  1388
             L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+G
Sbjct  89    LLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFG  148

Query  1387  ALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNS  1208
             A+NI  R  IP+PYP P A +TL++ DW+ T+HK LQ++LD+G   PSP G+LING+  +
Sbjct  149   AINIYARPRIPIPYPLPVADFTLLIGDWFKTNHKTLQQRLDSGGVLPSPDGMLINGQTQT  208

Query  1207  VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAG  1028
              TFTG QG TYM R+SNVG +++ NFRIQ H +++VEVEGSH +Q+ Y+SLD+HVGQS  
Sbjct  209   -TFTGDQGKTYMLRISNVGSSSTFNFRIQGHAMQVVEVEGSHVLQNVYESLDVHVGQSLS  267

Query  1027  FLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQAR  848
              LVTLN   K+YYIVAS+R+    ++ + +L Y  S     G +P PP     WS+ QAR
Sbjct  268   VLVTLNQPSKNYYIVASTRYTTSKLSVTGLLRYSNSGVPASGDMPPPPPEDLDWSLNQAR  327

Query  847   TIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLK  668
             + RWNLTANAARPNPQGS+HYGTI   ++ V  N+    +G  RYA+N VSYVN  TPLK
Sbjct  328   SFRWNLTANAARPNPQGSFHYGTITPTKSFVFSNSAPLFNGKQRYAVNGVSYVNSDTPLK  387

Query  667   LADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             LAD  NIPGVF+ NAI+  P + P     SV    LHD++E++FQNNE+++QS+HLDG D
Sbjct  388   LADHFNIPGVFSTNAIQSVPSSSPVTVATSVVQASLHDFLEVVFQNNEESMQSWHLDGYD  447

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VG+G G W    R  YNLVDA TR+T QVYP SWTAILVSLDN+GMWN+RS++W R 
Sbjct  448   FWVVGFGSGQWTPEQRPLYNLVDALTRHTTQVYPKSWTAILVSLDNQGMWNMRSAIWERQ  507

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ YL+VW+   SL  E + P + LLCG
Sbjct  508   YLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  538



>ref|XP_003524640.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=508

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/489 (62%), Positives = 380/489 (78%), Gaps = 2/489 (0%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDE  1574
             S+V+ ED Y++Y W V YGT+SPLG  Q+ I+ING FPGP+++++TN+NV++N++NKLDE
Sbjct  21    SLVQGEDAYKYYTWTVTYGTLSPLGSPQQVIMINGDFPGPQLDLVTNDNVVLNLVNKLDE  80

Query  1573  PILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGG  1394
             P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST LH+AAGG
Sbjct  81    PFLLTWNGIKQRKNSWQDGVLGTNCPIRPNSNYTYKFQAKDQIGTYTYFPSTSLHKAAGG  140

Query  1393  YGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRL  1214
             +G L++  RSVIP+PYP P   +TL++ DW+ T+HK L++ LD+GK    P GLLING+ 
Sbjct  141   FGGLHVYHRSVIPVPYPYPDGDFTLLIGDWYKTNHKVLRESLDSGKSLAFPDGLLINGQA  200

Query  1213  NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQS  1034
             ++ T  G QG TYMFR+SNVG++TSINFRIQ H LKLVE+EGSH +Q+ YD+LD+HVGQS
Sbjct  201   HT-TINGDQGKTYMFRISNVGLSTSINFRIQGHTLKLVEIEGSHIVQNTYDTLDVHVGQS  259

Query  1033  AGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQ  854
             A  LVTLN   KDYYIVAS+RF +    A+A+LHY  S +   G LP  P  QYHWS++Q
Sbjct  260   AAMLVTLNQPPKDYYIVASTRFSRKVRVATAVLHYSNSKSPASGPLPSSPIYQYHWSVKQ  319

Query  853   ARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTP  674
             ART RWNLTANAARPNPQGSYHYG I   +T+VL N+   I+G   YA+NKVSYVNP TP
Sbjct  320   ARTYRWNLTANAARPNPQGSYHYGKITPTKTIVLSNSAPLINGKLCYAVNKVSYVNPDTP  379

Query  673   LKLADWLNIPGVFTLNAIKDTPPAG-PAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLD  497
             LKLAD+ NIPG++++++I+  P    P     SV    LHD++E+IFQNNE T+QS+HLD
Sbjct  380   LKLADYFNIPGIYSVDSIQSIPSDNTPTSIATSVVPTSLHDFIEVIFQNNENTMQSWHLD  439

Query  496   GQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVW  317
             G DFW VGYG G W    R+ YNLVDA TR+T QVYPN WT ILVSLDN+G+WNLRS++W
Sbjct  440   GYDFWVVGYGFGQWTPAKRRTYNLVDALTRHTAQVYPNGWTTILVSLDNQGIWNLRSAIW  499

Query  316   PRNYLGQQV  290
              R YLGQQ+
Sbjct  500   ERQYLGQQI  508



>gb|AAM61328.1| pectinesterase-like protein [Arabidopsis thaliana]
Length=546

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/512 (60%), Positives = 379/512 (74%), Gaps = 1/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P
Sbjct  29    IVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQP  88

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST  H+AAGG+
Sbjct  89    FLLTWNGIKQRKNSWQDGVLGTNCPIQPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGGF  148

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P+A +TL+V DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  149   GAINVYARPGIPIPYPLPTADFTLLVGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  208

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             S TF+G QG TYM R+SNVG++++ NFRIQ H +K+VEVEGSH +Q  YDSLDIHVGQS 
Sbjct  209   S-TFSGDQGKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSL  267

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYYIVAS+RF++  ++   +L Y  S     G  P  P G+  WSMRQA
Sbjct  268   AVLVTLNQSPKDYYIVASTRFIRSKLSVMGLLRYSNSRVPASGDPPALPPGELVWSMRQA  327

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   +T V  N+   I+G  RYA+N VSYV   TPL
Sbjct  328   RTFRWNLTANAARPNPQGSFHYGMISPTKTFVFSNSAPLINGKQRYAVNGVSYVKSETPL  387

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVF+ NAI+  P   P     S+     HD++EI+FQNNEK++QS+HLDG 
Sbjct  388   KLADHFGISGVFSTNAIQSVPSNSPPTVATSIVQTSHHDFLEIVFQNNEKSMQSWHLDGY  447

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W  T R  +NLVDA TR+T QVYP SWT ILVSLDN+GMWN+RS++W R
Sbjct  448   DFWVVGFGSGQWTPTKRSLHNLVDALTRHTTQVYPESWTTILVSLDNQGMWNMRSAIWER  507

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ YL+VWN+  SL  E + P +  LCG
Sbjct  508   QYSGQQFYLKVWNSVQSLANEYNPPDNLQLCG  539



>ref|XP_010444713.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=545

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/512 (60%), Positives = 381/512 (74%), Gaps = 2/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W   YG ISPLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  29    IVKGESPYKFYTWTATYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  88

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST  H+AAGG+
Sbjct  89    FLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGGF  148

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P+A +TL+V DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  149   GAINVYARPGIPIPYPVPTADFTLLVGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  208

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             + TF+G QG TYM R+SNVG++++ NFRIQ H +K+VEVEGSH +Q  YDSLDIHVGQS 
Sbjct  209   T-TFSGDQGKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSL  267

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYY+VASSRFV+  ++   +L Y  S     G  P  P G+  WSMRQA
Sbjct  268   AVLVTLNQSPKDYYMVASSRFVRSKLSVMGLLRYSNSHVPASGDPPALPPGELVWSMRQA  327

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  328   RTFRWNLTANAARPNPQGSFHYGKITPTKSFVFANSAPLINGKQRYAVNGVSYVNSETPL  387

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVFT NAI++ P   P     SV    LHD++EI+FQNNEK++QS+HLDG 
Sbjct  388   KLADHFGISGVFT-NAIQNVPSNSPPTVATSVVQTSLHDFLEIVFQNNEKSMQSWHLDGY  446

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  YNLVD  TR+T QVYPNSWTAILVSLDN+GMWN+RS++W R
Sbjct  447   DFWVVGFGSGQWTPAKRSLYNLVDGLTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWER  506

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ YLRVWN   SL  E + P +  LCG
Sbjct  507   QYSGQQFYLRVWNPVQSLANEYNPPDNLQLCG  538



>ref|NP_569041.1| protein SKU5 similar 17 [Arabidopsis thaliana]
 gb|AAM19780.1| AT5g66920/MUD21_18 [Arabidopsis thaliana]
 gb|AAN38699.1| At5g66920/MUD21_18 [Arabidopsis thaliana]
 gb|AED98278.1| protein SKU5 similar 17 [Arabidopsis thaliana]
Length=546

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/512 (60%), Positives = 378/512 (74%), Gaps = 1/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P
Sbjct  29    IVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQP  88

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST  H+AAGG+
Sbjct  89    FLLTWNGIKQRKNSWQDGVLGTNCPIQPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGGF  148

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P+A +TL+V DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  149   GAINVYARPGIPIPYPLPTADFTLLVGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  208

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             S TF+G QG TYM R+SNVG++++ NFRIQ H +K+VEVEGSH +Q  YDSLDIHVGQS 
Sbjct  209   S-TFSGDQGKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSL  267

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYYIVAS+RF++  ++   +L Y  S     G  P  P G+  WSMRQA
Sbjct  268   AVLVTLNQSPKDYYIVASTRFIRSKLSVMGLLRYSNSRVPASGDPPALPPGELVWSMRQA  327

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   +T V  N+   I+G  RYA+N VSYV   TPL
Sbjct  328   RTFRWNLTANAARPNPQGSFHYGMISPTKTFVFSNSAPLINGKQRYAVNGVSYVKSETPL  387

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVF+ NAI+  P   P     SV     HD++EI+FQNNEK++QS+HLDG 
Sbjct  388   KLADHFGISGVFSTNAIQSVPSNSPPTVATSVVQTSHHDFLEIVFQNNEKSMQSWHLDGY  447

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  +NLVDA TR+T QVYP SWT ILVSLDN+GMWN+RS++W R
Sbjct  448   DFWVVGFGSGQWTPAKRSLHNLVDALTRHTTQVYPESWTTILVSLDNQGMWNMRSAIWER  507

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ YL+VWN+  SL  E + P +  LCG
Sbjct  508   QYSGQQFYLKVWNSVQSLANEYNPPDNLQLCG  539



>dbj|BAB08634.1| pectinesterase like protein [Arabidopsis thaliana]
Length=544

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/512 (60%), Positives = 378/512 (74%), Gaps = 1/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P
Sbjct  27    IVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQP  86

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST  H+AAGG+
Sbjct  87    FLLTWNGIKQRKNSWQDGVLGTNCPIQPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGGF  146

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P+A +TL+V DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  147   GAINVYARPGIPIPYPLPTADFTLLVGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  206

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             S TF+G QG TYM R+SNVG++++ NFRIQ H +K+VEVEGSH +Q  YDSLDIHVGQS 
Sbjct  207   S-TFSGDQGKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSL  265

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYYIVAS+RF++  ++   +L Y  S     G  P  P G+  WSMRQA
Sbjct  266   AVLVTLNQSPKDYYIVASTRFIRSKLSVMGLLRYSNSRVPASGDPPALPPGELVWSMRQA  325

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   +T V  N+   I+G  RYA+N VSYV   TPL
Sbjct  326   RTFRWNLTANAARPNPQGSFHYGMISPTKTFVFSNSAPLINGKQRYAVNGVSYVKSETPL  385

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVF+ NAI+  P   P     SV     HD++EI+FQNNEK++QS+HLDG 
Sbjct  386   KLADHFGISGVFSTNAIQSVPSNSPPTVATSVVQTSHHDFLEIVFQNNEKSMQSWHLDGY  445

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  +NLVDA TR+T QVYP SWT ILVSLDN+GMWN+RS++W R
Sbjct  446   DFWVVGFGSGQWTPAKRSLHNLVDALTRHTTQVYPESWTTILVSLDNQGMWNMRSAIWER  505

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ YL+VWN+  SL  E + P +  LCG
Sbjct  506   QYSGQQFYLKVWNSVQSLANEYNPPDNLQLCG  537



>ref|XP_006280268.1| hypothetical protein CARUB_v10026189mg [Capsella rubella]
 gb|EOA13166.1| hypothetical protein CARUB_v10026189mg [Capsella rubella]
Length=545

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/512 (61%), Positives = 379/512 (74%), Gaps = 2/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P
Sbjct  29    IVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQP  88

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST  H+AAGG+
Sbjct  89    FLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGGF  148

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P+A +TL+V DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  149   GAINVYARPGIPIPYPVPTADFTLLVGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  208

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             + TF+G QG TYM R+SNVG++ + NFRIQ H +K+VEVEGSH +Q  YDSLDIHVGQS 
Sbjct  209   T-TFSGDQGKTYMLRISNVGLSNTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSL  267

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYY+VASSRFV+  ++   +L Y  S     G  P  P G+  WSMRQA
Sbjct  268   AVLVTLNQSPKDYYMVASSRFVRNKLSVMGLLRYSNSHVPASGDPPALPPGELVWSMRQA  327

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   +T V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  328   RTFRWNLTANAARPNPQGSFHYGKITPTKTFVFSNSAPLINGKQRYAVNGVSYVNSETPL  387

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVFT NAI+  P   P     SV    LHD++EI+FQNNEK++QS+HLDG 
Sbjct  388   KLADHFGISGVFT-NAIQSVPSNSPPTVATSVVQTSLHDFLEIVFQNNEKSVQSWHLDGY  446

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  YNLVD  TR+T QVYPNSWTAILVSLDN+GMWN+RS++W R
Sbjct  447   DFWVVGFGSGQWTPAKRSLYNLVDGLTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWER  506

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ Y+RVWN   SL  E + P +  LCG
Sbjct  507   QYSGQQFYMRVWNPVQSLANEYNPPDNLQLCG  538



>ref|XP_010484570.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=543

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/512 (60%), Positives = 380/512 (74%), Gaps = 2/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W   YG ISPLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  27    IVKGESPYKFYTWTATYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  86

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST  H+AAGG+
Sbjct  87    FLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGGF  146

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P+A +TL+V DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  147   GAINVYARPGIPIPYPVPTADFTLLVGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  206

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             + TF+G QG TYM R+SNVG++++ NFRIQ H +K+VEVEGSH MQ  YDSLDIHVGQS 
Sbjct  207   T-TFSGDQGKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVMQTDYDSLDIHVGQSL  265

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYY+VAS+RFV+  ++   +L Y  S     G  P  P G+  WSMRQA
Sbjct  266   AVLVTLNQSPKDYYMVASTRFVRSKLSVMGLLRYSNSHVPASGDPPALPPGELVWSMRQA  325

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  326   RTFRWNLTANAARPNPQGSFHYGKIAPTKSFVFANSAPLINGKQRYAVNGVSYVNSETPL  385

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVFT NAI++ P   P     SV    LHD++EI+FQNNEK++QS+HLDG 
Sbjct  386   KLADHFGISGVFT-NAIQNVPSNSPPTVATSVVQTSLHDFLEIVFQNNEKSMQSWHLDGY  444

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  YNLVD  TR+T QVYP SWTAILVSLDN+GMWN+RS++W R
Sbjct  445   DFWVVGFGSGQWTPAKRSLYNLVDGLTRHTTQVYPKSWTAILVSLDNQGMWNMRSAIWER  504

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ YLRVWN   SL  E + P +  LCG
Sbjct  505   QYSGQQFYLRVWNPVQSLANEYNPPDNLQLCG  536



>gb|KHM99211.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/497 (61%), Positives = 381/497 (77%), Gaps = 10/497 (2%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLG----VKQRGIL----INGQFPGPeinvitnenviv  1598
             S+V+ ED Y++Y W V YGT+SPLG    V Q  +L    +NGQFPGP+++++TN+NV++
Sbjct  21    SLVQGEDAYKYYTWTVTYGTLSPLGSPQQVDQLDVLCLLKVNGQFPGPQLDLVTNDNVVL  80

Query  1597  nviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLST  1418
             N++NKLDEP L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST
Sbjct  81    NLVNKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIRPNSNYTYKFQAKDQIGTYTYFPST  140

Query  1417  QLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPK  1238
              LH+AAGG+G L++  RSVIP+PYP P   +TL++ DW+ T+HK L++ LD+GK    P 
Sbjct  141   SLHKAAGGFGGLHVYHRSVIPVPYPYPDGDFTLLIGDWYKTNHKVLRESLDSGKSLAFPD  200

Query  1237  GLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             GLLING+ ++ T  G QG TYMFR+SNVG++TSINFRIQ H LKLVE+EGSH +Q+ YD+
Sbjct  201   GLLINGQAHT-TINGDQGKTYMFRISNVGLSTSINFRIQGHTLKLVEIEGSHIVQNTYDT  259

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LD+HVGQSA  LVTLN   KDYYIVAS+RF +    A+A+LHY  S +   G LP  P  
Sbjct  260   LDVHVGQSAAMLVTLNQPPKDYYIVASTRFSRKVRVATAVLHYSNSKSPASGPLPSSPIY  319

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             QYHWS++QART RWNLTANAARPNPQGSYHYG I   +T+VL N+   I+G   YA+NKV
Sbjct  320   QYHWSVKQARTYRWNLTANAARPNPQGSYHYGKITPTKTIVLSNSAPLINGKLCYAVNKV  379

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAG-PAVHGVSVFGLELHDYVEIIFQNNEK  521
             SYVNP TPLKLAD+ NIPG++++++I+  P    P     SV    LHD++E+IFQNNE 
Sbjct  380   SYVNPDTPLKLADYFNIPGIYSVDSIQSIPSDNTPTSIATSVVPTSLHDFIEVIFQNNEN  439

Query  520   TLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGM  341
             T+QS+HLDG DFW VGYG G W    R+ YNLVDA TR+T QVYPN WT ILVSLDN+G+
Sbjct  440   TMQSWHLDGYDFWVVGYGFGQWTPAKRRTYNLVDALTRHTAQVYPNGWTTILVSLDNQGI  499

Query  340   WNLRSSVWPRNYLGQQV  290
             WNLRS++W R YLGQQ+
Sbjct  500   WNLRSAIWERQYLGQQI  516



>emb|CDY43557.1| BnaC02g16540D [Brassica napus]
Length=541

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/511 (59%), Positives = 379/511 (74%), Gaps = 1/511 (0%)
 Frame = -2

Query  1747  VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPI  1568
             V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P 
Sbjct  25    VKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPF  84

Query  1567  LFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYG  1388
             L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+G
Sbjct  85    LLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFG  144

Query  1387  ALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNS  1208
             A+N+  R  IP+PY  P + +TL++ DW+ T+HK LQ++LD+G   P P G+LING+  +
Sbjct  145   AINVYARPRIPIPYLLPVSDFTLLIGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQT  204

Query  1207  VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAG  1028
              +FTG QG TYM R+SNVG++++ NFRIQ HK+K+VEVEGSH +Q+ Y+SLD+HVGQS  
Sbjct  205   -SFTGDQGKTYMLRISNVGLSSTFNFRIQGHKMKVVEVEGSHVIQNDYESLDVHVGQSLS  263

Query  1027  FLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQAR  848
              LVTLN   KDYYIVAS+RF++  +  + +L Y  S     G  P  P G+  WSMRQAR
Sbjct  264   LLVTLNQPPKDYYIVASTRFLRRKLNVTGLLRYSNSRVPASGAPPPLPPGELIWSMRQAR  323

Query  847   TIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLK  668
             T RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TP+K
Sbjct  324   TFRWNLTANAARPNPQGSFHYGKIKPTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPVK  383

Query  667   LADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             LAD  NI GVF+ NAI+  P         SV    LHD++EI+FQNNEK++QS+HLDG D
Sbjct  384   LADHFNIAGVFSTNAIQSFPSNSRVTVATSVVQASLHDFLEIVFQNNEKSVQSWHLDGYD  443

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VG+G G W    R+ YNL DA TR+T QVYPN+WT ILVSLDN+GMW++RS+ W R 
Sbjct  444   FWVVGFGSGQWTPAKRRLYNLADALTRHTTQVYPNAWTTILVSLDNQGMWSMRSARWDRQ  503

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ YL+VW+   SL  E + P + L CG
Sbjct  504   YLGQQFYLKVWDPVKSLANEYNPPDNLLRCG  534



>ref|XP_009115829.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/511 (59%), Positives = 379/511 (74%), Gaps = 1/511 (0%)
 Frame = -2

Query  1747  VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPI  1568
             V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P 
Sbjct  25    VKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPF  84

Query  1567  LFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYG  1388
             L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+G
Sbjct  85    LLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFG  144

Query  1387  ALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNS  1208
             A+N+  R  IP+PY  P + +TL++ DW+ T+HK LQ++LD+G   P P G+LING+  +
Sbjct  145   AINVYARPRIPIPYLLPVSDFTLLIGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQT  204

Query  1207  VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAG  1028
              +FTG QG TYM R+SNVG++++ NFRIQ HK+K+VEVEGSH +Q+ Y+SLD+HVGQS  
Sbjct  205   -SFTGDQGKTYMLRISNVGLSSTFNFRIQGHKMKVVEVEGSHVIQNDYESLDVHVGQSLS  263

Query  1027  FLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQAR  848
              LVTLN   KDYYIVAS+RF++  +  + +L Y  S     G  P  P G+  WSMRQAR
Sbjct  264   LLVTLNQPPKDYYIVASTRFLRRKLNVTGLLRYSNSRFPASGAPPPLPPGELIWSMRQAR  323

Query  847   TIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLK  668
             T RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TP+K
Sbjct  324   TFRWNLTANAARPNPQGSFHYGKIKPTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPVK  383

Query  667   LADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             LAD  NI GVF+ NAI+  P         SV    LHD++EI+FQN+EK++QS+HLDG D
Sbjct  384   LADHFNIAGVFSTNAIQSVPSNSRVTVATSVVQASLHDFLEIVFQNSEKSVQSWHLDGYD  443

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VG+G G W    R+ YNL DA TR+T QVYPN+WT IL+SLDN+GMWN+RS+ W R 
Sbjct  444   FWVVGFGSGQWTPAKRRLYNLGDALTRHTTQVYPNAWTTILLSLDNQGMWNMRSARWDRQ  503

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ YL+VW+   SL  E + P + L CG
Sbjct  504   YLGQQFYLKVWDPVKSLANEYNPPDNLLRCG  534



>ref|XP_006848556.1| hypothetical protein AMTR_s00169p00049950 [Amborella trichopoda]
 gb|ERN10137.1| hypothetical protein AMTR_s00169p00049950 [Amborella trichopoda]
Length=539

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/523 (58%), Positives = 380/523 (73%), Gaps = 1/523 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             + G+LA   + + +A++PYRF  W V YGTISPLGV Q+GILINGQFPGP+++VITN+N+
Sbjct  10    IYGILACLIVVLAKADNPYRFLTWTVTYGTISPLGVPQQGILINGQFPGPQLDVITNDNL  69

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
              +NVINKLDEP L TWNGI+QRK+SW DGVLGTNCPI PN N+TYR Q KDQIGTY YF 
Sbjct  70    DINVINKLDEPFLLTWNGIQQRKNSWMDGVLGTNCPIPPNGNFTYRFQPKDQIGTYFYFP  129

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             +T +HRAAGG+G + + +R VIP PYP  +  +  ++ DW+ T+HK LQK LD G+P   
Sbjct  130   TTLMHRAAGGFGGMTVFKRVVIPAPYPPLAGDHQALIGDWYKTNHKDLQKMLDMGRPLAF  189

Query  1243  PKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
             P G+LING  N   F    G T   R+SNVG+ T++NFRIQ HKLKLVEVEGSHT+Q+ Y
Sbjct  190   PDGILINGHANGAYFYADPGKTCFIRISNVGLQTTLNFRIQGHKLKLVEVEGSHTIQNVY  249

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
             DS+D+HVGQS G LV  +   KDYY+VAS+RF    +T++AI HY  +   +   LP  P
Sbjct  250   DSIDVHVGQSYGVLVVADQPPKDYYVVASTRFTDRVLTSTAIFHYRNTNIPLSLPLPPAP  309

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
                  WS+ QAR+IRWNLT NAARPNPQGS+HYG I  +R  VL N+   I+G  RYA+N
Sbjct  310   T-DVEWSINQARSIRWNLTTNAARPNPQGSFHYGLIKPMRRFVLANSAPLINGKLRYAVN  368

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
             +VSY++P TPLKLADW NI GVF  N     P  G A  G SV    LHDYVEIIFQNNE
Sbjct  369   EVSYISPETPLKLADWFNIAGVFDFNTFPSVPSGGFARLGTSVVASSLHDYVEIIFQNNE  428

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
              T+Q++H+DG  FW VG G G W S   + YNLVDA +R+T QVYPNSWTAI +S+DN+G
Sbjct  429   NTIQTWHIDGFSFWVVGMGIGQWKSDSWRTYNLVDAVSRHTTQVYPNSWTAIYLSMDNQG  488

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWN RS++W R YLGQQ+Y RV+++E SL  E  +P +TLLCG
Sbjct  489   MWNARSAMWARQYLGQQLYFRVFSSERSLAREYSIPHNTLLCG  531



>ref|XP_010464737.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=545

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/512 (60%), Positives = 380/512 (74%), Gaps = 2/512 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             +V+ E PY+FY W   YG ISPLGV Q+ ILINGQFPGP+++V+TN+N+I+N+INKLD+P
Sbjct  29    IVKGESPYKFYTWTATYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQP  88

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGT++YF ST  H+AAGG+
Sbjct  89    FLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGGF  148

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLN  1211
             GA+N+  R  IP+PYP P+A +TL+V DW+ T+HK LQ++LD+G   P P G+LING+  
Sbjct  149   GAINVYARPGIPIPYPIPTADFTLLVGDWFKTNHKTLQQRLDSGGVLPFPDGMLINGQTQ  208

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
             + TF+G QG TYM R+SNVG++++ NFRIQ H +K+VEVEGSH +Q  YDSLDIHVGQS 
Sbjct  209   T-TFSGDQGKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSL  267

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVTLN   KDYY+ ASSRF++  ++   +L Y  S     G  P  P G+  WSMRQA
Sbjct  268   AVLVTLNQSPKDYYMAASSRFIRSKLSVMGLLRYSNSHVPASGDPPALPPGELVWSMRQA  327

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             RT RWNLTANAARPNPQGS+HYG I   ++ V  N+   I+G  RYA+N VSYVN  TPL
Sbjct  328   RTFRWNLTANAARPNPQGSFHYGKITPTKSFVFANSAPLINGKQRYAVNGVSYVNSETPL  387

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD   I GVFT NAI++ P   P     SV    LHD++EI+FQNNEK++QS+HLDG 
Sbjct  388   KLADHFGISGVFT-NAIQNVPSNSPPTVATSVVQTSLHDFLEIVFQNNEKSMQSWHLDGY  446

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VG+G G W    R  YNLVD  TR+T QVYPNSWTAILVSLDN+GMWN+RS++W R
Sbjct  447   DFWVVGFGSGQWTPAKRSLYNLVDGLTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWER  506

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              Y GQQ Y+RVWN   SL  E + P +  LCG
Sbjct  507   QYSGQQFYMRVWNPVQSLANEYNPPDNLQLCG  538



>emb|CDY12788.1| BnaC07g16450D [Brassica napus]
Length=543

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/511 (59%), Positives = 380/511 (74%), Gaps = 1/511 (0%)
 Frame = -2

Query  1747  VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPI  1568
             V+ E PY+FY W V YG ISPLGV Q+ ILINGQFPGP++ V+TN+N+I+N+INKLD+P 
Sbjct  27    VKGESPYKFYTWTVTYGVISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPF  86

Query  1567  LFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYG  1388
             L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIGTY+YF ST  H+AAGG+G
Sbjct  87    LLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFG  146

Query  1387  ALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNS  1208
             A+NI  R  IP+PYP P A +TL++ DW+ T+HK LQ++LD+G   PSP G+LING+  +
Sbjct  147   AINIYARPRIPIPYPLPVADFTLLIGDWFKTNHKTLQQRLDSGGALPSPDGMLINGQTQT  206

Query  1207  VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAG  1028
              TFTG QG TYM R+SNVG++++ NFRIQ H +++VEVEGSH +Q+ Y+SLD+HVGQS  
Sbjct  207   -TFTGDQGKTYMLRISNVGLSSTFNFRIQGHTMQVVEVEGSHVLQNVYESLDVHVGQSLS  265

Query  1027  FLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQAR  848
              LVTLN   KDYYIVAS+R+    ++ + +L Y  S     G +  PP     WS+ QAR
Sbjct  266   VLVTLNQPSKDYYIVASTRYTTSKLSVTGLLRYSNSGVPASGDMLPPPPEDLDWSLNQAR  325

Query  847   TIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLK  668
             + RWNLTANAARPNPQGS+HYGTI   ++ V  ++   I+G  RYA+N +SYV+  TPLK
Sbjct  326   SFRWNLTANAARPNPQGSFHYGTITPTKSFVFSSSAPLINGKQRYAVNGLSYVSSETPLK  385

Query  667   LADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             LAD  NIPGVF+ NAI+  P + PA    SV    LH Y   + +NNE+++QS+HLDG D
Sbjct  386   LADHFNIPGVFSTNAIQSVPSSAPATVATSVVRASLHVYNLNLNKNNEESMQSWHLDGYD  445

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VG+G G W    R  YNLVDA TR+T QVYPNSWTAILVSLDN+GMWN+RS++W R 
Sbjct  446   FWVVGFGSGQWTPEQRPLYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWERQ  505

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ YL+VW+   SL  E + P + LLCG
Sbjct  506   YLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  536



>ref|XP_006657409.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=543

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/513 (58%), Positives = 370/513 (72%), Gaps = 5/513 (1%)
 Frame = -2

Query  1738  EDPYRFYNWVVQYGTISPLG-VKQRGILINGQFPGPeinvitnenvivnviNKLDEPILF  1562
             +DPYRF+ W V YG I+PLG  +Q+GILINGQFPGP I+ +TN+N+IVNVIN LDEP L 
Sbjct  24    DDPYRFFTWSVTYGPINPLGSTQQQGILINGQFPGPRIDCVTNDNIIVNVINNLDEPFLL  83

Query  1561  TWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGAL  1382
             TWNGIKQRK+SW DGVLGTNCPI    N+TY+ Q KDQIGT++YF S  LHRAAGG+GA 
Sbjct  84    TWNGIKQRKNSWQDGVLGTNCPIPAGANYTYKFQAKDQIGTFTYFPSVALHRAAGGFGAF  143

Query  1381  NIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRLNSVT  1202
             N+ +R  IP+PY  P+  +TL+V DW+   HKQL++ LD G   P P  LLING  ++ T
Sbjct  144   NVYQRPAIPVPYAPPAGDFTLLVGDWYRAGHKQLRQTLDAGGALPPPDALLINGMPSAAT  203

Query  1201  FTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGFL  1022
             F G QG TY+FRVSNVG+ TS+N RIQ H L+LVEVEG+H +Q+ YDSLD+HVGQS  FL
Sbjct  204   FVGDQGKTYLFRVSNVGVKTSVNVRIQGHSLRLVEVEGTHPVQNVYDSLDVHVGQSVAFL  263

Query  1021  VTLNADVKDYYIVASSRFVKPY----MTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQ  854
             VTL+   +DY +VAS+RF+       +TA   LHY  +V++ PG LP PP     WSM Q
Sbjct  264   VTLDKPAQDYAVVASARFIPAMVAAPLTAMGTLHYSSAVSRAPGPLPAPPPEGAEWSMNQ  323

Query  853   ARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTP  674
             AR+ RWNLTA+AARPNPQGS+HYGTIP  RTLVL N+   ++G  RYA+N VS+V P TP
Sbjct  324   ARSFRWNLTASAARPNPQGSFHYGTIPTSRTLVLANSAPLLAGQRRYAVNGVSFVVPDTP  383

Query  673   LKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDG  494
             LKL D  NI  V   +++   P       G  V  L LH+++E++FQN E  LQS+HLDG
Sbjct  384   LKLVDNYNIANVIGWDSVPARPDGSAPRSGTPVVRLNLHEFIEVVFQNTENELQSWHLDG  443

Query  493   QDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWP  314
              DFW VGYG G W  + R  YNLVDA  R+TVQVYPN W+AILVSLDN+GMWNLRS+ W 
Sbjct  444   YDFWVVGYGNGQWTESQRTTYNLVDAQARHTVQVYPNGWSAILVSLDNQGMWNLRSANWD  503

Query  313   RNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             R YLGQQ+Y+RVW  + S   E  +P + +LCG
Sbjct  504   RQYLGQQLYMRVWTPQQSFSNEYSIPTNAILCG  536



>gb|KDO79340.1| hypothetical protein CISIN_1g0092422mg, partial [Citrus sinensis]
Length=472

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/458 (62%), Positives = 350/458 (76%), Gaps = 1/458 (0%)
 Frame = -2

Query  1768  AFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnvi  1589
             A   +++V+A+DPYRFY W V  GT+SPLGV Q  ILINGQFPGP ++V+TN+N+I+NVI
Sbjct  16    AALSVALVKADDPYRFYTWTVTSGTLSPLGVPQEVILINGQFPGPRLDVVTNDNIILNVI  75

Query  1588  NKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLH  1409
             NKLD+P L TWNGIKQRK+SW DGVLGTNCPI PN+N+TY+ Q KDQIG+Y YF ST +H
Sbjct  76    NKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSYFYFPSTLMH  135

Query  1408  RAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLL  1229
             RAAGGYG +NI +R  IP+PYP     +TL++ DW+ T+HK L++ LD+GK  P P G+L
Sbjct  136   RAAGGYGGINIYQRPRIPIPYPIQDGDFTLLIGDWFKTNHKILRQTLDSGKSLPFPDGVL  195

Query  1228  INGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDI  1049
             ING+    TF G QG TYMFR+SNVG++TS NFRIQ H +KLVEVEGSHT+Q+ YDSLD+
Sbjct  196   INGQ-GHTTFNGDQGKTYMFRISNVGLSTSFNFRIQGHTMKLVEVEGSHTIQNIYDSLDV  254

Query  1048  HVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYH  869
             HVGQS   LVTLN   KDYYIVAS+RF K  +TA+AILHY  S +   G LP  P  + H
Sbjct  255   HVGQSVSVLVTLNQPPKDYYIVASTRFTKNVLTATAILHYTNSHSPASGPLPTGPTYEIH  314

Query  868   WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYV  689
             WSM+QART RWNLTANAARPNPQGS+HYG I   RT+VL N+   I+G  RYA+N +SYV
Sbjct  315   WSMKQARTFRWNLTANAARPNPQGSFHYGKINTTRTIVLANSAPLINGKLRYAVNGISYV  374

Query  688   NPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQS  509
             N  TPLKLAD+ NIPG+F++N+I+  P  G +    SV  + LH+Y+E++FQNNEKT+QS
Sbjct  375   NSDTPLKLADYFNIPGIFSVNSIQSVPSGGASSVATSVMQVNLHEYIEVVFQNNEKTMQS  434

Query  508   YHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQ  395
             +HLDG DFW VGYG G W +  R+ YNL D  TR+T Q
Sbjct  435   WHLDGYDFWVVGYGSGQWAAEKRRTYNLADTLTRHTAQ  472



>emb|CDY67479.1| BnaCnng55180D [Brassica napus]
Length=541

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/520 (53%), Positives = 366/520 (70%), Gaps = 0/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +L F   ++V AE PYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I+N
Sbjct  12    LLCFSFFALVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++ R++S+ DG+ GT CPI P TN+TY +Q+KDQIG++ YF S  
Sbjct  72    VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLA  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+ +LD G+  PSP G
Sbjct  132   FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDG  191

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LINGR N  T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HTMQ  + SL
Sbjct  192   ILINGRSNGATLNVEQGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSL  251

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   L+T +   +DYY+VASSRF    +T + IL Y GS T   G +P  P  Q
Sbjct  252   DVHVGQSYSVLITADQSPRDYYVVASSRFTDKIITTTGILRYSGSSTSASGPIPGGPTIQ  311

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +N VS
Sbjct  312   IDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVS  371

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             +V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N E  +
Sbjct  372   FVPADTPLKLADFFKISGVYKINSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENKENIV  431

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QSYHL+G  FW VG  GG W++  R  YNL DA +R TVQVYP SWTAI ++LDN GMWN
Sbjct  432   QSYHLNGYSFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWN  491

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LRS  W R YLGQQ+YLRV+    SL  E  +P ++ LCG
Sbjct  492   LRSEFWARQYLGQQLYLRVFTTSTSLRDEYPIPKNSRLCG  531



>ref|XP_008384084.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/521 (55%), Positives = 367/521 (70%), Gaps = 2/521 (0%)
 Frame = -2

Query  1771  LAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnv  1592
             L  F ++ V  EDPYRF+ W V YG I PLGVKQ+GILINGQFPGP+I+ +TN+N++++V
Sbjct  13    LVLFLVNGVNGEDPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISV  72

Query  1591  iNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQL  1412
              N L EP L +W+GI+QR++SW DGV GT CPI P  N+TY +Q+KDQIG++ YF S Q 
Sbjct  73    FNYLREPFLISWDGIQQRRNSWQDGVFGTTCPIPPGRNFTYNIQVKDQIGSFFYFPSLQF  132

Query  1411  HRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQ-LDTGKPFPSPKG  1235
             H+AAGG+G + I  R  IP+P+P P+  +T++  DW+ T+H  L++  LD G+  P+P G
Sbjct  133   HKAAGGFGGIRIWSRPKIPVPFPTPAGDFTVLAGDWFKTNHYILRRGFLDRGRALPNPDG  192

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             LLINGR  N  TFT  QG TY FR+SNVG+TTSINFRIQ HK KLVEVEGSHT+Q+ YDS
Sbjct  193   LLINGRGWNGYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKXKLVEVEGSHTLQNXYDS  252

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LVT N  V+DYY+V SSRF +  +T +A+LHY  S   V G +P  P  
Sbjct  253   LDIHLGQSLSVLVTANQPVQDYYVVVSSRFTRQVLTTTAVLHYSNSRNGVSGPIPWGPTT  312

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR+IRWNLTA+  RPNPQGSYHYG I   RT++L N+   I+G  RYA+N V
Sbjct  313   QIAWSVSQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIMLGNSAPWINGKQRYAVNSV  372

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             SYV P TPLKLAD+ NI GVF++ +I   P  G      SV   +  +YVEI+FQN E T
Sbjct  373   SYVQPDTPLKLADYFNIQGVFSVGSIATNPTGGSGYLQTSVMHXDFREYVEIVFQNWEDT  432

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QS+H+DG  F+ +G  GG W    R +YNL D   R T QVYP +WTAI ++LDN GMW
Sbjct  433   VQSWHIDGYSFFVMGMEGGQWTPASRARYNLRDTVARSTTQVYPRAWTAIYIALDNVGMW  492

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV++  HS   E  +P + LLCG
Sbjct  493   NVRSQNWARQYLGQQFYLRVYSPAHSWRDEYPIPRNALLCG  533



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/527 (55%), Positives = 362/527 (69%), Gaps = 1/527 (0%)
 Frame = -2

Query  1792  LRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             +R    +L    +S    ED YRF+ W V YG I PLGVKQ+GILINGQFPGP+I  +TN
Sbjct  7     VRVSCFMLVMLLVSCTNGEDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTN  66

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
             EN+I+NV N LD+P L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y 
Sbjct  67    ENLIINVFNSLDQPFLISWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYF  126

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF S  LH+AAGGYG   I+ RSVIP+P+P P+A YT++  DW+  +H  L+  LD+G  
Sbjct  127   YFPSLALHKAAGGYGGFRILSRSVIPVPFPPPAADYTILAGDWYKKNHTDLKAILDSGSD  186

Query  1252  FPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
              P P GLLINGR  N  TFT  QG TY FR+SNVG+TTSINFRIQ HKL LVEVEG+HT+
Sbjct  187   LPFPDGLLINGRGANGYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKLLLVEVEGTHTL  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ YDSLDIH+GQS   LVT +   +DYYIVAS+RF    +  +A+LHY  S   V G L
Sbjct  247   QNTYDSLDIHLGQSYSVLVTADQPAQDYYIVASTRFTSQVLATTAVLHYSNSAGTVSGPL  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   RT+ L ++   I+G  R
Sbjct  307   PGGPTTQIDWSLEQARSIRRNLTASGPRPNPQGSYHYGLINTTRTIRLASSASIINGKQR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N VS++   TPLKLAD+ NI GVF+L +I   P  G A    SV   +   Y EI+F
Sbjct  367   YAVNSVSFIPADTPLKLADYFNISGVFSLGSIPVGPTGGGAYLQTSVMAADFRGYTEIVF  426

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             +N E TLQS+H+DG +F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + L
Sbjct  427   ENPEDTLQSWHIDGHNFFVVGMDGGQWTPASRLTYNLRDTISRCTVQVYPKSWTAVYMPL  486

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWN+RS  W R YLGQQ YLRV++   S   E  +P + LLCG
Sbjct  487   DNVGMWNVRSENWARQYLGQQFYLRVYSPAKSWRDEYPIPRNALLCG  533



>ref|XP_007213900.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15099.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=543

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/522 (56%), Positives = 368/522 (70%), Gaps = 2/522 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             VL  F ++ V  EDPYRF+ W + YG I PLGVKQ+GILINGQFPGP+I+ +TN+N++++
Sbjct  12    VLVLFLVNGVNGEDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVIS  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N L EP L +W+GI+QR++SW DGV GTNCPILP  N+TY +Q+KDQIG++ YF S  
Sbjct  72    VFNYLREPFLISWDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFL  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQ-LDTGKPFPSPK  1238
              H+AAGG+G + I  R  IP+P+P P+  +T++  DW+ T+H  L++  L+ G+  PSP 
Sbjct  132   FHKAAGGFGGIRIWSRPKIPVPFPNPAGDFTVLAGDWYKTNHYILRRSYLEFGRNLPSPD  191

Query  1237  GLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYD  1061
             GLLINGR  N  TFT  QG TY FR+SNVG+TTSINFRIQ HKLKLVEVEGSHT+Q+ YD
Sbjct  192   GLLINGRGWNGYTFTVDQGRTYRFRISNVGLTTSINFRIQGHKLKLVEVEGSHTLQNIYD  251

Query  1060  SLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPA  881
             SLDIH+GQS   LVT +   +DYY+V SSRF    +T +A+LHY  S   V G LP  P+
Sbjct  252   SLDIHLGQSYSVLVTADQPAQDYYVVVSSRFTPRVLTTTAVLHYSNSRKGVSGPLPWGPS  311

Query  880   GQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNK  701
              Q  WS+ QAR+IRWNLTA+  RPNPQGSYHYG I   RT++L N+   I+G  R+A+N 
Sbjct  312   TQVAWSLSQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIMLANSAPYINGKQRFAVNS  371

Query  700   VSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEK  521
             VSYV P TPLKLAD+  IPGVF++ +I   P  G      SV      +YVEI+FQN E 
Sbjct  372   VSYVQPDTPLKLADYFKIPGVFSVGSIPTNPTGGSGYLQTSVMHANFREYVEIVFQNWED  431

Query  520   TLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGM  341
             T+QS+H+DG  F+ +G  GG W    R +YNL D   R T QVYP SWTAI V+LDN GM
Sbjct  432   TVQSWHIDGYSFFVMGMDGGQWTPASRARYNLRDTVARSTTQVYPRSWTAIYVALDNVGM  491

Query  340   WNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WN+RS  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  492   WNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCG  533



>ref|XP_004505676.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=533

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/523 (54%), Positives = 367/523 (70%), Gaps = 0/523 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
                +   F I +V AEDPYRF++W + YG I PLGVKQ+GILINGQFPGPEI  +TN+N+
Sbjct  6     FCSIFLLFNIVLVFAEDPYRFFDWNITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNL  65

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N L EP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF 
Sbjct  66    IINVHNSLPEPFLISWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFP  125

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G++ I+ R  IP+P+P+P+  YTL++ DW+  DH +L+K LD G   P 
Sbjct  126   SLAFHKAAGGFGSIKILSRPRIPVPFPDPTDDYTLLIGDWYQIDHTRLRKVLDFGHRLPF  185

Query  1243  PKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
             P+ +LINGR N  TFT +QG TY  R+SNVG+  ++NFRIQNH +KLVEVEG+HT+Q  Y
Sbjct  186   PQAVLINGRANGTTFTVEQGKTYRLRISNVGLQNTLNFRIQNHIMKLVEVEGTHTIQTSY  245

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
              S+D+HVGQS   L+T +   KDYYIV S+RF    +T++A LHY  S   + G +P  P
Sbjct  246   SSIDVHVGQSYSVLITADQAPKDYYIVVSTRFTNTILTSTANLHYSNSQQPLLGPIPAGP  305

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
               Q  WS+ QAR+IR NLTA+  RPNPQGSYHYGTI I RT+ LE++   ++G  RYA+N
Sbjct  306   TTQIDWSLEQARSIRTNLTASGPRPNPQGSYHYGTINISRTIKLESSAALVNGKQRYAVN  365

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
              VS++   TPLKLAD+  I GVF + +I DTP   P     SV G +   +VEI+FQN+E
Sbjct  366   SVSFIPADTPLKLADYFKIGGVFQVGSIPDTPSHKPMYLDTSVMGADFRAFVEIVFQNHE  425

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
               +QS+H+DG  FW VG  GGVW    R +YNL DA +R T QVYP SWTAI ++LDN G
Sbjct  426   NIIQSWHIDGYSFWVVGMDGGVWTPNSRGQYNLNDAVSRSTTQVYPKSWTAIYMALDNVG  485

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWN+RS  W R YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  486   MWNVRSEFWTRQYLGQQFYLRVYSPVESVRDEYPIPKNALLCG  528



>ref|XP_009107631.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/520 (53%), Positives = 366/520 (70%), Gaps = 0/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +L +   ++V AE PYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I+N
Sbjct  13    LLCYSFFALVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  72

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++ R++S+ DG+ GT CPI P TN+TY +Q+KDQIG++ YF S  
Sbjct  73    VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLA  132

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+ +LD G+  PSP G
Sbjct  133   FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDG  192

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LINGR N  T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HTMQ  + SL
Sbjct  193   ILINGRSNGATLNVEQGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSL  252

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   L+T +   +DYY+VASSRF    +T + IL Y GS T   G +P  P  Q
Sbjct  253   DVHVGQSYSVLITADQSPRDYYVVASSRFTGKIITTTGILRYSGSSTSASGPIPGGPTIQ  312

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +N VS
Sbjct  313   IDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVS  372

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             +V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N E  +
Sbjct  373   FVPADTPLKLADFFKISGVYKINSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENKENIV  432

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QSYHL+G  FW VG  GG W++  R  YNL DA +R TVQVYP SWTAI ++LDN GMWN
Sbjct  433   QSYHLNGYSFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWN  492

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LRS  W R YLGQQ+YLRV+    SL  E  +P ++ LCG
Sbjct  493   LRSEFWARQYLGQQLYLRVFTTSTSLRDEYPIPKNSRLCG  532



>emb|CDY35790.1| BnaA08g04510D [Brassica napus]
Length=542

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/520 (53%), Positives = 366/520 (70%), Gaps = 0/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +L +   ++V AE PYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I+N
Sbjct  13    LLCYSFFALVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  72

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++ R++S+ DG+ GT CPI P TN+TY +Q+KDQIG++ YF S  
Sbjct  73    VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLA  132

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+ +LD G+  PSP G
Sbjct  133   FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDG  192

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LINGR N  T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HTMQ  + SL
Sbjct  193   ILINGRSNGATLNVEQGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSL  252

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   L+T +   +DYY+VASSRF    +T + IL Y GS T   G +P  P  Q
Sbjct  253   DVHVGQSYSVLITADQSPRDYYVVASSRFTDKIITTTGILRYSGSSTSASGPIPGGPTIQ  312

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +N VS
Sbjct  313   IDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVS  372

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             +V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N E  +
Sbjct  373   FVPADTPLKLADFFKISGVYKINSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENKENIV  432

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QSYHL+G  FW VG  GG W++  R  YNL DA +R TVQVYP SWTAI ++LDN GMWN
Sbjct  433   QSYHLNGYSFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWN  492

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LRS  W R YLGQQ+YLRV+    SL  E  +P ++ LCG
Sbjct  493   LRSEFWARQYLGQQLYLRVFTTSTSLRDEYPIPKNSRLCG  532



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/521 (54%), Positives = 364/521 (70%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             ++A   ++    EDPYRFYNW V YG I PLG+KQRGILINGQFPGP+I  +TN+N+I+N
Sbjct  12    LVALLTVTCTNGEDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTNDNLIIN  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S  
Sbjct  72    VFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLG  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G + I  RSVIP+P+P P+  +T++  DW++ +H  L+  LD+G   PSP G
Sbjct  132   FHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLKAILDSGNNLPSPDG  191

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             LLINGR  N  TFT  QG TY  R+SNVG+TTSINFRIQ HK+ LVEVEG+H++Q+ Y S
Sbjct  192   LLINGRGSNGFTFTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYSS  251

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LVT +   +DYYIV S+RF    ++ ++ILHY  S   V G  P  P  
Sbjct  252   LDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVLSTTSILHYSNSAGSVSGPPPGGPTT  311

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR++R NLTA+  RPNPQGSYHYG I   RT+ L ++   I G  RYA+N V
Sbjct  312   QIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSAPIIDGKQRYAVNSV  371

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S++ P TPLKLAD+  I GVF++ +I+D P  G A    SV   +   + E++F+N E T
Sbjct  372   SFIQPDTPLKLADYFKISGVFSIGSIQDNPTGGGAYLQTSVMNADFRGFAELVFENPEDT  431

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QS+H+DG  F+ VG  GG W+   R +YNL D  +R TVQVYPNSWTAI + LDN GMW
Sbjct  432   VQSWHIDGHSFFVVGMDGGQWEPASRLRYNLRDTISRCTVQVYPNSWTAIYMPLDNVGMW  491

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  492   NVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCG  532



>ref|XP_006435293.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 ref|XP_006473746.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR48533.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|KDO85016.1| hypothetical protein CISIN_1g009149mg [Citrus sinensis]
Length=542

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/522 (53%), Positives = 360/522 (69%), Gaps = 2/522 (0%)
 Frame = -2

Query  1774  VLAFFC--ISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvi  1601
             + + FC   ++V AEDPYRF+NW V YG I PLGV+QRGILIN QFPGP+I+ +TN+N+I
Sbjct  11    ICSLFCSLFAIVSAEDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLI  70

Query  1600  vnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLS  1421
             +NV N LDEP L +WNGI+ R++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S
Sbjct  71    INVFNSLDEPFLLSWNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPS  130

Query  1420  TQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSP  1241
                H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+ ++H  L+  LD GK  P P
Sbjct  131   LAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRAHLDKGKKLPLP  190

Query  1240  KGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYD  1061
              G+LINGR +   F  +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q  Y 
Sbjct  191   DGILINGRGSGAAFNVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYS  250

Query  1060  SLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPA  881
             SLD+HVGQS   LVT +   +DYYIV SSRF    +T + ILHY  S   V G +P  P 
Sbjct  251   SLDVHVGQSYSVLVTADQPARDYYIVVSSRFTSTVLTTTGILHYSNSAGPVSGPIPGGPT  310

Query  880   GQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNK  701
              Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   +T+ L ++   ++G  RYA+N 
Sbjct  311   VQIDWSLNQARSIRSNLTASGPRPNPQGSYHYGLINTTKTIRLSSSAGQVNGKQRYAINS  370

Query  700   VSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEK  521
             VS++   TPLKLAD+  I GVF + +I D P  G      +V G +   ++EI+FQN+E 
Sbjct  371   VSFIPADTPLKLADYFKIGGVFRIGSISDNPTGGGIYQDTAVMGADYRAFIEIVFQNDED  430

Query  520   TLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGM  341
              +QSYHL+G  FW VG  GG W S  R +YNL DA  R TVQVYP SW+AI ++LDN GM
Sbjct  431   IIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDAVARVTVQVYPKSWSAIYIALDNVGM  490

Query  340   WNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WNLRS  W R YLGQQ YLRV+    SL  E  +P +  LCG
Sbjct  491   WNLRSESWARQYLGQQFYLRVYTASTSLRDEYPIPKNARLCG  532



>ref|XP_006592035.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=544

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/535 (52%), Positives = 368/535 (69%), Gaps = 0/535 (0%)
 Frame = -2

Query  1819  KMRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             K+   PS        +L     + V AEDPYRF++W + YG I PLGVKQ+GILINGQFP
Sbjct  2     KLINKPSQLRALFCSILLLLEFAFVAAEDPYRFFDWTITYGDIYPLGVKQQGILINGQFP  61

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GPEI  +TN+N+I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q
Sbjct  62    GPEIYSVTNDNLIINVHNNLTEPFLLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQ  121

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
             +KDQIG++ YF S   H+AAGG+GA+ I+ R  IP+P+P+P+  ++L++ DW+  +HK+L
Sbjct  122   VKDQIGSFFYFPSLAFHKAAGGFGAIKILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKL  181

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             Q  LD G   P P+ +LINGR +  TFT  QG TY  R+SNVG+  ++NFRIQ H +KLV
Sbjct  182   QSVLDFGHKLPFPQAVLINGRPSGTTFTAIQGKTYRLRISNVGLQNTLNFRIQGHDMKLV  241

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEG+HT+Q  Y SLD+HVGQS   L+T +   KDYYIV S+RF    +T++AILHY  S
Sbjct  242   EVEGTHTIQTTYSSLDVHVGQSYSVLITADQAPKDYYIVVSTRFTNKILTSTAILHYSNS  301

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
             +  V G +P  P  Q  WS++QAR+IR NLTA+  RPNPQGSYHYG I I RT+ L ++ 
Sbjct  302   LQSVSGPIPGGPTTQIDWSIKQARSIRTNLTASGPRPNPQGSYHYGLINISRTITLVSSA  361

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               ++G  RYA+N +S+    TPLKLAD+ NI  VF + +I D+P   P     SV G + 
Sbjct  362   AQVNGKQRYAVNSISFRPVDTPLKLADYFNIGRVFQVGSIPDSPSGRPMYLDTSVMGADF  421

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
               +VEI+FQN+E  +QS+H+DG  FW VG  GGVW    R +YNL DA +R T QVYP S
Sbjct  422   RAFVEIVFQNHENIIQSWHIDGYSFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKS  481

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WTAI ++LDN GMWN+RS  W R YLGQQ YLRV++   S+  E  +P + +LCG
Sbjct  482   WTAIYMALDNVGMWNVRSEFWARQYLGQQFYLRVYSPVGSIRDEYPIPKNAILCG  536



>gb|KEH30611.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/524 (53%), Positives = 368/524 (70%), Gaps = 1/524 (0%)
 Frame = -2

Query  1783  LLGVLAFFCIS-MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             LL +L+F  I  +V +EDPYRF++W + YG I PLGVKQ+GILINGQFPGPEI  +TN+N
Sbjct  10    LLALLSFCSIFFLVASEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDN  69

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF
Sbjct  70    LIINVHNNLPEPFLLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYF  129

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G++ I+ R  IP+P+PEP+  YT ++ DW+  DH +L+K LD G   P
Sbjct  130   PSLAFHKAAGGFGSIKILSRPRIPVPFPEPANDYTFLIGDWYKIDHTKLRKVLDFGHKLP  189

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P+ +LING  N  +FT  QG TY  R+SNVG+  ++NFRIQ H +KLVEVEG+HT+Q  
Sbjct  190   LPQAVLINGHANGTSFTVDQGKTYRLRISNVGLEHTLNFRIQGHIMKLVEVEGTHTVQTS  249

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             YDS+D+HVGQS   L+T +   KDYYIV S+RF    +T++A LHY  S   + G +P  
Sbjct  250   YDSIDVHVGQSYSVLITADQAPKDYYIVVSTRFTNRVLTSTAALHYSNSQQPLSGPIPAG  309

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS++QAR+IR NLTA+  RPNPQGSYHYG I I RT+ LE++   ++G  RYA+
Sbjct  310   PTTQIDWSIQQARSIRTNLTASGPRPNPQGSYHYGMINISRTIKLESSAAQVNGKQRYAV  369

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+V   TPLKLAD+  I GVF + +I DTP         SV G +   +VEI+FQN+
Sbjct  370   NSVSFVPADTPLKLADYFKIGGVFQVGSIPDTPSGRSMYTDTSVMGADFRAFVEIVFQNH  429

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QS+H+DG  FW VG  GGVW    R +YNL DA +R T QVYP SWTAI ++LDN 
Sbjct  430   ESIVQSWHIDGYSFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKSWTAIYMALDNV  489

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWN+RS  W R YLGQQ Y+RV+++  S+  E  +P + LLCG
Sbjct  490   GMWNVRSEFWARQYLGQQFYMRVYSDAGSIRDEYPIPKNALLCG  533



>ref|XP_009359037.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=543

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/521 (55%), Positives = 367/521 (70%), Gaps = 2/521 (0%)
 Frame = -2

Query  1771  LAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnv  1592
             L  F ++ V  EDPYRF+ W V YG I PLGVKQRGILINGQFPGP+I+ +TN+N++++V
Sbjct  13    LVLFLVNGVIGEDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDAVTNDNLVISV  72

Query  1591  iNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQL  1412
              N L EP L +W+GI+QR++SW DGVLGTNCPI P  ++TY +Q+KDQIG++ YF S Q 
Sbjct  73    FNYLREPFLISWDGIQQRRNSWQDGVLGTNCPIPPGRSFTYNIQVKDQIGSFFYFPSLQF  132

Query  1411  HRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQ-LDTGKPFPSPKG  1235
             H+AAGG+G + I  R  IP+P+P P+  +T++  DW+ T+H  L++  LD G+  P+P G
Sbjct  133   HKAAGGFGGIRIRSRPKIPVPFPNPAGDFTVLAGDWFKTNHYLLRRGYLDRGRALPNPDG  192

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             LLINGR  N  TFT  +G TY FR+SNVG+TTSINFRIQ HK+KLVEVEGSHT+Q+ YDS
Sbjct  193   LLINGRGWNGYTFTVDRGRTYRFRISNVGLTTSINFRIQGHKMKLVEVEGSHTLQNMYDS  252

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LVT N  V+DYY+V SSRF +  +T +A+LHY  S   V G +P  P  
Sbjct  253   LDIHLGQSLSVLVTANQPVQDYYVVVSSRFTRRVLTTTAVLHYSNSRKGVSGPIPWGPTT  312

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR+IRWNLTA+  RPNPQGSYHYG I   RT++L N+   I+G  RYA+N V
Sbjct  313   QIAWSVSQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIMLGNSAPWINGKQRYAVNSV  372

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             SYV P TPLKLAD+ NI GVF++ +I   P  G      SV      +YVEI+FQN E T
Sbjct  373   SYVQPDTPLKLADYFNIQGVFSVGSIPTNPTGGSGYLQTSVMHANFREYVEIVFQNWEDT  432

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QS+H+DG  F+ +G  GG W    R  YN  D   R T QVYP +WTAI ++LD+ GMW
Sbjct  433   VQSWHIDGYSFFVMGMEGGQWTPASRACYNFRDTVARSTTQVYPRAWTAIYIALDSVGMW  492

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV++  HS   E  +P + LLCG
Sbjct  493   NVRSQNWGRQYLGQQFYLRVYSPAHSWRDEYPIPRNALLCG  533



>ref|XP_002524823.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF37543.1| multicopper oxidase, putative [Ricinus communis]
Length=538

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/521 (55%), Positives = 359/521 (69%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             V+A   ++ +  EDPYRFY+W + YG I PLGVKQ+GILINGQFPGP+I  +TN+N+I+N
Sbjct  13    VVAVLLVTCINGEDPYRFYSWNISYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIIN  72

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S  
Sbjct  73    VFNSLDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLG  132

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
             +H+AAGGYG   I  RSVIP+P+P P+  +T++  DW+  +H  L+  LD G   P P G
Sbjct  133   MHKAAGGYGGFKIASRSVIPVPFPPPAGDFTVLAGDWFRMNHTDLKAILDGGSDLPFPDG  192

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             LLINGR  N  TF+  QG TY FR+SNVG+TTSINFRIQ HK+ LVEVEG+HT+Q+ YDS
Sbjct  193   LLINGRGSNGYTFSVDQGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHTLQNTYDS  252

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LVT +   +DYYIV S+RF     T ++ILHY  S   V G  P  P  
Sbjct  253   LDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVFTTTSILHYSNSAGSVSGPPPGGPTI  312

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR+IR NL+A+  RPNPQGSYHYG +   RT+ L+N+   I+G  RYA+N V
Sbjct  313   QIDWSLEQARSIRRNLSASGPRPNPQGSYHYGLVNTTRTIRLQNSASMINGKQRYAVNSV  372

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S+    TPLKLAD  NIPGVF+L +I D P  G A    SV   +   Y E++F N E T
Sbjct  373   SFTPADTPLKLADHFNIPGVFSLGSIPDNPTGGGAYLQTSVMAADFRGYAEVVFDNPEDT  432

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             LQS+H+DG +F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + LDN GMW
Sbjct  433   LQSWHIDGHNFFVVGMDGGQWSPASRLSYNLRDTISRCTVQVYPKSWTAVYMPLDNVGMW  492

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W   YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  493   NVRSENWAHQYLGQQFYLRVYSPANSWRDEYPIPSNALLCG  533



>gb|KHG11003.1| L-ascorbate oxidase [Gossypium arboreum]
Length=545

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/526 (53%), Positives = 371/526 (71%), Gaps = 2/526 (0%)
 Frame = -2

Query  1789  RFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             RF + VL     ++V++EDPYRF+NW V YG I PLGV+Q+GILINGQFPGP++  +TN+
Sbjct  11    RFAV-VLVLSVFALVQSEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTND  69

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+I+NV N LDEP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q KDQIGT+ Y
Sbjct  70    NLIINVYNNLDEPFLLSWNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYY  129

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F S   H+AAGG+G + I+ R  IP+P+P+P++ +T+++ DW+ TDHK+LQ +LD G   
Sbjct  130   FPSLAFHKAAGGFGGIRILSRPRIPVPFPDPASDFTVLIGDWFKTDHKKLQAKLDRGHKL  189

Query  1249  PSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
             P P G+LING   N   FT +QG TY FR+SNVG+  S+NFRIQ HK+KLVEVEG+HT+Q
Sbjct  190   PFPDGILINGHGPNGAFFTVEQGKTYRFRISNVGLQNSLNFRIQGHKMKLVEVEGTHTVQ  249

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
               Y+SLD+HVGQS   LVT++   +D+YIVAS+RF    ++ +A LHY  S   V G +P
Sbjct  250   TMYESLDVHVGQSYSVLVTMDQSAQDFYIVASTRFTDKILSTTATLHYSNSNKAVSGPIP  309

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I I RT+ L ++ + + G  RY
Sbjct  310   GGPTDQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINITRTIKLVSSADQVKGKQRY  369

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
             A+N VS++   TPLKLAD+  I GVF + +I D P         SV G +   +VEI+F+
Sbjct  370   AVNSVSFIPADTPLKLADYFKIGGVFRVGSISDKPTGQNMYLDTSVMGSDFRAFVEIVFE  429

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             N+E  +QS+H+DG  FW VG  GG+W    RK+YNL DA +R T QVYP SWTAI ++LD
Sbjct  430   NHESIVQSWHIDGYAFWVVGMDGGLWTPDSRKEYNLRDAVSRSTTQVYPRSWTAIYMALD  489

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N GMWN+R+  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  490   NVGMWNVRTQFWARQYLGQQFYLRVYSPVNSPRDEYPIPKNALLCG  535



>gb|ABR18324.1| unknown [Picea sitchensis]
Length=542

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/534 (54%), Positives = 375/534 (70%), Gaps = 9/534 (2%)
 Frame = -2

Query  1798  GFLRF----LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPe  1631
             GFLR     +  V+AFF  S+  AEDPY+F+ W V +GTI PLG+ Q+GILINGQFPGP 
Sbjct  2     GFLRHSVICVFLVIAFFGYSL--AEDPYKFFTWNVTWGTIWPLGIPQQGILINGQFPGPR  59

Query  1630  invitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKD  1451
             I+ +TN+N+IVNV N LD+P L +W+GI+QR++SW DGV GTNCPI P  N+TY+ Q+KD
Sbjct  60    IDSVTNDNIIVNVFNSLDQPFLISWSGIQQRRNSWQDGVFGTNCPIPPGQNFTYKFQVKD  119

Query  1450  QIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQ  1271
             QIG+Y YF S  +H+AAGG+G L+++ R +IP+P+P P+   TL++ DW+  +H  L++ 
Sbjct  120   QIGSYYYFPSMYMHKAAGGFGGLSVVSRPLIPVPFPAPNGDITLLIGDWYKANHTILRRT  179

Query  1270  LDTGKPFPSPKGLLINGR--LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVE  1097
             LD G+    P  ++INGR   +  T T  QG TY  R+SNVG+++S+NFRIQ HKLKLVE
Sbjct  180   LDMGRSLGKPDAVVINGRGPASGATITVDQGKTYRLRISNVGLSSSLNFRIQGHKLKLVE  239

Query  1096  VEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSV  917
             VEGSHT+Q+ YDSLDIHVGQ+   LVT +   +DYY+VAS+RF  P +T  A  HY  S 
Sbjct  240   VEGSHTVQNVYDSLDIHVGQTYSVLVTTDQPSQDYYMVASTRFTSPVLTGLATFHYSNSQ  299

Query  916   TKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKE  737
              KV G +P  P  +  WS+ QAR++RWNLTA+AARPNPQGSYHYG I I RT+ L N+  
Sbjct  300   KKVSGPIPGAPT-EIVWSLNQARSVRWNLTASAARPNPQGSYHYGNITITRTIKLANSAP  358

Query  736   NISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELH  557
              I+G  RYA+N VSY+   TPL+LAD+ NI GVFT   I D+P  G      +   +E  
Sbjct  359   FINGKQRYAVNGVSYLPSATPLQLADYYNISGVFTAGGIPDSPRGGSGYLQTAALSVEYR  418

Query  556   DYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSW  377
              ++E++FQN E T+QS+HLDG  F+ VG  GG W    RK YNL DA +R T QVYPNSW
Sbjct  419   AFIEVVFQNYESTIQSWHLDGYSFFVVGMDGGDWTPANRKGYNLFDAVSRCTTQVYPNSW  478

Query  376   TAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             TA+L++ DN G+WNLRS  W R +LGQQ Y+RV +   SL  E D+P + LLCG
Sbjct  479   TAVLLTFDNAGLWNLRSQTWERQFLGQQTYVRVKSPVKSLRDEYDIPHNALLCG  532



>gb|KDP22727.1| hypothetical protein JCGZ_01829 [Jatropha curcas]
Length=541

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/525 (55%), Positives = 362/525 (69%), Gaps = 4/525 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F++ +L   C+S    EDPYRFY+W V YG I PLGVKQ+GILINGQFPGP+I  +TNEN
Sbjct  10    FMVILLLLTCVS---GEDPYRFYSWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNEN  66

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+N+ N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF
Sbjct  67    LIINIFNSLDEPFLLSWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYMLQVKDQIGSYFYF  126

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S  +H+AAGG G   I  RSVIP+P+P P+  +T++  DW+  +H  L+  LD G   P
Sbjct  127   PSLGMHKAAGGIGGFKIASRSVIPVPFPPPAGDFTVLAGDWFKKNHTDLKAILDGGSDLP  186

Query  1246  SPKGLLINGRL-NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
              P GLLINGR  N  TFT  QG TY FR+SNVG+TTSINFRIQ HK+ LVEVEG+HT+Q+
Sbjct  187   FPDGLLINGRASNGYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHTLQN  246

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              YDSLDIH+GQS   LVT +   +DYYIV S+RF    +TA++ LHY  S   V G  P 
Sbjct  247   TYDSLDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVLTATSTLHYSNSAGSVSGPPPG  306

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   RT+ L+N+   I+G  RYA
Sbjct  307   GPTTQVDWSLEQARSIRKNLTASGPRPNPQGSYHYGLINTTRTIRLQNSAPIINGKQRYA  366

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VS++   TPLKLAD  NIPGVF+L +I D P  G A    SV   +   Y EIIF+N
Sbjct  367   VNSVSFIPADTPLKLADHFNIPGVFSLGSIPDNPTGGGAYLQTSVMAADFRGYAEIIFEN  426

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
              E T+QS+H+DG   + VG  GG W    R  YNL D  +R TVQVYP SWTA+ + LDN
Sbjct  427   TEDTVQSWHVDGHILFVVGMDGGQWSPASRLSYNLRDTISRNTVQVYPKSWTAVYMPLDN  486

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWN+RS  W   YLGQQ YLRV++  +S   E  +P +T+LCG
Sbjct  487   VGMWNIRSENWAHQYLGQQFYLRVYSPANSWRDEYPIPTNTILCG  531



>ref|XP_002282214.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI37764.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/524 (53%), Positives = 364/524 (69%), Gaps = 1/524 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             LL    F  ++MV AEDPYRF+ W V YG I PLGV+Q+GILINGQFPGP+I  +TN+N+
Sbjct  9     LLLCATFSVLAMVGAEDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNL  68

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF 
Sbjct  69    IINVHNSLPEPFLISWNGVQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFP  128

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+  +H  L+  LD G+  P 
Sbjct  129   SLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTILIGDWYTHNHNTLKAILDRGRRLPF  188

Query  1243  PKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             P G+LINGR  N+ +FT ++G TY  R+SNVG+  S+NFRIQ HK+ LVEVEG+HT+Q  
Sbjct  189   PDGILINGRGANAASFTVERGKTYRLRISNVGLQNSLNFRIQGHKMTLVEVEGTHTLQTS  248

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y SLD+HVGQS   LVT +   KDYYI  SSRF +  +T+SA+LHY  SV+ V G LP  
Sbjct  249   YSSLDVHVGQSYSVLVTADQAAKDYYIAVSSRFTEKVLTSSAVLHYSNSVSPVSGPLPGG  308

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  +S+ QAR+IR NLTA+  RPNPQGSYHYG I I RT+ L NT   ++G  RYA+
Sbjct  309   PTTQIDYSLNQARSIRTNLTASGPRPNPQGSYHYGLINITRTIKLGNTAGQVNGKQRYAV  368

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS++   TPLKLAD+  I GVF + +I D P         SV G +   +VEI+F+N 
Sbjct  369   NSVSFIPADTPLKLADYFKIGGVFRIGSIPDQPSGKKMYLDTSVMGADFRAFVEIVFENR  428

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QS+HLDG  FW VG  GGVW    R +YNL DA +R T QVYP SWTA+ ++LDN 
Sbjct  429   ESIIQSWHLDGYSFWVVGMNGGVWTPASRNQYNLRDAVSRCTTQVYPKSWTAVYIALDNV  488

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLR+  W R YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  489   GMWNLRTEFWARQYLGQQFYLRVYSPVGSIRDEYPIPKNALLCG  532



>ref|XP_010046372.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW88773.1| hypothetical protein EUGRSUZ_A01118 [Eucalyptus grandis]
Length=542

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/510 (55%), Positives = 358/510 (70%), Gaps = 1/510 (0%)
 Frame = -2

Query  1741  AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPILF  1562
              EDPY FYNW V YG I PLGVKQ+GILINGQFPGP+I  +TN+N+I+NV N LDEP L 
Sbjct  26    GEDPYSFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNALDEPFLL  85

Query  1561  TWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGAL  1382
             +WNG++Q+++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S   H+AAGG+G  
Sbjct  86    SWNGVQQKRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGFGGF  145

Query  1381  NIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-LNSV  1205
              I+ RSVIP+P+P P+  +T++  DW+  +H  L+  LD G   P P GLLINGR  N  
Sbjct  146   KILSRSVIPVPFPPPANDFTILAGDWFTKNHSDLRAILDGGSDLPFPDGLLINGRGSNGY  205

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
             TFT  QG T+ FR+SNVG+TT+INFRIQ HK+ LVEVEG+HT+Q+ YDSLDIH+GQS   
Sbjct  206   TFTVDQGKTHRFRISNVGITTAINFRIQGHKMVLVEVEGTHTLQNTYDSLDIHLGQSCSV  265

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             LVT +   +DYYIV S+RF    +T ++ILHY  S   V G  P  P  Q  WS+ QAR+
Sbjct  266   LVTCDQPAQDYYIVVSTRFTSEVLTTTSILHYSNSAGSVSGPPPGGPTMQIDWSLEQARS  325

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKL  665
             +R NLTA+  RPNPQGSYHYG I   +T+ L N+   I+G  RYA+N VS+V   TPLKL
Sbjct  326   MRRNLTASGPRPNPQGSYHYGMINTTQTIRLANSASVINGKQRYAVNSVSFVPADTPLKL  385

Query  664   ADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQDF  485
             AD+ NIPGVFTL +I ++P  G A    SV   +   Y EI+F+N+E T+QS+H+DG +F
Sbjct  386   ADYFNIPGVFTLGSIPNSPTGGAAYLQTSVMAADFRGYAEIVFENSEDTVQSWHIDGHNF  445

Query  484   WAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRNY  305
             + VG  GG W    R  YNL D  +R TVQVYPNSWTA+ + LDN GMWN+RS  W R Y
Sbjct  446   FVVGMDGGQWTPASRLSYNLRDTISRCTVQVYPNSWTAVYMPLDNVGMWNVRSENWARQY  505

Query  304   LGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LGQQ Y RV+++  S   E  +P + LLCG
Sbjct  506   LGQQFYFRVYSSAKSWRDEYPIPSNALLCG  535



>gb|KHN05478.1| L-ascorbate oxidase like [Glycine soja]
Length=544

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/535 (52%), Positives = 367/535 (69%), Gaps = 0/535 (0%)
 Frame = -2

Query  1819  KMRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFP  1640
             K+   PS        +L     + V AEDPYRF++W + YG I PLGVKQ+GILINGQFP
Sbjct  2     KLINKPSQLRALFCSILLLLEFAFVAAEDPYRFFDWTITYGDIYPLGVKQQGILINGQFP  61

Query  1639  GPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQ  1460
             GPEI  +TN+N+I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q
Sbjct  62    GPEIYSVTNDNLIINVHNNLTEPFLLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQ  121

Query  1459  MKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQL  1280
             +KDQIG++ YF S   H+AAGG+GA+ I+ R  IP+P+P+P+  ++L++ DW+  +HK+L
Sbjct  122   VKDQIGSFFYFPSLAFHKAAGGFGAIKILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKL  181

Query  1279  QKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLV  1100
             Q  LD G   P P+ +LINGR +  TFT  QG TY  R+SNVG+  ++NFRIQ H +KLV
Sbjct  182   QSVLDFGHKLPFPQAVLINGRPSGTTFTAIQGKTYRLRISNVGLQNTLNFRIQGHDMKLV  241

Query  1099  EVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS  920
             EVEG+HT+Q  Y SLD+HVGQS   L+T +   KDYYIV S+RF    +T++AILHY  S
Sbjct  242   EVEGTHTIQTTYSSLDVHVGQSYSVLITADQAPKDYYIVVSTRFTNKILTSTAILHYSNS  301

Query  919   VTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTK  740
             +  V G +   P  Q  WS++QAR+IR NLTA+  RPNPQGSYHYG I I RT+ L ++ 
Sbjct  302   LQSVSGPILGGPTTQIDWSIKQARSIRTNLTASGPRPNPQGSYHYGLINISRTITLVSSA  361

Query  739   ENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLEL  560
               ++G  RYA+N VS+    TPLKLAD+ NI  VF + +I D+P   P     SV G + 
Sbjct  362   AQVNGKQRYAVNSVSFRPADTPLKLADYFNIGRVFQVGSIPDSPSGRPMYLDTSVMGADF  421

Query  559   HDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNS  380
               +VEI+FQN+E  +QS+H+DG  FW VG  GGVW    R +YNL DA +R T QVYP S
Sbjct  422   RAFVEIVFQNHENIIQSWHIDGYSFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKS  481

Query  379   WTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WTAI ++LDN GMWN+RS  W R YLGQQ YLRV++   S+  E  +P + +LCG
Sbjct  482   WTAIYMALDNVGMWNVRSEFWARQYLGQQFYLRVYSPVGSIRDEYPIPKNAILCG  536



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/519 (54%), Positives = 358/519 (69%), Gaps = 0/519 (0%)
 Frame = -2

Query  1771  LAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnv  1592
             L F   ++V AEDPYRF+NW V YG I PLGV+QRGILINGQFPGP+I+ +TN+N+I+NV
Sbjct  14    LFFALFAIVGAEDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINV  73

Query  1591  iNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQL  1412
              N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   
Sbjct  74    FNSLDEPFLLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAF  133

Query  1411  HRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGL  1232
             H+AAGG+G + I+ R  IP+P+ +P   YT+++ DW+  +H +L+  LD GK  P P G+
Sbjct  134   HKAAGGFGGIRILSRPRIPVPFADPDGDYTVLIGDWYKANHTELKAHLDNGKKLPFPDGI  193

Query  1231  LINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLD  1052
             LINGR +    T +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q  Y SLD
Sbjct  194   LINGRGSGYALTVEQGKTYRLRISNVGLEHSLNFRIQNHKMKLVEVEGTHTLQTTYSSLD  253

Query  1051  IHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQY  872
             +HVGQS   L+T +   +DYYIV SSRF    +T + +LHY  S   V G  P  P  Q 
Sbjct  254   VHVGQSYSVLITADQPGQDYYIVVSSRFTSQILTTTGVLHYSNSAGPVSGSPPGGPTIQV  313

Query  871   HWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSY  692
              WS+ QAR+IR NLTA+  RPNPQGSYHYG I   RT++  ++   ++G  RYA+N VSY
Sbjct  314   DWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTSRTIIFASSAGQVNGKQRYAVNSVSY  373

Query  691   VNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQ  512
             + P TPLKLAD+  I GVF  N+I D P  G      SV  ++   +VEI+FQN+E  +Q
Sbjct  374   IQPDTPLKLADFFKIQGVFKENSISDRPYGGGIYLDTSVLTVDYRAFVEIVFQNDEDIVQ  433

Query  511   SYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNL  332
             S+HLDG  F+ VG  GG W +  R +YNL DA  R T QVYP SWTAI V LDN GMWNL
Sbjct  434   SWHLDGYSFFVVGMDGGQWTTASRNQYNLRDAIARCTTQVYPKSWTAIYVPLDNVGMWNL  493

Query  331   RSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             R+  W R YLGQQ+YLRV+    SL  E  +P + LLCG
Sbjct  494   RTEFWARQYLGQQLYLRVYTTSTSLRDEFPIPKNALLCG  532



>gb|AAL24296.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91125.1| unknown protein [Arabidopsis thaliana]
Length=542

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/524 (52%), Positives = 366/524 (70%), Gaps = 3/524 (1%)
 Frame = -2

Query  1777  GVLAFFCISM---VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             G +  FC+S    V AE PYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N
Sbjct  9     GTILLFCLSFFAAVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDN  68

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNG++ R++S+ DG+ GT CPI P +N+TY +Q+KDQIG++ YF
Sbjct  69    LIINVHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYF  128

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+  +H  L+ +LD G+  P
Sbjct  129   PSLAFHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLP  188

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             SP G+LINGR N  T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HT+Q  
Sbjct  189   SPDGILINGRSNGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTM  248

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             + SLD+HVGQS   L+T +   +DYY+V SSRF    +T + +L Y GS T   G +P  
Sbjct  249   FSSLDVHVGQSYSVLITADQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGG  308

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +
Sbjct  309   PTIQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGV  368

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N 
Sbjct  369   NSVSFVPADTPLKLADFFKISGVYKINSISDKPTYGGLYLDTSVLQVDYRTFIEIVFENQ  428

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QSYHL+G  FW VG  GG W++  R  YNL DA +R TVQVYP SWTAI ++LDN 
Sbjct  429   EDIVQSYHLNGYSFWVVGMDGGQWETGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNV  488

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS  W R YLGQQ+YLRV+ +  SL  E  +P ++ LCG
Sbjct  489   GMWNLRSEFWARQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCG  532



>ref|XP_004166771.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/527 (55%), Positives = 368/527 (70%), Gaps = 4/527 (1%)
 Frame = -2

Query  1792  LRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             L FL  VL+F CI+    EDPYRF NW + YG I PLGVKQ+GILINGQFPGP+I  +TN
Sbjct  10    LTFLFLVLSFSCIN---GEDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTN  66

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
             EN+I+NV N LDEP L +WNGI+QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y 
Sbjct  67    ENLIINVFNSLDEPFLISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYF  126

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF S  LH+AAGG+G   I  RS+IP+P+P P+  +T++  DW++ +H  L+  LD G  
Sbjct  127   YFPSLALHKAAGGFGGFKIQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLRAILDGGSD  186

Query  1252  FPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
              PSP GLLINGR LN  TFT +QG TY FR+SNVG+TT+INFRIQ HK+ LVEVEG+HT+
Sbjct  187   LPSPDGLLINGRGLNGNTFTVEQGKTYRFRISNVGLTTAINFRIQGHKMLLVEVEGTHTL  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+S+DIH+GQS   LVT +   +DYYIV S+RF    +T +++LHY  S   V G  
Sbjct  247   QNTYESIDIHLGQSYSVLVTADQPPQDYYIVVSTRFTSQILTTTSLLHYSNSAASVSGPP  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q  WS+ QAR++R NLTAN  RPNPQGSYHYG I + RT+ L +T   I+G  R
Sbjct  307   PGGPTFQIDWSLEQARSLRRNLTANGPRPNPQGSYHYGLINVTRTIRLHSTAPIINGKQR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N VS++   TPLKLAD+  I GVF+L +I D P  G A    SV   +   Y E++F
Sbjct  367   YAVNSVSFIPADTPLKLADYFKISGVFSLGSIPDYPTGGDAYLQTSVMNADFRGYAEVVF  426

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             +N E  +QS+H+DG +F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + L
Sbjct  427   ENPEDVVQSWHVDGHNFFVVGMDGGQWIPASRLTYNLRDTISRCTVQVYPKSWTAVYMPL  486

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWN+RS  W R YLGQQ+YLRV++  +S   E  +P + L CG
Sbjct  487   DNVGMWNIRSENWARQYLGQQLYLRVYSPVNSWRDEYPIPSNALKCG  533



>ref|XP_009596487.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/530 (54%), Positives = 366/530 (69%), Gaps = 1/530 (0%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinv  1622
             S +L  +  VL F   +++  EDPYRFY W V YG I PLG+KQ+GILINGQFPGP I  
Sbjct  6     SSWLPLMAVVLMFVHTNLISGEDPYRFYTWNVTYGDIYPLGLKQQGILINGQFPGPPIEC  65

Query  1621  itnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIG  1442
             +TN+N+I+NV N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG
Sbjct  66    VTNDNLIINVFNNLDEPFLISWNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIG  125

Query  1441  TYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDT  1262
             ++ YF S   H+AAGG+G++NI  RSVIP+P+P P+  ++++  DW+  +H  L+  LD+
Sbjct  126   SFYYFPSLAFHKAAGGFGSINIASRSVIPVPFPPPAGEFSILSGDWFKQNHNDLKAILDS  185

Query  1261  GKPFPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGS  1085
             G   P P GLLI+GR  N  TFT  QG TY FR+SNVG+TTSINFRIQ HK+ +VEVEG+
Sbjct  186   GHDLPFPDGLLISGRGSNGYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKMMVVEVEGT  245

Query  1084  HTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVP  905
             HT+Q+ YDSLDIH+GQS   L+T +   KDYYIV S+RF    +TA++ L Y  S   V 
Sbjct  246   HTVQNTYDSLDIHLGQSYSVLLTTDQPAKDYYIVVSTRFTSQVLTATSTLRYSNSAGSVS  305

Query  904   GKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISG  725
             G  P  P  +  WS+ QAR++R NL+A+  RPNPQGSYHYG I    T+ L N+   I+G
Sbjct  306   GPPPGGPTTEVDWSLNQARSLRRNLSASGPRPNPQGSYHYGLINTTHTIRLANSAPIING  365

Query  724   ITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
               RYA+N VS+V   TPLKLAD  NIPGVFTL +I D+P  G A    SV   +   Y E
Sbjct  366   KQRYAINSVSFVPADTPLKLADHFNIPGVFTLGSIPDSPTGGGAYLQTSVMAADFRAYTE  425

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             +IF+N E T+QSYH+DG  F+ VG GGG W    R  YNL D  +R TVQ+YP SWTA+ 
Sbjct  426   VIFENLEDTVQSYHIDGHHFFVVGMGGGEWTPASRLTYNLRDTISRSTVQLYPKSWTALY  485

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             + LDN GMWN+RS  W R YLGQQ YLRV++  +S   E  +P D LLCG
Sbjct  486   MPLDNVGMWNIRSQNWARQYLGQQFYLRVYSPANSWRDEYPIPSDALLCG  535



>ref|XP_008371076.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
 ref|XP_008365611.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/525 (55%), Positives = 367/525 (70%), Gaps = 4/525 (1%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             + GVL  F ++ V  EDPYRF+ W V YG I PLGVKQRGILINGQFPGP+I+ +TN+N+
Sbjct  11    IFGVL--FLVNGVIGEDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDAVTNDNL  68

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             +++V N L EP L +W+GI+QR++SW DG  GTNCPI P  N+TY +Q+KDQIG++ YF 
Sbjct  69    VISVFNYLREPFLISWDGIQQRRNSWQDGNFGTNCPIPPGRNFTYNIQVKDQIGSFFYFP  128

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQ-LDTGKPFP  1247
             S + H+AAGG+G + I  R  IP+P+P P+  +T++  DW+ T+H  L++  LD G+  P
Sbjct  129   SLKFHKAAGGFGGIRIWSRPKIPVPFPNPAGDFTVLAGDWFKTNHYILRRGYLDRGRALP  188

Query  1246  SPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
             +P G+LINGR  N  TFT  QG TY FR+SNVG+T SINFRIQ HK+KLVEVEGSHT+Q+
Sbjct  189   NPDGILINGRGWNGYTFTVDQGKTYRFRISNVGLTASINFRIQGHKMKLVEVEGSHTLQN  248

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              YDSLDIH+GQS   LVT N  V+DYY+V SSRF +  +T +A+LHY  S   V G +P 
Sbjct  249   MYDSLDIHLGQSLSVLVTANQPVQDYYVVVSSRFTRRVLTTTAVLHYSNSRKGVSGPIPW  308

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  Q  WS+ QAR+IRWNLTA+  RPNPQGSYHYG I   RT++L N+   I+G  RYA
Sbjct  309   GPTTQIAWSVSQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIMLGNSAPWINGKQRYA  368

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VSYV P TPLKLAD  NI GVF++ +I   P  G      SV      +YVEI+FQN
Sbjct  369   VNSVSYVQPDTPLKLADHFNIQGVFSVGSIPTNPTGGSGYLQTSVMHANFREYVEIVFQN  428

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
              E T+QS+H+DG  F+ +G  GG W    R +YN  D   R T QVYP +WTAI ++LDN
Sbjct  429   WEDTVQSWHIDGHSFFVMGMEGGQWTPASRARYNFRDTVARSTTQVYPRAWTAIYIALDN  488

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWN+RS  W R YLGQQ YLRV++  HS   E  +P + LLCG
Sbjct  489   VGMWNVRSQNWERQYLGQQFYLRVYSPAHSWRDEYPIPRNALLCG  533



>ref|NP_564479.1| SKU5 similar 6 [Arabidopsis thaliana]
 gb|AEE31910.1| SKU5 similar 6 [Arabidopsis thaliana]
Length=542

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/524 (52%), Positives = 365/524 (70%), Gaps = 3/524 (1%)
 Frame = -2

Query  1777  GVLAFFCISM---VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             G +  FC+S    V AE PYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N
Sbjct  9     GTILLFCLSFFAAVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDN  68

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNG++ R++S+ DG+ GT CPI P +N+TY +Q+KDQIG++ YF
Sbjct  69    LIINVHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYF  128

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+  +H  L+ +LD G+  P
Sbjct  129   PSLAFHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLP  188

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             SP G+LINGR N  T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HT+Q  
Sbjct  189   SPDGILINGRSNGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTM  248

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             + SLD+HVGQS   L+T +   +DYY+V SSRF    +T + +L Y GS T   G +P  
Sbjct  249   FSSLDVHVGQSYSVLITADQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGG  308

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +
Sbjct  309   PTIQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGV  368

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N 
Sbjct  369   NSVSFVPADTPLKLADFFKISGVYKINSISDKPTYGGLYLDTSVLQVDYRTFIEIVFENQ  428

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QSYHL+G  FW VG  GG W +  R  YNL DA +R TVQVYP SWTAI ++LDN 
Sbjct  429   EDIVQSYHLNGYSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNV  488

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS  W R YLGQQ+YLRV+ +  SL  E  +P ++ LCG
Sbjct  489   GMWNLRSEFWARQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCG  532



>ref|NP_001058771.1| Os07g0119400 [Oryza sativa Japonica Group]
 dbj|BAC79733.1| putative pollen-specific protein NTP303 precursor [Oryza sativa 
Japonica Group]
 dbj|BAF20685.1| Os07g0119400 [Oryza sativa Japonica Group]
 gb|EAZ02590.1| hypothetical protein OsI_24700 [Oryza sativa Indica Group]
 gb|EAZ38518.1| hypothetical protein OsJ_22905 [Oryza sativa Japonica Group]
Length=545

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/519 (58%), Positives = 372/519 (72%), Gaps = 7/519 (1%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLG-VKQRGILINGQFPGPeinvitnenvivnviNKLD  1577
             ++  A+DPYRF+ W V YG+I+PLG   Q+GILINGQFPGP I+ +TN+N+IVNV N LD
Sbjct  21    TLAGADDPYRFFTWNVTYGSINPLGSTPQQGILINGQFPGPRIDCVTNDNIIVNVFNNLD  80

Query  1576  EPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAG  1397
             EP L TWNGIKQRK+SW DGVLGTNCPI P  N+TY+ Q KDQIGT+ YF S  +HRAAG
Sbjct  81    EPFLLTWNGIKQRKNSWQDGVLGTNCPIPPGANYTYKFQAKDQIGTFVYFPSVAMHRAAG  140

Query  1396  GYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK--PFPSPKGLLIN  1223
             G+GALN+ +R  IP+PYP P+  +TL+V DW+   HKQL++ LD G     P P  LLIN
Sbjct  141   GFGALNVYQRPAIPVPYPPPAGDFTLLVGDWYKAGHKQLRQALDAGGGGALPPPDALLIN  200

Query  1222  GRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHV  1043
             G  ++  F G QG TY+FRVSNVG+ TS+N RIQ H L+LVEVEG+H +Q+ YDSLD+HV
Sbjct  201   GMPSAAAFVGDQGRTYLFRVSNVGVKTSVNVRIQGHSLRLVEVEGTHPVQNVYDSLDVHV  260

Query  1042  GQSAGFLVTLNADVKDYYIVASSRF---VKPYMTASAILHYDGSVTKVPGKLPDPPAGQY  872
             GQS  FLVTL+   +DY +VAS+RF     P M A+  LHY  +V++ PG LP PP  Q 
Sbjct  261   GQSVAFLVTLDKAAQDYAVVASARFSPGASPLM-ATGTLHYSSAVSRAPGPLPAPPPEQA  319

Query  871   HWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSY  692
              WSM QAR+ RWNLTA+AARPNPQGS+HYGTI   RTLVL N+   ++G  RYA+N VS+
Sbjct  320   EWSMNQARSFRWNLTASAARPNPQGSFHYGTIATSRTLVLANSAPVLAGQRRYAVNGVSF  379

Query  691   VNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQ  512
             V P TPLKL D  NI  V   +++   P       G  V  L LH+++E++FQN E  LQ
Sbjct  380   VVPDTPLKLVDNYNIANVIGWDSVPARPDGAAPRSGTPVVRLNLHEFIEVVFQNTENELQ  439

Query  511   SYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNL  332
             S+HLDG DFW VGYG G W    R  YNLVDA  R+TVQVYPN W+AILVSLDN+GMWNL
Sbjct  440   SWHLDGYDFWVVGYGNGQWTENQRTTYNLVDAQARHTVQVYPNGWSAILVSLDNQGMWNL  499

Query  331   RSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             RS+ W R YLGQQ+Y+RVW  + S   E  +P + +LCG
Sbjct  500   RSANWDRQYLGQQLYMRVWTPQQSFSNEYSIPTNAILCG  538



>gb|AAF99833.1|AC008046_5 Putative pectinesterase [Arabidopsis thaliana]
Length=541

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/524 (52%), Positives = 365/524 (70%), Gaps = 3/524 (1%)
 Frame = -2

Query  1777  GVLAFFCISM---VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             G +  FC+S    V AE PYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N
Sbjct  8     GTILLFCLSFFAAVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDN  67

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNG++ R++S+ DG+ GT CPI P +N+TY +Q+KDQIG++ YF
Sbjct  68    LIINVHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYF  127

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+  +H  L+ +LD G+  P
Sbjct  128   PSLAFHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLP  187

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             SP G+LINGR N  T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HT+Q  
Sbjct  188   SPDGILINGRSNGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTM  247

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             + SLD+HVGQS   L+T +   +DYY+V SSRF    +T + +L Y GS T   G +P  
Sbjct  248   FSSLDVHVGQSYSVLITADQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGG  307

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +
Sbjct  308   PTIQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGV  367

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N 
Sbjct  368   NSVSFVPADTPLKLADFFKISGVYKINSISDKPTYGGLYLDTSVLQVDYRTFIEIVFENQ  427

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QSYHL+G  FW VG  GG W +  R  YNL DA +R TVQVYP SWTAI ++LDN 
Sbjct  428   EDIVQSYHLNGYSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNV  487

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS  W R YLGQQ+YLRV+ +  SL  E  +P ++ LCG
Sbjct  488   GMWNLRSEFWARQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCG  531



>ref|XP_002528421.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF33963.1| multicopper oxidase, putative [Ricinus communis]
Length=544

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/540 (53%), Positives = 370/540 (69%), Gaps = 10/540 (2%)
 Frame = -2

Query  1831  HPVKKMRQPPSGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILIN  1652
             + +K + +P +    FLL         +V AEDPYRF++W V YG I PLGVKQ+GILIN
Sbjct  4     YKIKLLARPANAAKNFLL---------IVNAEDPYRFFDWNVTYGDIYPLGVKQQGILIN  54

Query  1651  GQFPGPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWT  1472
             GQFPGP+I  +TN N+I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N+T
Sbjct  55    GQFPGPDIYSVTNNNLIINVHNSLPEPFLISWNGVQQRRNSYQDGVYGTTCPIPPGKNFT  114

Query  1471  YRMQMKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTD  1292
             Y +Q+KDQIG++ YF S   H+AAGG+G + I+ R +IP+P+P+P+  +T+++ DW+ T+
Sbjct  115   YTLQVKDQIGSFFYFPSLAFHKAAGGFGGIRILSRPLIPVPFPDPAGDFTVLIGDWYKTN  174

Query  1291  HKQLQKQLDTGKPFPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNH  1115
             H +L+  LD G   P P G+LINGR  N+ TFT + G TY  R+SNVG+  S+NFRIQ H
Sbjct  175   HTKLKAILDYGHRLPFPDGILINGRGPNATTFTFEPGKTYRLRISNVGLQNSLNFRIQGH  234

Query  1114  KLKLVEVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAIL  935
             K+KLVEVEG+HT+Q  Y SLD+HVGQS   LVT +   +DYYI  S+RF    +T +AIL
Sbjct  235   KMKLVEVEGTHTVQTTYSSLDVHVGQSYSVLVTADQAAQDYYIAVSTRFTNKVLTTTAIL  294

Query  934   HYDGSVTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLV  755
             HY  S  KV G +P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I I RT+ 
Sbjct  295   HYSNSAKKVSGPIPGGPTTQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIK  354

Query  754   LENTKENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSV  575
             LE++   ++G  RYA+N VS+    TPLKLAD+  I GVF + +I D+P         SV
Sbjct  355   LESSAAQVNGKQRYAVNSVSFRPADTPLKLADYFKIGGVFRVGSISDSPTGKKMYLDTSV  414

Query  574   FGLELHDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQ  395
              G +   +VEI+FQN+E  +QS+HLDG  FW VG  GGVW    R +YNL DA +R T Q
Sbjct  415   MGADFRAFVEIVFQNHENIVQSWHLDGYSFWVVGMDGGVWTPASRDQYNLRDAVSRCTTQ  474

Query  394   VYPNSWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             VYP SWTAI V+LDN GMWNLR+  W R YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  475   VYPKSWTAIYVALDNVGMWNLRTEFWARQYLGQQFYLRVYSPVMSIRDEYPIPKNALLCG  534



>ref|XP_003537754.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/527 (52%), Positives = 364/527 (69%), Gaps = 0/527 (0%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L     +L    ++ V AEDPYRF++W + YG I PLGVKQ+ ILINGQFPGPEI  +T
Sbjct  13    LLSLFCSILLLLELAFVAAEDPYRFFDWTITYGDIYPLGVKQQVILINGQFPGPEIYSVT  72

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++
Sbjct  73    NDNLIINVHNNLTEPFLLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSF  132

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
              YF S   H+AAGG+GA+ I+ R  IP+P+P+P+  ++L++ DW+  +HK+LQ  LD G 
Sbjct  133   FYFPSLAFHKAAGGFGAIKILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKLQSVLDFGH  192

Query  1255  PFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
               P P+ +LINGR +  TFT +QG TY  R+SNVG+  ++NFRIQ H +KLVEVEG+HT+
Sbjct  193   RLPFPQAVLINGRPSGTTFTVEQGKTYRLRISNVGLQNTLNFRIQGHDMKLVEVEGTHTI  252

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q  Y SLD+HVGQS   L+T++   KDYYIV S+RF     T++AILHY  S   V G +
Sbjct  253   QTTYSSLDVHVGQSYSVLITVDQAPKDYYIVVSTRFTNKIFTSTAILHYSNSQQSVSGPI  312

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q  WS++QAR+IR NLTA+  RPNPQGSYHYG I I RT+ L ++   ++   R
Sbjct  313   PSGPTTQIDWSIKQARSIRTNLTASGPRPNPQGSYHYGLINISRTITLVSSTAQVNKKQR  372

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N VS+    TPLKLAD+ NI G+F + +I D+P   P     SV G +   +VE++F
Sbjct  373   YAVNSVSFTPADTPLKLADYFNIGGIFQVGSIPDSPSGRPMYLDTSVMGADFRAFVEVVF  432

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QN+E  +QS+H+DG  FW VG  GGVW    R +YNL DA +R T QVYP SWTAI ++L
Sbjct  433   QNHENIIQSWHIDGYSFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKSWTAIYMAL  492

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWN+RS  W R YLGQQ YLRV+    S+  E  +P + LLCG
Sbjct  493   DNVGMWNMRSEFWARQYLGQQFYLRVYLPVGSIRDEYPIPKNALLCG  539



>ref|XP_009794442.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=541

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/521 (54%), Positives = 363/521 (70%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +L F   +++  EDPYRFY W + YG + PLGVKQ+GILINGQFPGP I  +TN+N+I+N
Sbjct  12    LLMFLHGNLICGEDPYRFYTWNITYGDVYPLGVKQQGILINGQFPGPTIECVTNDNLIIN  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG++ YF S  
Sbjct  72    VFNNLDEPFLISWNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLA  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G++NI   SVIP+P+P P+  ++++  DW+  +H  L+  LD+G   P P G
Sbjct  132   FHKAAGGFGSINIASSSVIPVPFPPPAGEFSILTGDWFKQNHNDLKAILDSGHDLPFPDG  191

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             LLING   N  TFT  QG TY FR+SNVG+TTSINFRIQ HK+ +VEVEG+HT+Q+ YDS
Sbjct  192   LLINGHGSNGYTFTIDQGKTYRFRISNVGLTTSINFRIQGHKMMVVEVEGTHTVQNTYDS  251

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   L+T +   KDYYIV S+RF    +TA++ LHY  S   V G  P  P  
Sbjct  252   LDIHLGQSFSVLLTADQPAKDYYIVVSTRFTSQVLTATSTLHYGNSAGSVSGLPPSGPTT  311

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             +  WS+ QAR++R NL+A+  RPNPQGSYHYG I   RT+ L N+   I+G  RYA+N V
Sbjct  312   EIDWSLNQARSLRRNLSASGPRPNPQGSYHYGLINTTRTIRLANSAPIINGKQRYAINSV  371

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S+V   TPLKLAD  NIPGVF+L +I D+P  G A    SV   E   Y+E+IF+N E +
Sbjct  372   SFVPADTPLKLADHFNIPGVFSLGSIPDSPTGGGAYLQTSVMAAEFRAYIEVIFENLEDS  431

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QSYH+DG  F+ VG GGG W    R  YNL D  +R TVQVYP SWTA+ + LDN GMW
Sbjct  432   VQSYHIDGHHFFVVGMGGGEWTPASRLTYNLRDTISRSTVQVYPKSWTALYMPLDNVGMW  491

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             ++RS  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  492   DIRSQNWVRQYLGQQFYLRVYSPANSWRDEYPIPSNALLCG  532



>ref|XP_009400332.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/530 (53%), Positives = 357/530 (67%), Gaps = 1/530 (0%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinv  1622
             SG    +L     F   +V AEDPYRF++W V +G I PLG++Q+GILINGQFPGP+I+ 
Sbjct  3     SGKATVVLLCGCCFLAMLVGAEDPYRFFDWNVTFGDIYPLGIRQQGILINGQFPGPDIHS  62

Query  1621  itnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIG  1442
              TN+N+IVNV N L EP L +WNG++QR +SW DGV GTNCPI P  N+TY M +KDQIG
Sbjct  63    QTNDNIIVNVYNSLTEPFLISWNGVQQRGNSWQDGVSGTNCPIPPGKNFTYVMHLKDQIG  122

Query  1441  TYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDT  1262
             ++ YF S   H+AAGG+G + I+ R  IP+P+  P+  +TL++ DW+   H  L+ +LD 
Sbjct  123   SFFYFPSLAFHKAAGGFGGIRILSRPRIPVPFATPADDFTLLIGDWYKAGHSVLKARLDR  182

Query  1261  GKPFPSPKGLLINGRL-NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGS  1085
             GK  P P  +LINGR  N  TF   QG TY  R+SNVG+  S+N R+Q H +KLVEVEG+
Sbjct  183   GKRLPFPDAILINGRSSNGATFAVDQGKTYRLRISNVGLQNSLNIRVQAHTMKLVEVEGT  242

Query  1084  HTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVP  905
             HT+Q+ Y SLD+HVGQS   LVT +  V+DYYI  S+RF  P +TA+A LHY  S  K  
Sbjct  243   HTLQNDYSSLDVHVGQSLSVLVTADQPVRDYYIAVSTRFTNPVLTATATLHYRNSKQKAS  302

Query  904   GKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISG  725
             G +P  P GQ  WS+ QARTIR NLTA+  RPNPQGSYHYG+I + R + L N+   ++G
Sbjct  303   GSIPAGPTGQIDWSLEQARTIRTNLTASGPRPNPQGSYHYGSINVTRAVRLANSAAQVNG  362

Query  724   ITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
               RYA+N VS+V   TPLKLAD   I GVF L +I D PP        SV   + H + E
Sbjct  363   KQRYAVNSVSFVEADTPLKLADHFKIGGVFRLGSIADYPPGAKEHLDTSVMAADFHAFAE  422

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             I+F+N E  +QS+HLDG +FW VG  GG W    R+ YN +DA +R T QVYP SWTA+ 
Sbjct  423   IVFENKESIVQSWHLDGYNFWVVGMDGGKWSPDRRRDYNRIDAVSRCTTQVYPKSWTAVY  482

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             V+LDN GMWNLRS  W R YLGQQ YLRV++   S+  E+ +P + LLCG
Sbjct  483   VALDNVGMWNLRSEFWGRRYLGQQFYLRVYSPVESVRDEHPIPNNALLCG  532



>ref|XP_011096053.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=541

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/525 (54%), Positives = 361/525 (69%), Gaps = 2/525 (0%)
 Frame = -2

Query  1783  LLGVLAFFCI-SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             L+ VL+   +   V  ++PYRFY W V YG I PLGVKQ+GILINGQFPGP I+ +TN+N
Sbjct  7     LITVLSLLLVLHAVNGDNPYRFYTWKVTYGDIYPLGVKQQGILINGQFPGPTIDCVTNDN  66

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I++V N L+EP L +WNG++QR++SW DG+ GT+CPI P  N+TY +Q KDQIGTY YF
Sbjct  67    LIISVYNYLNEPFLISWNGLQQRRNSWQDGMFGTSCPIPPGKNFTYALQAKDQIGTYFYF  126

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S  LH+AAGGYG++ +  R  IP+PYP P+  + ++  DW+   H+QL+  LD G   P
Sbjct  127   PSLALHKAAGGYGSIKVYSRPRIPVPYPTPAGDHVVLAGDWFKRSHRQLKYFLDGGHNLP  186

Query  1246  SPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
              P GL+INGR  N  TF   QG TY FR+SNVG+ TSINFRIQ H +KL+EVEGSHT+Q 
Sbjct  187   FPDGLIINGRGWNGYTFNVDQGKTYRFRISNVGLATSINFRIQGHTMKLIEVEGSHTLQT  246

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              Y SLD+H+GQS   LVT N   KDYY+V SSRF    +T +A+LHY  S  KV G  P 
Sbjct  247   TYSSLDVHLGQSYSVLVTANQPAKDYYVVVSSRFTSKVLTTTAVLHYRNSFAKVSGYPPG  306

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  +  WS+ QAR+IRWNLTA+  RPNPQGSYHYG I   RT++L N+   I+G  RYA
Sbjct  307   GPTTEIDWSLNQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIILANSAPYINGKQRYA  366

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VSYV+P TPLKLAD+ NI GVF++ +I D P  G      SV   +   +VEI+FQN
Sbjct  367   VNGVSYVSPDTPLKLADYFNIGGVFSVGSIPDRPNWGNGYLATSVMHADYRSFVEIVFQN  426

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
              E T+QS+H+DG  F+ VG  GG W    R +YNL D   R TVQVYP SWTAI ++LDN
Sbjct  427   WENTVQSWHIDGYSFFVVGMDGGQWTQASRSRYNLRDTVARCTVQVYPKSWTAIYIALDN  486

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWN+RS  W R YLGQQ YLRV+ +  S   E  +P + LLCG
Sbjct  487   VGMWNIRSEDWARQYLGQQFYLRVYTSSKSWRDELPIPRNALLCG  531



>ref|XP_003605947.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES88144.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=538

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/514 (55%), Positives = 355/514 (69%), Gaps = 1/514 (0%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDE  1574
             +    EDPYRFYNW V YG I PLGVKQ+GILINGQFPGP+I  +TN+N+I+NV N LDE
Sbjct  18    ACANGEDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDE  77

Query  1573  PILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGG  1394
             P L +WNG+ QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S   H+AAGG
Sbjct  78    PFLISWNGVLQRRNSWQDGVYGTNCPISPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGG  137

Query  1393  YGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-  1217
             YG   I  RSVIP+P+  PS  YT++  DW+  +H  L+  LD+G   P P GL+INGR 
Sbjct  138   YGGFTIASRSVIPVPFDPPSGDYTILAGDWYKRNHTDLRAILDSGSDLPFPDGLVINGRG  197

Query  1216  LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQ  1037
              N+ TF   QG TY FR+SNVG+TTSINFRIQ HK+KLVEVEGSHT+Q+ YDSLDIH+GQ
Sbjct  198   SNAYTFAVDQGKTYRFRISNVGITTSINFRIQGHKIKLVEVEGSHTLQNTYDSLDIHLGQ  257

Query  1036  SAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMR  857
             +   LVT +    DYYIV ++RF    + AS+ILHY  S   V G LP  P  +  WS+ 
Sbjct  258   TYSVLVTADQPPHDYYIVVTTRFTSQVLNASSILHYSNSAGSVSGPLPGGPTTEIDWSVE  317

Query  856   QARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTT  677
             QAR++R NLTA+  RPNPQGSYHYG I   RT+ L+N+   I+G  RYA+N VS++   T
Sbjct  318   QARSLRRNLTASGPRPNPQGSYHYGMINTTRTIRLQNSAPIINGKQRYAVNGVSFIPADT  377

Query  676   PLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLD  497
             PLKLAD  NI GVF+L +I D P  G      SV   +   +VE++F+N E TLQS+H+D
Sbjct  378   PLKLADHFNIQGVFSLGSIPDNPTGGGGYLQTSVMAADFRGFVEVVFENPEDTLQSWHID  437

Query  496   GQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVW  317
             G  F+ VG  GG W +  R  YNL D   R TVQVYP SWTA+ + LDN GMWN+RS  W
Sbjct  438   GHSFFVVGMDGGQWSAASRLNYNLRDTIARSTVQVYPKSWTALYMPLDNVGMWNVRSENW  497

Query  316   PRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              R YLG Q YLRV+++ +SL  E  +P + L CG
Sbjct  498   ARQYLGHQFYLRVYSSTNSLRDEYPIPSNALQCG  531



>ref|XP_008440923.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34061.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=542

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/523 (54%), Positives = 362/523 (69%), Gaps = 1/523 (0%)
 Frame = -2

Query  1780  LGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvi  1601
             L +L  F ++   A++PYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I
Sbjct  10    LIILVLFAVNEANADNPYRFFTWKVTYGNIYPLGVRQQGILINGQFPGPQIDAVTNDNLI  69

Query  1600  vnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLS  1421
             +NV N L EP L +WNG++QR++SW DGV GT C I P  N+TY +Q KDQIG+Y YF S
Sbjct  70    INVYNYLKEPFLISWNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQAKDQIGSYFYFPS  129

Query  1420  TQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSP  1241
             T  H+AAG +G + I  R  IP+P+P P+  +T++  DW+ T+H  L++ LD+GK  PSP
Sbjct  130   TAFHKAAGAFGGIRIWSRPGIPVPFPSPAGDFTVLAGDWYKTNHYILRRVLDSGKNLPSP  189

Query  1240  KGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
              GLLINGR  N  TF    G TY FR+SNVG++ SINFRIQ H +KLVEVEGSHT+Q+ Y
Sbjct  190   DGLLINGRGWNGYTFNVDPGKTYRFRISNVGISASINFRIQGHLMKLVEVEGSHTLQNTY  249

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
              SLDIH+GQS   LVT N   KDYY+V SSRF  P +T +A+LHY  S  KV G +P  P
Sbjct  250   SSLDIHLGQSYSVLVTANQPPKDYYVVVSSRFTSPILTTTAVLHYSNSWQKVSGPVPGGP  309

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
               +  WS++QAR+IRWNLTA+  RPNPQGSYHYG I   RT+VL N+   I+G  R+A+N
Sbjct  310   TTEIAWSLQQARSIRWNLTASGPRPNPQGSYHYGLIKTSRTIVLANSAPVINGKQRFAVN  369

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
              VS+V   TPLKLAD+  IPGVF LN+I   P  G A    SV G    +Y+EI+FQN E
Sbjct  370   GVSFVQADTPLKLADYFKIPGVFNLNSIPTNPTWGNAYLQTSVMGSNFREYIEIVFQNWE  429

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
              T+QS+H+ G  F+ VG  GG W    R +YNL D   R T QVYP +WTAI ++LDN G
Sbjct  430   NTVQSWHISGYSFFVVGMDGGQWTPASRGRYNLRDTVARCTTQVYPKAWTAIYMALDNVG  489

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWN+RS  W R YLGQQ YLRV+ +  S   E  +P + LLCG
Sbjct  490   MWNVRSESWARQYLGQQFYLRVYTSSTSFRDELPIPRNALLCG  532



>ref|XP_008229964.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=542

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/521 (54%), Positives = 362/521 (69%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             ++A   ++    EDPYRFYNW V YG I PLG+KQRGILINGQFPGP+I  +TN+N+I+N
Sbjct  12    LVALLTVTCTSGEDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTNDNLIIN  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S  
Sbjct  72    VFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLG  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G + I  RSVIP+P+P P+  +T++  DW++ +H  L+  LD+G   P   G
Sbjct  132   FHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLKAILDSGNNLPLSDG  191

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             LLINGR  N  TFT  QG TY  R+SNVG+TTSINFRIQ HK+ LVEVEG+H++Q+ Y S
Sbjct  192   LLINGRGSNGFTFTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYSS  251

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LVT +   +DYYIV S+RF    ++ ++ILHY  +   V G  P  P  
Sbjct  252   LDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVLSTTSILHYSNAAGSVSGPPPGGPTT  311

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR++R NLTA+  RPNPQGSYHYG I   RT+ L ++   I G  RYA+N V
Sbjct  312   QIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSAPIIDGKQRYAVNSV  371

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S++ P TPLKLAD+  I GVF++ +I+D P  G A    SV   +   + E++F+N E T
Sbjct  372   SFIQPDTPLKLADYFKISGVFSIGSIQDNPTGGGAYLQTSVMNADFRGFAELVFENPEDT  431

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QS+H+DG  F+ VG  GG W+   R +YNL D  +R TVQVYPNSWTAI + LDN GMW
Sbjct  432   VQSWHIDGHSFFVVGMDGGQWEPASRLRYNLRDTISRCTVQVYPNSWTAIYMPLDNVGMW  491

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  492   NVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCG  532



>ref|XP_004144498.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/527 (55%), Positives = 367/527 (70%), Gaps = 4/527 (1%)
 Frame = -2

Query  1792  LRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             L FL  VL+F CI+    EDPYRF NW + YG I PLGVKQ+GILINGQFPGP+I  +TN
Sbjct  10    LTFLFLVLSFSCIN---GEDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTN  66

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
             EN+I+NV N LDEP L +WNGI+QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y 
Sbjct  67    ENLIINVFNSLDEPFLISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYF  126

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF S  LH+AAGG+G   I  RS+IP+P+P P+  +T++  DW++ +H  L+  LD G  
Sbjct  127   YFPSLALHKAAGGFGGFKIQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLRAILDGGSD  186

Query  1252  FPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
              PSP GLLINGR LN  TFT +QG TY FR+SNVG+TT+INFRIQ HK+ LVEVEG+HT+
Sbjct  187   LPSPDGLLINGRGLNGNTFTVEQGKTYRFRISNVGLTTAINFRIQGHKMLLVEVEGTHTL  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+S+DIH+GQS   LVT +   +DYYIV S+RF    +T +++LHY  S   V G  
Sbjct  247   QNTYESIDIHLGQSYSVLVTADQPPQDYYIVVSTRFTSQILTTTSLLHYSNSAASVSGPP  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q  WS+ QAR++R NLTAN  RPNPQGSYHY  I + RT+ L +T   I+G  R
Sbjct  307   PGGPTFQIDWSLEQARSLRRNLTANGPRPNPQGSYHYRLINVTRTIRLHSTAPIINGKQR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N VS++   TPLKLAD+  I GVF+L +I D P  G A    SV   +   Y E++F
Sbjct  367   YAVNSVSFIPADTPLKLADYFKISGVFSLGSIPDYPTGGDAYLQTSVMNADFRGYAEVVF  426

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             +N E  +QS+H+DG +F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + L
Sbjct  427   ENPEDVVQSWHVDGHNFFVVGMDGGQWIPASRLTYNLRDTISRCTVQVYPKSWTAVYMPL  486

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWN+RS  W R YLGQQ+YLRV++  +S   E  +P + L CG
Sbjct  487   DNVGMWNIRSENWARQYLGQQLYLRVYSPVNSWRDEYPIPSNALKCG  533



>ref|XP_008224692.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=543

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/522 (55%), Positives = 366/522 (70%), Gaps = 2/522 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             VL  F ++ V  EDPYR + W + YG I PLGVKQ+GILINGQFPGP+I+ +TN+N++++
Sbjct  12    VLVLFLVNGVNGEDPYRLFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVIS  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N L EP L +W+GI+QR++SW DGV GTNCPILP  N+TY +Q+KDQIG++ YF S  
Sbjct  72    VFNYLREPFLISWDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFL  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQ-LDTGKPFPSPK  1238
              H+AAGG+G + I  R  IP+P+P P+  +T++  DW+ T+H  L++  L+ G+  PSP 
Sbjct  132   FHKAAGGFGGIRIWSRPKIPVPFPNPAGDFTVLAGDWYKTNHYILRRSFLEFGRNLPSPD  191

Query  1237  GLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYD  1061
             GLLINGR  N  TFT  QG TY FR+SNVG+TTSINFRIQ HKLKLVEVEGSHT+Q+ YD
Sbjct  192   GLLINGRGWNGYTFTVDQGRTYRFRISNVGLTTSINFRIQGHKLKLVEVEGSHTLQNIYD  251

Query  1060  SLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPA  881
             SLDIH+GQS   LVT +  V+DYY+V SSRF    +T +A+LHY  S   V G LP  P+
Sbjct  252   SLDIHLGQSYSVLVTADQPVQDYYVVVSSRFTPRVLTTTAVLHYSNSRKGVSGPLPWGPS  311

Query  880   GQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNK  701
              Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   RT++L N+   I+G  R+A+N 
Sbjct  312   TQVAWSLSQARSIRSNLTASGPRPNPQGSYHYGLIKPARTIMLANSAPYINGKQRFAVNS  371

Query  700   VSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEK  521
             VSYV P TPLKLAD+  IPGVF++ +I   P  G      SV      +YVEI+FQN E 
Sbjct  372   VSYVQPDTPLKLADYFKIPGVFSVGSIPTNPTGGSGYLQTSVMHANFREYVEIVFQNWED  431

Query  520   TLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGM  341
             T+QS+H+DG  F+ +G  GG W    R +YNL D     T QVYP SWTAI V+LDN GM
Sbjct  432   TVQSWHIDGYSFFVMGMDGGQWTPASRARYNLRDTVALSTTQVYPRSWTAIYVALDNVGM  491

Query  340   WNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             WN+RS  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  492   WNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCG  533



>ref|XP_010530339.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/520 (53%), Positives = 359/520 (69%), Gaps = 1/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
              L+ F ++ V  E PYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I+N
Sbjct  12    CLSIF-VAAVTGESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  70

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++ R++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S  
Sbjct  71    VFNSLDEPFLISWNGVQNRRNSYVDGVYGTTCPIPPGRNYTYILQVKDQIGSFYYFPSLA  130

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G + I+ R +IP+P+ +P+  YT+++ DW+ ++H  L+ +LD GK  P+P G
Sbjct  131   FHKAAGGFGGIRILSRPLIPVPFDQPAGDYTVLIGDWYKSNHTDLKARLDRGKKLPNPDG  190

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LINGR +  TF  +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q  + SL
Sbjct  191   ILINGRSSGATFNVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTFSSL  250

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   LVT +   +DYY+V SSRF     T + IL Y GS T   G +P  P  Q
Sbjct  251   DVHVGQSYSVLVTADQPARDYYVVVSSRFTDKINTTTGILRYSGSSTPASGPIPGGPTIQ  310

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR IR NLTA+  RPNPQGSYHYG + + RT+   ++   I+G  RYALN VS
Sbjct  311   VDWSLNQARAIRTNLTASGPRPNPQGSYHYGLVSLARTIRFGSSAGQINGKQRYALNSVS  370

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             +V   TPLKLAD+  I GV+ +N+I D P  G      SV   +   +VEI+F+NNE  +
Sbjct  371   FVPADTPLKLADFFQISGVYKVNSISDRPTGGGMYLDTSVLQADYRTFVEIVFENNEDIV  430

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QSYHLDG  FW VG  GG W    R  YNL DA +R TVQVYP SWTAI ++LDN GMWN
Sbjct  431   QSYHLDGYAFWVVGMDGGQWTVASRNGYNLRDAISRSTVQVYPKSWTAIYIALDNVGMWN  490

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LRS  W R YLGQQ+YLRV+    SL  E  +P + LLCG
Sbjct  491   LRSEFWARQYLGQQLYLRVFTTSTSLRDEFPIPKNALLCG  530



>ref|XP_004290036.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/511 (55%), Positives = 366/511 (72%), Gaps = 2/511 (0%)
 Frame = -2

Query  1741  AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPILF  1562
              EDPYRF+ W V YG I PLG+KQRGILINGQFPGPEI  +TN+N+I+NV N L EP L 
Sbjct  22    GEDPYRFFEWNVTYGDIYPLGIKQRGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLI  81

Query  1561  TWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGAL  1382
             TWNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   H+AAGG+GA+
Sbjct  82    TWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAI  141

Query  1381  NIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRL-NSV  1205
              I+ R  IP+P+PEP+A Y+L++ DW+N DHK+LQ  LD G   P+P+GLLINGR  N  
Sbjct  142   KILSRPRIPVPFPEPAADYSLLIGDWYNLDHKRLQAILDNGHRLPNPQGLLINGRGGNDT  201

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
              FT +QG TY  R+SNVGM  ++NFRIQ H++KLVEVEG+HT+Q  YDSLD+HVGQS   
Sbjct  202   WFTVEQGKTYRLRISNVGMQNTLNFRIQGHQMKLVEVEGTHTVQTTYDSLDVHVGQSYSV  261

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             L+T +   +DYYIV S+RF    +T++A+LHY  S  +V G +P  P  Q  WS+ QART
Sbjct  262   LITADQAPQDYYIVTSTRFTSKVLTSTAVLHYSNSRRQVSGPIPGGPTIQTGWSLSQART  321

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKL  665
             IR NLTA+  RPNPQGSYHYG + + RT+ L ++   ++G  RY +N VS++   TPLKL
Sbjct  322   IRTNLTASGPRPNPQGSYHYGLVNVSRTIRLSSSAAQVNGKQRYGVNGVSFIPADTPLKL  381

Query  664   ADWLNIPGVFTLNAIKDTPPAGPAVH-GVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             AD+  I GVF + +I+D P    +++   +V G +   +VEI+F+N E  +QS+HLDG  
Sbjct  382   ADYFKIDGVFKVGSIQDNPTGQKSLYLDTAVMGADFRTFVEIVFENPENIVQSWHLDGYY  441

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VG  GG W    RK+YNLVDA +R+T QVYP SWTA+ V+LDN GMWN+RS  W R 
Sbjct  442   FWVVGMDGGKWTPDSRKEYNLVDAVSRHTTQVYPKSWTAVYVALDNVGMWNVRSQFWTRQ  501

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  502   YLGQQFYLRVYSPVGSVRDEYPIPKNALLCG  532



>ref|XP_006307199.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
 gb|EOA40097.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
Length=541

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/523 (52%), Positives = 366/523 (70%), Gaps = 2/523 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             LL  L+F  +  V AE PYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+
Sbjct  11    LLLCLSFLAV--VIAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNL  68

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             ++NV N LDEP L +WNG++ R++S+ DG+ GT CPI P +N+TY +Q+KDQIG++ YF 
Sbjct  69    VINVHNSLDEPFLISWNGVQNRRNSFVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFP  128

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+ +LD G+  PS
Sbjct  129   SLAFHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKSRLDRGRKLPS  188

Query  1243  PKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
             P G+LINGR +  T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HT+Q  +
Sbjct  189   PDGILINGRSSGATINVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMF  248

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
              SLD+HVGQS   L+T +   +DYY+V SSRF    +T + +L Y GS T   G+LP  P
Sbjct  249   SSLDVHVGQSYSVLITADQSPRDYYVVVSSRFTNKIITTTGVLRYSGSSTPASGQLPGGP  308

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
               Q  WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +N
Sbjct  309   TIQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVN  368

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
              VS+V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N E
Sbjct  369   SVSFVPADTPLKLADYFKISGVYKVNSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENKE  428

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
               +QSYHL+G  FW VG  GG W +  R  YNL DA +R TVQVYP SWTAI ++LDN G
Sbjct  429   DIVQSYHLNGYSFWVVGMDGGQWRTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVG  488

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWNLRS  W R YLGQQ+YLRV+    SL  E  +P ++ LCG
Sbjct  489   MWNLRSEFWARQYLGQQLYLRVFTTSTSLRDEYPIPRNSRLCG  531



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/521 (54%), Positives = 360/521 (69%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +L F  +S    E PYRF+NW V YG I PLGVKQ+GILINGQFPGP I  +TN+N+I++
Sbjct  11    LLVFMLVSCTRGESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDNLIIS  70

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S  
Sbjct  71    VFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLA  130

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGGYG + I  R +IP+P+  P+  +T++  DW+  +H  L+  LD+G   P P G
Sbjct  131   FHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLKAILDSGSDLPFPDG  190

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             L+INGR  N+ TFT  QG TY FR+SNVG++TSINFRIQ HK+ LVEVEG+HT+Q+ YDS
Sbjct  191   LVINGRGSNANTFTVDQGKTYRFRISNVGISTSINFRIQGHKMLLVEVEGTHTLQNTYDS  250

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LV  +   + YYIV S+RF    ++A+++LHY  S   V G  P  P  
Sbjct  251   LDIHLGQSYSVLVRADQPPQGYYIVISTRFTSQVLSATSVLHYSNSAGSVSGPPPGGPTT  310

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR++R NLTA+  RPNPQGSYHYG I    T+ L+NT   I+G  RYA+N V
Sbjct  311   QIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTHTIRLQNTAPTINGKQRYAVNSV  370

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S++   TPLKLAD+  IPGVF++ +I D P  G A    SV   +   + E++F+N E T
Sbjct  371   SFIPADTPLKLADYFKIPGVFSVGSIPDNPTGGGAYLQTSVMAADFRGFAEVVFENPEDT  430

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             LQS+H+DG +F+AVG  GG W    R  YNL D  +R TVQVYP SWTA+ V LDN GMW
Sbjct  431   LQSWHIDGHNFFAVGMDGGEWTPASRLTYNLRDTISRCTVQVYPKSWTAVYVPLDNVGMW  490

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV+++ +S   E  +P + LLCG
Sbjct  491   NIRSENWARQYLGQQFYLRVYSSANSWRDEYPIPSNALLCG  531



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/529 (53%), Positives = 365/529 (69%), Gaps = 3/529 (1%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
             G +  LL + A F I++  AEDPYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +
Sbjct  8     GAISALLCLAALFSIAV--AEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSV  65

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG+
Sbjct  66    TNDNLIINVFNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGRNFTYILQVKDQIGS  125

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             + YF S   H+AAGG+G + I+ R  IP+P+P+P   YT+++ DW+ ++H  L+  LD+G
Sbjct  126   FYYFPSLDFHKAAGGFGGIRILSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLKAHLDSG  185

Query  1258  KPFPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             K  PSP G+LINGR     +   +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+H
Sbjct  186   KKLPSPDGILINGRGPGGFSLNFEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTH  245

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPG  902
             T+Q  Y SLD+HVGQS   LVT +   +DYY+VASSRF  P +T +  +HY  S   V G
Sbjct  246   TLQTTYSSLDVHVGQSYSVLVTADQPGQDYYVVASSRFTSPILTTTGTVHYANSAGAVSG  305

Query  901   KLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGI  722
               P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   +T VLEN+   ++G 
Sbjct  306   PPPGGPTIQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINXNKTYVLENSAGQVNGK  365

Query  721   TRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEI  542
              RY +N VS+V   TPLKLAD+  I GVF + +I D P  G      SV G +   +VEI
Sbjct  366   QRYGVNSVSFVPADTPLKLADYFKIGGVFRVGSISDKPTGGGLYLDTSVLGADYRTFVEI  425

Query  541   IFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILV  362
             +FQNNE  +QS+HLDG  F+ VG  GG W +  R  YNL DA +R T QVYP SWTAI +
Sbjct  426   VFQNNEDIIQSWHLDGYSFFVVGMDGGQWTTASRDAYNLRDAVSRCTTQVYPKSWTAIHI  485

Query  361   SLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +LDN GMWNLR+  W R YLGQQ+YLRV+ +  SL  E  +P +  LCG
Sbjct  486   ALDNVGMWNLRTEFWARQYLGQQLYLRVYTSSTSLRDEFPIPRNARLCG  534



>ref|XP_004145114.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004153223.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004158002.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=542

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/523 (55%), Positives = 361/523 (69%), Gaps = 1/523 (0%)
 Frame = -2

Query  1780  LGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvi  1601
             L +L  F ++ V A++PYRF+ W V YG I PLGVKQ+GILINGQFPGP+I+ +TN+N+I
Sbjct  10    LIILVLFAVNEVNADNPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLI  69

Query  1600  vnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLS  1421
             +NV N L EP L +WNG++QR++SW DGV GT C I P  N+TY +Q KDQIG+Y YF S
Sbjct  70    INVYNYLKEPFLISWNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQAKDQIGSYFYFPS  129

Query  1420  TQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSP  1241
             T  H+AAG +G + I  R  IP+P+  P+  +T++  DW+ T+H  +++ LD+GK  PSP
Sbjct  130   TAFHKAAGAFGGIRIWSRPGIPVPFAPPAGDFTVLAGDWYKTNHYIMRQVLDSGKNIPSP  189

Query  1240  KGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
              GLLINGR  N  TF    G TY FR+SNVG++ SINFRIQ H +KLVEVEGSHT+Q+ Y
Sbjct  190   DGLLINGRGWNGYTFNVDPGKTYRFRISNVGISASINFRIQGHLMKLVEVEGSHTLQNTY  249

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
              SLDIH+GQS   LVT N   KDYY+V SSRF  P +T +A+LHY  S  KV G +P  P
Sbjct  250   SSLDIHLGQSYSVLVTANQPPKDYYVVVSSRFTSPILTTTAVLHYSNSWQKVSGPVPGGP  309

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
               +  WS++QAR+IRWNLTA+  RPNPQGSYHYG I   RT+VL N+   I+G  R+A+N
Sbjct  310   TTEIAWSLQQARSIRWNLTASGPRPNPQGSYHYGLIKTSRTIVLANSAPVINGKQRFAVN  369

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
              VS+V   TPLKLAD+  IPGVF LN I   P  G A    SV G    +Y+EI+FQN E
Sbjct  370   SVSFVQADTPLKLADYFKIPGVFNLNNIPTNPTWGNAYLQTSVMGSNFREYIEIVFQNWE  429

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
              T+QS+H+ G  F+ VG  GG W    R +YNL D   R T QVYP SWTAI ++LDN G
Sbjct  430   NTVQSWHISGYSFFVVGMDGGQWTPASRSRYNLRDTVARCTTQVYPKSWTAIYMALDNVG  489

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWN+RS  W R YLGQQ YLRV+ +  S   E  +P + LLCG
Sbjct  490   MWNVRSESWARQYLGQQFYLRVYTSSTSFRDELPIPRNALLCG  532



>ref|XP_004955371.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=537

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/512 (59%), Positives = 367/512 (72%), Gaps = 4/512 (1%)
 Frame = -2

Query  1741  AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPILF  1562
             A+DPYR+Y W V YG I+PLG  Q+GILINGQFPGP I+ +TN+N+IVNV+N LDEP L 
Sbjct  20    ADDPYRYYTWTVTYGPINPLGTTQQGILINGQFPGPRIDCVTNDNLIVNVVNNLDEPFLL  79

Query  1561  TWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGAL  1382
             TWNGIKQRK+SW DGV GTNC I P  N+TY+ Q KDQIGT+ YF S  LHRAAGG+GAL
Sbjct  80    TWNGIKQRKNSWQDGVAGTNCAIPPGANYTYKFQAKDQIGTFFYFPSLALHRAAGGFGAL  139

Query  1381  NIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP-FPSPKGLLINGRLNSV  1205
             N+ +R  IP+PYP P+  +TL+V DW+   HKQL++ LD G    P P GLLING   S 
Sbjct  140   NVYQRPAIPVPYPPPAGDFTLLVGDWYAAGHKQLRQALDAGAAALPPPDGLLING-AQSA  198

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
             TF G  G TY+FRVSNVG+  S+N RIQ H L+L EVEG+H +Q+ YDSLDIH GQS  F
Sbjct  199   TFVGDLGRTYLFRVSNVGLKASVNVRIQGHSLRLAEVEGTHPVQNAYDSLDIHPGQSLAF  258

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             LVTL+    DY +V S+RF    +TA   LHY G+  + PG LP PP GQ+ WS+ QAR+
Sbjct  259   LVTLDKPPLDYAVVVSTRFAAANLTAVGTLHYAGATARAPGPLPPPPPGQFDWSLNQARS  318

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENI-SGITRYALNKVSYVNPTTPLK  668
              RWNLTA+AARPNPQGS+HYGTIP  RTLVL ++   + +G  R A+N VS+V P TPLK
Sbjct  319   FRWNLTASAARPNPQGSFHYGTIPTSRTLVLASSSSAVLAGRRRCAVNGVSFVVPDTPLK  378

Query  667   LADWLNIPGVFTLNAIKDTPPAG-PAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             LAD  NI  V   + +   P  G P   G  V  L LH++VE++FQN E  +QS+HLDG 
Sbjct  379   LADNYNIANVMDWDGVPARPVGGAPPRAGTPVVRLNLHEFVEVVFQNTENEMQSWHLDGY  438

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             DFW VGYG G W    R+ YNLVDA  R+TVQVYPN W+AILVSLDN+GMWNLRS++W R
Sbjct  439   DFWVVGYGNGQWTEMQRQTYNLVDAQARHTVQVYPNGWSAILVSLDNQGMWNLRSAIWDR  498

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              YLGQQ+YLRVW  E S   E  +P + +LCG
Sbjct  499   QYLGQQLYLRVWTPEQSFANEYSIPTNAILCG  530



>ref|XP_007041705.1| SKU5 similar 5 [Theobroma cacao]
 gb|EOX97536.1| SKU5 similar 5 [Theobroma cacao]
Length=547

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/511 (54%), Positives = 363/511 (71%), Gaps = 1/511 (0%)
 Frame = -2

Query  1744  EAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPIL  1565
             +AEDPYRF+NW V YG I PLGV+Q+GILINGQFPGPE+  +TN+N+I+NV N LDEP L
Sbjct  27    QAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPELYSVTNDNLIINVYNNLDEPFL  86

Query  1564  FTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGA  1385
              +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   H+AAGG+G 
Sbjct  87    LSWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGG  146

Query  1384  LNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-LNS  1208
             + I+ R  IP+P+P+P+  +T+++ DW+ TDH+QL+ +LD G   P P G+LING   N 
Sbjct  147   IKILSRPRIPVPFPDPAGDFTVLIGDWYKTDHRQLKARLDGGHKLPFPDGILINGHGPNG  206

Query  1207  VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAG  1028
               FT +QG TY FR+SNVG+  ++NFRIQ H +KLVEVEG+HT+Q  Y+SLD+HVGQS  
Sbjct  207   AIFTVEQGKTYRFRISNVGLQNTLNFRIQGHSMKLVEVEGTHTVQTIYESLDVHVGQSYS  266

Query  1027  FLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQAR  848
              LVT++   KD+YIVAS+RF    +T +A LHY  S   V G +P  P  Q  WS+ QAR
Sbjct  267   VLVTMDQTAKDFYIVASTRFTDKILTTTASLHYSNSNKAVSGPIPGGPTDQIDWSLNQAR  326

Query  847   TIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLK  668
             +IR NLTA+  RPNPQGSYHYG I I RT+ L ++   ++G  RYA+N VS+V   TPLK
Sbjct  327   SIRTNLTASGPRPNPQGSYHYGLINITRTIKLVSSAAQVNGKQRYAVNSVSFVPADTPLK  386

Query  667   LADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             LAD+  I GVF + +I D+P         SV G +   +VEI+F+N+E  +QS+H++G  
Sbjct  387   LADYFKIDGVFRVGSISDSPAGKKMYLDTSVMGADFRAFVEIVFENHESIVQSWHINGYA  446

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             FW VG  GG+W    RK+YNL DA +R T QVYP SWTAI ++LDN GMWN+R+  W R 
Sbjct  447   FWVVGMDGGLWTPDSRKQYNLRDAVSRSTTQVYPRSWTAIYIALDNVGMWNVRTEFWARQ  506

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  507   YLGQQFYLRVYSPVESVRDEYPIPKNALLCG  537



>gb|KDP47151.1| hypothetical protein JCGZ_00042 [Jatropha curcas]
Length=540

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/524 (54%), Positives = 370/524 (71%), Gaps = 2/524 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             + GVL  F +++V AEDPYRF++W V YG I PLGVKQ+GILINGQFPGP+I  +TN N+
Sbjct  8     IYGVLCTF-LTVVGAEDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNL  66

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF 
Sbjct  67    IINVHNSLPEPFLISWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFP  126

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G + I+ R +IP+P+PEP+  +T+++ DW+ T+H +L+  LD G   P 
Sbjct  127   SLAFHKAAGGFGGIRILSRPLIPVPFPEPADDFTVLIGDWFKTNHTKLKAILDRGHRLPF  186

Query  1243  PKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             P G+LINGR  N+  FT +QG TY  R+SNVG+  S+NFRIQ H +KLVEVEG+HT+Q  
Sbjct  187   PDGILINGRGPNATYFTFEQGKTYRLRISNVGLQNSLNFRIQGHTMKLVEVEGTHTVQTT  246

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y SLD+HVGQS   LVT +   ++YYI  S+RF    +T +AILHY  S  +V G +P  
Sbjct  247   YSSLDVHVGQSYSVLVTADQPPQNYYIAVSTRFTSKVLTTTAILHYSNSNKQVSGPIPGG  306

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q +WS+ QAR+IR NLTA+  RPNPQGSYHYG I I RT+ LE++   ++   RYA+
Sbjct  307   PTTQINWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAGQVNRKQRYAV  366

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+V   TPLK+AD+ NI GVF + +I D P         SV G    D+VEI+FQN+
Sbjct  367   NSVSFVPADTPLKIADYFNISGVFRVGSIPDYPTHKKMYLDTSVMGAGFRDFVEIVFQNH  426

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +Q++H+DG +FW VG  GGVW S  R +YNL DA +R T QVYP SWTAI V+LDN 
Sbjct  427   ENIVQTWHIDGYNFWVVGMNGGVWTSASRNEYNLRDAVSRCTTQVYPKSWTAIYVALDNV  486

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWN+RS  W R YLGQQ YLRV++   S+  E ++P + LLCG
Sbjct  487   GMWNVRSEFWARQYLGQQFYLRVYSPVRSIRDEYNIPKNALLCG  530



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/521 (54%), Positives = 359/521 (69%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +L F  +S    E PYRF+NW V YG I PLGVKQ+GILINGQFPGP I  +TN+N+I++
Sbjct  11    LLVFMLVSCTRGESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDNLIIS  70

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S  
Sbjct  71    VFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQVKDQIGSYFYFPSLA  130

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGGYG + I  R +IP+P+  P+  +T++  DW+  +H  L+  LD+G   P P G
Sbjct  131   FHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLKAILDSGSDLPFPDG  190

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             L+INGR  N+ TFT  QG TY FR+SNVG++TSINFRIQ HK+ LVEVEG+HT+Q+ YDS
Sbjct  191   LVINGRGSNANTFTVDQGKTYRFRISNVGISTSINFRIQGHKMLLVEVEGTHTLQNTYDS  250

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LV  +   + YYIV S+RF    ++A+++LHY  S   V G  P  P  
Sbjct  251   LDIHLGQSYSVLVRADQPPQGYYIVISTRFTSQVLSATSVLHYSNSAGSVSGPPPGGPTT  310

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR++R NLTA+  RPNPQGSYHYG I    T+ L+NT   I+G  RYA+N V
Sbjct  311   QIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTHTIRLQNTGPTINGKQRYAVNSV  370

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S++   TPLKLAD+  IPGVF++  I D P  G A    SV   +   + E++F+N E T
Sbjct  371   SFIPADTPLKLADYFKIPGVFSVGNIPDNPTGGGAYLQTSVMAADFRGFAEVVFENPEDT  430

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             LQS+H+DG +F+AVG  GG W    R  YNL D  +R TVQVYP SWTA+ V LDN GMW
Sbjct  431   LQSWHIDGHNFFAVGMDGGEWTPASRLTYNLRDTISRCTVQVYPKSWTAVYVPLDNVGMW  490

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV+++ +S   E  +P + LLCG
Sbjct  491   NIRSENWARQYLGQQFYLRVYSSANSWRDEYPIPSNALLCG  531



>gb|ABK25092.1| unknown [Picea sitchensis]
 gb|ACN40425.1| unknown [Picea sitchensis]
Length=539

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 367/531 (69%), Gaps = 5/531 (1%)
 Frame = -2

Query  1798  GFLRFLLGVLAFFCISM--VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPein  1625
             GF + +L V+    I+   V  ED Y+++ W V YGTI P+GV Q+GILINGQFPGP++N
Sbjct  2     GFSQRILAVICVVWITAAGVRTEDAYKYFTWTVTYGTIYPMGVPQQGILINGQFPGPQLN  61

Query  1624  vitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQI  1445
             V+TN+NVI+NV N L+EP L +WNGI+QR++SW DGVLGT+CPI P  N+TY+ Q KDQI
Sbjct  62    VVTNDNVIINVFNYLNEPFLLSWNGIQQRRNSWQDGVLGTSCPIPPRRNFTYKFQAKDQI  121

Query  1444  GTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLD  1265
             GTY YF ST LH+AAGG+G L I  RSVI +PYP P+  YT ++ DW+ T+H  L++ LD
Sbjct  122   GTYFYFPSTLLHKAAGGFGGLAIASRSVISIPYPTPAGEYTALIGDWYKTNHAVLRRWLD  181

Query  1264  TGKPFPSPKGLLINGRLNSV-TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEG  1088
             +G+    P G+ INGR   + TF    G TY  R+SNVG++TS+NFRIQ HK+KLVEVEG
Sbjct  182   SGRALGMPNGVHINGRGKGLSTFKVDPGRTYRLRISNVGLSTSLNFRIQGHKMKLVEVEG  241

Query  1087  SHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKV  908
             SHT+Q+ YDSLD+HVGQS   L+T +   KDYYIVAS+RF  P +   A+L Y  S    
Sbjct  242   SHTVQNVYDSLDLHVGQSCSVLITADQAPKDYYIVASTRFTNPVLYGVALLRYSNSRQPA  301

Query  907   PGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENIS  728
              G LP  P  Q  WS+ QAR+IRWNLTANAARPNPQGSYHYG I   RT+ L N+   I+
Sbjct  302   SGPLPPGPTTQIDWSLSQARSIRWNLTANAARPNPQGSYHYGLIKPARTITLANSAPIIN  361

Query  727   GITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYV  548
             G  RYA+N VS++ P TPLKLAD+  I GVF L  I D P  G      +V   +   ++
Sbjct  362   GKQRYAVNGVSFMPPDTPLKLADYFKIQGVFNLGTISDYPRGGGGYLQTAVMSGQFRSFI  421

Query  547   EIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAI  368
             EI+FQN+E T+QS+H+DG  F+  G  GG W    RK YNL DA +R T QVYPNSWTA+
Sbjct  422   EIVFQNDENTIQSWHIDGYSFFVAGMDGGQWSPASRKGYNLFDAVSRSTTQVYPNSWTAV  481

Query  367   LVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             L+ LDN GMWN+RS +W R YLGQQ Y++V     +   E  +P + L+CG
Sbjct  482   LLMLDNAGMWNVRSEIWARQYLGQQFYMKV--AGFAGQDEYIVPRNALMCG  530



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/524 (54%), Positives = 362/524 (69%), Gaps = 3/524 (1%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             LL + A F  SM  AEDPYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+
Sbjct  13    LLCLAALF--SMAVAEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNL  70

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF 
Sbjct  71    IINVFNSLDEPFLLSWNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFP  130

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+  +H  L+  LD GK  P 
Sbjct  131   SLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKANHTTLKAHLDRGKKLPL  190

Query  1243  PKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             P G+LINGR     +   +QG TY  R+SN+G+  S+NFRIQNHK+KLVEVEG+HT+Q  
Sbjct  191   PDGILINGRGPGGFSLNFEQGKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTLQTT  250

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y SLD+HVGQS   LVT +   +DYY+VASSRF  P +T +  +HY  S  KV G  P  
Sbjct  251   YSSLDVHVGQSYSVLVTADQPGQDYYLVASSRFTSPILTTTGTVHYANSAGKVSGPPPGG  310

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I + +T VL+N+   ++G  RY +
Sbjct  311   PTIQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYVLQNSAGQVNGKQRYGV  370

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+V   TPLKLAD+  I GVF + +I D P  G      SV G +   +VEI+FQNN
Sbjct  371   NSVSFVPADTPLKLADYFKIGGVFRVGSISDRPTGGGLYLDTSVLGADYRAFVEIVFQNN  430

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QS+HLDG  F+ VG  GG W +  R  YNL DA +R T QVYP SWTAI + LDN 
Sbjct  431   EDIIQSWHLDGYSFFVVGMDGGQWTTASRSAYNLRDAVSRCTTQVYPKSWTAIYIPLDNV  490

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLR+  W R YLGQQ+YLRV+ +  S+  E  +P + LLCG
Sbjct  491   GMWNLRTEFWARQYLGQQLYLRVYTSSTSIRDEYPIPRNALLCG  534



>ref|XP_009413373.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413374.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/510 (56%), Positives = 357/510 (70%), Gaps = 1/510 (0%)
 Frame = -2

Query  1741  AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPILF  1562
              + PYRF+ W V YG I PLGVKQ+GILINGQFPGP+I  +TN+N+IVNV N L EP LF
Sbjct  23    GDSPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLIVNVFNSLPEPFLF  82

Query  1561  TWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGAL  1382
             +WNGI+QR+SSW DGV GTNCPI P  N+TY MQ+KDQIG+Y YF S   H+AAGGYG +
Sbjct  83    SWNGIQQRRSSWQDGVYGTNCPIPPGGNFTYTMQVKDQIGSYFYFPSLAFHKAAGGYGGI  142

Query  1381  NIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-LNSV  1205
              ++ R +IP+P+  P+A YT++V DW+  +H  L+  LD GK  P P GLLING+  N  
Sbjct  143   RVLSRPLIPVPFAPPAADYTVLVGDWYKANHTDLRNILDGGKDLPFPDGLLINGQGSNGS  202

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
              FT  QG TY FRVSNVG+ TS+N RIQ H L LVEVEGSHT+Q+ Y SLDIH+GQS  F
Sbjct  203   AFTVDQGKTYRFRVSNVGVATSLNIRIQGHALLLVEVEGSHTLQNTYSSLDIHLGQSYSF  262

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             LVT +    DYYIV S+RF    ++ +AILHY  S  K     P  P     WS+ QAR+
Sbjct  263   LVTADQPPMDYYIVVSTRFTTTVLSTTAILHYSNSDGKRVEPPPGGPTTDIEWSLNQARS  322

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKL  665
             IRWNLTA+  RPNPQGSYHYG + + RT+ + N+   I+G  RYA+N +S++   TPLKL
Sbjct  323   IRWNLTASGPRPNPQGSYHYGYVNVTRTIRIANSAPVINGKQRYAVNSLSFIPADTPLKL  382

Query  664   ADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQDF  485
             AD+ NI GVF L +I D P +GPA    SV   +   YVEI+F+N+E ++QS+H+DG +F
Sbjct  383   ADFYNISGVFELGSISDIPTSGPASLRTSVMAADFRAYVEIVFENSETSVQSWHIDGYNF  442

Query  484   WAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRNY  305
             W VG  GG W    R  YNL DA +R TVQVYPNSW+AI + LDN GMWN+RS  W R Y
Sbjct  443   WIVGMDGGQWTPASRDSYNLRDAVSRCTVQVYPNSWSAIYMPLDNVGMWNIRSENWARQY  502

Query  304   LGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LGQQ Y+RV++  +S   EN +P + LLCG
Sbjct  503   LGQQFYIRVYSPANSWRDENPIPRNALLCG  532



>ref|XP_002888337.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64596.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/523 (52%), Positives = 365/523 (70%), Gaps = 3/523 (1%)
 Frame = -2

Query  1774  VLAFFCISM---VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             V+  FC+S    V AE PYRF++W V YG I PLGV+Q+GILING+FPGP+I+ +TN+N+
Sbjct  11    VVLLFCLSFFAAVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGKFPGPDIHSVTNDNL  70

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N LDEP L +WNGI+ R++S+ DG+ GT CPI P +N+TY +Q+KDQIG++ YF 
Sbjct  71    IINVHNSLDEPFLISWNGIQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFP  130

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+ +LD G+  P 
Sbjct  131   SLAFHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKSRLDRGRKLPP  190

Query  1243  PKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
             P G+LINGR N  T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HT+Q  +
Sbjct  191   PDGILINGRSNGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMF  250

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
              SLD+HVGQS   L+T +   + YY+V SSRF    +T++ +L Y GS T   G +P  P
Sbjct  251   SSLDVHVGQSYSVLITADQSPRAYYVVVSSRFTDKIITSTGVLRYSGSSTPASGPIPGGP  310

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
               Q  WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +N
Sbjct  311   TIQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVN  370

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
              VS+V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N E
Sbjct  371   SVSFVPADTPLKLADFFKISGVYKINSISDKPTYGGLYLDTSVLQVDYRTFIEIVFENQE  430

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
               +QSYHL+G  FW VG  GG W +  R  YNL DA +R TVQVYP SWTAI ++LDN G
Sbjct  431   DIVQSYHLNGYSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVG  490

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWNLRS  W R YLGQQ+YLRV+ +  SL  E  +P ++ LCG
Sbjct  491   MWNLRSEFWARQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCG  533



>ref|XP_007221787.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
 gb|EMJ22986.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
Length=544

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/515 (55%), Positives = 360/515 (70%), Gaps = 1/515 (0%)
 Frame = -2

Query  1756  ISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLD  1577
              S+V AEDPYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I+NV N LD
Sbjct  20    FSIVAAEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLD  79

Query  1576  EPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAG  1397
             EP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   H+AAG
Sbjct  80    EPFLISWNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAG  139

Query  1396  GYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR  1217
             G+G + I+ R  IP+P+P+P+  YT+++ DW+ ++H  L+  LD GK  P P G+LINGR
Sbjct  140   GFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTSLKAHLDAGKKLPFPDGILINGR  199

Query  1216  -LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVG  1040
                  +F  +QG TY  R+SNVG+  S+NFRIQNHKLKLVEVEG+HT+Q  Y SLD+HVG
Sbjct  200   GPGGFSFNFEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVG  259

Query  1039  QSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSM  860
             QS   LVT +   +DYYIVASSRF  P +T +  LHY  S  +V G  P  P  Q  WS+
Sbjct  260   QSYSVLVTADQPGQDYYIVASSRFTTPILTTTGTLHYTNSAGRVSGPPPGGPTIQVDWSL  319

Query  859   RQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPT  680
              QAR+IR NLTA+  RPNPQGSYHYG I   +T VLEN+   ++G  RY +N VS+V   
Sbjct  320   NQARSIRTNLTASGPRPNPQGSYHYGLINTTKTYVLENSAGQVNGKQRYGVNSVSFVPAD  379

Query  679   TPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHL  500
             TPLKLAD+  I GVF + +I D P  G      SV G +   +VE +FQNNE  +QS+HL
Sbjct  380   TPLKLADYFKIGGVFRVGSISDRPTGGGLYLDTSVLGADYRTFVEFVFQNNEDIIQSWHL  439

Query  499   DGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSV  320
             DG  F+ VG  GG W    RK+YNL DA +R TVQVYP SWTAI V+LDN GMWNLR+  
Sbjct  440   DGYSFFVVGLDGGQWTPASRKEYNLRDAVSRCTVQVYPKSWTAIYVALDNVGMWNLRTEF  499

Query  319   WPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             W R YLGQQ+YLRV+    S+  E  +P + LLCG
Sbjct  500   WARQYLGQQLYLRVYTPSTSIRDEYPIPKNALLCG  534



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/531 (53%), Positives = 362/531 (68%), Gaps = 8/531 (2%)
 Frame = -2

Query  1783  LLGVLAFFCISM-------VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPein  1625
             L  + A  C+S+       V AEDPYRF+ W V YG I PLGV+QRGILINGQFPGP+IN
Sbjct  5     LGAISALLCLSLTASLLAVVTAEDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDIN  64

Query  1624  vitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQI  1445
              +TN+N+I+NV N LDEP L +WNGI+QR +S+ DGV GT CPI P  N TY +Q+KDQI
Sbjct  65    SVTNDNLIINVFNSLDEPFLLSWNGIQQRHNSFQDGVYGTTCPIPPGRNLTYILQVKDQI  124

Query  1444  GTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLD  1265
             G++ YF S   H+AAGG+G + I+ R  IP+P+P+PS  YT+++ DW+ ++H  L+  LD
Sbjct  125   GSFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPSGDYTVLIGDWYKSNHTTLKAHLD  184

Query  1264  TGKPFPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEG  1088
              GK  P P G+LINGR  N  + T +QG TY  R+SNVG+  S+NFRIQ+HK+KLVEVEG
Sbjct  185   RGKKLPFPDGILINGRGPNQFSLTFEQGKTYRLRISNVGLQHSLNFRIQDHKMKLVEVEG  244

Query  1087  SHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKV  908
             +HT+Q  Y SLD+HVGQS   LVT +    DYYIV SSRF  P +T + ILHY G+  +V
Sbjct  245   THTLQTTYSSLDVHVGQSYSVLVTADQPGHDYYIVVSSRFSTPILTTTGILHYSGAGGQV  304

Query  907   PGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENIS  728
              G +P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I + +T +L +    ++
Sbjct  305   SGPIPGGPTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYILASAAGQVN  364

Query  727   GITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYV  548
             G  RY +N VS+V   TPLKLAD+  I GVF + ++ D P  G      SV G +   +V
Sbjct  365   GKQRYGINSVSFVPADTPLKLADYFKISGVFRVGSVSDRPTGGNLYLDTSVLGADYRTFV  424

Query  547   EIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAI  368
             EI+FQN+E  +QSYHLDG  F+ VG  GG W +  R  YNL DA  R T QVYP SWTAI
Sbjct  425   EIVFQNDEDIVQSYHLDGYQFFVVGMDGGKWTTASRNGYNLRDAVARSTTQVYPFSWTAI  484

Query  367   LVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              +SLDN GMWNLR+  W R YLGQQ+YLRV+ +  S+  E  +P +  LCG
Sbjct  485   YLSLDNVGMWNLRTEFWARQYLGQQLYLRVYTSSTSIRDEYPIPRNARLCG  535



>ref|XP_004232701.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=548

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/525 (55%), Positives = 361/525 (69%), Gaps = 1/525 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F + ++    +  + A++PYR+Y W + YG I PLGVKQ+GILINGQFPGP+I+ +TN+N
Sbjct  14    FTIILVLVTTLQCIYADNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDN  73

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I++V N L EP L +WNGI+QR++SW DGV GT CPILP  N+TY +Q KDQIG+Y YF
Sbjct  74    LIISVYNYLSEPFLISWNGIQQRRNSWQDGVYGTTCPILPGKNFTYTLQAKDQIGSYFYF  133

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S  +H+AAGGYGA+ +  R  IP+P+  P+  +T++  D +   H+QL+  LD+G   P
Sbjct  134   PSLAMHKAAGGYGAIRVYSRPRIPVPFAPPAHDFTVLAGDLYKRSHRQLKYILDSGHDLP  193

Query  1246  SPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
              P GL+INGR  N  TFT  QG TY FR+SNVG+ TSINFRIQ H +KLVEVEGSHT+Q 
Sbjct  194   LPDGLIINGRGWNGYTFTVDQGKTYRFRISNVGIATSINFRIQGHTMKLVEVEGSHTLQT  253

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              Y SLDIH+GQS   LVT N   KDYYIV SSRF    +T +A+LHY  S TKV G  P 
Sbjct  254   TYTSLDIHLGQSYSVLVTANQPPKDYYIVVSSRFTTRVLTTTAVLHYSNSWTKVSGPPPG  313

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  Q +WS+ QAR+IRWNLTA+  RPNPQGSYHYG I   RT++L N+   I+G  RYA
Sbjct  314   GPTTQINWSLYQARSIRWNLTASGPRPNPQGSYHYGLIKPSRTIMLANSAPYINGKQRYA  373

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VSY +P TPLKLAD  NI GVF L +I D P  G A  G  V       YVEIIFQN
Sbjct  374   VNSVSYTDPDTPLKLADHFNIGGVFNLGSISDQPYNGNAYIGTPVMAANFRSYVEIIFQN  433

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
              E T+QS+H+DG  F+ VG  GG W    R  YNL D   R TVQVYP SWTAI ++LDN
Sbjct  434   WENTVQSWHIDGYSFFVVGMDGGQWTPANRAHYNLRDTIARCTVQVYPKSWTAIYMALDN  493

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWN+RS  W R YLGQQ YLRV++  +S   E  +P + +LCG
Sbjct  494   VGMWNIRSENWSRRYLGQQFYLRVYSPANSWRDELPIPKNAILCG  538



>ref|XP_008455444.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=543

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/527 (54%), Positives = 365/527 (69%), Gaps = 4/527 (1%)
 Frame = -2

Query  1792  LRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
             L  L  VL+F CI     EDPYRF+ W + YG I PLGVKQ+GILINGQFPGP+I  +TN
Sbjct  10    LTSLFLVLSFSCI---YGEDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTN  66

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
             EN+I+NV N LDEP L +WNGI+QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y 
Sbjct  67    ENLIINVFNSLDEPFLISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYF  126

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF S  LH+AAGG+G   I  RS+IP+P+P P+  +T++  DW++ +H  L+  LD G  
Sbjct  127   YFPSLALHKAAGGFGGFKIQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLRAILDGGSD  186

Query  1252  FPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
              PSP GLLINGR LN  TFT +QG TY FR+SNVG+TT+INFRIQ HK+ LVEVEG+HT+
Sbjct  187   LPSPDGLLINGRGLNGNTFTVEQGKTYRFRISNVGLTTAINFRIQGHKMLLVEVEGTHTL  246

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q+ Y+S+D+H+GQS   LVT +   +DYYIV S+RF    +T ++ILHY  S   V G  
Sbjct  247   QNTYESIDVHLGQSYSVLVTADQPPQDYYIVVSTRFTSQILTTTSILHYSNSAASVSGPP  306

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q  WS+ QAR++R NLTAN  RPNPQGSYHYG I +  T+ L++T   I+G  R
Sbjct  307   PGGPTIQIDWSLEQARSLRRNLTANGPRPNPQGSYHYGLINVTHTIRLQSTAPIINGKQR  366

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N VS++   TPLKLAD+  I GVF+L +I D P    A    SV   +   Y E++F
Sbjct  367   YAVNSVSFIPADTPLKLADYFKISGVFSLGSIPDYPTGSGAYLQTSVMAADFRGYAEVVF  426

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             +N E  +QS+H+DG +F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + L
Sbjct  427   ENPEDVVQSWHVDGHNFFVVGMDGGQWTPANRLTYNLRDTISRCTVQVYPKSWTAVYMPL  486

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWN+RS  W R YLGQQ+YLRV++  +S   E  +P + L CG
Sbjct  487   DNVGMWNIRSENWARQYLGQQLYLRVYSPVNSWRDEYPIPSNALKCG  533



>ref|XP_008382461.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=535

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/528 (53%), Positives = 364/528 (69%), Gaps = 4/528 (1%)
 Frame = -2

Query  1795  FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvit  1616
              L+FL  V+    + +V AEDPYR+++W V YG I PLG +Q+GILINGQFPGPEI  +T
Sbjct  2     LLKFLAAVV--LVLGLVSAEDPYRYFDWNVTYGDIYPLGARQQGILINGQFPGPEIYSVT  59

Query  1615  nenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTY  1436
             N+N+I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++
Sbjct  60    NDNLIINVHNSLPEPFLISWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSF  119

Query  1435  SYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGK  1256
              YF S   H+AAGG+GA+ I  R  IP+P+PEP+  Y++++ DW+ TDHK L+  LD G 
Sbjct  120   YYFPSLAFHKAAGGFGAIKIJSRPRIPVPFPEPAGDYSILIGDWYKTDHKVLKAILDRGH  179

Query  1255  PFPSPKGLLINGRLNS-VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHT  1079
               P P  +LINGR  S  TFT +QG TY  R+SNVG+  S+NFRIQ H LKLVEVEG+HT
Sbjct  180   RLPFPDSVLINGRGPSGTTFTFEQGKTYRLRISNVGLQNSLNFRIQGHXLKLVEVEGTHT  239

Query  1078  MQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGK  899
             +Q  Y+SLDIHVGQS   LVT +   +DYYI  S+RF    +T++AI HY  S  +V G 
Sbjct  240   LQTTYESLDIHVGQSYSVLVTADQAPQDYYIAVSTRFTSKVLTSTAIFHYSNSARQVSGP  299

Query  898   LPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGIT  719
             +P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG + + RT++L+++   +SG  
Sbjct  300   IPGGPT-QTGWSLSQARSIRTNLTASGPRPNPQGSYHYGLVNVSRTIMLQSSAAQVSGKQ  358

Query  718   RYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEII  539
             RYA+N VS++   TPLKLAD+  I GVF + +I D P         SV G +   +VEI+
Sbjct  359   RYAVNSVSFIPADTPLKLADYFKIDGVFKVGSISDYPTHQNMYLDTSVMGADFRAFVEIV  418

Query  538   FQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVS  359
             F+N E  +QS+HLDG  FW VG  GG W  T R +YNL DA +R T QVYP SWTAI ++
Sbjct  419   FENKENIVQSFHLDGYSFWVVGMDGGKWTPTSRNEYNLRDAVSRSTTQVYPKSWTAIYIA  478

Query  358   LDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LDN GMWN+RS  W R YLGQQ YLRV++   S   E  +P + LLCG
Sbjct  479   LDNVGMWNVRSEFWARQYLGQQFYLRVYSPVESTRDEFPIPRNALLCG  526



>ref|XP_004144874.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004152953.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/525 (52%), Positives = 370/525 (70%), Gaps = 2/525 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F + ++    I++  A+ PYRF++W V YG I PLGV+Q+GILINGQFPGP+I  +TN+N
Sbjct  13    FTVALVFSSFINIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDN  72

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             + +NV N L EP L +WNG++QRK+S+ DGV GT CPI P  N+TYR+Q+KDQIG+Y YF
Sbjct  73    IYINVHNSLPEPFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYF  132

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G++ ++ R +IP+P+PEP+A YTL++ DW+  +H  L+  LD G   P
Sbjct  133   PSLAFHKAAGGFGSIRVLSRPLIPVPFPEPAADYTLLIGDWYTANHTTLKTILDRGHKLP  192

Query  1246  SPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
              P G++INGR  N+ TFT ++G TY  R++NVG+  S+NFR+Q+H++KLVEVEG+HTMQ+
Sbjct  193   FPNGIVINGRGPNATTFTVEKGKTYRLRITNVGLQHSLNFRVQDHEMKLVEVEGTHTMQN  252

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              Y SLD+HVGQS   L+T +   +D+YIV S+RF    + ++AILHY  S T V G +P 
Sbjct  253   TYSSLDVHVGQSYSVLITADQPSRDFYIVVSTRFAPKVLISTAILHYSDSTTSVGGPIPG  312

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  +  WS+ QAR+IR NLTA+  RPNPQGSYHYG I I RT+ LE++   +S   RYA
Sbjct  313   GPT-EVEWSINQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAALVSRKQRYA  371

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VS++   TPLKLAD+  I GVF++ ++ D P   P     SV G +   ++EI+FQN
Sbjct  372   VNSVSFIPADTPLKLADYFGIDGVFSVGSVPDVPSRKPMYLDTSVMGADYRAFIEIVFQN  431

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
             +E  +QS+H+DG  FW VG  GGVW    R++YNL DA +R T QVYP SWTAI +SLDN
Sbjct  432   HENIVQSWHIDGYSFWVVGMDGGVWTPASREQYNLRDAVSRCTTQVYPKSWTAIYMSLDN  491

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWN+RS  W R YLGQQ YLRV+    S   E ++P + LLCG
Sbjct  492   VGMWNIRSEFWARQYLGQQFYLRVYTPVKSFRDEYNVPDNALLCG  536



>ref|XP_006348131.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=548

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/525 (55%), Positives = 361/525 (69%), Gaps = 1/525 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F + ++    +  V A +PYR+Y W + YG I PLGVKQ+GILINGQFPGP+I+ +TN+N
Sbjct  14    FTIILVLVTTLQTVYAGNPYRYYTWKITYGNIYPLGVKQQGILINGQFPGPQIDCVTNDN  73

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I++V N L EP L +WNGI+QR++SW DGV G+ CPILP  N+TY +Q KDQIG+Y YF
Sbjct  74    LIISVYNYLSEPFLISWNGIQQRRNSWQDGVYGSTCPILPGKNFTYTLQAKDQIGSYFYF  133

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S  +H+AAGGYGA+ +  R  IP+P+  P+  +T++  D +   H+QL+  LD+G   P
Sbjct  134   PSLAMHKAAGGYGAIRVYSRPRIPVPFAPPAHDFTVLAGDLYKRSHRQLKYILDSGHDLP  193

Query  1246  SPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
              P GL+INGR  N  TFT  QG TY FR+SNVG+ TSINFRIQ H +KLVEVEGSHT+Q 
Sbjct  194   LPDGLIINGRGWNGYTFTVDQGKTYRFRISNVGIATSINFRIQGHTMKLVEVEGSHTLQT  253

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              Y SLDIH+GQS   LVT N   KDYY+V SSRF    +T +A+LHY  S TKV G  P 
Sbjct  254   TYTSLDIHLGQSYSVLVTANQPPKDYYVVVSSRFTTRVLTTTAVLHYSNSWTKVSGPPPG  313

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  Q +WS+ QAR+IRWNLTA+  RPNPQGSYHYG I   RT++L N+   I+G  RYA
Sbjct  314   GPTTQINWSLYQARSIRWNLTASGPRPNPQGSYHYGLIKPSRTIMLANSAPYINGKQRYA  373

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VSY +P TPLKLAD  NI GVF L +I D P  G A  G  V       YVEIIFQN
Sbjct  374   VNSVSYTDPDTPLKLADHFNIGGVFNLGSISDQPYNGNAYIGTPVMSANFRSYVEIIFQN  433

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
              E T+QS+H+DG  F+ VG  GG W  + R  YNL D   R TVQVYP SWTAI ++LDN
Sbjct  434   WENTVQSWHIDGYSFFVVGMDGGQWTPSSRAHYNLRDTIARCTVQVYPKSWTAIYMALDN  493

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWN+RS  W R YLGQQ YLRV++  +S   E  +P + +LCG
Sbjct  494   VGMWNIRSENWSRRYLGQQFYLRVYSPANSWRDELPIPKNAILCG  538



>ref|XP_004500896.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=548

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/513 (55%), Positives = 357/513 (70%), Gaps = 1/513 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
             + EAEDPYRF+NW V YG I PLGV+QRGILINGQFPGP+I+ +TN+N+I+NV N LDEP
Sbjct  26    ITEAEDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEP  85

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   H+AAGG+
Sbjct  86    FLISWNGIQQRRNSFEDGVFGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLSFHKAAGGF  145

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-L  1214
             G + I+ R  IP+P+P+P   YT+++ DW+ ++H  L+  LD GK  P P G+LINGR  
Sbjct  146   GGIRILSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGILINGRGP  205

Query  1213  NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQS  1034
             N ++F  +QG TY  R+SNVG+  S+NFRIQNHKLKLVEVEG+HT+Q  Y SLD+HVGQS
Sbjct  206   NEISFNVEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQS  265

Query  1033  AGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQ  854
                LVT +   +DYYIV S+RF    +T + +L Y  S   V G  P  P  Q  WS+ Q
Sbjct  266   YSVLVTADQPSQDYYIVVSTRFSSKILTTTGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQ  325

Query  853   ARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTP  674
             AR+IR NLTA+  RPNPQGSYHYG I   +T++L ++   ++G  RYA+N VSYV P TP
Sbjct  326   ARSIRTNLTASGPRPNPQGSYHYGLINTTKTIILSSSPGQVNGKQRYAINSVSYVAPDTP  385

Query  673   LKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDG  494
             LKLAD+  I GVF + +I D P  G      SV   +   +VEI+FQNNE  +QSYHLDG
Sbjct  386   LKLADYFKISGVFRVGSISDRPTGGGIYLDTSVLQADYRSFVEIVFQNNENIIQSYHLDG  445

Query  493   QDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWP  314
               F+ VG  GG W +  R +YNL DA  R T QVYP SWTAI V+LDN GMWNLRS  W 
Sbjct  446   YSFFVVGMDGGQWTTASRNQYNLRDAVARCTTQVYPYSWTAIYVALDNVGMWNLRSEFWA  505

Query  313   RNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             R YLGQQ YLRV+    S+  E  +P + LLCG
Sbjct  506   RQYLGQQFYLRVYTTSTSIRDEFPIPKNALLCG  538



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/520 (53%), Positives = 363/520 (70%), Gaps = 2/520 (0%)
 Frame = -2

Query  1771  LAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnv  1592
             LA F I +  AE PYRF+ W V YG I PLGV+Q+GILINGQFPGP+I  +TN+N+I+NV
Sbjct  17    LAMFAI-VARAESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINV  75

Query  1591  iNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQL  1412
              N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG+Y YF S   
Sbjct  76    HNSLPEPFLISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGF  135

Query  1411  HRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGL  1232
              +AAGG+G + I+ R +IP+P+PEP+  +T+++ DW+  +H +L+  LD G   PSP G+
Sbjct  136   QKAAGGFGGIRILSRPLIPVPFPEPAGDFTVLIGDWYKANHNKLKSVLDRGHRLPSPDGI  195

Query  1231  LINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             LING   N  +FT +QG TY FR+SNVG+  S+NFRIQ HK+KLVEVEG+HT+Q  Y SL
Sbjct  196   LINGHGSNGASFTVEQGKTYRFRISNVGLQHSLNFRIQGHKMKLVEVEGTHTIQTTYSSL  255

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   LVT++   +D+YI  S+RF    +T++  LHY  S   V G +P  P  Q
Sbjct  256   DVHVGQSYSVLVTMDQPPQDFYIAVSTRFTNKVLTSTGTLHYSNSAHPVSGPVPGGPTTQ  315

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR+IR NLTA+  RPNPQGSYHYG I I RT+ LE++   ++G  RYA+N VS
Sbjct  316   IDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAGQVNGKQRYAVNSVS  375

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             ++   TPLKLAD+  I GVF + +I+D P  G      SV G +   ++EI+FQN+E  +
Sbjct  376   FIPADTPLKLADYFKIGGVFRVGSIQDQPTGGNIYLDTSVMGADFRGFIEIVFQNHENIV  435

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QS+H+DG +FW VG  GGVW    R +YNL DA +R T QVYP SWTAI V+LDN GMWN
Sbjct  436   QSWHIDGYNFWVVGMNGGVWTPASRNEYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWN  495

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +RS  W R YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  496   VRSEFWARQYLGQQFYLRVYSPVESIRDEYPIPKNALLCG  535



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/524 (53%), Positives = 359/524 (69%), Gaps = 3/524 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F++G+   F  +   AEDPYRF++W V YG I PLGV+QRGILINGQFPGP+I+ +TN+N
Sbjct  11    FIVGISLIFAAA---AEDPYRFFDWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDN  67

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF
Sbjct  68    LIINVFNSLDEPFLISWNGIQQRRNSFQDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYF  127

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+ ++H  L+ QLD+G   P
Sbjct  128   PSLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRVQLDSGNKLP  187

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
                G+LINGR +  T   +QG TY  R+SNVG+  S+NFRIQNHK+K+VEVEG+HT+Q  
Sbjct  188   LADGILINGRGSGATLNVEQGKTYRLRISNVGLQNSLNFRIQNHKMKVVEVEGTHTLQTT  247

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             + SLD+HVGQS   LVT +   +DYYIV SSRF  P +T + +L Y  S   V G +P  
Sbjct  248   FSSLDVHVGQSYSVLVTADQPAQDYYIVVSSRFTSPVLTTTGVLRYSNSAGPVSGPIPGG  307

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR IR NLTA+  RPNPQGSYHYG I   RT+ L ++   ++G  RYA+
Sbjct  308   PTIQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAV  367

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+    TPLKLAD+  I GVF + +I D P  G      SV   +   +VEI+F+N 
Sbjct  368   NSVSFTPADTPLKLADYFKIDGVFRVGSISDHPTGGGIYLDTSVMQADYRAFVEIVFENP  427

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QS+HLDG  F+ VG  GG W    R +YNL DA  R TVQVYPNSWTAI V+LDN 
Sbjct  428   EDIVQSWHLDGYSFFVVGMDGGQWTPASRNEYNLRDAVARCTVQVYPNSWTAIYVALDNV  487

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWN+RS  W R YLGQQ YLRV+    SL  E  +P + LLCG
Sbjct  488   GMWNVRSEFWARQYLGQQFYLRVYTTSTSLRDEYPIPKNALLCG  531



>gb|KFK34651.1| hypothetical protein AALP_AA5G173600 [Arabis alpina]
Length=543

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/523 (52%), Positives = 363/523 (69%), Gaps = 1/523 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             +L  L+FF  ++V  E PYRFY+W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+NV
Sbjct  12    VLFCLSFFA-AVVTGESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNV  70

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N LDEP L +WNG++ R++S+ DG+ GT CPI P TN+TY +QMKDQIG++ YF 
Sbjct  71    IINVHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQMKDQIGSFYYFP  130

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             +   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+ +LD GK  PS
Sbjct  131   TLAFHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDKGKKLPS  190

Query  1243  PKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
             P G+LINGR +  T   +QG TY  R+SNVG+  S+NFRIQ HK+KLVEVEG+HT+Q  +
Sbjct  191   PDGILINGRSSGATINVEQGKTYRLRISNVGLQNSLNFRIQGHKMKLVEVEGTHTLQTIF  250

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
               LD+HVGQ+   L+T +   +DYY+  SSRF     T + +L Y GS T   G +P  P
Sbjct  251   SELDVHVGQTYSVLITADQSPRDYYVAVSSRFTDKINTTTGVLRYSGSSTPASGPVPWGP  310

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
             + Q  WS+RQAR IR NLTA+  RPNPQGSYHYG +P+ RT+V  ++   I+G  RY +N
Sbjct  311   SIQVDWSLRQARAIRTNLTASGPRPNPQGSYHYGLVPLARTIVFGSSAGQINGKQRYGVN  370

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
              VS+V   TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EI+F+N E
Sbjct  371   SVSFVPADTPLKLADYFKISGVYKVNSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENQE  430

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
               +QSYHL+G  FW VG  GG W S+ R  YNL D  +R TVQVYP SWTAI ++LDN G
Sbjct  431   DIVQSYHLNGYSFWVVGMDGGQWSSSSRNGYNLRDGVSRCTVQVYPKSWTAIYIALDNVG  490

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWNLRS  W R YLGQQ+Y+RV+    SL  E  +P ++ LCG
Sbjct  491   MWNLRSEFWARQYLGQQLYVRVYTTSTSLRDEYPIPKNSHLCG  533



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/527 (53%), Positives = 360/527 (68%), Gaps = 6/527 (1%)
 Frame = -2

Query  1777  GVLAFFCIS-----MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
              +   FCI+     +V AEDPYRF+NW V YG I PLG++Q+GILINGQFPGP+I+ +TN
Sbjct  10    AICTLFCIAVSFFAIVGAEDPYRFFNWNVTYGDIYPLGIRQQGILINGQFPGPDIHSVTN  69

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
             +N+I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ 
Sbjct  70    DNLIINVFNSLDEPFLLSWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFY  129

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF S   H+AAGG+G + I+ R  IP+P+ +P   YT+++ DW+ ++H  L+  LD GK 
Sbjct  130   YFPSLAFHKAAGGFGGIRILSRPRIPVPFADPDGDYTILIGDWYKSNHTDLKAHLDNGKK  189

Query  1252  FPSPKGLLINGRLNSVTF-TGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
              P P G+LINGR  S  + T +QG TY  R+SN+G+  S+NFRIQNHK+KLVEVEG+HT+
Sbjct  190   LPFPDGILINGRGPSGYYLTVEQGKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTL  249

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q  Y SLD+HVGQS   L T +   +DYYIV SSRF    +T + +LHY  S   V G  
Sbjct  250   QTTYSSLDVHVGQSYSVLFTADQPGQDYYIVVSSRFTTQVLTTTGVLHYSNSAGSVSGPP  309

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   RT++L ++   ++G  R
Sbjct  310   PGGPTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTSRTIILASSAGQVNGKQR  369

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             YA+N VS++   TPLKLAD+  IPGVF  N+I D P  G      SV  ++   +VEI+F
Sbjct  370   YAVNSVSFIPQDTPLKLADFFKIPGVFKENSISDRPYGGGIYLDTSVLTVDYRAFVEIVF  429

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE  +QS+HLDG  F+ VG  GG W S  R +YNL DA  R T QVYP SWTAI V L
Sbjct  430   QNNEDIVQSWHLDGYSFFVVGMDGGQWTSASRDQYNLRDAVARCTAQVYPMSWTAIYVPL  489

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWNLR+  W R YLGQQ+YLRV+    SL  E  +P + L CG
Sbjct  490   DNVGMWNLRTEFWARQYLGQQLYLRVYTTSTSLRDEYPIPKNALTCG  536



>ref|XP_010266098.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=547

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/511 (55%), Positives = 357/511 (70%), Gaps = 1/511 (0%)
 Frame = -2

Query  1744  EAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPIL  1565
             +AEDPYRF+ W V YG I PLGV+Q+GILINGQFPGP+I  +TN+N+I+NV N L EP L
Sbjct  27    KAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFL  86

Query  1564  FTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGA  1385
              +WNGI+QR++SW DGV GTNCPI P  N+TY +Q+KDQIG++ YF S   H+AAGG+G 
Sbjct  87    LSWNGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGG  146

Query  1384  LNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-LNS  1208
             + I+ R  IP+P+P+P+  +T+++ DW+N  H  L+ +LD GK    P G+LINGR  N 
Sbjct  147   IRILSRPRIPVPFPDPAGDFTVLIGDWYNASHTALKAKLDRGKRLHFPDGILINGRGPNG  206

Query  1207  VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAG  1028
              +FT +QG TY FR+SNVG+  S+NFRIQ HK+KLVEVEG+HT+Q  + SLD+HVGQS  
Sbjct  207   ASFTVEQGKTYRFRISNVGLQNSLNFRIQGHKMKLVEVEGTHTLQTVFSSLDVHVGQSYS  266

Query  1027  FLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQAR  848
              LVT +   +DYYI  S+RF    +T +AILHY  SV +V G  P  P  Q  WS+ QA 
Sbjct  267   VLVTADQPAQDYYIAVSTRFTSVVLTTTAILHYSNSVGRVSGSPPAGPTFQIDWSLNQAL  326

Query  847   TIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLK  668
             +IR NLTA+  RPNPQGSYHYG I I RT+ L N+   I+G  RYA+N VS+V   TPLK
Sbjct  327   SIRTNLTASGPRPNPQGSYHYGLINITRTIRLANSAGLINGKQRYAVNGVSFVPADTPLK  386

Query  667   LADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQD  488
             LAD+  I GVF L +I D P  G      SV   +   +VEI+F+N+E  +QS+HLDG  
Sbjct  387   LADYFKIGGVFRLGSISDNPTGGQRYLDTSVMPADFRAFVEIVFENHESIVQSWHLDGYS  446

Query  487   FWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRN  308
             F+ VG  GG W  T RK+YNL DA  R T QVYP SWTAI V+LDN GMWNLR+  W R 
Sbjct  447   FFVVGMDGGKWTPTSRKQYNLRDAIVRCTTQVYPKSWTAIYVALDNVGMWNLRTEFWARQ  506

Query  307   YLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  507   YLGQQFYLRVYSPVESIRDEYPIPKNALLCG  537



>ref|XP_010918208.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/512 (54%), Positives = 353/512 (69%), Gaps = 1/512 (0%)
 Frame = -2

Query  1747  VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPI  1568
             V A++PYRF+ W V +G I PLGV+Q+GILINGQFPGP+I  +TN+N+I+NV N L EP 
Sbjct  20    VGADNPYRFFTWNVSFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLSEPF  79

Query  1567  LFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYG  1388
             L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG++ YF S   H+AAGG+G
Sbjct  80    LISWNGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLYFHKAAGGFG  139

Query  1387  ALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-LN  1211
                I+ R +IP+P+ EP+  YT+++ DW+  +H  L+  LD GK  P P G+LINGR  N
Sbjct  140   GFRILSRPLIPVPFSEPAGDYTVLIGDWYKANHTALRATLDGGKKLPFPDGILINGRGPN  199

Query  1210  SVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSA  1031
                FT  QG TY  R+SNVG+  S+N RIQNH +KLVEVEG+HT+Q  Y S+D+HVGQS 
Sbjct  200   GAYFTVDQGKTYRLRISNVGLQNSLNIRIQNHTMKLVEVEGTHTLQSSYSSIDVHVGQSL  259

Query  1030  GFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQA  851
               LVT +   KDYYI  S+RF    +T +A+LHY  S  KV G +P  P  Q  WS+ QA
Sbjct  260   SVLVTADQSPKDYYIAVSTRFTTIILTTTAVLHYSNSGQKVTGLIPGGPTTQIDWSLNQA  319

Query  850   RTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPL  671
             R+ R NLTA+  RPNPQGSYHYG I + RT+ L ++   ++G  RYA+N VSYV P TPL
Sbjct  320   RSFRTNLTASGPRPNPQGSYHYGMINLTRTIRLASSAAQVNGKQRYAVNSVSYVEPDTPL  379

Query  670   KLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQ  491
             KLAD+  I GVF L +I D P  G      SV   +   +VEI+FQNNE  +QS+HLDG 
Sbjct  380   KLADYYKIGGVFRLGSISDNPTGGKEYLDTSVMAADYRVFVEIVFQNNEDIVQSWHLDGY  439

Query  490   DFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPR  311
             +FW VG  GG W S  RK YNL DA +R T QVYP SWTA+ + LDN GMWN+R+  W R
Sbjct  440   NFWVVGMDGGQWSSDSRKGYNLRDAVSRCTTQVYPKSWTAVYLMLDNVGMWNVRTEYWAR  499

Query  310   NYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  500   QYLGQQFYLRVYSPLESIRDEYPIPKNALLCG  531



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/530 (53%), Positives = 362/530 (68%), Gaps = 1/530 (0%)
 Frame = -2

Query  1801  SGFLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinv  1622
             S +L  +  V+ F  ++ +  EDPYRFY W V YG I PLGVKQ+GILINGQFPGP I  
Sbjct  6     STWLPLMAMVMMFLHVNFIHGEDPYRFYAWNVTYGDIYPLGVKQQGILINGQFPGPPIQC  65

Query  1621  itnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIG  1442
             +TN+N+I+NV N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG
Sbjct  66    VTNDNLIINVFNNLDEPFLISWNGVEQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIG  125

Query  1441  TYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDT  1262
             ++ YF S   H+AAGG+G++NI  RSVIP+P+P P+  ++++  DW+  +H  L+  LD 
Sbjct  126   SFYYFPSLAFHKAAGGFGSINIASRSVIPVPFPSPAGEFSILTGDWFKQNHSDLKAILDG  185

Query  1261  GKPFPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGS  1085
             G   P P GLLING   N  TFT  QG TY FR+SNVG+TTS+NFRIQ HK+ +VEVEG+
Sbjct  186   GHDLPFPDGLLINGHGSNGYTFTVDQGKTYRFRISNVGLTTSVNFRIQGHKMTVVEVEGT  245

Query  1084  HTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVP  905
             HT+Q+ YDSLDIH+GQS   L+T +   +DYYIV S+RF    +TA++ L Y  S   V 
Sbjct  246   HTVQNAYDSLDIHLGQSYSVLLTADQPAQDYYIVVSTRFTSQVLTATSTLRYSNSAGSVS  305

Query  904   GKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISG  725
             G  P  P  +  WS  QAR++R NLTA+  RPNPQGSYHYG I   RT+ L N+   I+G
Sbjct  306   GPPPGGPTIEIDWSFNQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLANSAPIING  365

Query  724   ITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVE  545
               RYA+N VS++   TPLKLAD  NIPGVFTL +I D+P    A    SV   +   Y E
Sbjct  366   KQRYAINSVSFIPADTPLKLADHFNIPGVFTLGSIPDSPTGSGAYLQTSVMSADFRAYTE  425

Query  544   IIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAIL  365
             ++F+N E ++QSYH+DG  F+ VG G G W    R  YNL D  +R TVQVYP SWTA+ 
Sbjct  426   VVFENLEDSVQSYHIDGHHFFVVGMGRGEWTPASRLTYNLRDTISRSTVQVYPKSWTALY  485

Query  364   VSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             + LDN GMWN+RS  W R YLGQQ YLRV++  +S   E+ +P + L CG
Sbjct  486   MPLDNVGMWNIRSQNWARQYLGQQFYLRVYSPVNSWRDESPVPSNVLHCG  535



>ref|XP_007131584.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
 gb|ESW03578.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
Length=545

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/541 (52%), Positives = 368/541 (68%), Gaps = 11/541 (2%)
 Frame = -2

Query  1816  MRQPPSGFLRFLLGVLAFFC-------ISMVEAEDPYRFYNWVVQYGTISPLGVKQRGIL  1658
             M   PS  LR     L+ FC       +  V AEDPYRF++W V YG I PLGVKQ+GIL
Sbjct  1     MMNKPSQQLR----ALSAFCSVLLLLDLVFVAAEDPYRFFDWTVTYGDIYPLGVKQQGIL  56

Query  1657  INGQFPGPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTN  1478
             INGQFPGPEI  +TN+N+I+NV N L EP L +WNG++QR++S+ DGV GT CPI P  N
Sbjct  57    INGQFPGPEIYSVTNDNLIINVRNNLTEPFLLSWNGVQQRRNSYQDGVYGTTCPIPPGQN  116

Query  1477  WTYRMQMKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWN  1298
             +TY +Q+KDQIG++ YF S   H+AAGG+GA+ I+ R  IP+P+P+P+  ++L++ DW+ 
Sbjct  117   FTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIKILSRPRIPVPFPDPAGDFSLLIGDWYQ  176

Query  1297  TDHKQLQKQLDTGKPFPSPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQN  1118
              +HK LQ  LD G   P P+ +LINGR N  TFT +QG TY  R+SNVG+  S+NFRI+ 
Sbjct  177   INHKTLQTVLDLGHRLPLPQAVLINGRPNGTTFTVEQGKTYRLRISNVGLENSLNFRIEG  236

Query  1117  HKLKLVEVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAI  938
             H +KLVEVEG+HT+Q  Y SLD+HVGQS   L+T +   KDYYI  S+RF    +T++A 
Sbjct  237   HSMKLVEVEGTHTIQTTYSSLDVHVGQSYSVLITADQAPKDYYIAVSTRFTDKIITSTAN  296

Query  937   LHYDGSVTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTL  758
             LHY  S   V G +P  P  Q  WS++QAR+IR NLTA+  RPNPQGSYHYG I + RT+
Sbjct  297   LHYSNSQQSVSGLIPGGPTDQIDWSLQQARSIRTNLTASGPRPNPQGSYHYGLINVSRTI  356

Query  757   VLENTKENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVS  578
              L ++   ++   RYA+N VS++   TPLKLAD+  I GVF + +I D+P   P     S
Sbjct  357   TLVSSAAQVNRKQRYAVNSVSFIPADTPLKLADYFKIGGVFQVGSIPDSPSRKPMYLDTS  416

Query  577   VFGLELHDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTV  398
             V G +   +VEI+FQN+E  +QS+H+DG  FW VG  GGVW    R +YNL DA +R T 
Sbjct  417   VMGADFRAFVEIVFQNHENIVQSWHIDGYSFWVVGMDGGVWTPQSRNEYNLRDAVSRSTT  476

Query  397   QVYPNSWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLC  218
             QVYP SWTAI ++LDN GMWN+RS  W R YLGQQ Y+RV++   S+  E  +P + LLC
Sbjct  477   QVYPKSWTAIYMALDNVGMWNVRSEFWARQYLGQQFYMRVYSPVGSIRDEYPIPKNALLC  536

Query  217   G  215
             G
Sbjct  537   G  537



>ref|XP_010500092.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/524 (52%), Positives = 364/524 (69%), Gaps = 3/524 (1%)
 Frame = -2

Query  1777  GVLAFFCISM---VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             G +   C+S    V AE PYRFY+W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N
Sbjct  9     GTVLLLCLSFLATVTAESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDN  68

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNG++ R++S+ DG+ GT CPI P +N+TY +Q+KDQIG++ YF
Sbjct  69    LIINVHNSLDEPFLISWNGVQNRRNSYVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYF  128

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ T+H  L+ +LD G+  P
Sbjct  129   PSLAFHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKTNHTDLKSRLDRGRKLP  188

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             SP G+LINGR    T   +QG TY  R+SNVG+  S+NFRIQNH++KLVEVEG+HT+Q  
Sbjct  189   SPDGILINGRSYGATINVEQGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTLQTM  248

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             + SLDIHVGQS   L+T +   +DYY+V SSRF    +T + +L Y GS     G +P  
Sbjct  249   FSSLDIHVGQSYSVLITADQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSASASGPIPGG  308

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR IR NLTA+  RPNPQGSYHYG IP++RT+V  ++   I+G  RY +
Sbjct  309   PTIQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGV  368

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+V+  TPLKLAD+  I GV+ +N+I D P  G      SV  ++   ++EIIF+N 
Sbjct  369   NSVSFVSSDTPLKLADFFKISGVYKINSISDKPTGGGLYLDTSVLQVDYRTFIEIIFENK  428

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QSYHL+G  FW VG  GG W +  R  YNL DA +R TVQVYP SWTAI ++LDN 
Sbjct  429   EDIVQSYHLNGYSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNV  488

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS  W R YLGQQ+YLRV+ +  SL  E  +P ++ LCG
Sbjct  489   GMWNLRSEFWARQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCG  532



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/513 (55%), Positives = 356/513 (69%), Gaps = 1/513 (0%)
 Frame = -2

Query  1750  MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEP  1571
              + AEDPYRF+ W V YG I PLGVKQ+GILINGQFPGP I  +TN+N+I+NV N LDEP
Sbjct  22    CIIAEDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEP  81

Query  1570  ILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGY  1391
              L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S   H+AAGGY
Sbjct  82    FLISWNGLEQRRNSWQDGVWGTNCPIPPGKNYTYALQVKDQIGSYFYFPSLAFHKAAGGY  141

Query  1390  GALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-L  1214
             G + I  RSVIP+P+  P+  YT++  DW+N  H  L+  LD+G   P P GLLINGR  
Sbjct  142   GGIKIASRSVIPVPFAPPAGDYTILAGDWFNQSHNDLKAILDSGHNLPFPNGLLINGRGT  201

Query  1213  NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQS  1034
             N   FT + G TY FR+SNVG+ TSINFRIQ HK+ LVEVEG+HT+Q+ YDSLDIH+GQS
Sbjct  202   NGYVFTVEHGKTYRFRISNVGLATSINFRIQGHKMVLVEVEGTHTLQNTYDSLDIHLGQS  261

Query  1033  AGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQ  854
                LVT +  ++DYY+VAS RF    +TA+++L Y  S   V G  P  P  +  WS+ Q
Sbjct  262   YSVLVTADQPIQDYYLVASMRFTPQVLTATSVLRYSNSQKSVSGPPPGGPTIEVDWSLNQ  321

Query  853   ARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTP  674
             AR++R NLTA+  RPNPQGSYHYG I    T+ L N+   I+G  RYA+N VS++   TP
Sbjct  322   ARSLRRNLTASGPRPNPQGSYHYGLINTTHTIRLANSAPIINGKQRYAVNSVSFIPADTP  381

Query  673   LKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDG  494
             +KLAD+ NIPGVF+L++I   P  G      SV   E   Y EI+F+N+E TLQS+H+DG
Sbjct  382   VKLADYFNIPGVFSLSSIPQNPTGGGGYLQTSVMASEYRGYAEIVFENSEDTLQSWHIDG  441

Query  493   QDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWP  314
               F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + LDN GMWN+RS  W 
Sbjct  442   HHFFVVGMDGGEWTPASRFVYNLRDTISRSTVQVYPKSWTAVYMPLDNAGMWNVRSQDWA  501

Query  313   RNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             R +LGQQ YLR+++  +S   EN +P +TLLCG
Sbjct  502   RQHLGQQFYLRIFSPANSWRDENPIPSNTLLCG  534



>ref|XP_008236098.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=536

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/516 (53%), Positives = 356/516 (69%), Gaps = 1/516 (0%)
 Frame = -2

Query  1759  CISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKL  1580
              +    AEDPYRF++W + YG I PLGV+Q+GILINGQFPGPEI  +TN+N+I+NV N L
Sbjct  12    VLGFATAEDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSL  71

Query  1579  DEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAA  1400
              EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   H+AA
Sbjct  72    PEPFLISWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAA  131

Query  1399  GGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLING  1220
             GG+GA+ I+ R  IP+P+P+P+  Y++++ DW+ TDHK L+  LD G   P P G++ING
Sbjct  132   GGFGAIKILSRPRIPVPFPDPAGDYSILIGDWYKTDHKILKGILDRGHRLPFPDGIIING  191

Query  1219  R-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHV  1043
             R  N   FT  QG TY  R+SNVG+  S+NFRIQ HKLKLVEVEG+HT+Q  Y+SLDIHV
Sbjct  192   RGPNGTYFTFDQGKTYRLRISNVGLQNSLNFRIQGHKLKLVEVEGTHTIQTTYESLDIHV  251

Query  1042  GQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWS  863
             GQS   LVT +   +DYYI  S+RF    +T++A+ HY  S  +V G +P  P  Q  WS
Sbjct  252   GQSYSVLVTADQAPQDYYIAVSTRFTSQVLTSTAVFHYSNSARQVSGPIPAGPTTQTGWS  311

Query  862   MRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNP  683
             + QA +IR NLTA+  RPNPQGSYHYG + + RT+ LE++   +SG  RYA+N VS++  
Sbjct  312   LSQALSIRTNLTASGPRPNPQGSYHYGLVNVSRTIKLESSAAQVSGKQRYAVNSVSFIPA  371

Query  682   TTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYH  503
              TPLKLAD+  I GVF + +I D P         SV G +   +VEI+FQN+E  +QS+H
Sbjct  372   DTPLKLADYFKIGGVFKVGSISDNPTGQKMYLDTSVMGADFRAFVEIVFQNHENIVQSWH  431

Query  502   LDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSS  323
             LDG  FW VG  GG W    R KYNL DA +R T QVYP SWTAI ++LDN GMWNLRS 
Sbjct  432   LDGYSFWVVGMDGGKWTPASRNKYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRSE  491

Query  322   VWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              W R YLGQQ YLRV++   S   E  +P + LLCG
Sbjct  492   FWARQYLGQQFYLRVYSPVESARDEYPIPRNALLCG  527



>ref|XP_010103300.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95367.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=548

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/527 (53%), Positives = 363/527 (69%), Gaps = 5/527 (1%)
 Frame = -2

Query  1792  LRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitn  1613
                +L VLA     +V AEDPYRF++W + YG I PLGV+QRGILINGQFPGP+I  +TN
Sbjct  13    FSLILLVLA----GLVSAEDPYRFFDWKITYGDIYPLGVRQRGILINGQFPGPDIFSVTN  68

Query  1612  envivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYS  1433
             +N+I+NV N L EP L +W+G++ RK+S+ DGV GT CPI P  N+TY++QMKDQIGT+ 
Sbjct  69    DNIIINVQNNLPEPFLLSWSGVQNRKNSFEDGVYGTTCPIPPGKNFTYKLQMKDQIGTFF  128

Query  1432  YFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKP  1253
             YF S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+  DH++L+  LD G  
Sbjct  129   YFPSLAFHKAAGGFGGIKILSRPRIPVPFPDPAGDYTILIGDWYKLDHQKLKAILDGGHK  188

Query  1252  FPSPKGLLINGRLNSVT-FTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTM  1076
              P+P G+LINGR  S T FT + G TY  R+SNVG+  S+NFRIQ HK+KLVEVEG+HT+
Sbjct  189   LPNPDGILINGRGPSGTSFTFEPGKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTI  248

Query  1075  QDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKL  896
             Q  Y S+D+HVGQS   LVT +   +DYY   SSRF    + ++AI+HY  S  +V G +
Sbjct  249   QTTYSSIDVHVGQSYSVLVTADLAPQDYYFAVSSRFTDKVLPSTAIIHYSNSARQVSGPI  308

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  +  WS+ QAR+IR NLTA+  RPNPQGSYHYG I I RT++LE++   ++   R
Sbjct  309   PGGPTTEIDWSLNQARSIRTNLTASGPRPNPQGSYHYGQINISRTIILESSAALVNRKQR  368

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N VS+V   TPLKLAD+  I GVF + +I D PP        SV G +   +VEI+F
Sbjct  369   YGINSVSFVPADTPLKLADYFKIGGVFRVGSIADKPPRKKMYLDTSVMGADYRSFVEIVF  428

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QN E  +QSYHL+G +FW VG  GG W    RK+YNL DA +R T QVYP SWTAI V+L
Sbjct  429   QNRENIVQSYHLNGYNFWVVGMDGGQWTPASRKQYNLEDAVSRCTTQVYPRSWTAIYVAL  488

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWN+RS  W R YLGQQ YLRV+   +S   E  +P + LLCG
Sbjct  489   DNVGMWNIRSEFWARQYLGQQFYLRVYTPVNSTRDEYLIPQNALLCG  535



>ref|XP_002460757.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
 gb|EER97278.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
Length=548

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/510 (55%), Positives = 358/510 (70%), Gaps = 1/510 (0%)
 Frame = -2

Query  1741  AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPILF  1562
              +DPYRF+ W V YG I PLGVKQ+GILIN QFPGP+I  +TN+N+I+NV NKL+EP L 
Sbjct  29    GDDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLL  88

Query  1561  TWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGAL  1382
             +W+G++QR++S+ DGV GT CPI P  N+TY MQ KDQIGTY YF S   H+AAGG+G +
Sbjct  89    SWSGLQQRRNSFEDGVAGTTCPIPPGANFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGI  148

Query  1381  NIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-LNSV  1205
              ++ R  IP+P+P P+A YT+++ DW+  +H  L+  LD+GK    P GLLINGR LN  
Sbjct  149   RVLSRPQIPVPFPPPAADYTVLIGDWYKANHTDLRYVLDSGKAIGFPDGLLINGRSLNGY  208

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
             TFT + G TY FR++NVG+ TS+N R Q H +KLVEVEGSHTMQ  Y SLD+H+GQS   
Sbjct  209   TFTVQPGRTYRFRITNVGLATSLNIRFQGHTMKLVEVEGSHTMQTTYSSLDVHLGQSYSV  268

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             L+T +    DY +V S+RF    ++ +A+LHY  S  K PG LP  P  Q  WS+ QAR+
Sbjct  269   LLTADQPGFDYAVVVSTRFTAKIISTTAVLHYTNSAGKAPGSLPGGPTIQIDWSLNQARS  328

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKL  665
             IRWNLTA+  RPNPQGSYHYG +P+ RT+ L N+   ++G  RYA+N VSYV+P TPLK+
Sbjct  329   IRWNLTASGPRPNPQGSYHYGLVPVTRTIRLANSAAAVNGKQRYAVNSVSYVSPDTPLKV  388

Query  664   ADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQDF  485
             AD+  I GVF++  I D+P  G A    SV G    DYVEI+F+NNE  +QS+H+DG  F
Sbjct  389   ADYYKIGGVFSVGTIADSPTYGGAYLQTSVMGANYRDYVEIVFENNEDEVQSWHIDGYAF  448

Query  484   WAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRNY  305
             W VG  GG W S  R+ YNL D  +RYTVQVYP SWTAI + LDN GMWN+RS  W R Y
Sbjct  449   WVVGMDGGKWSSASRQGYNLRDGVSRYTVQVYPRSWTAIYMPLDNVGMWNVRSENWARQY  508

Query  304   LGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LGQQ YLRVW    SL  E  +P + LLCG
Sbjct  509   LGQQFYLRVWTPSTSLRDEYPIPKNALLCG  538



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/524 (53%), Positives = 361/524 (69%), Gaps = 3/524 (1%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             LL + A F I++  AEDPYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+
Sbjct  13    LLCLAALFSIAV--AEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNL  70

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF 
Sbjct  71    IINVFNSLDEPFLLSWNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFP  130

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+  +H  L+  LD GK  P 
Sbjct  131   SLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKANHTTLKAHLDRGKKLPF  190

Query  1243  PKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             P G+LINGR     +   +QG TY  R+SN+G+  S+NFRIQNHK+KLVEVEG+HT+Q  
Sbjct  191   PDGILINGRGPGGFSLNFEQGKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTLQTT  250

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y SLD+HVGQS   LVT +   +DYY+VASSRF  P +T +  +HY  S  KV G  P  
Sbjct  251   YSSLDVHVGQSYSVLVTADQPGQDYYLVASSRFTSPILTTTGTVHYANSAGKVSGPPPGG  310

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I + +T VL+N+   ++G  RY +
Sbjct  311   PTIQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYVLQNSAGQVNGKQRYGV  370

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+V   TPLKLAD+  I GVF + +I D P  G      SV G +   +VEI+FQNN
Sbjct  371   NSVSFVPADTPLKLADYFKIGGVFRVGSISDRPTGGGLYLDTSVLGADYRAFVEIVFQNN  430

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QS+HLDG  F+ VG  GG W +  R  YNL DA +R T QVYP SWTAI + LDN 
Sbjct  431   EDIIQSWHLDGYSFFVVGMDGGQWTTASRNAYNLRDAVSRCTTQVYPKSWTAIYIPLDNV  490

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLR+  W R YLGQQ+YLRV+    S+  E  +P +  LCG
Sbjct  491   GMWNLRTEFWARQYLGQQLYLRVYTPSTSIRDEYPIPRNARLCG  534



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/526 (53%), Positives = 362/526 (69%), Gaps = 4/526 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
              L   ++FF I  V AEDPYRF++W V YGTI PLG+ Q+GILINGQFPGP+I+ +TN+N
Sbjct  5     LLFLFISFFAI--VGAEDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDN  62

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +QMKDQIG++ YF
Sbjct  63    IIINVFNSLDEPFLLSWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYF  122

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+  +H  L+ QLD G   P
Sbjct  123   PSLGFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYQANHTTLRAQLDNGSMLP  182

Query  1246  SPKGLLINGRL--NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
              P G+LINGR    + +   +QG TY  R+SNVG+ +S+NFRIQ H++K+VEVEG+HT+Q
Sbjct  183   LPDGILINGRGPNRTASINVEQGKTYRLRISNVGLQSSLNFRIQGHRMKVVEVEGTHTLQ  242

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
              ++ SLD+HVGQS   LVT +   +D+YIV SSRF  P +T +AIL Y  S   V G  P
Sbjct  243   TEFSSLDVHVGQSYSVLVTADQPAQDFYIVVSSRFTTPILTTTAILRYANSAGSVQGPPP  302

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P  Q  WS+ QAR IR NLTA+  RPNPQGSYHYG I   RT+VL N+   ++G  RY
Sbjct  303   GGPTIQIDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIVLSNSAGIVNGKQRY  362

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
             A+N VS++   TPLK+AD+  I GVF + +I D P  G      SV G +   +VEI+FQ
Sbjct  363   AVNSVSFIPADTPLKVADFFKIGGVFRVGSISDWPNGGGIYQDTSVMGADYRAFVEIVFQ  422

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             NNE  +QS+H DG  F+ VG  GG W S  R +YNL DA  R TVQVYP SW+AI V+LD
Sbjct  423   NNEDLIQSWHFDGYSFFVVGMDGGQWTSNSRNQYNLRDAIARCTVQVYPKSWSAIYVALD  482

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N GMWN+RS  W R YLGQQ YLRV+    SL  E  +P + LLCG
Sbjct  483   NVGMWNIRSEFWARQYLGQQFYLRVYTPSTSLRDEYPIPKNALLCG  528



>dbj|BAK04971.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/540 (54%), Positives = 371/540 (69%), Gaps = 5/540 (1%)
 Frame = -2

Query  1825  VKKMRQPPSG--FLRFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILIN  1652
             V+KM    S    L FL+G L    + +V  EDPYRF+ W V YG I PLGVKQ+GILIN
Sbjct  4     VRKMAMGGSAVALLSFLIG-LPLLSV-LVAGEDPYRFFTWNVSYGDIYPLGVKQQGILIN  61

Query  1651  GQFPGPeinvitnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWT  1472
             GQFPGP+I+ +TN+N++VNV NKL+EP L +W+G++QR++S+ DGV GT CPI    N+T
Sbjct  62    GQFPGPQIDAVTNDNLVVNVFNKLNEPFLLSWSGVQQRRNSFEDGVAGTTCPIPAGANFT  121

Query  1471  YRMQMKDQIGTYSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTD  1292
             Y +Q+KDQIGTY YF S   H+AAGG+GA+ ++ R  IP+P+P P+A YT ++ DW+  +
Sbjct  122   YILQVKDQIGTYFYFPSLAFHKAAGGFGAIRVLSRPRIPVPFPPPAADYTALIGDWYKAN  181

Query  1291  HKQLQKQLDTGKPFPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNH  1115
             H  L+  LD+GK    P GLLINGR  N  TFT + G TY FR++NVG+ TS+N R Q H
Sbjct  182   HTDLRYMLDSGKALGFPDGLLINGRGWNGYTFTVRPGMTYRFRITNVGLATSLNIRFQGH  241

Query  1114  KLKLVEVEGSHTMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAIL  935
              +KLVEVEGSHTMQ  Y SLD+H+GQS   L+T +    DY IV S+RF    ++ +A+L
Sbjct  242   TMKLVEVEGSHTMQTSYSSLDVHLGQSYSVLLTADQPALDYAIVVSTRFTTKIISTTAVL  301

Query  934   HYDGSVTKVPGKLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLV  755
             HY  S  K PG LP  P  Q  WS+ QAR+IRWNLTA+  RPNPQGSYHYG +P  RT+ 
Sbjct  302   HYANSAGKAPGPLPGGPTTQIDWSLNQARSIRWNLTASGPRPNPQGSYHYGQVPTTRTIR  361

Query  754   LENTKENISGITRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSV  575
             L N+   I+G  RYA+N VS+VN  TPLK+AD+  +PGVF++  I D+P  G A    SV
Sbjct  362   LANSAATINGKQRYAVNGVSHVNADTPLKIADYYKMPGVFSVGTISDSPTYGGAYLRTSV  421

Query  574   FGLELHDYVEIIFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQ  395
              G +   YVEI+F+N+E  +QS+H+DG  FW VG  GG W    R+ YNL D  +RYTVQ
Sbjct  422   MGADYRGYVEIVFENSENEVQSWHIDGYAFWVVGMNGGKWSPASRQIYNLRDGVSRYTVQ  481

Query  394   VYPNSWTAILVSLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             VYPN+WTAI + LDN GMWN+RS  W R YLGQQ YLRVW    S   E  +P + LLCG
Sbjct  482   VYPNAWTAIYMPLDNVGMWNVRSETWARQYLGQQFYLRVWTPSTSWRDEFPIPKNALLCG  541



>ref|XP_010676489.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/521 (54%), Positives = 354/521 (68%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             +  FF I+  +AE PYRFY W V YG I PLGVKQ+GILINGQFPGP I  +TN+N+IV+
Sbjct  13    LFFFFIITSSKAESPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPPIEAVTNDNLIVS  72

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNGI+QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S  
Sbjct  73    VFNSLDEPFLLSWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYYYFPSLA  132

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGGYG + I  R +IP+PYP P+  +T++  DW+  +H  L+  LD GK  PSP G
Sbjct  133   FHKAAGGYGGIRIDSRPLIPVPYPTPAGDFTVLAGDWYKMNHTDLKAILDGGKDLPSPDG  192

Query  1234  LLINGRLNS-VTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             L+INGR  S  TFT  QG TY FR+SNVG+ TSINFRI  HK  LVE EG HT+Q+ Y S
Sbjct  193   LIINGRGPSGFTFTVDQGKTYRFRISNVGIATSINFRIDGHKFILVETEGDHTLQNTYSS  252

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LD+H+GQS   LVT++   KDYY+V SSRF    +T ++ILHY  S   V G  P  P  
Sbjct  253   LDVHLGQSYSILVTMDQPPKDYYVVVSSRFTTDVLTTTSILHYSNSAASVSGLPPGGPTT  312

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR++R NLTA+  RPNPQGSYHYG I   RT+ L N+   I+G  RYA+N V
Sbjct  313   QIDWSINQARSVRQNLTASGPRPNPQGSYHYGMINTTRTIRLANSAPVINGKQRYAVNGV  372

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S++   TPLKLAD+  I GVFTL +I D P +G      SV   +   +VE++F+N E +
Sbjct  373   SFIPADTPLKLADYFKISGVFTLGSIPDNPTSGGGYLQTSVMAADYRAFVEVVFENPEDS  432

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QS+H+DG   + VG  GG W    R  YNL DA +R +VQVYP SWTA+ + LDN GMW
Sbjct  433   VQSWHIDGHVLFIVGMDGGDWSPASRSSYNLRDAISRCSVQVYPKSWTAVYMPLDNVGMW  492

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV++   S   E  +P + LLCG
Sbjct  493   NIRSENWARQYLGQQFYLRVYSPADSWRDEYPIPSNALLCG  533



>ref|XP_002307765.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE94761.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=548

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/527 (52%), Positives = 364/527 (69%), Gaps = 7/527 (1%)
 Frame = -2

Query  1774  VLAFFCI-----SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             +  F C+     S+V+AEDPYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+
Sbjct  12    LCTFLCLTVSILSVVKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTND  71

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ Y
Sbjct  72    NLIINVYNSLDEPFLLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYY  131

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H +L+  LD+G+  
Sbjct  132   FPSLGFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTILIGDWYMSNHTKLKAILDSGRKL  191

Query  1249  PSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
             P P G+LINGR  N  + T +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q
Sbjct  192   PFPNGILINGRGRNGYSLTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQ  251

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPY-MTASAILHYDGSVTKVPGKL  896
               Y SLD+HVGQS   L T +   +DYYIV +SRF  P  +  + ILHY  S   V G  
Sbjct  252   TTYSSLDVHVGQSYSVLFTADQPGQDYYIVVTSRFTAPVVLNTTGILHYSNSAGPVSGPF  311

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   RT+++ N+   ++G  R
Sbjct  312   PGGPTTQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQR  371

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N VS++ P TP+KLAD+  I GVF  N+I D P  G      SV  L    +VEI+F
Sbjct  372   YGVNSVSFIAPDTPMKLADYFKIQGVFKENSISDRPYGGGLYLDTSVLTLPYRAFVEIVF  431

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE  +QS+HLDG  F+ VG  GG W +  R +YNL D  +R T+QVYP +WTAI + L
Sbjct  432   QNNEDIVQSWHLDGYSFFVVGMDGGQWTTASRNQYNLRDGVSRCTIQVYPKAWTAIYIPL  491

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWNLR+  W R YLGQQ YLRV+ +  SL  E  +P + LLCG
Sbjct  492   DNVGMWNLRTEFWARQYLGQQFYLRVYTDSTSLRDEYPIPKNALLCG  538



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/520 (53%), Positives = 362/520 (70%), Gaps = 2/520 (0%)
 Frame = -2

Query  1771  LAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnv  1592
             LA F I +  AE PYRF+ W V YG I PLGV+Q+GILINGQFPGP+I  +TN+N+I+NV
Sbjct  17    LAMFAI-VARAESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINV  75

Query  1591  iNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQL  1412
              N L EP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG+Y YF S   
Sbjct  76    HNSLPEPFLISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGF  135

Query  1411  HRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGL  1232
              +AAGG+G + I+ R +IP+P+PEP+  +T+++ DW+  +H +L+  LD G   PSP G+
Sbjct  136   QKAAGGFGGIRILSRPLIPVPFPEPAGDFTVLIGDWYKANHNKLKAVLDRGHRLPSPDGI  195

Query  1231  LINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             LING   N  +FT +QG TY FR+SNVG+  S+NFRIQ HK+KLVEVEG+HT+Q  Y SL
Sbjct  196   LINGHGSNGASFTVEQGKTYRFRISNVGLQHSLNFRIQGHKMKLVEVEGTHTIQTTYSSL  255

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   LVT++   +D+YI  S+RF    +T++  LHY      V G +P  P  Q
Sbjct  256   DVHVGQSYSVLVTMDQPPQDFYIAVSTRFTNKVLTSAGTLHYSNPARPVSGPVPGGPTTQ  315

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR+IR NLTA+  RPNPQGSYHYG I I RT+ LE++   ++G  RYA+N VS
Sbjct  316   IDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAGQVNGKQRYAVNSVS  375

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             ++   TPLKLAD+  I GVF + +I+D P  G      SV G +   ++EI+FQN+E  +
Sbjct  376   FIPADTPLKLADYFKIGGVFRVGSIQDQPTGGNIYLDTSVMGADFRGFIEIVFQNHENIV  435

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QS+H+DG +FW VG  GGVW    R +YNL DA +R T QVYP SWTAI V+LDN GMWN
Sbjct  436   QSWHIDGYNFWVVGMNGGVWTPASRNEYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWN  495

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +RS  W R YLGQQ YLRV++   S+  E  +P + LLCG
Sbjct  496   VRSEFWARQYLGQQFYLRVYSPVESIRDEYPIPKNALLCG  535



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/521 (54%), Positives = 357/521 (69%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             ++A   +S    EDPYRFYNW V YG I PLGVKQ+GILINGQFPGP+I+ +TN+N+I++
Sbjct  12    LVALLTVSFTNGEDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIIS  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S  
Sbjct  72    VFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYYYFPSLA  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGGYG + I  R  IP+P+  P+  +T++  DW+  +H  L+  LD G   P P G
Sbjct  132   FHKAAGGYGGIKISSRPRIPVPFDPPAGDFTILAGDWFKQNHTDLKAILDGGNNLPFPDG  191

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             L+INGR  N  TFT  QG TY FR+SNVG+ TSINFRIQ HK+ LVEVEG HT+Q+ Y S
Sbjct  192   LIINGRGSNGNTFTVDQGKTYRFRISNVGIATSINFRIQGHKMLLVEVEGIHTLQNTYSS  251

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LVT +   +DYYIV S+RF    ++A++ILHY  S   V G  P  P  
Sbjct  252   LDIHLGQSLSVLVTADQPPQDYYIVVSTRFTSQVLSATSILHYSNSGGSVSGPPPGGPTT  311

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             +  WS+ QAR+ R NLTA+  RPNPQGSYHYG I   RT+ L N+   I+G  RYA+N V
Sbjct  312   EVDWSLEQARSFRRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAPIINGKQRYAINSV  371

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S++ P TPLK+AD+  I GVF++ +I D P  G      SV   +   +VE +F+N E T
Sbjct  372   SFLQPDTPLKVADYFKISGVFSVGSISDNPTGGGGYLQTSVMHADFRAFVEFVFENPENT  431

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             LQS+HLDG  F+ VG  GG W    R +YNL+D  +R TVQVYPNSWTAI V LDN GMW
Sbjct  432   LQSWHLDGYSFFVVGMDGGQWTPASRLRYNLMDTVSRCTVQVYPNSWTAIYVPLDNVGMW  491

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  492   NVRSENWARQYLGQQFYLRVYSPVNSWRDEYPIPKNALLCG  532



>gb|EPS74059.1| hypothetical protein M569_00695 [Genlisea aurea]
Length=541

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/510 (55%), Positives = 357/510 (70%), Gaps = 1/510 (0%)
 Frame = -2

Query  1741  AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPILF  1562
              ++PYRF+ W V YG I PLGVKQ+GILINGQFPGP I+ +TN+N+I+NV N L+EP L 
Sbjct  22    GDNPYRFFYWNVSYGDIYPLGVKQQGILINGQFPGPSISCVTNDNLIINVFNSLNEPFLI  81

Query  1561  TWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGAL  1382
             +WNG++QR++SW DGV GT CPI P  N+TY +Q KDQIGTY YF S  LH++AGGYG++
Sbjct  82    SWNGLQQRRNSWQDGVFGTTCPIPPGKNFTYALQAKDQIGTYFYFPSLGLHKSAGGYGSI  141

Query  1381  NIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-LNSV  1205
              I  R  IP+PYP P   + ++  DW+  +H+QL+  LD G+  P P G++INGR  N  
Sbjct  142   KIYSRPKIPVPYPTPDGDHVVLAGDWFKREHRQLKYILDGGRDLPFPDGIIINGRGWNGY  201

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
             +FT +QG TY FR+SNVG+TTSINFRIQ H +KLVEVEGSHT+Q+ Y SLD+H+GQS   
Sbjct  202   SFTVQQGKTYRFRISNVGLTTSINFRIQGHTMKLVEVEGSHTVQNTYSSLDVHLGQSYSV  261

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             LVT +   KDYY+  SSRF    +T +A+LHY  S+ +V G  P  P  +  WS+ QAR+
Sbjct  262   LVTADQPPKDYYVAVSSRFTAKILTTTAVLHYQNSLAQVSGPPPGGPTVEVDWSLNQARS  321

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKL  665
             +RWNLTA+  RPNPQGSYHYG I   RT++L N+   I G  R+A+N VSYV+P TPLKL
Sbjct  322   LRWNLTASGPRPNPQGSYHYGLIKPARTIILANSAPYIDGKLRFAVNGVSYVSPDTPLKL  381

Query  664   ADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQDF  485
             AD+  I GVF++ +I ++P  G A    SV   +   +VEI+FQN E +LQS+H+DG  F
Sbjct  382   ADYFKISGVFSVGSISESPNWGNAYLSTSVMNADFRSFVEIVFQNWEDSLQSWHIDGYSF  441

Query  484   WAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRNY  305
             + VG  GG W    R +YNL D   R TVQVYP SWTAI ++LDN GMWN+RS  W R Y
Sbjct  442   FVVGMDGGQWTQASRLRYNLRDTVARCTVQVYPKSWTAIYMALDNVGMWNIRSENWARQY  501

Query  304   LGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LGQQ YLRV+    S   E  +P + LLCG
Sbjct  502   LGQQFYLRVYTPSTSFRDELPIPRNALLCG  531



>ref|XP_006656379.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=546

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/526 (53%), Positives = 362/526 (69%), Gaps = 4/526 (1%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             L+ +L    +     +DPYRFY W V +G I PLGVKQ+GILINGQFPGP+I+ +TN+N+
Sbjct  12    LVSLLVASSLLAARGDDPYRFYTWNVTFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNI  71

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             ++NV N L  P L +W GI+QR+SSW DGV GTNCPI P  N+TY MQ KDQIG+Y YF 
Sbjct  72    VINVYNSLPSPFLLSWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFP  131

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGGYG + ++ R  IP+P+  P+  +T++  DW+  +H  LQ  LD+G   P 
Sbjct  132   SLAFHKAAGGYGGIRVLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPF  191

Query  1243  PKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             P GLLING+  N   FT  QG TY FRVSNVG++TS+N RIQ H L LVEVEGSHT+Q  
Sbjct  192   PDGLLINGQGWNGNRFTVDQGKTYRFRVSNVGISTSVNIRIQGHSLLLVEVEGSHTVQSS  251

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y S+D+H+GQS  FLVT +   +DY I+ S+RF  P +T +A+LHY  S   V   +P P
Sbjct  252   YTSIDVHLGQSYSFLVTADQPPQDYSIIVSTRFTNPVLTTTAVLHYSNS-NGVLSTVPPP  310

Query  886   PAG--QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
             PA   Q  WS+ QAR+IRWNLTA+  RPNPQGSYHYG +   RT+ L N++ NI+G  RY
Sbjct  311   PAPTIQIDWSLNQARSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSRANINGKLRY  370

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
             A+N VS++   TPLK+AD+ NI GVFTL ++ D P  G A    +V    + DY+E+IF+
Sbjct  371   AVNSVSFIPADTPLKVADFYNIQGVFTLGSMPDNPTGGGAYLQTAVMAANMRDYIEVIFE  430

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             N+E  +QS+H+DG  FW VG  GG W    R+ YNL DA  RYT+QVYP SWTAI + LD
Sbjct  431   NSENFVQSWHIDGYAFWVVGMDGGQWTPASRQSYNLRDAIARYTLQVYPQSWTAIYMPLD  490

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N GMWN+RS +W R YLGQQ YLRV++  +S   EN +P + LLCG
Sbjct  491   NVGMWNIRSEIWGRQYLGQQFYLRVYSPANSWRDENPIPKNALLCG  536



>ref|XP_002301616.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
 gb|EEE80889.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
Length=545

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/521 (53%), Positives = 356/521 (68%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             ++    +S    EDPYRFY W V YG I PLGVKQ+GILING+FPGP+I  +TN+N+I++
Sbjct  15    LVVLLLVSCTIGEDPYRFYTWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIIS  74

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF S  
Sbjct  75    VFNSLDEPFLLSWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLG  134

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
             +H+AAGG+G   I  RSVIP+P+P P+  +T++  DW+  +H  L+  LD G   P P G
Sbjct  135   MHKAAGGFGGFKIASRSVIPVPFPPPAGDFTILAGDWFKKNHTDLKAILDGGSDLPFPDG  194

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             LLINGR  N  TFT  QG TY  R+SNVG+TTSINFRIQ HK+ LVEVEG+H++Q+ YDS
Sbjct  195   LLINGRGSNGYTFTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYDS  254

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LDIH+GQS   LVT +   +DY+IV S+RF    +T ++ILHY  S   V    P  P  
Sbjct  255   LDIHLGQSYSVLVTADQAAQDYFIVVSTRFTSQVLTTTSILHYSNSAGSVSDSPPSGPTI  314

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             Q  WS+ QAR++R NLTA+  RPNPQGSYHYG I    T+ L+N+   I+G  RYA+N V
Sbjct  315   QLDWSVEQARSLRRNLTASGPRPNPQGSYHYGLINTTHTVRLQNSAPIINGKQRYAVNSV  374

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S++   TPLKLAD  NIPGVF+L +I + P  G A    SV   +   Y EI+F+N E  
Sbjct  375   SFIPADTPLKLADHFNIPGVFSLGSISNNPTGGGAYRQTSVMAADFRGYAEIVFENPEDN  434

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QS+H+DG +F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + LDN GMW
Sbjct  435   VQSWHIDGHNFFVVGMDGGQWSPASRLTYNLRDTISRCTVQVYPESWTAVYMPLDNVGMW  494

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  495   NVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPTNALLCG  535



>gb|KEH40258.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/529 (54%), Positives = 361/529 (68%), Gaps = 10/529 (2%)
 Frame = -2

Query  1771  LAFFCIS---------MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvi  1619
             L   C+S         ++ AEDPYRF+NW V YG I PLGV+Q+GILINGQFPGP+I+ +
Sbjct  5     LVLLCVSVYLFAITTTIIVAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSV  64

Query  1618  tnenvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGT  1439
             TN+N+I+NV N LDEP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG+
Sbjct  65    TNDNLIINVFNSLDEPFLISWNGVQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGS  124

Query  1438  YSYFLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTG  1259
             + YF S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+ QLD G
Sbjct  125   FYYFPSLAFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTVLIGDWYKSNHTDLKAQLDNG  184

Query  1258  KPFPSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSH  1082
             K  P P G+LINGR     +   +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+H
Sbjct  185   KKLPFPDGILINGRGSGGSSLNVEQGKTYRLRISNVGLENSLNFRIQNHKMKLVEVEGTH  244

Query  1081  TMQDQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPG  902
             T+Q  Y SLD+HVGQS   LVT +   +DYYIV SSRF  P +T++ IL Y  S   V G
Sbjct  245   TLQTTYSSLDVHVGQSYSVLVTADQPSQDYYIVVSSRFTNPVLTSTGILRYSNSAGPVSG  304

Query  901   KLPDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGI  722
               P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I + RT+VL ++   ++G 
Sbjct  305   PPPGGPTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINLTRTIVLSSSAGQVNGK  364

Query  721   TRYALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEI  542
              RYA+N VSYV P TPLKLAD+  I GV+   +I D P  G      SV   +   +VEI
Sbjct  365   QRYAINSVSYVAPDTPLKLADFFKIAGVYRPGSISDRPSGGGIYLDTSVMQTDYRTFVEI  424

Query  541   IFQNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILV  362
             +FQN+E  LQSYHLDG  F+ VG  GG W S  R +YNL DA +R T QVYP SWTAI V
Sbjct  425   VFQNDEDILQSYHLDGYSFFVVGMDGGQWTSDKRNQYNLRDAVSRSTTQVYPKSWTAIYV  484

Query  361   SLDNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              LDN GMWNLRS  W R YLGQQ Y+RV+    SL  E  +P + LLCG
Sbjct  485   PLDNVGMWNLRSEFWARQYLGQQFYMRVYTTSTSLRDEYPIPKNALLCG  533



>gb|KEH36280.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=544

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/523 (53%), Positives = 359/523 (69%), Gaps = 6/523 (1%)
 Frame = -2

Query  1765  FFCIS-----MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvi  1601
               C+S     +  AEDPY+F+NW V YG I PLGV+QRGILINGQFPGP+I+ +TN+N+I
Sbjct  12    LLCVSTSLFHITSAEDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLI  71

Query  1600  vnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLS  1421
             +NV N L+EP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S
Sbjct  72    INVFNSLNEPFLISWNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPS  131

Query  1420  TQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSP  1241
                 +AAGG+G + I+ R  IP+P+PEP+  YT+++ DW+ ++H  L+  LD GK  P P
Sbjct  132   LAFQKAAGGFGGIRILSRPRIPVPFPEPAGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIP  191

Query  1240  KGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
              G+LINGR  N ++F  +QG TY  R+SNVG+  S+NFRIQNHKLKLVEVEG+HT+Q  Y
Sbjct  192   DGVLINGRGPNGLSFNVEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTY  251

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
              SLD+HVGQS   LVT +   +DYY+VAS+RF    +T +A+L Y  S   V G  P  P
Sbjct  252   SSLDVHVGQSYSVLVTADQPSQDYYVVASTRFSSKILTTTAVLRYSNSAGAVSGPPPGGP  311

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
               Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   +T++L ++   ++G  RY +N
Sbjct  312   TIQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINTTKTIILASSPGQVNGKQRYGIN  371

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
              VSYV P TPLKLAD+  I GVF + +I + P  G      SV   +   +VEI+FQNNE
Sbjct  372   SVSYVVPDTPLKLADYFKISGVFRVGSISERPTGGGLYLDTSVMQADYRSFVEIVFQNNE  431

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
               +QSYHLDG  F+ VG  GG W ++ R  YNL DA  R T QVYP SWTAI V+LDN G
Sbjct  432   NIVQSYHLDGYSFFVVGMDGGQWTTSSRNGYNLRDAVARCTTQVYPYSWTAIYVALDNVG  491

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWNLR+  W R YLGQQ YLRV+    S+  E  +P +  LCG
Sbjct  492   MWNLRTEFWARQYLGQQFYLRVYTASTSIRDEFPIPKNARLCG  534



>ref|XP_008447902.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=546

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/521 (53%), Positives = 369/521 (71%), Gaps = 3/521 (1%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             VL  F I++  A+ PYRF++W V YG I PLGV+Q+GILINGQFPGP+I  +TN+N+ +N
Sbjct  18    VLGLF-INIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYIN  76

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N L EP L +WNG++QRK+S+ DGV GT CPI P  N+TYR+Q+KDQIG+Y YF S  
Sbjct  77    VHNSLPEPFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLA  136

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G++ ++ R +IP+P+PEP+A YTL++ DW+  +H  L+  LD G   P P G
Sbjct  137   FHKAAGGFGSIRVLSRPLIPVPFPEPAADYTLLIGDWYTANHTTLKTILDRGHRLPFPNG  196

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             ++INGR  ++ TFT ++G TY FR++NVG+  S+NFR+Q+H+LKLVEVEG+HTMQ+ Y S
Sbjct  197   IVINGRGPSATTFTVEKGKTYRFRITNVGLQHSLNFRVQDHELKLVEVEGTHTMQNTYSS  256

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
             LD+HVGQS   L+T +   +D+YI  S+RF    +T++AILHY  S T V G +P  P  
Sbjct  257   LDVHVGQSYSVLITADQPSRDFYIAVSTRFAPKVLTSTAILHYSDSTTSVGGPIPGGPT-  315

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             +  WS+ QAR+IR NLTA+  RPNPQGSYHYG I I RT+ LE++   ++   RYA+N V
Sbjct  316   EVEWSINQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAALVNRKQRYAVNSV  375

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S++   TPLKLAD+ +I GVF + +I D P         SV G +   ++EI+FQN+E  
Sbjct  376   SFIPADTPLKLADYFSIDGVFRIGSIPDFPSGKTMFLDTSVMGADYRAFIEIVFQNHENI  435

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QS+H+DG  FW VG  GGVW    R++YNL DA +R T QVYP SWTAI +SLDN GMW
Sbjct  436   VQSWHIDGYSFWVVGMDGGVWTPASREQYNLRDAVSRCTTQVYPKSWTAIYMSLDNVGMW  495

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV+    S   E ++P + LLCG
Sbjct  496   NIRSEFWARQYLGQQFYLRVYTPVKSFRDEYNVPDNALLCG  536



>ref|XP_011041276.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=548

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/527 (52%), Positives = 364/527 (69%), Gaps = 7/527 (1%)
 Frame = -2

Query  1774  VLAFFCI-----SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             +  F C+     S+V+AEDPYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+
Sbjct  12    LCTFLCLTVSILSVVKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTND  71

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ Y
Sbjct  72    NLIINVYNSLDEPFLLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYY  131

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H +L+  LD+G+  
Sbjct  132   FPSLGFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTILIGDWYMSNHTKLKALLDSGRRL  191

Query  1249  PSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
             P P G+LINGR  N  + T +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q
Sbjct  192   PFPSGILINGRGRNGYSLTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQ  251

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPY-MTASAILHYDGSVTKVPGKL  896
               + SLD+HVGQS   L T +   +DYYIV +SRF  P  +  + ILHY  S   V G  
Sbjct  252   TTFSSLDVHVGQSYSVLFTADQPGQDYYIVVTSRFTAPVVLNTTGILHYSNSAGPVSGPF  311

Query  895   PDPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITR  716
             P  P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   RT+++ N+   ++G  R
Sbjct  312   PGGPTTQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQR  371

Query  715   YALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIF  536
             Y +N VS+V P TP+KLAD+  I GVF  N+I D P  G      SV  L    +VEI+F
Sbjct  372   YGVNSVSFVAPDTPMKLADYFKIQGVFKENSISDRPYGGGLYLDTSVLTLPYRAFVEIVF  431

Query  535   QNNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSL  356
             QNNE  +QS+HLDG  F+ VG  GG W +  R +YNL D  +R T+QVYP +WTAI + L
Sbjct  432   QNNENIVQSWHLDGYSFFVVGMDGGQWTTASRNQYNLRDGVSRCTIQVYPKAWTAIYIPL  491

Query  355   DNKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             DN GMWNLR+  W R YLGQQ YLRV+ +  SL  E  +P + LLCG
Sbjct  492   DNVGMWNLRTEFWARQYLGQQFYLRVYTDSTSLRDEYPIPKNALLCG  538



>ref|XP_006383902.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|ERP61699.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=544

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/524 (54%), Positives = 359/524 (69%), Gaps = 2/524 (0%)
 Frame = -2

Query  1780  LGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvi  1601
             L V   F  + V  EDPYRF  W + YG I PLGVKQ+GILINGQFPGP+I+ +TNEN+I
Sbjct  11    LVVFLLFLGNDVNCEDPYRFITWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLI  70

Query  1600  vnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLS  1421
             ++V N L EP L +WNGI+QR++SW DGV GT+CPI P  N+TY +Q+KDQIG++ YF S
Sbjct  71    ISVYNYLREPFLISWNGIQQRRNSWQDGVYGTSCPIPPGKNFTYALQVKDQIGSFFYFPS  130

Query  1420  TQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSP  1241
                H+AAG +G + I  R  IP+P+P P+  +T++  DW+  +H QL++ LD G   P P
Sbjct  131   LGFHKAAGAFGGIRIWSRPRIPVPFPAPAGDFTVLAGDWYKRNHYQLRRVLDGGHNLPFP  190

Query  1240  KGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
              GLLINGR  N  TFT   G TY FR+SNVG+TTSINFRIQ HK+KLVEVEGSHT+Q+ Y
Sbjct  191   DGLLINGRGWNGYTFTVDPGKTYRFRISNVGLTTSINFRIQGHKMKLVEVEGSHTLQNTY  250

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
               LDIH+GQS   LVT +   KDYYIV SSRF KP +  +A+LHY  S  +V G +P  P
Sbjct  251   SDLDIHLGQSYSVLVTADQPAKDYYIVVSSRFTKPVLATTAVLHYSNSWQRVSGPIPGGP  310

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
               Q  WS+ QAR+ RWNLTA+  RPNPQGSYHYG I   RT+ L N+   I+   RYA+N
Sbjct  311   TTQIDWSLNQARSFRWNLTASGPRPNPQGSYHYGLIKTSRTITLANSGPIINRKQRYAVN  370

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAG-PAVHGVSVFGLELHDYVEIIFQNN  527
              VSY+   TPLK+AD+ NIPGVF+L ++  +P  G  A    +V      +++EI+FQN 
Sbjct  371   GVSYIPADTPLKIADYFNIPGVFSLGSMPSSPSWGNNAYLQTAVMSANFREFIEIVFQNW  430

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E T+QS+H+DG  F+ VG  GG W    R +YNL D   R T QVYP SWTAI ++LDN 
Sbjct  431   EDTVQSWHIDGHSFFVVGMDGGQWTPASRARYNLRDTVARCTTQVYPKSWTAIYMALDNV  490

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWN+RS  W R YLGQQ YLRV++  HS   E  +P + LLCG
Sbjct  491   GMWNIRSENWARQYLGQQFYLRVYSPAHSWRDELPIPKNALLCG  534



>gb|KHG04142.1| L-ascorbate oxidase [Gossypium arboreum]
Length=550

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/525 (55%), Positives = 365/525 (70%), Gaps = 1/525 (0%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F++ ++          EDPYRFY W V YG I PLGVKQ+ ILINGQFPGP+I  +TNEN
Sbjct  14    FIIILVMLLVCCCTNGEDPYRFYTWNVTYGDIYPLGVKQQVILINGQFPGPQIETVTNEN  73

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LD+P L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF
Sbjct  74    LIINVFNSLDQPFLISWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYF  133

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S  LH+AAGGYG   I+ RSV+P+P+P P+A YT++  DW+N +H  L+  LD+G   P
Sbjct  134   PSLALHKAAGGYGGFRILSRSVVPVPFPPPAADYTILAGDWYNKNHNYLKAILDSGHDLP  193

Query  1246  SPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
              P GL+INGR  N  TFT  QG TY FR+SNVG+TTSINFRIQ HKL LVEVEG+HT+Q+
Sbjct  194   FPDGLIINGRGANGYTFTVDQGKTYRFRISNVGITTSINFRIQGHKLLLVEVEGTHTLQN  253

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              YDSLDIH+GQS   LVT +   +DYYIVAS+RF    +  +AILHY  S   V G  P 
Sbjct  254   TYDSLDIHLGQSLSVLVTADQPARDYYIVASTRFTSQVLATTAILHYSNSSAAVSGPPPG  313

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  Q  WS+ QAR+IR NLTA+AARPNPQGSYHYG +   RT+ L ++   I+G  RYA
Sbjct  314   GPTTQIDWSLEQARSIRLNLTASAARPNPQGSYHYGLVKTTRTIRLASSAAVINGKQRYA  373

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VS++   TPLKLAD+  I GVF+L +I D P  G A    SV   +   YVEI+F+N
Sbjct  374   VNGVSFIPADTPLKLADYFKISGVFSLGSIPDAPTGGGAYLKTSVMAADYRGYVEIVFEN  433

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
              E T+QS+H+DG  F+ VG  GG W    R  YNL DA  R TVQVYP SW+A+ ++LDN
Sbjct  434   PEDTVQSWHIDGYSFFVVGMDGGQWTPASRLGYNLRDAIARCTVQVYPKSWSAVYIALDN  493

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWN+RS  W R YLGQQ YLR+++  +S   E  +P + L+CG
Sbjct  494   VGMWNVRSENWVRQYLGQQFYLRIFSAANSWRDEYPIPRNALVCG  538



>emb|CDP10787.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/521 (53%), Positives = 357/521 (69%), Gaps = 1/521 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             V     +  +  EDPY+F+ W V YG I PLGVKQ+GILINGQFPGP+I  +TNEN+IV+
Sbjct  11    VAVVLLMKCINGEDPYQFFTWNVTYGDIYPLGVKQQGILINGQFPGPQITSVTNENLIVS  70

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N L+EP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG++ YF S  
Sbjct  71    VFNSLNEPFLLSWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLA  130

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
               +AAGGYG++ I  RSVIP+P+P P+A YT++  DW+  +H  L+  LD G   P P G
Sbjct  131   FQKAAGGYGSIRIYSRSVIPVPFPPPAAEYTILAGDWFKQNHTDLRAILDGGHDLPFPDG  190

Query  1234  LLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDS  1058
             +LINGR  N  TFT  QG TY FR+SNVG+ TS+NFRIQ HK+ LVEVEG+HT+Q+ YDS
Sbjct  191   ILINGRGSNGYTFTVDQGKTYRFRISNVGLVTSLNFRIQGHKMLLVEVEGTHTLQNTYDS  250

Query  1057  LDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAG  878
              D+H+GQS   LVT +   +DYYIV S+RF    +TA+++LHY  S   V G  P  P  
Sbjct  251   FDLHLGQSCSVLVTADQPARDYYIVFSTRFTSQVLTATSLLHYSNSAVSVVGPPPGGPTT  310

Query  877   QYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKV  698
             +  WS+ QAR+IR NLTA+  RPNPQGSYHYG +   RT+ L N+   I+G  RYA+N V
Sbjct  311   EIDWSLNQARSIRQNLTASGPRPNPQGSYHYGMVNTTRTIRLANSAPVINGKKRYAVNSV  370

Query  697   SYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKT  518
             S+V   TPLKLAD+ NI GVF+L ++ D P         SV   +   + E++F+N+E T
Sbjct  371   SFVPADTPLKLADYYNIQGVFSLGSMPDNPTGSGGYLQTSVMAADFRAFFEVVFENSEDT  430

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QS+H+DG  F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + LDN GMW
Sbjct  431   VQSWHIDGHIFFVVGMDGGQWSPASRSNYNLRDGISRCTVQVYPRSWTALYMPLDNVGMW  490

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N+RS  W R YLGQQ YLRV++  +SL  E  +P + LLCG
Sbjct  491   NVRSENWARQYLGQQFYLRVYSPANSLRDEYPIPKNALLCG  531



>ref|XP_006390229.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27515.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=541

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/520 (52%), Positives = 358/520 (69%), Gaps = 0/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             ++ F  +  V AEDPYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I+N
Sbjct  12    IIGFSLLFAVTAEDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S  
Sbjct  72    VYNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLA  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+ ++H  L+ QLD+G+  P P G
Sbjct  132   FHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAQLDSGRKLPLPDG  191

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LINGR +  T   +QG TY  R+SNVG+  S+NFRIQNHK+K+VEVEG HT+Q  + SL
Sbjct  192   ILINGRGSGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHKMKVVEVEGIHTLQTTFSSL  251

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   L+T +   +DYY+V SSRF    +T + +L Y  S   V G +P  P  Q
Sbjct  252   DVHVGQSYSVLITADQPPRDYYVVVSSRFTSAVLTTTGVLRYSNSAGGVSGPIPGGPTIQ  311

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR IR NLTA+  RPNPQGSYHYG I   RT+ L ++   ++G  RYA+N VS
Sbjct  312   IDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVS  371

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             +    TPLKLAD+  I GV+ + +I+  P  G      SV  ++   +VEI+F+N+E  +
Sbjct  372   FNPADTPLKLADYFKIDGVYRVGSIQSQPTGGGIYLDTSVLQVDYRSFVEIVFENSEDIV  431

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QS+HLDG  FW VG  GG W    R  YNL DA  R TVQVYP+SWTAI ++LDN GMWN
Sbjct  432   QSWHLDGYSFWVVGMDGGQWSPDSRNGYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWN  491

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             +RS  W R YLGQQ+YLRV+    SL  E  +P + LLCG
Sbjct  492   IRSEFWARQYLGQQLYLRVYTTSTSLRDEYPIPKNALLCG  531



>ref|XP_004957823.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=550

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/526 (54%), Positives = 360/526 (68%), Gaps = 1/526 (0%)
 Frame = -2

Query  1789  RFLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             R +   +      +V  +DPYRF+ W V YG I PLGVKQ+GILIN QFPGP+I  +TN+
Sbjct  15    RLVFSFMGLLVPLLVAGDDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTND  74

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+I+NV NKL+EP L +W+G++QR++S+ DGV GT CPI P  N+TY MQ KDQIGTY Y
Sbjct  75    NLIINVFNKLNEPFLLSWSGLQQRRNSFEDGVAGTTCPIPPGGNFTYIMQAKDQIGTYYY  134

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F S   H+AAGG+G + ++ R  IP+P+P P+A YT+++ DW+  +H  L+  LD+GK  
Sbjct  135   FPSLAFHKAAGGFGGIRVLSRPQIPVPFPPPAADYTVLIGDWYKANHTDLRYMLDSGKAL  194

Query  1249  PSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
               P GLLINGR  N  TFT + G TY FR+SNVG+ TS+N R Q H +KLVEVEGSHTMQ
Sbjct  195   GFPDGLLINGRSWNGYTFTVEPGRTYRFRISNVGLATSLNIRFQGHTMKLVEVEGSHTMQ  254

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
               Y SLD+H+GQS   L+T +    DY +V S+RF    ++ +A+LHY  S  K PG LP
Sbjct  255   TTYSSLDVHLGQSYSVLLTADQPGFDYAVVVSTRFTTKIISTTAVLHYTNSAGKAPGPLP  314

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P  Q  WS+ QAR+IRWNLTA+  RPNPQGSYHYG +P+ RT+ L N+   I+G  RY
Sbjct  315   GGPTIQIDWSLNQARSIRWNLTASGPRPNPQGSYHYGLVPVTRTIRLANSAAIINGKQRY  374

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
             A+N VSYV+P TPLK+AD+  I GVF++  I D+P  G A    SV G    DYVE++F+
Sbjct  375   AVNSVSYVSPDTPLKVADYYKIGGVFSVGTIADSPSYGSAYLQTSVMGANYRDYVEVVFE  434

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             NNE  +QS+H+DG  FW VG  GG W    R+ YNL D  +RYTVQVYP SWTAI + LD
Sbjct  435   NNEDEVQSWHIDGYAFWVVGMDGGKWSPASRQGYNLRDGVSRYTVQVYPRSWTAIYMPLD  494

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N GMWN+RS  W R YLGQQ YLRVW    S   E  +P + LLCG
Sbjct  495   NVGMWNVRSENWARQYLGQQFYLRVWTPSTSFRDEYPIPKNALLCG  540



>ref|XP_011047251.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
 ref|XP_011047252.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=547

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/525 (54%), Positives = 359/525 (68%), Gaps = 3/525 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             F+L VL    ++    EDPYRF+ W V YG I PLGVKQ+GILING FPGP+I  +TN+N
Sbjct  15    FMLAVL--LLVTCTAGEDPYRFHTWNVTYGDIYPLGVKQQGILINGLFPGPQIESVTNDN  72

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I++V N LDEP L +WNG++QR++SW DGV GTNCPI P  N+TY +Q+KDQIG+Y YF
Sbjct  73    LIISVFNSLDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYF  132

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S  +H+AAGG+G   I  RSVIP+P+P PS  +T +  DW+  +H  L+  LD G   P
Sbjct  133   PSLGMHKAAGGFGGFKIASRSVIPVPFPPPSGDFTFLAGDWFKKNHNDLKAILDGGSDLP  192

Query  1246  SPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
              P GLLINGR  N  TFT  QG TY FR+SNVG+TTSINFRIQ HK+ LVEVEG+H++Q+
Sbjct  193   FPDGLLINGRGSNGYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQN  252

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              YDSLDIH+GQS   LVT +    DY+IV S+RF    +T ++ILHY  S   V      
Sbjct  253   TYDSLDIHLGQSYSVLVTADQAAHDYFIVVSTRFTSQVLTTTSILHYSNSAGSVSDAPLG  312

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  Q  WS+ QAR++R NL+A+  RPNPQGSYHYG I   RT+ L+N+   I+G  R+A
Sbjct  313   GPTIQIDWSLEQARSLRRNLSASGPRPNPQGSYHYGLINTTRTVRLQNSAPIINGKQRFA  372

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VS+++  TPLKLAD  NIPGVF+L +I D+P  G A    SV   +   Y EI+F+N
Sbjct  373   VNSVSFISADTPLKLADHYNIPGVFSLVSIPDSPTGGGAYLPTSVMAADFRGYAEIVFEN  432

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
              E  +QS+H+DG +F+ VG  GG W    R  YNL D  +R TVQVYP SWTA+ + LDN
Sbjct  433   PEDNVQSWHIDGHNFFVVGMDGGQWSPASRLSYNLRDTISRCTVQVYPESWTAVYMPLDN  492

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWN+RS  W R YLGQQ YLRV++  +S   E  +P + LLCG
Sbjct  493   VGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPTNALLCG  537



>gb|KEH29685.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=537

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/514 (55%), Positives = 355/514 (69%), Gaps = 2/514 (0%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDE  1574
             +    EDPYRFYNW V YG I PLGVKQ+GILING+FPGP+I  +TN+N+I+NV N LDE
Sbjct  18    ACANGEDPYRFYNWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIINVFNSLDE  77

Query  1573  PILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGG  1394
             P L +WNG+ QR++SW DGV GTNCPI P  N TY +Q+KDQIG+Y YF S   H+AAGG
Sbjct  78    PFLISWNGVLQRRNSWQDGVYGTNCPISPGKN-TYILQVKDQIGSYFYFPSLAFHKAAGG  136

Query  1393  YGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-  1217
             YG   I  RSVIP+P+  PS  +T++  DW+  +H  L+  LD+GK  P P GL+INGR 
Sbjct  137   YGGFTIATRSVIPVPFDPPSGDFTILAGDWYKRNHTDLRAILDSGKNLPFPDGLVINGRG  196

Query  1216  LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQ  1037
              N+ TFT  QG TY FR+SNVG+TTSINFRIQ HK+KLVEVEGSHT+Q+ YDSLDIH+GQ
Sbjct  197   SNAYTFTVDQGKTYRFRISNVGITTSINFRIQGHKMKLVEVEGSHTVQNIYDSLDIHLGQ  256

Query  1036  SAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMR  857
             +   LVT +    DYYIV ++RF    + AS+ILHY  S  +V G LP  P  +  WS+ 
Sbjct  257   TYSVLVTADQPPHDYYIVVTTRFTSQVLNASSILHYRNSARRVSGPLPAGPTTKIDWSVE  316

Query  856   QARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTT  677
             QAR++R NLTA+  RPNPQGSYHYG I   RT+ L+N+   I G  RYA+N VS++   T
Sbjct  317   QARSLRRNLTASGPRPNPQGSYHYGMINTTRTIRLQNSAPIIKGKQRYAVNSVSFIPADT  376

Query  676   PLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLD  497
             PLKLAD+  I GVF+L +I D P  G      SV   +   ++E++F+N E TLQS+H+D
Sbjct  377   PLKLADYFKIQGVFSLGSIPDNPTGGGGNLQTSVMAADFRGFLEVVFENPEDTLQSWHID  436

Query  496   GQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVW  317
             G  F+ VG  GG W +  R  YNL D   R TVQVYP SWTA+ + LDN GMWN+RS  W
Sbjct  437   GHSFFVVGMDGGQWSAASRLNYNLRDTIARSTVQVYPKSWTALYMPLDNVGMWNVRSENW  496

Query  316   PRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              R YLG Q YLRV++  +SL  E  +P + L CG
Sbjct  497   ARQYLGHQFYLRVYSPVNSLRDEYPIPNNALRCG  530



>ref|XP_007136137.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
 gb|ESW08131.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
Length=548

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/510 (55%), Positives = 354/510 (69%), Gaps = 1/510 (0%)
 Frame = -2

Query  1741  AEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDEPILF  1562
             AEDPYRF+NW V YG I PLGV+QRGILINGQFPGP+I+ +TN+N+I+NV N LDEP L 
Sbjct  29    AEDPYRFFNWNVTYGDIFPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLL  88

Query  1561  TWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGGYGAL  1382
             +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   H+A GG+G +
Sbjct  89    SWNGIQQRRNSFEDGVFGTTCPIAPGKNFTYILQVKDQIGSFYYFPSLAFHKAGGGFGGI  148

Query  1381  NIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGR-LNSV  1205
              I+ R  IP+P+P+P   YT+++ DW+ ++H  L+  LD GK  P P G+LINGR  N  
Sbjct  149   RILSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLRAHLDNGKKLPFPDGILINGRGPNGA  208

Query  1204  TFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVGQSAGF  1025
             +F  +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q  Y SLD+HVGQS   
Sbjct  209   SFNVEQGKTYRLRISNVGLEHSLNFRIQNHKMKLVEVEGTHTVQTTYSSLDVHVGQSYSV  268

Query  1024  LVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSMRQART  845
             LVT +   +DYYIV S+RF    +T S +L Y  S   V G  P  P  Q  WS+ QAR+
Sbjct  269   LVTADQPARDYYIVVSTRFSYKVLTTSGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQARS  328

Query  844   IRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPTTPLKL  665
             IR NLTA+  RPNPQGSYHYG I   RT+VL ++   + G  RYA+N VSYV P TPLKL
Sbjct  329   IRTNLTASGPRPNPQGSYHYGLINTSRTIVLASSAGQVHGKQRYAMNSVSYVAPDTPLKL  388

Query  664   ADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHLDGQDF  485
             AD+  I GVF   +I D P  G      SV   +   +VEI+FQNNE  +QSYHLDG  F
Sbjct  389   ADYFKISGVFRPGSISDRPSGGGIYLDTSVLQTDYRTFVEIVFQNNENIVQSYHLDGYSF  448

Query  484   WAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSVWPRNY  305
             + VG  GG+W +  R +YNL DA +R T QVYP SWTAI V+LDN GMWNLRS  W R Y
Sbjct  449   FVVGMDGGLWTAASRNQYNLHDAVSRCTTQVYPMSWTAIYVALDNVGMWNLRSEFWARQY  508

Query  304   LGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LGQQ+Y+RV+    S+  E  +P + +LCG
Sbjct  509   LGQQLYMRVYTTSTSIRDEFPVPKNAILCG  538



>gb|AGT57427.1| ascorbate oxidase [Prunus persica]
Length=536

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/516 (53%), Positives = 355/516 (69%), Gaps = 1/516 (0%)
 Frame = -2

Query  1759  CISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKL  1580
              +    AEDPYRF++W + YG I PLGV+Q+GILINGQFPGPEI  +TN+N+I+NV N L
Sbjct  12    VLGFAAAEDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSL  71

Query  1579  DEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAA  1400
              EP L +WNG++ R++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   H+AA
Sbjct  72    PEPFLISWNGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAA  131

Query  1399  GGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLING  1220
             GG+GA+ I+ R  IP+P+P+P++ Y++++ DW+ TDHK L+  LD G   P P G++ING
Sbjct  132   GGFGAIKILSRPRIPVPFPDPASDYSILIGDWYKTDHKILKGILDRGHRLPFPDGIIING  191

Query  1219  R-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHV  1043
             R  N   FT  QG TY  R+SNVG+  S+NFRIQ HKLKLVEVEG+HT+Q  YDSLDIHV
Sbjct  192   RGPNGTYFTFDQGKTYRLRISNVGLQNSLNFRIQGHKLKLVEVEGTHTIQTTYDSLDIHV  251

Query  1042  GQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWS  863
             GQS   LVT +   +DYYI  S+RF    +T++A+ HY  S  +V G +P  P  Q  WS
Sbjct  252   GQSYSVLVTADQAPQDYYIAVSTRFTSKVLTSTAVFHYSNSGRQVSGPIPAGPTTQTGWS  311

Query  862   MRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNP  683
             + QA +IR NLTA+  RPNPQGSYHYG + + RT+ LE++   +SG  RYA+N VS++  
Sbjct  312   LSQALSIRTNLTASGPRPNPQGSYHYGLVNVSRTIKLESSAAQVSGKQRYAVNSVSFIPA  371

Query  682   TTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYH  503
              TPLKLAD+  I GVF + +I D P         SV G +   +VEI+FQN+E  +QS+H
Sbjct  372   DTPLKLADYFKIGGVFKVGSISDNPTGQKMYLDTSVMGADFRAFVEIVFQNHENIVQSWH  431

Query  502   LDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSS  323
             LDG  FW VG  GG W    R +YNL DA +R T QVYP SWTAI ++LDN GMWNLR+ 
Sbjct  432   LDGYSFWVVGMDGGKWTPASRNEYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRTE  491

Query  322   VWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              W R YLGQQ YLRV++   S   E   P + LLCG
Sbjct  492   FWARQYLGQQFYLRVYSPAESARDEYPTPRNALLCG  527



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/526 (52%), Positives = 359/526 (68%), Gaps = 6/526 (1%)
 Frame = -2

Query  1774  VLAFFC-----ISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitne  1610
             +  F C     IS+V+AEDPYRF++W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+
Sbjct  12    LCTFLCVSVSIISIVKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTND  71

Query  1609  nvivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSY  1430
             N+I+NV N LDEP L +WNGI+QR++S+ DGV+GT CPI P  N+TY +Q+KDQIG++ Y
Sbjct  72    NLIINVYNSLDEPFLLSWNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYY  131

Query  1429  FLSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPF  1250
             F S   H+AAGG+G + I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+  LD G+  
Sbjct  132   FPSLGFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTVLIGDWYLSNHTDLKAALDGGRKL  191

Query  1249  PSPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQ  1073
             P P G+LINGR  N    T +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q
Sbjct  192   PFPDGILINGRGRNGYYLTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQ  251

Query  1072  DQYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLP  893
               Y SLD+HVGQS   L T +   +DYYIV +SRF    +  + +LHY  S   V G  P
Sbjct  252   TTYSSLDVHVGQSYSVLFTADQPGQDYYIVVTSRFTSTVLNTTGVLHYSNSAGAVSGPFP  311

Query  892   DPPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRY  713
               P  +  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   RT+++ N+   ++G  RY
Sbjct  312   GGPTIEVDWSINQARSIRTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQRY  371

Query  712   ALNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQ  533
              +N VS+V P TP+KLAD+  I GVF  N I D P  G      +V  +    YVEI+FQ
Sbjct  372   GVNSVSFVAPDTPMKLADYFKIQGVFKENGITDRPYGGGLYLDTAVLTVPYRAYVEIVFQ  431

Query  532   NNEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLD  353
             N+E  LQS+HLDG  F+ VG  GG W +  R +YNL DA  R T QVYP +WTAI + LD
Sbjct  432   NDEDILQSWHLDGYSFFVVGMDGGQWTTASRDQYNLRDAVARCTAQVYPKAWTAIYIPLD  491

Query  352   NKGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             N GMWNLR+  W R YLGQQ YLRV+ +  SL  E  +P + LLCG
Sbjct  492   NVGMWNLRTEFWARQYLGQQFYLRVYTDSTSLRDEFPIPKNALLCG  537



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/524 (52%), Positives = 355/524 (68%), Gaps = 3/524 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
               +G+   F ++   AEDPYRFY W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N
Sbjct  12    LFIGLSLLFAVT---AEDPYRFYEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDN  68

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNG++QR++S+ DGV GT CPI P  N+TY +QMKDQIG++ YF
Sbjct  69    IIINVFNSLDEPFLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYF  128

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+P+P+   T+++ DW+ ++H  L+ QLD GK  P
Sbjct  129   PSLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLKAQLDNGKKLP  188

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P G+LINGR +  T   +QG  Y  R+SNVG+  S+NFRIQNHK+K+VEVEG+HT+Q  
Sbjct  189   LPDGILINGRSSGATLNVEQGKVYRLRISNVGLQDSLNFRIQNHKMKVVEVEGTHTLQTT  248

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             + SLD+HVGQS   LVT +   +DYY+V SSRF    +T + +L Y  S   V G +P  
Sbjct  249   FSSLDVHVGQSYSVLVTADQPPRDYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGG  308

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR IR NLTA+  RPNPQGSYHYG I   RT+ L ++   + G  RYA+
Sbjct  309   PTIQIDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAV  368

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+    TPLKLAD+  I GV+   +I+  P  G      SV  ++   +VEI+F+N 
Sbjct  369   NSVSFKPADTPLKLADYFKIDGVYRTGSIQYQPTGGGIYLDTSVMQVDYRTFVEIVFENT  428

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QSYHLDG  FW VG  GG W    R +YNL DA  R TVQVYP+SWTAIL++LDN 
Sbjct  429   EDIIQSYHLDGYSFWVVGMDGGQWSPNSRNEYNLRDAVARCTVQVYPSSWTAILIALDNV  488

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS  W R YLGQQ YLRV+    SL  E  +P + LLCG
Sbjct  489   GMWNLRSEFWARQYLGQQFYLRVYTPSTSLRDEYPVPRNALLCG  532



>ref|XP_004142986.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 gb|KGN62282.1| Multicopper oxidase [Cucumis sativus]
Length=539

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/515 (53%), Positives = 358/515 (70%), Gaps = 2/515 (0%)
 Frame = -2

Query  1753  SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKLDE  1574
             ++V AEDPYRF++W V YGTI PLG+ Q+GILINGQFPGP+I+ +TN+N+I+NV N LDE
Sbjct  15    AIVRAEDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDE  74

Query  1573  PILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAAGG  1394
             P L +WNGI+QR++S+ DGV GT CPI P  N+TY +QMKDQIG++ YF S   H+AAGG
Sbjct  75    PFLLSWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGG  134

Query  1393  YGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLINGRL  1214
             +G + I+ R  IP+P+P+P+  YT+++ DW+  +H  L+ QLD G   P P G+LINGR 
Sbjct  135   FGGIRILSRPRIPVPFPDPAGDYTVLIGDWYQANHTTLRAQLDNGSMLPLPDGILINGRG  194

Query  1213  --NSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHVG  1040
                + +   +QG TY  R+SNVG+ +S+NFRIQ H++K+VEVEG+HT+Q ++ SLDIHVG
Sbjct  195   PNRTASINVEQGKTYRLRISNVGLQSSLNFRIQGHRMKVVEVEGTHTLQTEFSSLDIHVG  254

Query  1039  QSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWSM  860
             QS   LVT +   +D+YIV SSRF  P ++ +AIL Y  S   V G  P  P  Q  WS+
Sbjct  255   QSYSVLVTADQPAQDFYIVVSSRFTTPILSTTAILRYANSAGSVQGPPPGGPTIQIDWSL  314

Query  859   RQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNPT  680
              QAR IR NLTA+  RPNPQGSYHYG I   RT+V+ N+   + G  RYA+N VS++   
Sbjct  315   NQARAIRTNLTASGPRPNPQGSYHYGMITTTRTIVVANSAGIVDGKQRYAVNSVSFIPAD  374

Query  679   TPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYHL  500
             TPLK+AD+  I GVF + +I D P  G      SV G +   +VEI+FQNNE  +QS+HL
Sbjct  375   TPLKVADFFKIGGVFRVGSISDWPNGGGIYQDTSVMGADYRAFVEIVFQNNEDLIQSWHL  434

Query  499   DGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSSV  320
             DG  F+ VG  GG W S  R +YNL DA  R TVQVYP SW+AI V+LDN GMWN+R+  
Sbjct  435   DGYSFFVVGMDGGQWTSNSRNQYNLRDAIARCTVQVYPKSWSAIYVALDNVGMWNIRTEF  494

Query  319   WPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             W R YLGQQ YLRV+    SL  E  +P + LLCG
Sbjct  495   WARQYLGQQFYLRVYTPSTSLRDEYPIPKNALLCG  529



>ref|XP_008221175.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=544

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/525 (54%), Positives = 361/525 (69%), Gaps = 5/525 (1%)
 Frame = -2

Query  1774  VLAFFCI----SMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
             V A  C+    S+V AEDPY+F+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N
Sbjct  10    VSALLCLTALFSIVAAEDPYKFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDN  69

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF
Sbjct  70    LIINVFNSLDEPFLISWNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYF  129

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+ ++H  L+  LD GK  P
Sbjct  130   PSLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTSLRAHLDAGKKLP  189

Query  1246  SPKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQD  1070
              P G+LINGR     +   +QG TY  R+SNVG+  S+NFRIQNH LKLVEVEG+HT+Q 
Sbjct  190   FPDGILINGRGPGGFSLNFEQGKTYRLRISNVGLQHSLNFRIQNHNLKLVEVEGTHTLQT  249

Query  1069  QYDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPD  890
              Y SLD+HVGQS   LVT +   +DYYIVASSRF  P +T +  LHY  S  +V G  P 
Sbjct  250   TYSSLDVHVGQSYSVLVTADQPGQDYYIVASSRFTTPILTTTGTLHYTNSAGRVSGPPPG  309

Query  889   PPAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYA  710
              P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   +T VLEN+   ++G  RY 
Sbjct  310   GPTIQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINTTKTYVLENSAGQVNGKQRYG  369

Query  709   LNKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQN  530
             +N VS+V   TPLKLAD+  I GVF + +I D P  G      SV G +   +VE +FQN
Sbjct  370   VNSVSFVPADTPLKLADYFKIGGVFRVGSISDRPTGGGLYLDTSVLGADYRTFVEFVFQN  429

Query  529   NEKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDN  350
             NE  +QS+HLDG  F+ VG  GG W    RK+YNL DA +R T+QVYP SWTAI V+LDN
Sbjct  430   NEDIIQSWHLDGYSFFVVGLDGGQWTPNSRKEYNLRDAVSRCTIQVYPKSWTAIYVALDN  489

Query  349   KGMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              GMWNLR+  W R YLGQQ+YLRV+    S+  E  +P +  LCG
Sbjct  490   VGMWNLRTEFWARQYLGQQLYLRVYTPSTSIRDEYPIPKNARLCG  534



>ref|XP_007200295.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
 gb|EMJ01494.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
Length=536

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/516 (53%), Positives = 355/516 (69%), Gaps = 1/516 (0%)
 Frame = -2

Query  1759  CISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKL  1580
              +    AEDPYRF++W + YG I PLGV+Q+GILINGQFPGPEI  +TN+N+I+NV N L
Sbjct  12    VLGFAAAEDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSL  71

Query  1579  DEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAA  1400
              EP L +WNG++ R++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S   H+AA
Sbjct  72    PEPFLISWNGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAA  131

Query  1399  GGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLING  1220
             GG+GA+ I+ R  IP+P+P+P+  Y++++ DW+ TDHK L+  LD G   P P G++ING
Sbjct  132   GGFGAIKILSRPRIPVPFPDPAGDYSILIGDWYKTDHKILKGILDRGHRLPFPDGIIING  191

Query  1219  R-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIHV  1043
             R  N   FT  QG TY  R+SNVG+  S+NFRIQ HKLKLVEVEG+HT+Q  YDSLDIHV
Sbjct  192   RGPNGTYFTFDQGKTYRLRISNVGLQNSLNFRIQGHKLKLVEVEGTHTIQTTYDSLDIHV  251

Query  1042  GQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYHWS  863
             GQS   LVT +   +DYYI  S+RF    +T++A+ HY  S  +V G +P  P  Q  WS
Sbjct  252   GQSYSVLVTADQAPQDYYIAVSTRFTSKVLTSTAVFHYSNSGRQVSGPIPAGPTTQTGWS  311

Query  862   MRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYVNP  683
             + QA +IR NLTA+  RPNPQGSYHYG + + RT+ LE++   +SG  RYA+N VS++  
Sbjct  312   LSQALSIRTNLTASGPRPNPQGSYHYGLVNVSRTIKLESSAAQVSGKQRYAVNSVSFIPA  371

Query  682   TTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTLQSYH  503
              TPLKLAD+  I GVF + +I D P         SV G +   +VEI+FQN+E  +QS+H
Sbjct  372   DTPLKLADYFKIGGVFKVGSISDNPTGQKMYLDTSVMGADFRAFVEIVFQNHENIVQSWH  431

Query  502   LDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNLRSS  323
             LDG  FW VG  GG W    R +YNL DA +R T QVYP SWTAI ++LDN GMWNLR+ 
Sbjct  432   LDGYSFWVVGMDGGKWTPASRNEYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRTE  491

Query  322   VWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
              W R YLGQQ YLRV++   S   E  +P + LLCG
Sbjct  492   FWARQYLGQQFYLRVYSPVESARDEYPIPRNALLCG  527



>gb|ACJ85585.1| unknown [Medicago truncatula]
Length=544

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/523 (53%), Positives = 358/523 (68%), Gaps = 6/523 (1%)
 Frame = -2

Query  1765  FFCIS-----MVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvi  1601
               C+S     +  AEDPY+F+NW V YG I PLGV+QRGILINGQFPGP+I+ +TN+N+I
Sbjct  12    LLCVSTSLFHITSAEDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLI  71

Query  1600  vnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLS  1421
             +NV N L+EP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S
Sbjct  72    INVFNSLNEPFLISWNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPS  131

Query  1420  TQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSP  1241
                 +AAGG+G + I+ R  IP+P+PEP+  YT+++ DW+ ++H  L+  LD GK  P P
Sbjct  132   LAFQKAAGGFGGIRILSRPRIPVPFPEPAGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIP  191

Query  1240  KGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQY  1064
              G+LINGR  N ++F  +QG TY  R+SNVG+  S+NFRIQNHKLKLVEVEG+HT+Q  Y
Sbjct  192   DGVLINGRGPNGLSFNVEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTY  251

Query  1063  DSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPP  884
              SLD+HVGQS   LVT +   +DYY+VAS+RF     T +A+L Y  S   V G  P  P
Sbjct  252   SSLDVHVGQSYSVLVTADQPSQDYYVVASTRFSSKIPTTTAVLRYSNSAGAVSGPPPGGP  311

Query  883   AGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALN  704
               Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   +T++L ++   ++G  RY +N
Sbjct  312   TIQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINTTKTIILASSPGQVNGKQRYGIN  371

Query  703   KVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNE  524
              VSYV P TPLKLAD+  I GVF + +I + P  G      SV   +   +VEI+FQNNE
Sbjct  372   SVSYVVPDTPLKLADYFKISGVFRVGSISERPTGGGLYLDTSVMQADYRSFVEIVFQNNE  431

Query  523   KTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKG  344
               +QSYHLDG  F+ VG  GG W ++ R  YNL DA  R  +QVYP SWTAI V+LDN G
Sbjct  432   NIVQSYHLDGYSFFVVGMDGGQWTTSSRNGYNLRDAVARCAIQVYPYSWTAIYVALDNVG  491

Query  343   MWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             MWNLR+  W R YLGQQ YLRV+    S+  E  +P +  LCG
Sbjct  492   MWNLRTEFWARQYLGQQFYLRVYTASTSIRDEFPIPKNARLCG  534



>ref|XP_003523207.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/524 (54%), Positives = 360/524 (69%), Gaps = 1/524 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             LL  +A     +  AEDPYRF+NW V YG I PLGV+Q GILINGQFPGP+I+ +TN+N+
Sbjct  14    LLLCVAISLFHIAGAEDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNL  73

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF 
Sbjct  74    IINVFNSLDEPFLLSWNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFP  133

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+ ++H  L+ +LD GK  P 
Sbjct  134   SLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKARLDRGKKLPF  193

Query  1243  PKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             P G+LINGR  N V+   +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q  
Sbjct  194   PDGILINGRGPNGVSLNVEQGKTYRLRISNVGLQHSLNFRIQNHKMKLVEVEGTHTLQTT  253

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y SLD+HVGQS   LVT +   +DYYIV SSRF    +T + +L Y  S   V G  P  
Sbjct  254   YSSLDVHVGQSYSVLVTADQPAQDYYIVFSSRFSYKVLTTTGVLRYSNSAGPVSGPPPGG  313

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   +T++L ++   ++G  RYA+
Sbjct  314   PTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTTKTIILASSAGQVNGKQRYAI  373

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VSYV P TPLKLAD+  I GVF   +I D P  G      SV   +   +VEI+FQNN
Sbjct  374   NSVSYVAPDTPLKLADYFKISGVFRPGSISDRPTGGGIYLDTSVLQADYRTFVEIVFQNN  433

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             EK +QSYHLDG  F+ VG  GG W    R +YNL DA  R T QVYP SWTAI ++LDN 
Sbjct  434   EKIVQSYHLDGYSFFVVGMDGGQWTPASRNQYNLRDAVARCTTQVYPFSWTAIYIALDNV  493

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS  W R YLGQQ+YLRV+    S+  E  +P + +LCG
Sbjct  494   GMWNLRSEFWARQYLGQQLYLRVYTASTSIRDEFPVPKNAILCG  537



>emb|CDX73238.1| BnaC06g36860D [Brassica napus]
Length=541

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/520 (52%), Positives = 356/520 (68%), Gaps = 0/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             ++ F  +  V AE PYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I+N
Sbjct  12    IVGFALLFAVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S  
Sbjct  72    VYNSLDEPFLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLA  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G L I+ R  IP+P+ +P+  YT+++ DW+  +H  L+ QLD+G+  P P G
Sbjct  132   FHKAAGGFGGLRILSRPGIPVPFADPAGDYTVLIGDWYKANHTDLKAQLDSGRKLPLPDG  191

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LINGR +  T   +QG TY  R+SN+G+  S+NFRIQNHK+K+VEVEG+HT+Q  + SL
Sbjct  192   ILINGRGSGATLNVEQGKTYRLRISNIGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSL  251

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   LVT +   +DYY+V SSRF    +T + +L Y GS   V G +P  P  Q
Sbjct  252   DVHVGQSYSVLVTADQPAQDYYVVVSSRFTSDVLTTTGVLRYSGSAGGVSGPIPGGPTIQ  311

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR IR NLTA+  RPNPQGSYHYG I   RT+ L ++   ++G  RYA+N VS
Sbjct  312   IDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVS  371

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             +    TPLKLAD+  I GV+ + +I+  P  G      SV   +   ++EI+F+N+E  +
Sbjct  372   FNPADTPLKLADYFKIDGVYRVGSIQSQPTGGGIYLDTSVMQTDYRTFIEIVFENSEDIV  431

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QS+HLDG  FW VG  GG W    R +YNL DA  R TVQVYP+SWTAI ++LDN GMWN
Sbjct  432   QSWHLDGYSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWN  491

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LRS  W R YLGQQ YLRV+    SL  E  +P + LLCG
Sbjct  492   LRSEFWARQYLGQQFYLRVYTTSTSLRDEYPIPKNALLCG  531



>gb|KHG03845.1| L-ascorbate oxidase [Gossypium arboreum]
Length=542

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/519 (55%), Positives = 363/519 (70%), Gaps = 4/519 (1%)
 Frame = -2

Query  1759  CISM--VEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviN  1586
             CI    V  E PYRF+   V +G I PLGVKQ+GILINGQFPGP I+ +TN+N+I++V N
Sbjct  14    CILFLGVNGESPYRFFTLKVTHGDIYPLGVKQKGILINGQFPGPTIDAVTNDNLIIHVYN  73

Query  1585  KLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHR  1406
              L+ P L +WNG++QR++SW DGVLGTNCPI P  N+TY +Q+KDQIGT+ YF S   H+
Sbjct  74    YLNVPFLISWNGVQQRRNSWQDGVLGTNCPIRPGKNFTYVLQVKDQIGTFFYFPSLFFHK  133

Query  1405  AAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLI  1226
             AAGGYG++ I  R  IP+P+P P+  +T++  DW+  +H  L++ L++G   P P GL+I
Sbjct  134   AAGGYGSIRIWSRPKIPVPFPTPAGDFTVLAGDWYKRNHYVLRRYLESGHSLPFPDGLVI  193

Query  1225  NGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDI  1049
             NGR  N  TFT   G TY FRVSNVG++TSINFRIQ+HKLKL+EVEGSHT+Q+ Y S DI
Sbjct  194   NGRGWNGYTFTVDPGRTYRFRVSNVGISTSINFRIQSHKLKLIEVEGSHTLQNTYHSFDI  253

Query  1048  HVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQYH  869
             H+GQS  FLVT +   +DYY+VASSRF    +T +AILHY  S   V G +P  P  Q  
Sbjct  254   HLGQSYSFLVTADQAPQDYYVVASSRFTPRVLTTTAILHYSNSRKGVSGLIPWAPTFQIA  313

Query  868   WSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVSYV  689
              S+ QAR+IRWNLTA+  RPNPQGSYHYG I   RT++L N+   I+G  RYA+N VSYV
Sbjct  314   PSLMQARSIRWNLTASGPRPNPQGSYHYGMITPSRTIMLANSAPYINGKQRYAVNGVSYV  373

Query  688   NPTTPLKLADWLNIPGVFTLNAIKDTPPAG-PAVHGVSVFGLELHDYVEIIFQNNEKTLQ  512
              P TPLKLAD+  IPGVF L +I   PP+G  A    SV   +   YVEI+FQN E T+Q
Sbjct  374   PPDTPLKLADYFKIPGVFNLGSIPTRPPSGNNAYLQTSVMAADFRKYVEIVFQNWENTVQ  433

Query  511   SYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWNL  332
             S+H+DG  F+ VG  GG W    R+ YNL+DA +R T QVYP SWTAI ++LDN GMWN+
Sbjct  434   SWHIDGYSFFVVGMDGGQWTPDSRRSYNLIDAVSRCTTQVYPRSWTAIYMALDNVGMWNI  493

Query  331   RSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             RS  W R YLGQQ YLRV++  +S   E  +P   LLCG
Sbjct  494   RSENWARQYLGQQFYLRVYSPANSWRDEYPIPKHALLCG  532



>ref|XP_006302110.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
 gb|EOA35008.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
Length=541

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/524 (52%), Positives = 359/524 (69%), Gaps = 3/524 (1%)
 Frame = -2

Query  1786  FLLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnen  1607
              L+G+   F ++   AEDPYRF+ W + YG I PLGV+Q+GILINGQFPGP+I+ +TN+N
Sbjct  11    LLIGLSLLFAVT---AEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDN  67

Query  1606  vivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYF  1427
             +I+NV N LDEP L +WNG++QR++S+ DGV GT CPI P  N+TY +QMKDQIG++ YF
Sbjct  68    IIINVYNSLDEPFLLSWNGVQQRRNSFVDGVYGTTCPIPPGKNYTYMLQMKDQIGSFYYF  127

Query  1426  LSTQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFP  1247
              S   H+AAGG+G + I+ R  IP+P+P+P+   T+++ DW+ ++H  L+ QLD GK  P
Sbjct  128   PSLGFHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLRAQLDNGKKLP  187

Query  1246  SPKGLLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
              P G+LINGR +  T   +QG TY  R+SNVG+  S+NFRIQ+HK+K+VEVEG+HT+Q  
Sbjct  188   LPDGILINGRSSGATLNVEQGKTYRLRISNVGLQDSLNFRIQDHKMKVVEVEGTHTLQTT  247

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             + SLD+HVGQS   LVT +   KDYY+V SSRF    +T + +L Y  S   V G +P  
Sbjct  248   FSSLDVHVGQSYSVLVTADQPPKDYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGG  307

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR IR NLTA+  RPNPQGSYHYG I   RT+ L ++   + G  RYA+
Sbjct  308   PTIQIDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAV  367

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VS+    TPLKLAD+  I GV+   +I+  P  G      SV  ++   +VEIIF+N+
Sbjct  368   NSVSFKPADTPLKLADYFKIDGVYRTGSIQYQPTGGGIYLDTSVMQVDYRTFVEIIFENS  427

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QS+HLDG  FW VG  GG W    R +YNL DA  R TVQVYP+SWTAIL++LDN 
Sbjct  428   EDIVQSWHLDGYSFWVVGMDGGQWSPASRNEYNLRDAVARCTVQVYPSSWTAILIALDNV  487

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS  W R YLGQQ+YLRV+    SL  E  +P + LLCG
Sbjct  488   GMWNLRSEFWARQYLGQQLYLRVYTPSTSLRDEYPVPRNALLCG  531



>ref|XP_003527461.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/524 (53%), Positives = 361/524 (69%), Gaps = 1/524 (0%)
 Frame = -2

Query  1783  LLGVLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenv  1604
             LL  +A     +  AEDPYRF+NW + YG I PLGV+Q GILINGQFPGP+I+ +TN+N+
Sbjct  14    LLLCVAISLFHIAGAEDPYRFFNWNITYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNL  73

Query  1603  ivnviNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFL  1424
             I+NV N LDEP L +WNGI+QR++S+ DGV GT CPI    N+TY +Q+KDQIGT+ YF 
Sbjct  74    IINVFNSLDEPFLLSWNGIQQRRNSFEDGVFGTTCPIPAGKNFTYILQVKDQIGTFYYFP  133

Query  1423  STQLHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPS  1244
             S   H+AAGG+G + I+ R  IP+P+P+P+  YT+++ DW+ ++H  L+ +LD GK  P 
Sbjct  134   SLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKARLDRGKKLPF  193

Query  1243  PKGLLINGR-LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQ  1067
             P G+LINGR  N V+F  +QG TY  R+SNVG+  S+NFRIQNHK+KLVEVEG+HT+Q  
Sbjct  194   PDGILINGRGPNGVSFNVEQGKTYRLRISNVGLQHSLNFRIQNHKMKLVEVEGTHTLQTM  253

Query  1066  YDSLDIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDP  887
             Y SLD+HVGQS   LVT +   +DYYIV S+RF    +T + +L Y  S   V G  P  
Sbjct  254   YSSLDVHVGQSYSVLVTADQPAQDYYIVVSTRFSYKVLTTTGVLRYSNSAGPVSGPPPGG  313

Query  886   PAGQYHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYAL  707
             P  Q  WS+ QAR+IR NLTA+  RPNPQGSYHYG I   +T++L ++   ++G  RYA+
Sbjct  314   PTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTTKTIILASSAGQVNGKQRYAI  373

Query  706   NKVSYVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNN  527
             N VSYV P TPLKLAD+  I GVF   +I D P  G      SV   +  ++VEI+FQNN
Sbjct  374   NSVSYVVPDTPLKLADYFKISGVFRPGSISDRPTGGGIYLDTSVLQADYRNFVEIVFQNN  433

Query  526   EKTLQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNK  347
             E  +QSYHLDG  F+ VG  GG W +  R +YNL DA  R T QVYP SWTAI ++LDN 
Sbjct  434   ENIVQSYHLDGYSFFVVGMDGGQWTTASRNQYNLRDAVARCTTQVYPFSWTAIYIALDNV  493

Query  346   GMWNLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             GMWNLRS  W R YLGQQ+YLRV+    S+  E  +P + +LCG
Sbjct  494   GMWNLRSEFWARQYLGQQLYLRVYTTSTSIRDEFPVPKNAILCG  537



>ref|XP_009106271.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/520 (52%), Positives = 357/520 (69%), Gaps = 0/520 (0%)
 Frame = -2

Query  1774  VLAFFCISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivn  1595
             ++ F  +  V AE PYRF+ W V YG I PLGV+Q+GILINGQFPGP+I+ +TN+N+I+N
Sbjct  12    IVGFALLFAVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  1594  viNKLDEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQ  1415
             V N LDEP L +WNG++QR++S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S  
Sbjct  72    VYNSLDEPFLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLA  131

Query  1414  LHRAAGGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKG  1235
              H+AAGG+G L I+ R  IP+P+ +P+  YT+++ DW+ ++H  L+ QLD+G+  P P G
Sbjct  132   FHKAAGGFGGLRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKAQLDSGRKLPLPDG  191

Query  1234  LLINGRLNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSL  1055
             +LINGR +  T   +QG TY  R+SN+G+  S+NFRIQNHK+K+VEVEG+HT+Q  + SL
Sbjct  192   ILINGRGSGATLNVEQGKTYRLRISNIGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSL  251

Query  1054  DIHVGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGSVTKVPGKLPDPPAGQ  875
             D+HVGQS   LVT +   +DYY+V SSRF    +T + +L Y GS   V G +P  P  Q
Sbjct  252   DVHVGQSYSVLVTADQPAQDYYVVVSSRFTSDVLTTTGVLRYSGSAGGVSGPIPGGPTIQ  311

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS+ QAR IR NLTA+  RPNPQGSYHYG I   RT+ L ++   ++G  RYA+N VS
Sbjct  312   IDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVS  371

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVHGVSVFGLELHDYVEIIFQNNEKTL  515
             +    TPLKLAD+  I GV+ + +I+  P  G      SV   +   ++EI+F+N+E  +
Sbjct  372   FNPADTPLKLADYFKIDGVYRVGSIQSQPTGGGIYLDTSVMQTDYRTFIEIVFENSEDIV  431

Query  514   QSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMWN  335
             QS+HLDG  FW VG  GG W    R +YNL DA  R TVQVYP+SWTAI ++LDN GMWN
Sbjct  432   QSWHLDGYSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWN  491

Query  334   LRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             LRS  W R YLGQQ YLRV+    SL  E  +P + LLCG
Sbjct  492   LRSEFWARQYLGQQFYLRVYTTSTSLRDEYPIPKNALLCG  531



>ref|XP_006283464.1| hypothetical protein CARUB_v10004509mg [Capsella rubella]
 gb|EOA16362.1| hypothetical protein CARUB_v10004509mg [Capsella rubella]
Length=554

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/521 (53%), Positives = 362/521 (69%), Gaps = 6/521 (1%)
 Frame = -2

Query  1759  CISMVEAEDPYRFYNWVVQYGTISPLGVKQRGILINGQFPGPeinvitnenvivnviNKL  1580
              IS V+AEDPYRF++W V YGTISPLG+  RGILINGQ+PGP+I  +TN+N+I+NV N L
Sbjct  22    LISFVQAEDPYRFFDWRVTYGTISPLGIPLRGILINGQYPGPDIYSVTNDNLIINVHNDL  81

Query  1579  DEPILFTWNGIKQRKSSWTDGVLGTNCPILPNTNWTYRMQMKDQIGTYSYFLSTQLHRAA  1400
             DEP L +WNG++ RK+S+ DGV GT CPI P  N+TY +Q+KDQIG++ YF S  +H+A 
Sbjct  82    DEPFLLSWNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAV  141

Query  1399  GGYGALNIIRRSVIPLPYPEPSAVYTLIVSDWWNTDHKQLQKQLDTGKPFPSPKGLLING  1220
             GG+G   I+ R  IP+P+PEP+  +T +VSDW+  DHK L+  LD G   P P+G+LING
Sbjct  142   GGFGGFRILSRPRIPVPFPEPAGDFTFLVSDWFERDHKTLKALLDRGHKLPLPQGVLING  201

Query  1219  R--LNSVTFTGKQGSTYMFRVSNVGMTTSINFRIQNHKLKLVEVEGSHTMQDQYDSLDIH  1046
             +    S + T  +G TY FR+SNVG+  ++NFRIQ H++KLVEVEG+HT+Q  Y SLDIH
Sbjct  202   QGVSFSSSLTVHKGKTYRFRISNVGLQNTLNFRIQGHQMKLVEVEGTHTVQSMYTSLDIH  261

Query  1045  VGQSAGFLVTLNADVKDYYIVASSRFVKPYMTASAILHYDGS---VTKVPGKLPDPPAGQ  875
             VGQS   LVT++   +DY IV S++FV   +  S+ +HY  S   ++     +  PP  +
Sbjct  262   VGQSYSVLVTMDQPAQDYGIVVSTKFVAKKLLVSSTIHYFNSRKTLSSASVHVEPPPTDE  321

Query  874   YHWSMRQARTIRWNLTANAARPNPQGSYHYGTIPIVRTLVLENTKENISGITRYALNKVS  695
               WS++QAR+IR NLTA+  RPNPQGSYHYG I I RTL+LE++   +    RYA+N VS
Sbjct  322   LDWSIKQARSIRTNLTASGPRPNPQGSYHYGRIKISRTLILESSAARVHRKQRYAINGVS  381

Query  694   YVNPTTPLKLADWLNIPGVFTLNAIKDTPPAGPAVH-GVSVFGLELHDYVEIIFQNNEKT  518
             +V   TPLKLAD+  I GVF + +I D P  G  +    SV G    D++EI+FQN EK 
Sbjct  382   FVAADTPLKLADYFKIKGVFKVGSIPDKPRRGVGMRMDTSVMGARHRDFLEIVFQNREKI  441

Query  517   LQSYHLDGQDFWAVGYGGGVWDSTLRKKYNLVDATTRYTVQVYPNSWTAILVSLDNKGMW  338
             +QSYHLDG  FW VG   G W    R++YNL DA +R T QVYP SWTA+ V+LDN GMW
Sbjct  442   VQSYHLDGYSFWVVGMDRGAWSKASRREYNLRDAVSRSTTQVYPESWTAVYVALDNVGMW  501

Query  337   NLRSSVWPRNYLGQQVYLRVWNNEHSLYTENDMPPDTLLCG  215
             NLRS  W R YLGQQ+YLRV++  HSL  E  +P + LLCG
Sbjct  502   NLRSEYWARQYLGQQLYLRVYSPAHSLRDEYLLPKNALLCG  542



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5775615136212