BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14344_g1_i1 len=1702 path=[1680:0-1194 2875:1195-1218
2899:1219-1240 2921:1241-1701]

Length=1702
                                                                      Score     E

ref|XP_009625087.1|  PREDICTED: ABC transporter B family member 1...    817   0.0      
ref|XP_009625085.1|  PREDICTED: ABC transporter B family member 1...    817   0.0      
ref|XP_009787798.1|  PREDICTED: ABC transporter B family member 1...    802   0.0      
ref|XP_006343128.1|  PREDICTED: ABC transporter B family member 1...    797   0.0      
emb|CDO97815.1|  unnamed protein product                                791   0.0      
ref|XP_004236380.1|  PREDICTED: ABC transporter B family member 1...    791   0.0      
ref|XP_010654400.1|  PREDICTED: ABC transporter B family member 1...    762   0.0      
ref|XP_007024714.1|  Multidrug/pheromone exporter, MDR family, AB...    761   0.0      
ref|XP_002529182.1|  multidrug resistance protein 1, 2, putative        753   0.0      Ricinus communis
gb|KHG28826.1|  ABC transporter B family member 19                      748   0.0      
gb|KHG28827.1|  ABC transporter B family member 19                      749   0.0      
ref|XP_008228350.1|  PREDICTED: ABC transporter B family member 1...    744   0.0      
gb|KDP40662.1|  hypothetical protein JCGZ_24661                         740   0.0      
gb|KHN39598.1|  ABC transporter B family member 19                      741   0.0      
ref|XP_003548375.1|  PREDICTED: ABC transporter B family member 1...    741   0.0      
ref|XP_007216167.1|  hypothetical protein PRUPE_ppa015387mg             739   0.0      
ref|XP_011073033.1|  PREDICTED: ABC transporter B family member 1...    741   0.0      
ref|XP_006466134.1|  PREDICTED: ABC transporter B family member 1...    739   0.0      
ref|XP_006426752.1|  hypothetical protein CICLE_v10027300mg             738   0.0      
ref|XP_010104606.1|  ABC transporter B family member 19                 761   0.0      
gb|KDO45716.1|  hypothetical protein CISIN_1g000406mg                   738   0.0      
ref|XP_006369112.1|  hypothetical protein POPTR_0001s16560g             737   0.0      
ref|XP_011048586.1|  PREDICTED: ABC transporter B family member 1...    730   0.0      
ref|XP_009336717.1|  PREDICTED: ABC transporter B family member 1...    720   0.0      
ref|XP_009378366.1|  PREDICTED: ABC transporter B family member 1...    712   0.0      
ref|XP_008380772.1|  PREDICTED: ABC transporter B family member 2...    710   0.0      
gb|EYU21290.1|  hypothetical protein MIMGU_mgv1a000189mg                718   0.0      
ref|XP_004155963.1|  PREDICTED: ABC transporter B family member 1...    714   0.0      
ref|XP_004141818.1|  PREDICTED: ABC transporter B family member 1...    713   0.0      
gb|KGN45464.1|  hypothetical protein Csa_7G448750                       713   0.0      
ref|XP_004510541.1|  PREDICTED: ABC transporter B family member 1...    713   0.0      
ref|XP_008342433.1|  PREDICTED: ABC transporter B family member 1...    699   0.0      
ref|XP_008462268.1|  PREDICTED: ABC transporter B family member 1...    709   0.0      
ref|XP_003627370.1|  ABC transporter B family member                    709   0.0      
ref|XP_004305767.1|  PREDICTED: ABC transporter B family member 1...    710   0.0      
ref|XP_010034721.1|  PREDICTED: ABC transporter B family member 1...    705   0.0      
ref|XP_006843855.1|  hypothetical protein AMTR_s00007p00263610          674   0.0      
ref|XP_010937363.1|  PREDICTED: ABC transporter B family member 1...    649   0.0      
ref|XP_008787010.1|  PREDICTED: ABC transporter B family member 1...    642   0.0      
ref|XP_010230241.1|  PREDICTED: ABC transporter B family member 1...    612   0.0      
emb|CBI35827.3|  unnamed protein product                                605   0.0      
gb|EMT16661.1|  ABC transporter B family member 19                      608   0.0      
ref|XP_008669709.1|  PREDICTED: ABC transporter B family member 1...    593   0.0      
tpg|DAA38661.1|  TPA: hypothetical protein ZEAMMB73_035779              593   0.0      
ref|XP_002447460.1|  hypothetical protein SORBIDRAFT_06g001440          580   0.0      Sorghum bicolor [broomcorn]
gb|AAN65444.1|  Hypothetical protein                                    575   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEE58440.1|  hypothetical protein OsJ_09662                          573   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389871.1|  PREDICTED: ABC transporter B family member 1...    567   0.0      
gb|EEC74635.1|  hypothetical protein OsI_10267                          558   4e-179   Oryza sativa Indica Group [Indian rice]
ref|XP_007135398.1|  hypothetical protein PHAVU_010G1262001g            513   2e-175   
gb|EMS48444.1|  ABC transporter B family member 19                      394   2e-129   
ref|XP_001757525.1|  ATP-binding cassette transporter, subfamily ...    376   4e-113   
dbj|BAJ53110.1|  JHL20J20.17                                            374   5e-113   
dbj|BAF01897.1|  putative P-glycoprotein                                360   1e-112   Arabidopsis thaliana [mouse-ear cress]
gb|KDP36900.1|  hypothetical protein JCGZ_08191                         374   2e-112   
ref|XP_009398790.1|  PREDICTED: putative multidrug resistance pro...    356   1e-111   
gb|AFW58472.1|  hypothetical protein ZEAMMB73_248443                    362   4e-111   
ref|XP_002983053.1|  hypothetical protein SELMODRAFT_117529             370   7e-111   
gb|AIU41630.1|  ABC transporter family protein                          369   7e-111   
ref|XP_002510564.1|  multidrug resistance protein 1, 2, putative        370   1e-110   Ricinus communis
dbj|BAG96130.1|  unnamed protein product                                365   2e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965566.1|  ATP-binding cassette transporter                   369   2e-110   
ref|XP_001759716.1|  ATP-binding cassette transporter, subfamily ...    369   3e-110   
ref|XP_010069803.1|  PREDICTED: ABC transporter B family member 1...    369   3e-110   
gb|ABX82929.1|  LO4                                                     368   6e-110   Solanum pennellii
ref|NP_001234209.1|  L04                                                367   7e-110   
gb|KDO84909.1|  hypothetical protein CISIN_1g000851mg                   364   1e-109   
ref|XP_006338462.1|  PREDICTED: ABC transporter B family member 1...    367   1e-109   
ref|XP_010937072.1|  PREDICTED: ABC transporter B family member 19      367   1e-109   
ref|XP_006473688.1|  PREDICTED: ABC transporter B family member 1...    363   2e-109   
gb|EYU34087.1|  hypothetical protein MIMGU_mgv1a000781mg                362   2e-109   
ref|XP_004304461.1|  PREDICTED: ABC transporter B family member 1...    367   3e-109   
ref|XP_006652374.1|  PREDICTED: ABC transporter B family member 1...    365   5e-109   
ref|XP_004173903.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    353   6e-109   
ref|XP_008387923.1|  PREDICTED: ABC transporter B family member 1...    364   9e-109   
gb|KDO84908.1|  hypothetical protein CISIN_1g000851mg                   364   1e-108   
ref|XP_006435210.1|  hypothetical protein CICLE_v10000054mg             364   1e-108   
ref|XP_011034998.1|  PREDICTED: ABC transporter B family member 1...    360   2e-108   
gb|EEC77398.1|  hypothetical protein OsI_16157                          364   2e-108   Oryza sativa Indica Group [Indian rice]
emb|CAD59581.1|  MDR-like ABC transporter                               363   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052982.1|  Os04g0459000                                       364   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009151836.1|  PREDICTED: ABC transporter B family member 19      363   3e-108   
emb|CDX86408.1|  BnaA06g31250D                                          363   3e-108   
ref|XP_006473687.1|  PREDICTED: ABC transporter B family member 1...    363   3e-108   
ref|XP_002983357.1|  hypothetical protein SELMODRAFT_117838             364   3e-108   
ref|XP_010655614.1|  PREDICTED: ABC transporter B family member 9...    362   3e-108   
ref|XP_002967417.1|  hypothetical protein SELMODRAFT_87743              364   4e-108   
ref|XP_010554005.1|  PREDICTED: ABC transporter B family member 1...    363   4e-108   
ref|XP_002447959.1|  hypothetical protein SORBIDRAFT_06g018860          363   5e-108   Sorghum bicolor [broomcorn]
ref|XP_004975845.1|  PREDICTED: ABC transporter B family member 1...    362   6e-108   
emb|CDY65012.1|  BnaCnng45670D                                          362   6e-108   
ref|XP_011098607.1|  PREDICTED: ABC transporter B family member 19      362   6e-108   
ref|XP_002877137.1|  P-glycoprotein 19                                  362   8e-108   
ref|XP_006290510.1|  hypothetical protein CARUB_v10016588mg             362   1e-107   
ref|XP_008784383.1|  PREDICTED: ABC transporter B family member 19      362   1e-107   
ref|XP_008369562.1|  PREDICTED: ABC transporter B family member 1...    362   2e-107   
gb|KFM27090.1|  ABC transporter B family member 4                       362   2e-107   
ref|XP_002271185.1|  PREDICTED: ABC transporter B family member 9...    361   2e-107   Vitis vinifera
ref|XP_002279471.2|  PREDICTED: ABC transporter B family member 1...    361   2e-107   Vitis vinifera
ref|XP_006395333.1|  hypothetical protein EUTSA_v10003528mg             361   2e-107   
ref|XP_004499289.1|  PREDICTED: ABC transporter B family member 1...    361   2e-107   
ref|XP_010514603.1|  PREDICTED: ABC transporter B family member 1...    361   2e-107   
ref|XP_002301961.1|  multidrug resistance P-glycoprotein                360   2e-107   Populus trichocarpa [western balsam poplar]
ref|XP_008221400.1|  PREDICTED: ABC transporter B family member 1...    360   3e-107   
ref|XP_009339152.1|  PREDICTED: ABC transporter B family member 1...    362   3e-107   
ref|NP_001169660.1|  uncharacterized protein LOC100383541               360   3e-107   Zea mays [maize]
gb|ABG56414.1|  MDR-like ABC transporter                                361   3e-107   
ref|XP_009339155.1|  PREDICTED: ABC transporter B family member 1       361   3e-107   
ref|XP_010256924.1|  PREDICTED: ABC transporter B family member 19      360   4e-107   
gb|AES81895.2|  ABC transporter B family protein                        361   4e-107   
emb|CDP17032.1|  unnamed protein product                                361   4e-107   
ref|XP_008804466.1|  PREDICTED: ABC transporter B family member 1...    355   4e-107   
gb|ABG56413.1|  MDR-like ABC transporter                                360   4e-107   Catharanthus roseus [chatas]
ref|XP_011034997.1|  PREDICTED: ABC transporter B family member 1...    360   5e-107   
ref|NP_189528.1|  ABC transporter B family member 19                    360   5e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025208.1|  P-glycoprotein 9 isoform 1                         360   5e-107   
ref|XP_010528330.1|  PREDICTED: ABC transporter B family member 19      360   5e-107   
gb|EYU46880.1|  hypothetical protein MIMGU_mgv1a000319mg                360   7e-107   
ref|XP_005850708.1|  hypothetical protein CHLNCDRAFT_34209              360   7e-107   
gb|KFK33760.1|  hypothetical protein AALP_AA5G056700                    359   7e-107   
ref|XP_010425667.1|  PREDICTED: ABC transporter B family member 19      359   7e-107   
ref|XP_010502886.1|  PREDICTED: ABC transporter B family member 1...    359   7e-107   
gb|KHN48276.1|  ABC transporter B family member 1                       359   8e-107   
ref|XP_004485974.1|  PREDICTED: ABC transporter B family member 9...    359   1e-106   
ref|XP_002960296.1|  ATP-binding cassette transporter                   360   1e-106   
emb|CAD40903.1|  OSJNBa0036B21.21                                       359   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006396373.1|  hypothetical protein EUTSA_v10029280mg             344   1e-106   
ref|XP_006375419.1|  multidrug resistant ABC transporter family p...    359   1e-106   
emb|CDY00109.1|  BnaC09g01920D                                          358   2e-106   
ref|XP_010693227.1|  PREDICTED: ABC transporter B family member 19      358   2e-106   
ref|XP_002893495.1|  P-glycoprotein 13                                  358   2e-106   
emb|CDY20012.1|  BnaA09g02390D                                          358   2e-106   
ref|XP_009111610.1|  PREDICTED: ABC transporter B family member 1...    358   2e-106   
gb|KHN12634.1|  ABC transporter B family member 13                      357   2e-106   
gb|KDO72403.1|  hypothetical protein CISIN_1g0408752mg                  344   2e-106   
ref|XP_010266821.1|  PREDICTED: ABC transporter B family member 1...    358   3e-106   
ref|XP_010522857.1|  PREDICTED: ABC transporter B family member 1...    358   3e-106   
ref|XP_003549468.1|  PREDICTED: ABC transporter B family member 1...    358   3e-106   
ref|XP_003541417.1|  PREDICTED: ABC transporter B family member 1...    359   3e-106   
ref|XP_003579896.1|  PREDICTED: ABC transporter B family member 1...    358   3e-106   
ref|XP_010108971.1|  ABC transporter B family member 19                 358   3e-106   
ref|XP_009347047.1|  PREDICTED: ABC transporter B family member 19      358   3e-106   
dbj|BAF02132.1|  putative ABC transporter                               349   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004164800.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    357   3e-106   
ref|XP_007204682.1|  hypothetical protein PRUPE_ppa000269mg             359   3e-106   
gb|KGN60047.1|  hypothetical protein Csa_3G873270                       357   4e-106   
ref|XP_007162774.1|  hypothetical protein PHAVU_001G179300g             358   4e-106   
ref|XP_003520656.1|  PREDICTED: ABC transporter B family member 1...    358   4e-106   
gb|KHN09525.1|  ABC transporter B family member 1                       358   5e-106   
ref|XP_007225446.1|  hypothetical protein PRUPE_ppa000363mg             357   6e-106   
ref|XP_004136487.1|  PREDICTED: ABC transporter B family member 1...    357   6e-106   
emb|CAN71068.1|  hypothetical protein VITISV_031708                     358   6e-106   Vitis vinifera
ref|XP_008387548.1|  PREDICTED: ABC transporter B family member 1       358   6e-106   
dbj|BAC41846.1|  putative P-glycoprotein                                357   7e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554389.1|  PREDICTED: ABC transporter B family member 1...    357   1e-105   
ref|XP_009334844.1|  PREDICTED: ABC transporter B family member 1...    356   1e-105   
ref|XP_011016204.1|  PREDICTED: ABC transporter B family member 2...    356   1e-105   
ref|XP_009377013.1|  PREDICTED: ABC transporter B family member 1       357   2e-105   
gb|KHN02316.1|  ABC transporter B family member 1                       356   2e-105   
ref|XP_009376834.1|  PREDICTED: ABC transporter B family member 1...    357   2e-105   
gb|AAN28720.2|  MDR-like p-glycoprotein                                 355   2e-105   Arabidopsis thaliana [mouse-ear cress]
gb|KGN58980.1|  Multidrug resistance protein 1, 2                       356   2e-105   
ref|XP_011040312.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    353   3e-105   
ref|XP_007051281.1|  ATP binding cassette subfamily B4 isoform 1        355   3e-105   
ref|XP_008439691.1|  PREDICTED: ABC transporter B family member 9       355   3e-105   
ref|XP_009591470.1|  PREDICTED: ABC transporter B family member 19      355   3e-105   
ref|XP_004134559.1|  PREDICTED: ABC transporter B family member 9...    355   3e-105   
dbj|BAK05967.1|  predicted protein                                      355   3e-105   
ref|XP_011079475.1|  PREDICTED: ABC transporter B family member 4...    355   4e-105   
ref|XP_009758464.1|  PREDICTED: ABC transporter B family member 19      355   4e-105   
ref|XP_004489384.1|  PREDICTED: ABC transporter B family member 1...    355   4e-105   
gb|KFK44669.1|  hypothetical protein AALP_AA1G288400                    354   4e-105   
ref|XP_009609959.1|  PREDICTED: ABC transporter B family member 1       355   4e-105   
ref|NP_001275319.1|  P-glycoprotein                                     355   5e-105   
ref|XP_007144334.1|  hypothetical protein PHAVU_007G147400g             355   5e-105   
ref|XP_004246624.1|  PREDICTED: ABC transporter B family member 1       355   5e-105   
ref|XP_010267196.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    355   6e-105   
emb|CDP19825.1|  unnamed protein product                                354   6e-105   
ref|XP_010095132.1|  ABC transporter B family member 9                  354   7e-105   
gb|AIU41628.1|  ABC transporter family protein                          355   9e-105   
ref|XP_010481062.1|  PREDICTED: ABC transporter B family member 1...    354   1e-104   
ref|XP_002992781.1|  hypothetical protein SELMODRAFT_236608             352   1e-104   
ref|XP_008804465.1|  PREDICTED: ABC transporter B family member 1...    353   1e-104   
ref|XP_006827168.1|  hypothetical protein AMTR_s00010p00254310          353   1e-104   
ref|XP_006354367.1|  PREDICTED: ABC transporter B family member 1       354   1e-104   
ref|XP_001784127.1|  ATP-binding cassette transporter, subfamily ...    353   1e-104   
ref|XP_009789853.1|  PREDICTED: ABC transporter B family member 1...    354   1e-104   
ref|XP_010457236.1|  PREDICTED: ABC transporter B family member 1...    353   1e-104   
gb|EPS61919.1|  hypothetical protein M569_12874                         352   1e-104   
ref|XP_010481058.1|  PREDICTED: ABC transporter B family member 1...    353   2e-104   
ref|XP_010457237.1|  PREDICTED: ABC transporter B family member 1...    353   2e-104   
ref|XP_001775250.1|  ATP-binding cassette transporter, subfamily ...    353   2e-104   
ref|XP_010101619.1|  ABC transporter B family member 1                  354   2e-104   
gb|KEH42187.1|  ABC transporter B family protein                        353   2e-104   
emb|CDY51307.1|  BnaCnng20520D                                          353   2e-104   
ref|XP_010666555.1|  PREDICTED: ABC transporter B family member 1...    353   2e-104   
ref|XP_004137839.1|  PREDICTED: ABC transporter B family member 1...    353   3e-104   
ref|XP_006856780.1|  hypothetical protein AMTR_s00055p00102180          352   3e-104   
gb|KHN39417.1|  ABC transporter B family member 13                      352   3e-104   
ref|XP_003544389.1|  PREDICTED: ABC transporter B family member 1...    352   3e-104   
ref|XP_007160658.1|  hypothetical protein PHAVU_001G005900g             352   3e-104   
ref|XP_004497537.1|  PREDICTED: ABC transporter B family member 1...    353   3e-104   
emb|CDP02220.1|  unnamed protein product                                352   4e-104   
ref|XP_009772017.1|  PREDICTED: ABC transporter B family member 9...    352   4e-104   
ref|XP_010906448.1|  PREDICTED: ABC transporter B family member 2...    352   4e-104   
ref|XP_002981724.1|  hypothetical protein SELMODRAFT_154740             352   5e-104   
gb|EYU28160.1|  hypothetical protein MIMGU_mgv1a000337mg                351   6e-104   
gb|KEH24996.1|  ABC transporter B family protein                        351   7e-104   
ref|XP_002967803.1|  ATP-binding cassette transporter                   352   7e-104   
emb|CDP07374.1|  unnamed protein product                                351   8e-104   
ref|XP_002519488.1|  multidrug resistance protein 1, 2, putative        352   8e-104   Ricinus communis
gb|AES64094.2|  ABC transporter B family protein                        351   8e-104   
ref|NP_171753.1|  P-glycoprotein 11                                     351   8e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077318.1|  PREDICTED: ABC transporter B family member 1       352   8e-104   
ref|XP_010523879.1|  PREDICTED: ABC transporter B family member 4...    351   8e-104   
gb|KHG25987.1|  ABC transporter B family member 1                       352   9e-104   
ref|XP_002121963.3|  PREDICTED: multidrug resistance protein 1A         347   9e-104   Ciona intestinalis [sea vase]
ref|XP_010241797.1|  PREDICTED: ABC transporter B family member 1       352   9e-104   
ref|XP_003535149.1|  PREDICTED: ABC transporter B family member 1...    352   1e-103   
ref|XP_010037650.1|  PREDICTED: ABC transporter B family member 1...    352   1e-103   
emb|CDP06775.1|  unnamed protein product                                350   1e-103   
ref|XP_010474667.1|  PREDICTED: ABC transporter B family member 1...    351   1e-103   
gb|KHG30028.1|  ABC transporter B family member 1                       352   1e-103   
ref|XP_010037649.1|  PREDICTED: ABC transporter B family member 1...    352   1e-103   
ref|XP_010439807.1|  PREDICTED: ABC transporter B family member 1...    349   1e-103   
ref|XP_007159374.1|  hypothetical protein PHAVU_002G232900g             350   1e-103   
ref|NP_174115.1|  ABC transporter B family member 13                    350   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KGN57987.1|  hypothetical protein Csa_3G418780                       349   2e-103   
ref|XP_010692517.1|  PREDICTED: uncharacterized protein LOC104905624    355   2e-103   
ref|XP_006593671.1|  PREDICTED: ABC transporter B family member 1...    348   2e-103   
ref|XP_009111196.1|  PREDICTED: ABC transporter B family member 11      350   2e-103   
ref|XP_009136898.1|  PREDICTED: ABC transporter B family member 9       350   2e-103   
gb|EMT32511.1|  ABC transporter B family member 19                      350   2e-103   
ref|XP_001779184.1|  ATP-binding cassette transporter, subfamily ...    350   3e-103   
ref|XP_011008935.1|  PREDICTED: ABC transporter B family member 19      349   3e-103   
gb|EYU38439.1|  hypothetical protein MIMGU_mgv1a020314mg                350   3e-103   
ref|XP_010559276.1|  PREDICTED: ABC transporter B family member 9       350   3e-103   
emb|CDX89963.1|  BnaA10g01190D                                          349   3e-103   
gb|KHN39060.1|  ABC transporter B family member 1                       349   3e-103   
ref|XP_006603863.1|  PREDICTED: ABC transporter B family member 1...    347   4e-103   
ref|XP_002283051.2|  PREDICTED: ABC transporter B family member 19      349   4e-103   Vitis vinifera
ref|XP_010530473.1|  PREDICTED: ABC transporter B family member 1       350   4e-103   
gb|KDP29159.1|  hypothetical protein JCGZ_16548                         350   4e-103   
ref|XP_004151954.1|  PREDICTED: putative multidrug resistance pro...    349   5e-103   
ref|XP_002515185.1|  multidrug resistance protein 1, 2, putative        349   5e-103   Ricinus communis
ref|XP_010439790.1|  PREDICTED: ABC transporter B family member 1...    349   5e-103   
gb|AAP72956.1|  putative MDR-like P-glycoprotein                        348   6e-103   Lactuca sativa [cultivated lettuce]
ref|XP_010460561.1|  PREDICTED: ABC transporter B family member 1...    348   6e-103   
ref|XP_006355579.1|  PREDICTED: ABC transporter B family member 9...    349   6e-103   
gb|KFK33112.1|  hypothetical protein AALP_AA6G332600                    348   6e-103   
ref|XP_010439800.1|  PREDICTED: ABC transporter B family member 1...    348   6e-103   
ref|XP_006467555.1|  PREDICTED: ABC transporter B family member 9...    349   6e-103   
ref|XP_010460562.1|  PREDICTED: ABC transporter B family member 1...    348   7e-103   
gb|KDO78013.1|  hypothetical protein CISIN_1g000789mg                   348   7e-103   
ref|XP_007151220.1|  hypothetical protein PHAVU_004G027800g             348   9e-103   
ref|XP_004233862.2|  PREDICTED: ABC transporter B family member 9...    348   1e-102   
ref|XP_010684039.1|  PREDICTED: ABC transporter B family member 1       349   1e-102   
ref|XP_010271027.1|  PREDICTED: ABC transporter B family member 4...    347   1e-102   
ref|XP_003543769.1|  PREDICTED: ABC transporter B family member 1...    348   1e-102   
gb|EPS64351.1|  hypothetical protein M569_10429                         347   1e-102   
ref|XP_002973102.1|  ATP-binding cassette transporter                   347   1e-102   
gb|EYU46879.1|  hypothetical protein MIMGU_mgv1a000296mg                348   1e-102   
ref|XP_002515186.1|  multidrug resistance protein 1, 2, putative        348   2e-102   Ricinus communis
ref|XP_006449604.1|  hypothetical protein CICLE_v10014058mg             348   2e-102   
gb|AIU41631.1|  ABC transporter family protein                          347   2e-102   
gb|KDO72405.1|  hypothetical protein CISIN_1g006496mg                   335   2e-102   
ref|NP_181228.1|  ABC transporter B family member 1                     348   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273385.1|  PREDICTED: ABC transporter B family member 9       348   2e-102   
gb|EMT10010.1|  Putative multidrug resistance protein                   337   2e-102   
ref|XP_002879630.1|  ATPGP1                                             348   2e-102   
gb|KCW51753.1|  hypothetical protein EUGRSUZ_J01214                     347   2e-102   
ref|XP_003554410.1|  PREDICTED: ABC transporter B family member 1...    347   2e-102   
gb|KHN45492.1|  ABC transporter B family member 19                      347   2e-102   
ref|XP_002515187.1|  multidrug resistance protein 1, 2, putative        347   2e-102   Ricinus communis
ref|XP_007051282.1|  ATP binding cassette subfamily B4 isoform 2        347   2e-102   
gb|AAM98246.1|  putative ABC transporter                                347   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002986365.1|  ATP-binding cassette transporter                   347   2e-102   
ref|XP_007027421.1|  ATP binding cassette subfamily B1 isoform 3        346   2e-102   
ref|XP_009610882.1|  PREDICTED: ABC transporter B family member 9       347   2e-102   
ref|XP_002323847.1|  multidrug resistance P-glycoprotein                347   2e-102   
ref|XP_002976764.1|  hypothetical protein SELMODRAFT_105467             347   2e-102   
ref|XP_010045629.1|  PREDICTED: ABC transporter B family member 1...    347   2e-102   
ref|XP_010032346.1|  PREDICTED: ABC transporter B family member 19      347   2e-102   
ref|XP_010540773.1|  PREDICTED: ABC transporter B family member 2...    347   2e-102   
ref|XP_006303137.1|  hypothetical protein CARUB_v10008098mg             348   2e-102   
ref|XP_009119625.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    347   2e-102   
ref|XP_010052120.1|  PREDICTED: ABC transporter B family member 9...    347   3e-102   
ref|XP_011018746.1|  PREDICTED: ABC transporter B family member 1       347   4e-102   
ref|XP_006418332.1|  hypothetical protein EUTSA_v10006577mg             347   4e-102   
emb|CAA71277.1|  P-glycoprotein-2                                       346   4e-102   
gb|AAM20507.1|  P-glycoprotein-2                                        346   4e-102   
ref|NP_194326.2|  P-glycoprotein 2                                      347   4e-102   
ref|XP_010940643.1|  PREDICTED: ABC transporter B family member 1...    347   5e-102   
ref|XP_002517493.1|  multidrug resistance protein 1, 2, putative        346   5e-102   
ref|XP_010509416.1|  PREDICTED: ABC transporter B family member 1...    347   5e-102   
gb|KFK36572.1|  hypothetical protein AALP_AA4G140900                    347   5e-102   
ref|XP_006282856.1|  hypothetical protein CARUB_v10006816mg             346   5e-102   
gb|AFW59635.1|  hypothetical protein ZEAMMB73_350646                    336   5e-102   
ref|XP_002323485.2|  P glycoprotein1                                    347   5e-102   
ref|XP_006293439.1|  hypothetical protein CARUB_v10022511mg             347   5e-102   
ref|XP_010271025.1|  PREDICTED: ABC transporter B family member 1...    347   6e-102   
ref|XP_006381407.1|  P glycoprotein1                                    347   6e-102   
dbj|BAJ99824.1|  predicted protein                                      347   6e-102   
ref|XP_002988703.1|  hypothetical protein SELMODRAFT_184079             346   7e-102   
ref|XP_010677330.1|  PREDICTED: ABC transporter B family member 2...    345   8e-102   
ref|XP_003541677.1|  PREDICTED: ABC transporter B family member 9...    346   8e-102   
gb|KHG03822.1|  ABC transporter B family member 21                      346   8e-102   
ref|XP_002869639.1|  multidrug resistance protein 2                     345   1e-101   
dbj|BAD12941.1|  putative P-glycoprotein 1                              336   1e-101   
ref|XP_002979534.1|  hypothetical protein SELMODRAFT_177681             345   1e-101   
dbj|BAM11098.1|  ABC protein                                            345   1e-101   
ref|XP_009345202.1|  PREDICTED: putative multidrug resistance pro...    345   1e-101   
ref|XP_010516925.1|  PREDICTED: ABC transporter B family member 1...    346   1e-101   
emb|CDY46744.1|  BnaA03g16880D                                          346   1e-101   
ref|XP_006482501.1|  PREDICTED: ABC transporter B family member 1...    345   1e-101   
gb|EMS56432.1|  ABC transporter B family member 19                      345   1e-101   
ref|XP_010505240.1|  PREDICTED: ABC transporter B family member 1       346   1e-101   
gb|EEE56476.1|  hypothetical protein OsJ_05696                          345   1e-101   
ref|XP_010439908.1|  PREDICTED: ABC transporter B family member 9       345   1e-101   
ref|XP_006482502.1|  PREDICTED: ABC transporter B family member 1...    345   1e-101   
ref|XP_006847022.1|  hypothetical protein AMTR_s00017p00164980          345   2e-101   
ref|XP_007027420.1|  ATP binding cassette subfamily B1 isoform 2        346   2e-101   
ref|XP_009133103.1|  PREDICTED: ABC transporter B family member 1       345   2e-101   
emb|CDX79704.1|  BnaC03g20400D                                          345   2e-101   
ref|XP_004301784.1|  PREDICTED: ABC transporter B family member 2...    345   2e-101   
ref|XP_007027419.1|  ATP binding cassette subfamily B1 isoform 1        345   2e-101   
ref|XP_008777170.1|  PREDICTED: ABC transporter B family member 2...    344   2e-101   
ref|XP_008379345.1|  PREDICTED: ABC transporter B family member 19      344   2e-101   
ref|XP_004295792.1|  PREDICTED: putative multidrug resistance pro...    345   2e-101   
ref|XP_010935700.1|  PREDICTED: ABC transporter B family member 1...    345   2e-101   
gb|KDP45498.1|  hypothetical protein JCGZ_09747                         344   2e-101   
ref|XP_004304313.1|  PREDICTED: ABC transporter B family member 1...    344   2e-101   
ref|XP_006647008.1|  PREDICTED: LOW QUALITY PROTEIN: putative mul...    344   2e-101   
ref|XP_010436379.1|  PREDICTED: ABC transporter B family member 2       344   2e-101   
ref|XP_010045610.1|  PREDICTED: ABC transporter B family member 1...    345   2e-101   
sp|Q6YUU5.1|MDR_ORYSJ  RecName: Full=Putative multidrug resistanc...    344   2e-101   
ref|XP_011094609.1|  PREDICTED: ABC transporter B family member 1...    345   2e-101   
ref|XP_002977745.1|  ATP-binding cassette transporter                   344   3e-101   
gb|KFK43347.1|  hypothetical protein AALP_AA1G113900                    344   3e-101   
ref|XP_010666235.1|  PREDICTED: ABC transporter B family member 1...    343   3e-101   
ref|XP_004155099.1|  PREDICTED: ABC transporter B family member 4...    344   3e-101   
ref|XP_002515184.1|  multidrug resistance protein 1, 2, putative        344   3e-101   
ref|XP_008454545.1|  PREDICTED: putative multidrug resistance pro...    344   3e-101   
ref|XP_006410867.1|  hypothetical protein EUTSA_v10016150mg             344   4e-101   
ref|XP_008776907.1|  PREDICTED: ABC transporter B family member 9...    343   4e-101   
emb|CDP05798.1|  unnamed protein product                                343   4e-101   
ref|XP_007213036.1|  hypothetical protein PRUPE_ppa020218mg             343   4e-101   
emb|CDP13052.1|  unnamed protein product                                343   4e-101   
ref|NP_001288986.1|  ABC transporter B family member 1                  344   4e-101   
ref|XP_008776908.1|  PREDICTED: ABC transporter B family member 9...    343   4e-101   
ref|XP_006417431.1|  hypothetical protein EUTSA_v10009914mg             343   4e-101   
ref|XP_010449508.1|  PREDICTED: ABC transporter B family member 9...    343   4e-101   
ref|XP_008776905.1|  PREDICTED: ABC transporter B family member 9...    343   4e-101   
gb|KHN38940.1|  ABC transporter B family member 2                       343   4e-101   
gb|KGN61257.1|  hypothetical protein Csa_2G074190                       344   4e-101   
gb|AAR10387.1|  P-glycoprotein 1                                        345   5e-101   
ref|XP_008776904.1|  PREDICTED: ABC transporter B family member 9...    343   5e-101   
ref|XP_009358106.1|  PREDICTED: ABC transporter B family member 1...    343   7e-101   
ref|NP_174122.1|  ABC transporter B family member 14                    343   7e-101   
ref|XP_004969646.1|  PREDICTED: ABC transporter B family member 4...    343   7e-101   
gb|EYU33605.1|  hypothetical protein MIMGU_mgv1a000336mg                343   7e-101   
ref|XP_002266505.1|  PREDICTED: ABC transporter B family member 1       343   8e-101   
ref|XP_007214562.1|  hypothetical protein PRUPE_ppa000338mg             343   8e-101   
emb|CDY15249.1|  BnaC05g01280D                                          343   9e-101   
ref|XP_011013349.1|  PREDICTED: ABC transporter B family member 1...    343   9e-101   
ref|XP_010518387.1|  PREDICTED: ABC transporter B family member 4       343   9e-101   
ref|XP_010424672.1|  PREDICTED: ABC transporter B family member 3       342   9e-101   
ref|XP_003520772.2|  PREDICTED: ABC transporter B family member 4...    343   9e-101   
gb|KDO51692.1|  hypothetical protein CISIN_1g000687mg                   343   1e-100   
gb|KDP21188.1|  hypothetical protein JCGZ_21659                         343   1e-100   
ref|XP_004152829.1|  PREDICTED: ABC transporter B family member 4...    343   1e-100   
ref|XP_008230752.1|  PREDICTED: ABC transporter B family member 19      342   1e-100   
emb|CAN77320.1|  hypothetical protein VITISV_009891                     347   1e-100   
gb|EPS59348.1|  p-glycoprotein                                          338   1e-100   
ref|XP_010478145.1|  PREDICTED: ABC transporter B family member 1...    342   1e-100   
dbj|BAD07905.1|  putative MDR-like ABC transporter                      330   1e-100   
gb|KDO51694.1|  hypothetical protein CISIN_1g000687mg                   343   1e-100   
ref|XP_003533440.1|  PREDICTED: ABC transporter B family member 2...    342   1e-100   
ref|XP_009395305.1|  PREDICTED: ABC transporter B family member 1...    343   1e-100   
ref|XP_006428358.1|  hypothetical protein CICLE_v10010916mg             343   1e-100   
ref|XP_004155533.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    342   1e-100   
ref|XP_010478144.1|  PREDICTED: ABC transporter B family member 1...    342   1e-100   
ref|XP_006432793.1|  hypothetical protein CICLE_v100000602mg            339   1e-100   
emb|CDY27639.1|  BnaA09g27680D                                          342   1e-100   
ref|XP_001751653.1|  ATP-binding cassette transporter, subfamily ...    342   1e-100   
gb|AAG10627.1|AC022521_5  Putative ABC transporter                      342   1e-100   
emb|CDY37953.1|  BnaC05g08210D                                          342   1e-100   
gb|AFP44681.1|  hypothetical protein                                    343   1e-100   
ref|NP_192092.1|  ABC transporter B family member 5                     342   2e-100   
ref|NP_171754.1|  P-glycoprotein 12                                     342   2e-100   
ref|XP_004495861.1|  PREDICTED: ABC transporter B family member 2...    342   2e-100   
ref|XP_010552958.1|  PREDICTED: ABC transporter B family member 1...    340   2e-100   
ref|XP_009141619.1|  PREDICTED: ABC transporter B family member 1       342   2e-100   
ref|XP_009415585.1|  PREDICTED: ABC transporter B family member 19      342   2e-100   
ref|XP_002890755.1|  P-glycoprotein 14                                  342   2e-100   
ref|XP_006306598.1|  hypothetical protein CARUB_v10008102mg             342   2e-100   
emb|CDY24379.1|  BnaA07g03040D                                          340   2e-100   
ref|XP_002519757.1|  multidrug resistance protein 1, 2, putative        341   2e-100   
ref|NP_001046147.2|  Os02g0190000                                       332   2e-100   
ref|XP_010544933.1|  PREDICTED: ABC transporter B family member 2...    342   2e-100   
tpg|DAA35747.1|  TPA: hypothetical protein ZEAMMB73_634725              337   2e-100   
ref|XP_008459308.1|  PREDICTED: ABC transporter B family member 19      341   3e-100   
gb|EYU28158.1|  hypothetical protein MIMGU_mgv1a000293mg                342   3e-100   
ref|XP_006431028.1|  hypothetical protein CICLE_v10010930mg             341   3e-100   
gb|KHN47358.1|  ABC transporter B family member 9                       343   3e-100   
gb|KHN14170.1|  ABC transporter B family member 11                      341   3e-100   
ref|XP_008341564.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    341   3e-100   
ref|XP_010507941.1|  PREDICTED: ABC transporter B family member 4...    341   3e-100   
ref|XP_003612850.1|  ABC transporter B family member                    341   3e-100   
ref|XP_004233863.1|  PREDICTED: ABC transporter B family member 9...    341   3e-100   
gb|KHN04865.1|  ABC transporter B family member 2                       341   3e-100   
ref|XP_003517674.1|  PREDICTED: ABC transporter B family member 2...    341   4e-100   
ref|XP_006413247.1|  hypothetical protein EUTSA_v10024237mg             341   4e-100   
gb|KFK35399.1|  hypothetical protein AALP_AA5G280000                    340   4e-100   
ref|XP_006397891.1|  hypothetical protein EUTSA_v10001285mg             341   4e-100   
ref|XP_006306603.1|  hypothetical protein CARUB_v10008108mg             340   5e-100   
ref|XP_006402405.1|  hypothetical protein EUTSA_v10005750mg             341   5e-100   
ref|XP_010499288.1|  PREDICTED: ABC transporter B family member 1...    337   5e-100   
ref|XP_010939542.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    340   5e-100   
ref|XP_010499287.1|  PREDICTED: ABC transporter B family member 1...    338   6e-100   
ref|XP_001774240.1|  ATP-binding cassette transporter, subfamily ...    340   6e-100   
gb|KFK29108.1|  hypothetical protein AALP_AA7G090300                    340   6e-100   
ref|XP_008223620.1|  PREDICTED: ABC transporter B family member 4...    340   6e-100   
ref|XP_011005954.1|  PREDICTED: ABC transporter B family member 4...    341   6e-100   
ref|XP_006293571.1|  hypothetical protein CARUB_v10022518mg             340   7e-100   
gb|AFW66244.1|  hypothetical protein ZEAMMB73_446753                    332   7e-100   
ref|XP_010054273.1|  PREDICTED: ABC transporter B family member 9...    340   8e-100   
ref|XP_010908483.1|  PREDICTED: ABC transporter B family member 2...    340   8e-100   
emb|CDM83833.1|  unnamed protein product                                340   9e-100   
emb|CAD59586.1|  MDR-like ABC transporter                               340   9e-100   
gb|EYU34148.1|  hypothetical protein MIMGU_mgv1a000301mg                340   9e-100   
ref|XP_010552950.1|  PREDICTED: ABC transporter B family member 1...    340   9e-100   
ref|XP_007158282.1|  hypothetical protein PHAVU_002G139400g             340   9e-100   
ref|XP_008789538.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    341   9e-100   
ref|XP_002304346.1|  P-glycoprotein                                     340   9e-100   
ref|XP_004148691.1|  PREDICTED: ABC transporter B family member 1...    340   1e-99    
ref|XP_007217651.1|  hypothetical protein PRUPE_ppa000359mg             340   1e-99    
emb|CDX94395.1|  BnaC01g17890D                                          339   1e-99    
ref|XP_005964429.1|  PREDICTED: multidrug resistance protein 1-like     340   1e-99    
ref|XP_010232186.1|  PREDICTED: ABC transporter B family member 4...    338   1e-99    
ref|XP_007145097.1|  hypothetical protein PHAVU_007G209600g             339   2e-99    
gb|EAY75483.1|  hypothetical protein OsI_03383                          339   2e-99    
ref|XP_011083466.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    339   2e-99    
ref|XP_006415706.1|  hypothetical protein EUTSA_v10006583mg             339   2e-99    
gb|KCW75983.1|  hypothetical protein EUGRSUZ_D00348                     339   2e-99    
gb|KDO53161.1|  hypothetical protein CISIN_1g0008301mg                  337   2e-99    
gb|EEC71330.1|  hypothetical protein OsI_03378                          339   2e-99    
ref|XP_009360960.1|  PREDICTED: ABC transporter B family member 9...    339   2e-99    
ref|XP_006840351.1|  hypothetical protein AMTR_s00045p00109940          338   2e-99    
ref|XP_006192273.1|  PREDICTED: multidrug resistance protein 1-like     332   2e-99    
ref|XP_006386686.1|  hypothetical protein POPTR_0002s18860g             338   2e-99    
emb|CDX93393.1|  BnaA06g06550D                                          338   2e-99    
ref|XP_009385386.1|  PREDICTED: ABC transporter B family member 4...    339   2e-99    
ref|XP_010098744.1|  ABC transporter B family member 11                 339   2e-99    
gb|EAZ13201.1|  hypothetical protein OsJ_03121                          339   2e-99    
ref|XP_009121075.1|  PREDICTED: ABC transporter B family member 5...    338   2e-99    
ref|XP_007017851.1|  P-glycoprotein 13                                  338   2e-99    
ref|XP_009765178.1|  PREDICTED: putative multidrug resistance pro...    335   2e-99    
gb|EEE55238.1|  hypothetical protein OsJ_03116                          339   2e-99    
ref|XP_010054272.1|  PREDICTED: ABC transporter B family member 9...    339   2e-99    
ref|XP_004308506.1|  PREDICTED: ABC transporter B family member 9...    339   2e-99    
emb|CAD59587.1|  MDR-like ABC transporter                               338   2e-99    
ref|XP_006471591.1|  PREDICTED: ABC transporter B family member 2...    338   3e-99    
ref|XP_003569618.2|  PREDICTED: ABC transporter B family member 1...    339   3e-99    
ref|XP_009113725.1|  PREDICTED: ABC transporter B family member 1...    337   3e-99    
ref|XP_009104300.1|  PREDICTED: ABC transporter B family member 5...    338   3e-99    
ref|XP_004295414.1|  PREDICTED: ABC transporter B family member 9...    338   3e-99    
ref|XP_009396182.1|  PREDICTED: ABC transporter B family member 1...    339   3e-99    
ref|XP_011028151.1|  PREDICTED: ABC transporter B family member 2...    336   3e-99    
gb|KCW87514.1|  hypothetical protein EUGRSUZ_B03963                     338   3e-99    
ref|XP_004007830.1|  PREDICTED: multidrug resistance protein 1-like     338   3e-99    
ref|XP_006303653.1|  hypothetical protein CARUB_v10011664mg             338   4e-99    
ref|XP_002882100.1|  P-glycoprotein 4, P-glycoprotein4                  338   4e-99    
ref|XP_004512509.1|  PREDICTED: ABC transporter B family member 2...    338   4e-99    
ref|XP_002517423.1|  multidrug resistance protein 1, 2, putative        327   4e-99    
ref|XP_009371200.1|  PREDICTED: ABC transporter B family member 2...    338   4e-99    
ref|XP_010905017.1|  PREDICTED: ABC transporter B family member 4...    337   4e-99    
gb|EMT10003.1|  ABC transporter B family member 11                      327   4e-99    
gb|KGN52452.1|  Multidrug resistance protein 1, 2                       339   4e-99    
ref|XP_010798071.1|  PREDICTED: multidrug resistance protein 1 is...    334   4e-99    
ref|XP_002314333.2|  hypothetical protein POPTR_0010s00540g             338   4e-99    
dbj|BAJ94109.1|  predicted protein                                      337   4e-99    
emb|CDX67881.1|  BnaA07g19210D                                          337   4e-99    
ref|XP_008587656.1|  PREDICTED: multidrug resistance protein 1          338   4e-99    
ref|XP_010499285.1|  PREDICTED: ABC transporter B family member 1...    338   5e-99    
ref|XP_007524019.1|  PREDICTED: ATP-binding cassette sub-family B...    328   5e-99    
ref|XP_009353526.1|  PREDICTED: ABC transporter B family member 9...    338   5e-99    
ref|XP_010499286.1|  PREDICTED: ABC transporter B family member 1...    338   5e-99    
ref|XP_010232183.1|  PREDICTED: ABC transporter B family member 9...    338   5e-99    
ref|XP_008383571.1|  PREDICTED: ABC transporter B family member 9...    338   5e-99    
gb|KHG11900.1|  ABC transporter B family member 21                      338   5e-99    
ref|XP_009148411.1|  PREDICTED: ABC transporter B family member 10      337   5e-99    
gb|KHF98198.1|  ABC transporter B family member 9                       338   5e-99    
ref|XP_009359800.1|  PREDICTED: ABC transporter B family member 1...    338   5e-99    
ref|XP_001784237.1|  ATP-binding cassette transporter, subfamily ...    337   6e-99    
ref|XP_005679085.1|  PREDICTED: multidrug resistance protein 1-like     337   6e-99    
ref|XP_009395922.1|  PREDICTED: ABC transporter B family member 1...    337   6e-99    
ref|XP_009104372.1|  PREDICTED: ABC transporter B family member 21      338   6e-99    
ref|XP_010847137.1|  PREDICTED: ATP-binding cassette sub-family B...    337   7e-99    
ref|XP_010241454.1|  PREDICTED: ABC transporter B family member 1...    338   7e-99    



>ref|XP_009625087.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Nicotiana tomentosiformis]
Length=1523

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/535 (84%), Positives = 492/535 (92%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +   L LILVGLGFGCI TM+GQQG CG AGT+LT R+R+ LFK+ILKQEPGWFD D
Sbjct  990   LKREVGYLCLILVGLGFGCIFTMVGQQGFCGWAGTRLTMRVRSLLFKAILKQEPGWFDLD  1049

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLS+D VS RSV+GDRFSVLLMGLSSAAVGLG+SF LEWRL LLA ALTPF
Sbjct  1050  ENSTGVLVSRLSVDCVSVRSVVGDRFSVLLMGLSSAAVGLGVSFKLEWRLALLATALTPF  1109

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+NVG KLDNSSYA+AS+IAAGAVSNIRTVATFSTQE IV+SFE+ALSEPK
Sbjct  1110  TLGASYLTLIINVGGKLDNSSYAKASSIAAGAVSNIRTVATFSTQEQIVKSFEQALSEPK  1169

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             RTSVRRSQ+LG ALG SQGAMYGAYTLTLWFGAYLVK+GYTN G VYKIFLILVLSSF+V
Sbjct  1170  RTSVRRSQMLGLALGLSQGAMYGAYTLTLWFGAYLVKQGYTNFGDVYKIFLILVLSSFAV  1229

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMAS AIPAVL IINRRP IG++ + KG+K E SKPFDIEF+MVTFAYPS
Sbjct  1230  GQLAGLAPDTSMASTAIPAVLAIINRRPTIGNE-RVKGKKIEISKPFDIEFKMVTFAYPS  1288

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDVIV+RNF+LKI+GGTMVALVGASGSGKST IW+IQRFYDP QGRVLME VDLRELNL
Sbjct  1289  RPDVIVMRNFTLKIRGGTMVALVGASGSGKSTAIWLIQRFYDPTQGRVLMEGVDLRELNL  1348

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALV QEPALFAGTI ENIAFG PNAS+ EIE+AAKEA+IHKFISGLP+GYET+
Sbjct  1349  KWLRRQTALVSQEPALFAGTIRENIAFGKPNASWAEIEDAAKEAHIHKFISGLPQGYETE  1408

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VGQSGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALRKISK+ATT+
Sbjct  1409  VGQSGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALRKISKRATTV  1468

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EA++IAVVKEG +AEYGSHDKLMAS L+G+YA+LV AE EA AF+
Sbjct  1469  VVAHRLSTIREASMIAVVKEGTIAEYGSHDKLMASHLDGLYASLVWAETEALAFS  1523


 Score =   268 bits (686),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 208/544 (38%), Positives = 311/544 (57%), Gaps = 44/544 (8%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             + +++ GL    +V    +     L G +   RIR    +++L+Q+ G+FD + N TG +
Sbjct  359   VCVLMTGLTAVVVVGAYLETTCWRLVGERSAHRIRTKYLRAVLRQDIGFFDTELN-TGEI  417

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGAS  1328
             +  +S D    + V+G++ +  +  + +   G  + F   W+++L   A+T      G +
Sbjct  418   MHGISSDVAQIQEVMGEKMAHFVHHIFTFINGYAVGFRRSWKVSLAVFAVTPLSMFCGLA  477

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
             Y ++ + +  K +  SY +A +IA  A+S+IRTV  F  ++ +   + ++L    R    
Sbjct  478   YKAIYVGLTQK-EEESYRKAGSIAEQAMSSIRTVTAFVAEDFLDAKYVESLENSGR----  532

Query  1147  RSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF-------  1013
                 LG+ +GF++GA         Y  + L  W+G+ LV +G  + G     F       
Sbjct  533   ----LGAKVGFAKGAGIGVIYLVTYATWALAFWYGSILVAKGELSGGEAIACFFGVNVGG  588

Query  1012  --LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPF  842
               L L LS F+  Q A         + A   V E+I+R P I  DP   +GR+  T +  
Sbjct  589   RGLALSLSYFA--QFA-------QGTVAATRVFEVIDRIPEI--DPYSSEGRRLSTVRG-  636

Query  841   DIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGR  662
              IEF+ VTFAYP+RP V +L++ +L I     +ALVG SG GKST+  +I+RFYDP+QG 
Sbjct  637   KIEFKCVTFAYPARPTVQILQSLNLVIPASRTLALVGTSGGGKSTIFALIERFYDPVQGL  696

Query  661   VLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIH  482
             + ++  D+R L +KWLRSQ  +VGQEP LF  +I EN+  G  NA+  E   A   A  H
Sbjct  697   ITLDGHDIRTLQVKWLRSQIGMVGQEPVLFGTSILENVMMGKENATKKEAMAACVAANAH  756

Query  481   KFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQ  302
              FIS LPEGY+T+VG  G QLSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE  VQ
Sbjct  757   SFISRLPEGYDTQVGDRGTQLSGGQKQRIALARAMVKDPKILLLDEPTSALDPESEAIVQ  816

Query  301   DALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRA  122
              A+ KISK  TT+V+AHRL+T++ A+ I V+  G+V E G+HD+LM  E  G+Y  L++ 
Sbjct  817   RAIDKISKGRTTLVIAHRLATVRNAHTIVVLDRGSVVETGNHDQLM--EKAGVYFGLIKL  874

Query  121   EQEA  110
               EA
Sbjct  875   ASEA  878



>ref|XP_009625085.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Nicotiana tomentosiformis]
Length=1553

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/535 (84%), Positives = 492/535 (92%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +   L LILVGLGFGCI TM+GQQG CG AGT+LT R+R+ LFK+ILKQEPGWFD D
Sbjct  1020  LKREVGYLCLILVGLGFGCIFTMVGQQGFCGWAGTRLTMRVRSLLFKAILKQEPGWFDLD  1079

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLS+D VS RSV+GDRFSVLLMGLSSAAVGLG+SF LEWRL LLA ALTPF
Sbjct  1080  ENSTGVLVSRLSVDCVSVRSVVGDRFSVLLMGLSSAAVGLGVSFKLEWRLALLATALTPF  1139

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+NVG KLDNSSYA+AS+IAAGAVSNIRTVATFSTQE IV+SFE+ALSEPK
Sbjct  1140  TLGASYLTLIINVGGKLDNSSYAKASSIAAGAVSNIRTVATFSTQEQIVKSFEQALSEPK  1199

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             RTSVRRSQ+LG ALG SQGAMYGAYTLTLWFGAYLVK+GYTN G VYKIFLILVLSSF+V
Sbjct  1200  RTSVRRSQMLGLALGLSQGAMYGAYTLTLWFGAYLVKQGYTNFGDVYKIFLILVLSSFAV  1259

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMAS AIPAVL IINRRP IG++ + KG+K E SKPFDIEF+MVTFAYPS
Sbjct  1260  GQLAGLAPDTSMASTAIPAVLAIINRRPTIGNE-RVKGKKIEISKPFDIEFKMVTFAYPS  1318

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDVIV+RNF+LKI+GGTMVALVGASGSGKST IW+IQRFYDP QGRVLME VDLRELNL
Sbjct  1319  RPDVIVMRNFTLKIRGGTMVALVGASGSGKSTAIWLIQRFYDPTQGRVLMEGVDLRELNL  1378

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALV QEPALFAGTI ENIAFG PNAS+ EIE+AAKEA+IHKFISGLP+GYET+
Sbjct  1379  KWLRRQTALVSQEPALFAGTIRENIAFGKPNASWAEIEDAAKEAHIHKFISGLPQGYETE  1438

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VGQSGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALRKISK+ATT+
Sbjct  1439  VGQSGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALRKISKRATTV  1498

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EA++IAVVKEG +AEYGSHDKLMAS L+G+YA+LV AE EA AF+
Sbjct  1499  VVAHRLSTIREASMIAVVKEGTIAEYGSHDKLMASHLDGLYASLVWAETEALAFS  1553


 Score =   256 bits (653),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 210/574 (37%), Positives = 314/574 (55%), Gaps = 74/574 (13%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             + +++ GL    +V    +     L G +   RIR    +++L+Q+ G+FD + N TG +
Sbjct  359   VCVLMTGLTAVVVVGAYLETTCWRLVGERSAHRIRTKYLRAVLRQDIGFFDTELN-TGEI  417

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGAS  1328
             +  +S D    + V+G++ +  +  + +   G  + F   W+++L   A+T      G +
Sbjct  418   MHGISSDVAQIQEVMGEKMAHFVHHIFTFINGYAVGFRRSWKVSLAVFAVTPLSMFCGLA  477

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
             Y ++ + +  K +  SY +A +IA  A+S+IRTV  F  ++ +   + ++L    R    
Sbjct  478   YKAIYVGLTQK-EEESYRKAGSIAEQAMSSIRTVTAFVAEDFLDAKYVESLENSGR----  532

Query  1147  RSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF-------  1013
                 LG+ +GF++GA         Y  + L  W+G+ LV +G  + G     F       
Sbjct  533   ----LGAKVGFAKGAGIGVIYLVTYATWALAFWYGSILVAKGELSGGEAIACFFGVNVGG  588

Query  1012  --LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPF  842
               L L LS F+  Q A         + A   V E+I+R P I  DP   +GR+  T +  
Sbjct  589   RGLALSLSYFA--QFA-------QGTVAATRVFEVIDRIPEI--DPYSSEGRRLSTVRG-  636

Query  841   DIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGR  662
              IEF+ VTFAYP+RP V +L++ +L I     +ALVG SG GKST+  +I+RFYDP+QG+
Sbjct  637   KIEFKCVTFAYPARPTVQILQSLNLVIPASRTLALVGTSGGGKSTIFALIERFYDPVQGK  696

Query  661   -----------------VLMEEV-------------DLRELNLKWLRSQTALVGQEPALF  572
                               L++E+             D+R L +KWLRSQ  +VGQEP LF
Sbjct  697   HMNLSYIASITVCGYFSCLIKEITNIWAGLITLDGHDIRTLQVKWLRSQIGMVGQEPVLF  756

Query  571   AGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIA  392
               +I EN+  G  NA+  E   A   A  H FIS LPEGY+T+VG  G QLSGGQKQRIA
Sbjct  757   GTSILENVMMGKENATKKEAMAACVAANAHSFISRLPEGYDTQVGDRGTQLSGGQKQRIA  816

Query  391   IARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAV  212
             +ARA++K  K+LLLDE +SALD ESE  VQ A+ KISK  TT+V+AHRL+T++ A+ I V
Sbjct  817   LARAMVKDPKILLLDEPTSALDPESEAIVQRAIDKISKGRTTLVIAHRLATVRNAHTIVV  876

Query  211   VKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             +  G+V E G+HD+LM  E  G+Y  L++   EA
Sbjct  877   LDRGSVVETGNHDQLM--EKAGVYFGLIKLASEA  908



>ref|XP_009787798.1| PREDICTED: ABC transporter B family member 19-like [Nicotiana 
sylvestris]
Length=1523

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/535 (84%), Positives = 493/535 (92%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +   L LILVGLGFGCI TM+GQQG CG AGT+LT R+R+FLFK+ILKQEPGWFD D
Sbjct  990   LKREVGYLCLILVGLGFGCIFTMVGQQGFCGWAGTRLTMRVRSFLFKAILKQEPGWFDLD  1049

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLS+D VSFRSV+GDRFSVLLMGLSSAAVGLG+SF LEWRL LLA ALTPF
Sbjct  1050  ENSTGVLVSRLSVDCVSFRSVVGDRFSVLLMGLSSAAVGLGVSFKLEWRLALLATALTPF  1109

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+NVG KLDNSSY +AS+IAAGAVSNIRTVATFSTQE IV+SFE+ALSEPK
Sbjct  1110  TLGASYLTLIINVGGKLDNSSYTKASSIAAGAVSNIRTVATFSTQEKIVKSFEQALSEPK  1169

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             RTSVRRSQ+LG ALG SQGAMYGAYTL LWFGAYLVK+GYTN G VYKIFLILVLSSF+V
Sbjct  1170  RTSVRRSQMLGLALGLSQGAMYGAYTLNLWFGAYLVKQGYTNFGDVYKIFLILVLSSFAV  1229

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMAS AIPAVL IINRRP IG++ + KG+K E SKPFDIEF+MVTFAYPS
Sbjct  1230  GQLAGLAPDTSMASTAIPAVLAIINRRPSIGNE-RVKGKKIEISKPFDIEFKMVTFAYPS  1288

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+VIV+RNF+LKI+GGTMVALVGASGSGKST+IWMIQRFYDP QGRVLME VDLRELNL
Sbjct  1289  RPEVIVMRNFTLKIRGGTMVALVGASGSGKSTVIWMIQRFYDPTQGRVLMEGVDLRELNL  1348

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALV QEPALFAGTI ENIAFG PNAS+ EIEEAAKEA+IHKFISGLP+GYET+
Sbjct  1349  KWLRRQTALVSQEPALFAGTIRENIAFGEPNASWAEIEEAAKEAHIHKFISGLPQGYETE  1408

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VGQSGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALRKISK+ATTI
Sbjct  1409  VGQSGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALRKISKRATTI  1468

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EA++IAVVKEG +AEYGSHDKL AS L+G+YA+LVRAE EA AF+
Sbjct  1469  VVAHRLSTIREASMIAVVKEGTIAEYGSHDKLTASHLDGLYASLVRAETEALAFS  1523


 Score =   265 bits (676),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 208/544 (38%), Positives = 312/544 (57%), Gaps = 44/544 (8%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             + +++ GL    +V    +     L G +   RIR    +++L+Q+ G+FD + N TG +
Sbjct  358   VCVLMTGLTAVVVVGAYLETTCWRLVGERSAHRIRTKYLRAVLRQDIGFFDTELN-TGEI  416

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftL--GAS  1328
             +  +S D    + V+G++ +  +  + +   G  + F   W+++L   A+TP ++  G +
Sbjct  417   MHGISSDVAQIQEVMGEKMAHFVHHIFTFINGYAVGFRRSWKVSLAVFAVTPLSMFCGLA  476

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
             Y ++ + +  K +  SY +A +IA  A+S+IRTV  F  ++ +   + ++L    R    
Sbjct  477   YKAIYVGLTQK-EEESYRKAGSIAEQAMSSIRTVTAFVAEDFLDAKYVESLENSGR----  531

Query  1147  RSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF-------  1013
                 LG+ +GF++GA         Y  + L  W+G+ LV +G  + G     F       
Sbjct  532   ----LGAKVGFAKGAGIGVIYLVTYATWALAFWYGSILVAKGELSGGEAIACFFGVNVGG  587

Query  1012  --LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPF  842
               L L LS F+  Q A         + A   V E+I+R P I  DP   +GR+  T +  
Sbjct  588   RGLALSLSYFA--QFA-------QGTVAATRVFEVIDRIPEI--DPYSPEGRRLSTVRG-  635

Query  841   DIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGR  662
              IEF+ VTFAYP+RP V +L++ +L I     +ALVG SG GKST+  +I+RFYDP+QG 
Sbjct  636   KIEFKCVTFAYPARPTVQILQSLNLVIPASRTLALVGTSGGGKSTIFALIERFYDPVQGL  695

Query  661   VLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIH  482
             + ++  D+R L +KWLRSQ  +VGQEP LF  +I  N+  G  NA+  E   A   A  H
Sbjct  696   ITLDGHDIRTLQVKWLRSQIGMVGQEPVLFGTSILANVMMGKENATKKEAMAACVAANAH  755

Query  481   KFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQ  302
              FIS LPEGY+T+VG  G QLSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE  VQ
Sbjct  756   SFISRLPEGYDTQVGDRGTQLSGGQKQRIALARAMVKDPKILLLDEPTSALDPESEAIVQ  815

Query  301   DALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRA  122
              A+ KISK  TT+V+AHRL+T++ A+ I V+  G+V E G+HD+LM  E  G Y  L++ 
Sbjct  816   RAIDKISKGRTTLVIAHRLATVRNAHTIVVLDRGSVVETGNHDQLM--EKAGAYFGLIKL  873

Query  121   EQEA  110
               EA
Sbjct  874   ASEA  877



>ref|XP_006343128.1| PREDICTED: ABC transporter B family member 19-like [Solanum tuberosum]
Length=1527

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/535 (85%), Positives = 492/535 (92%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +   L LILVGLGFGCI  M+GQQG CG AGTKLT R+R+FLFKSILKQEPGWFD D
Sbjct  994   LKREVGYLCLILVGLGFGCIFAMVGQQGFCGWAGTKLTMRVRSFLFKSILKQEPGWFDLD  1053

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLS+D VSFRSVLGDRFSVLLMGLSSAAVGLG+SF LEWRL LLA A+TPF
Sbjct  1054  ENSTGVLVSRLSVDCVSFRSVLGDRFSVLLMGLSSAAVGLGVSFKLEWRLALLATAVTPF  1113

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+NVG KLDNSSYA+AS+IAAGAVSNIRTVATFSTQE IV+SFEKALSEPK
Sbjct  1114  TLGASYLTLIINVGGKLDNSSYAKASSIAAGAVSNIRTVATFSTQEQIVKSFEKALSEPK  1173

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             RTSVRRSQ+LG ALG SQGAMYGAYTLTLWFGAYLVK+GYTN G VYKIFLILVLSSF+V
Sbjct  1174  RTSVRRSQMLGLALGLSQGAMYGAYTLTLWFGAYLVKQGYTNFGDVYKIFLILVLSSFAV  1233

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMAS AIPAVL IINR+P I +D + KG+K E SKPFDIEF  VTFAYPS
Sbjct  1234  GQLAGLAPDTSMASTAIPAVLSIINRKPSISTD-RLKGKKIEISKPFDIEFRTVTFAYPS  1292

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDVIVLRNF+LKI+GGTMVALVGASGSGKST+IWMIQRFYDPIQGRVLME VDLRELNL
Sbjct  1293  RPDVIVLRNFTLKIRGGTMVALVGASGSGKSTVIWMIQRFYDPIQGRVLMEGVDLRELNL  1352

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALV QEPALFAGTI ENIAFG PNA++ EIEEAAKEA+IHKFISGLP+GYET+
Sbjct  1353  KWLRRQTALVSQEPALFAGTIRENIAFGKPNATWAEIEEAAKEAHIHKFISGLPQGYETE  1412

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VGQSGVQLSGGQKQRIAIARAILKKSK+LLLDEASSALDLESEKHVQDALRKISK+ATT+
Sbjct  1413  VGQSGVQLSGGQKQRIAIARAILKKSKLLLLDEASSALDLESEKHVQDALRKISKRATTV  1472

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EA+VIAVVKEG +AEYGSHDKLMAS L+G+Y+ LVRAE EA AF+
Sbjct  1473  VVAHRLSTIREASVIAVVKEGTIAEYGSHDKLMASHLDGLYSNLVRAETEALAFS  1527


 Score =   270 bits (691),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 214/564 (38%), Positives = 324/564 (57%), Gaps = 56/564 (10%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQ--QGLCG-LAGTKLTSRIRNFLFKSILKQEPGWFDFDENST  1511
             + +++ GL    +V M+G   +  C  L G +   RIR    +++L+Q+ G+FD + N T
Sbjct  359   VCVLMTGL---SVVVMVGAYLETTCWRLVGERSAHRIRTKYLRAVLRQDIGFFDTELN-T  414

Query  1510  GVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftL  1337
             G ++  +S D    + V+G++ +  +  + +   G  + F   W+++L   A+T      
Sbjct  415   GEIMHGISSDVAQIQEVMGEKMAHFVHHIFTFINGYAVGFRRSWKVSLAVFAVTPLSMFC  474

Query  1336  GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             G +Y ++ + +  K +  SY +A +IA  A+S+IRTV  F  ++++   + ++L +  R 
Sbjct  475   GLAYKAIYVGLTLK-EEESYRKAGSIAEQAMSSIRTVTAFVAEDYLDAKYVESLQKSGR-  532

Query  1156  SVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF----  1013
                    LG+ +GF++GA         Y  + L  W+G+ LV +G  + GA    F    
Sbjct  533   -------LGAKVGFAKGAGIGVIYLVTYATWALAFWYGSILVAKGELSGGAAIACFFGVN  585

Query  1012  -----LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQR-KGRKFETS  851
                  L L LS F+  Q A         + A   V E+I+R P I  DP   +GR+  T 
Sbjct  586   VGGRGLALSLSYFA--QFA-------QGTVAATRVFEVIDRVPEI--DPYSLEGRRLSTI  634

Query  850   KPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPI  671
             +   IEF+ VTFAYP+RP V +L++ +L +     +ALVG SG GKST+  +I+RFYDP+
Sbjct  635   RG-KIEFKCVTFAYPARPTVQILQSLNLVVPASRTLALVGISGGGKSTIFALIERFYDPL  693

Query  670   QGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEA  491
             QG + ++  D+R L +KWLR+Q  +VGQEP LF  +I EN+  G  NA+  E   A   A
Sbjct  694   QGLITLDGHDIRTLQVKWLRTQIGMVGQEPVLFGTSILENVMMGKENATKKEAMAACVAA  753

Query  490   YIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEK  311
               H FIS LPEGY+T+VG  G QLSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE 
Sbjct  754   NAHSFISRLPEGYDTQVGDRGTQLSGGQKQRIALARAMIKDPKILLLDEPTSALDPESEA  813

Query  310   HVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATL  131
              VQ A+ KISK  TT+V+AHRL+T++ A+ I V+  G+V E G+HD+LM  E  G Y  L
Sbjct  814   IVQRAIDKISKDRTTLVIAHRLATVRNAHTIVVLDHGSVVETGNHDQLM--EKAGAYFGL  871

Query  130   VRAEQEAYAFA*DLIIPFSNLEEM  59
             ++   EA      +  P SNL ++
Sbjct  872   IKLASEA------VPKPMSNLGDV  889



>emb|CDO97815.1| unnamed protein product [Coffea canephora]
Length=1525

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/535 (81%), Positives = 486/535 (91%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ + + L LILVGLGFGCI  M GQQGLCG AGTKLT R+R+FLF++ILKQEPGWFD +
Sbjct  992   LKREIRKLCLILVGLGFGCIGFMTGQQGLCGWAGTKLTKRVRDFLFRAILKQEPGWFDIN  1051

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG+LVSRLS D VSFRS+LGD+ SVLLMGLSSAAVGLG SF LEWRLTLLAAALTPF
Sbjct  1052  ENSTGILVSRLSSDCVSFRSILGDKISVLLMGLSSAAVGLGFSFFLEWRLTLLAAALTPF  1111

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASYFSLI+NVGPKLDNSSYA+ASNIAA AVSNIRTVATFST E IVQSF++ALS+PK
Sbjct  1112  TLGASYFSLIINVGPKLDNSSYAKASNIAADAVSNIRTVATFSTHERIVQSFDQALSKPK  1171

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+R+QILG ALGFSQGAMYGAYTLTL+FGAYLVKEGYTN G VYKIFLILVLSSFSV
Sbjct  1172  KLSVKRTQILGLALGFSQGAMYGAYTLTLFFGAYLVKEGYTNFGDVYKIFLILVLSSFSV  1231

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDT +A  A+PAVL I++RRPLI  D  +KG K E  KPFD+EF MVTFAYPS
Sbjct  1232  GQLAGLAPDTYLAPTAVPAVLNILSRRPLI-QDESQKGSKIEMLKPFDVEFRMVTFAYPS  1290

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDVIVLR+F LKIKGGTMVALVG SGSGKST+IWM+QRFYDPI+G++LM  V+LREL+L
Sbjct  1291  RPDVIVLRDFGLKIKGGTMVALVGGSGSGKSTVIWMVQRFYDPIRGKILMGGVNLRELDL  1350

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALVGQEPALFAG+I ENIAFG PNAS+ EIE+AAKEAYIHKFISGLPEGYET+
Sbjct  1351  KWLRRQTALVGQEPALFAGSIRENIAFGNPNASWAEIEDAAKEAYIHKFISGLPEGYETE  1410

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG SG+QLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDAL+KI+K+ATTI
Sbjct  1411  VGDSGIQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALKKIAKRATTI  1470

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EA+ IAVV++GAVAEYGSH+KLMAS L+G+YA+LVRAE EA  F+
Sbjct  1471  VVAHRLSTIREADAIAVVRDGAVAEYGSHEKLMASHLDGVYASLVRAELEATTFS  1525


 Score =   267 bits (682),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 208/542 (38%), Positives = 299/542 (55%), Gaps = 32/542 (6%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
               + + L++ GL    +V    +     + G +   RIR    +++L+Q+ G+FD D  S
Sbjct  357   DVEKICLLMTGLAAVVVVGAYMEITCWRMVGERSALRIRTQYLRAVLRQDIGFFDTD-IS  415

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltll--aaaltpft  1340
             T  ++  +S D    + V+G++ +  +  + +   G  + F   W+++L   A       
Sbjct  416   TSDIMHGISSDVAQIQEVMGEKMAHFVHHIFTFICGYTVGFLRSWKISLAIFAVTPLTMF  475

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G +Y ++   +  K +  SY RA +IA  A+S+IRTV +F  ++ + + +   L     
Sbjct  476   CGIAYKAIYGGLAAK-EEDSYRRAGSIAEQAISSIRTVFSFVAEDLLAEKYVDVLD----  530

Query  1159  TSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLIL  1004
                 +S  LG  +GF++GA         Y  + L  W+G+ LV       G     F  +
Sbjct  531   ----KSVPLGIKIGFAKGAGIGVIYLVTYATWALAFWYGSILVARKEIKGGEAIACFFGV  586

Query  1003  VLS----SFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDI  836
              +     + S+   A  A  T  AS     V E+I+R P I  DP     K  ++    I
Sbjct  587   TVGGRGLALSLSYFAQFAQGTVAASR----VFEVIDRVPDI--DPYSDEGKRLSNPRGKI  640

Query  835   EFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVL  656
             EF+ VTFAYPSRP + +L++ +L I      ALVG SG GKST+  +I+RFYDP QG V 
Sbjct  641   EFKGVTFAYPSRPTIQILQSLNLVIPASKTSALVGTSGGGKSTIFALIERFYDPTQGIVT  700

Query  655   MEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKF  476
             ++  DLR L +KWLRSQ  +VGQEP LF+ TI EN+  G  NA+  E  +A   A  H F
Sbjct  701   LDGNDLRTLQVKWLRSQIGMVGQEPVLFSTTILENVMMGKENATKKEAIKACIAANAHSF  760

Query  475   ISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDA  296
             ISGLP+GYET VG  G  LSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE  VQ A
Sbjct  761   ISGLPQGYETMVGDRGTLLSGGQKQRIALARAMIKDPKILLLDEPTSALDPESETVVQKA  820

Query  295   LRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             + KIS   TTIV+AHRL+TIK A+ I V+  G+V E G+H +LM  E +G Y  LV+   
Sbjct  821   IDKISMGRTTIVIAHRLATIKHADAIVVLDRGSVVEIGNHHELM--ENSGSYYNLVKLAL  878

Query  115   EA  110
             EA
Sbjct  879   EA  880



>ref|XP_004236380.1| PREDICTED: ABC transporter B family member 19-like [Solanum lycopersicum]
Length=1528

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/535 (84%), Positives = 491/535 (92%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +   L LILVGLGFGCI  M+GQQG CG AGTKLT R+R+ LFKSILKQEPGWFD D
Sbjct  995   LKREVGYLCLILVGLGFGCIFAMVGQQGFCGWAGTKLTMRVRSLLFKSILKQEPGWFDLD  1054

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLS+D VSFRSVLGDRFSVLLMGLSSAAVGL +SF LEWRL LLA A+TPF
Sbjct  1055  ENSTGVLVSRLSVDCVSFRSVLGDRFSVLLMGLSSAAVGLSVSFKLEWRLALLATAVTPF  1114

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+NVG KLDNSSYA+AS+IAAGAVSNIRTVATFSTQE IV+SFEKALSEPK
Sbjct  1115  TLGASYLTLIINVGGKLDNSSYAKASSIAAGAVSNIRTVATFSTQEQIVRSFEKALSEPK  1174

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             RTSVRRSQ+LG ALG SQGAMYGAYTLTLWFGAYLVK+GYTN G VYKIFLILVLSSF+V
Sbjct  1175  RTSVRRSQMLGLALGLSQGAMYGAYTLTLWFGAYLVKQGYTNFGDVYKIFLILVLSSFAV  1234

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMAS AIPAVL IINRRP I +D + KG+K ETSKPFDIEF+ VTFAYPS
Sbjct  1235  GQLAGLAPDTSMASTAIPAVLSIINRRPSIRTD-RLKGKKIETSKPFDIEFKTVTFAYPS  1293

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDVIVLRNF+LKI+GGTMVALVGASGSGKST+IWMIQRFYDP QGRVL+E VDLRELNL
Sbjct  1294  RPDVIVLRNFTLKIRGGTMVALVGASGSGKSTVIWMIQRFYDPTQGRVLIEGVDLRELNL  1353

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALV QEPALFAGTI ENIAFG PNA++ EIEEAAKEA+IHKFISGLP+GYET+
Sbjct  1354  KWLRRQTALVSQEPALFAGTIRENIAFGNPNATWAEIEEAAKEAHIHKFISGLPQGYETE  1413

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VGQSGVQLSGGQKQRIAIARAILKKSK+LLLDEASSALDLESEKHVQDALRKISK+ATT+
Sbjct  1414  VGQSGVQLSGGQKQRIAIARAILKKSKLLLLDEASSALDLESEKHVQDALRKISKRATTV  1473

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EA++IAVVKEG +AEYGSHDKLMAS L+G+Y+ LVRAE EA AF+
Sbjct  1474  VVAHRLSTIREASMIAVVKEGTIAEYGSHDKLMASHLDGLYSNLVRAETEALAFS  1528


 Score =   266 bits (681),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 207/547 (38%), Positives = 317/547 (58%), Gaps = 50/547 (9%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQ--QGLCG-LAGTKLTSRIRNFLFKSILKQEPGWFDFDENST  1511
             + +++ GL    +V M+G   +  C  L G +   RIR    +++L+Q+ G+FD + N T
Sbjct  360   VCVLMTGL---SVVVMVGAYLETTCWRLVGERSAHRIRTKYLRAVLRQDIGFFDTELN-T  415

Query  1510  GVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftL  1337
             G ++  +S D    + V+G++ +  +  + +   G  + F   W+++L   A+T      
Sbjct  416   GEIMHGISSDVAQIQEVMGEKMAHFVHHIFTFINGYAVGFRRSWKVSLAVFAVTPLSMFC  475

Query  1336  GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             G +Y ++ + +  K +  SY +A +IA  A+S+IRTV  F  ++++   + ++L +  R 
Sbjct  476   GLAYKAIYVGLTLK-EEESYRKAGSIAEQAMSSIRTVTAFVAEDYLDAKYVESLQKSGR-  533

Query  1156  SVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF----  1013
                    LG+ +GF++GA         Y  + L  W+G+ LV +G  + GA    F    
Sbjct  534   -------LGAKVGFAKGAGIGVIYLVTYATWALAFWYGSILVAKGELSGGAAIACFFGVN  586

Query  1012  -----LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQR-KGRKFETS  851
                  L L LS F+  Q A         + A   V E+I+R P I  DP   +GR+  T 
Sbjct  587   VGGRGLALSLSYFA--QFA-------QGTVAATRVFEVIDRVPEI--DPYSLEGRRLSTI  635

Query  850   KPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPI  671
             +   +EF+ VTFAYP+RP V +L++ +L +     +ALVG SG GKST+  +I+RFY+P+
Sbjct  636   RG-KVEFKCVTFAYPARPTVQILQSLNLVVPASRTLALVGISGGGKSTIFALIERFYNPL  694

Query  670   QGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEA  491
             QG + ++  D+R L +KWLR+Q  +VGQEP LF  +I EN+  G  NA+  E   A   A
Sbjct  695   QGLITLDGHDIRTLQVKWLRTQIGMVGQEPVLFGTSILENVMMGKENATKKEAMAACVAA  754

Query  490   YIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEK  311
               H F+S LPEGY+T+VG  G QLSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE 
Sbjct  755   NAHSFVSRLPEGYDTQVGDRGTQLSGGQKQRIALARAMIKDPKILLLDEPTSALDAESEA  814

Query  310   HVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATL  131
              VQ A+ KISK  TT+V+AHRL+T++ A+ I V+  G+V E G+HD+LM  E  G Y  L
Sbjct  815   IVQRAIDKISKDRTTLVIAHRLATVRNAHTIVVLDRGSVVETGNHDQLM--EKAGAYFGL  872

Query  130   VRAEQEA  110
             ++   EA
Sbjct  873   IKLASEA  879



>ref|XP_010654400.1| PREDICTED: ABC transporter B family member 19-like [Vitis vinifera]
Length=1566

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/528 (80%), Positives = 478/528 (91%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             LSL++VGLGFGC++T++GQQG CG AGTKLT R+R+ LF+SILKQEPGWFDFD+NSTGVL
Sbjct  1040  LSLVIVGLGFGCVITLVGQQGFCGWAGTKLTKRVRDRLFRSILKQEPGWFDFDDNSTGVL  1099

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             VSRLSID V+FRSVLGDRFSVLL GLSSAAVGLGISF L+WRLTLLAAALTP TLGASYF
Sbjct  1100  VSRLSIDCVTFRSVLGDRFSVLLTGLSSAAVGLGISFFLDWRLTLLAAALTPLTLGASYF  1159

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             SLI+NVGP+LDNSSYARASNIAAGAVSNIRTV TFS Q+ +V +F++ALSEPK+ SV+RS
Sbjct  1160  SLIINVGPRLDNSSYARASNIAAGAVSNIRTVTTFSAQQQLVHTFDQALSEPKKKSVKRS  1219

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             Q+LG ALGFSQGAMYGAYTLTLWFG YL+KE   N G V+KIFLILV+SSFSVGQLAGLA
Sbjct  1220  QVLGLALGFSQGAMYGAYTLTLWFGTYLIKEDKANFGDVFKIFLILVMSSFSVGQLAGLA  1279

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDTSMA+ A+PAV  IINRRP+I SD + KGRK E SKP D+E +MVTFAYPSRP+V VL
Sbjct  1280  PDTSMAATAVPAVFSIINRRPMISSDGE-KGRKVERSKPVDVELKMVTFAYPSRPEVTVL  1338

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R F LK+KGG+MVALVG SGSGKST++W+IQRFYDP QG+VLM  VD++E+N+KWLR Q 
Sbjct  1339  REFCLKVKGGSMVALVGGSGSGKSTVVWLIQRFYDPNQGKVLMGGVDIKEMNVKWLRRQI  1398

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
             ALVGQEPALFAG+I ENIAFG PNAS+ EIEEAA EAYIHKFIS LP+GYET+VG+SG Q
Sbjct  1399  ALVGQEPALFAGSIRENIAFGNPNASWAEIEEAANEAYIHKFISSLPQGYETQVGESGAQ  1458

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALRK+S++ATTIVVAHRLS
Sbjct  1459  LSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHVQDALRKVSERATTIVVAHRLS  1518

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             TI+EA++IAVVK+GAV EYGSHD L+AS LNG+YA+LVRAE EA AF+
Sbjct  1519  TIREAHMIAVVKDGAVTEYGSHDTLLASHLNGVYASLVRAETEASAFS  1566


 Score =   271 bits (694),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 207/543 (38%), Positives = 314/543 (58%), Gaps = 34/543 (6%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
               Q +SL++ GL    +V    +     + G + + RIR    +++L+Q+ G+FD  + S
Sbjct  393   DVQQISLLMAGLAAIVVVGAYMEITCWRIVGERSSQRIRTKYLRAVLRQDIGFFD-TQIS  451

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftL-  1337
             TG ++  +S D    + V+G++ +  +  + +   G  + F   W+++L+  ++ P  + 
Sbjct  452   TGNIMHGISSDVAQIQEVMGEKMAHFIHHVFTFICGYAVGFWRSWKVSLVVLSVIPLMMF  511

Query  1336  -GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G +Y ++ + +  K +  SY  A ++A  A+S+IRTV +F  ++H+ + + + L     
Sbjct  512   CGIAYKAIYVGLTAK-EEVSYRIAGSVAEQAISSIRTVFSFVAEDHLAERYAELL-----  565

Query  1159  TSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLIL  1004
                ++S   G  LGF++GA         Y  + L  W+G+ LV  G  + GA    F  +
Sbjct  566   ---QKSVPFGVKLGFAKGAGMGVIYLVTYSTWALAFWYGSILVARGEISGGAAIACFFGV  622

Query  1003  VLS----SFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFD  839
              L     + S+   A  A  T  AS     V EII+R P I  DP   +GRK  + +   
Sbjct  623   NLGGRGLALSLSYFAQFAQGTVAASR----VFEIIDRVPEI--DPYSPEGRKLPSIRG-R  675

Query  838   IEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRV  659
             IEF+ VTFAYPSRP   +LR+ +L++     +ALVG+SG GKST+  +I+RFYDP++G +
Sbjct  676   IEFKGVTFAYPSRPTAAILRSLNLEVPSSKTLALVGSSGGGKSTIFALIERFYDPVKGII  735

Query  658   LMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHK  479
              ++  D+R L +KWLR Q  +VGQEP LF  +I EN+  G  NA+  E   A   A  H 
Sbjct  736   TLDGHDIRTLQVKWLRGQIGMVGQEPVLFTTSILENVMMGKENATKKEAIAACVAANAHS  795

Query  478   FISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQD  299
             FISGLP+GY+T+VG  G QLSGGQKQRIA+ARA+    ++LLLDE +SALD ESE  VQ 
Sbjct  796   FISGLPQGYDTQVGDRGTQLSGGQKQRIALARALTTDPRILLLDEPTSALDPESESVVQQ  855

Query  298   ALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             A+ KIS   TT+V+AHRL+T++ A+ I V+  GAV E G+H KLM  E +G Y  LV+  
Sbjct  856   AIDKISAGRTTLVIAHRLATVRNAHTIVVLNHGAVVETGNHHKLM--EKSGAYYNLVKLA  913

Query  118   QEA  110
              EA
Sbjct  914   SEA  916



>ref|XP_007024714.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
[Theobroma cacao]
 gb|EOY27336.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
[Theobroma cacao]
Length=1625

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/535 (77%), Positives = 479/535 (90%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +   LSL LVGLGFGCI+ M GQQG CG AGTKLT R+R+ LF+SILKQEPGWFDF+
Sbjct  1092  LKREVAKLSLALVGLGFGCIIAMTGQQGFCGWAGTKLTIRVRDLLFRSILKQEPGWFDFE  1151

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +NSTG+LVSRLS+D +SFR+VLGDR+SVLLMG+SSAAVGLG+SF   WRLTLLAAALTPF
Sbjct  1152  DNSTGILVSRLSVDCLSFRAVLGDRYSVLLMGVSSAAVGLGVSFYFGWRLTLLAAALTPF  1211

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+N+GP+LDNSSYA+ASNIA+GAVSNIRTV TFS QE IV+SF+KALSEP+
Sbjct  1212  TLGASYLNLIINIGPRLDNSSYAKASNIASGAVSNIRTVTTFSAQEEIVKSFDKALSEPR  1271

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQILG  LG SQGAMYGAYTLTLWFGAYLVK+G T+ G VY IFLILVLSSFSV
Sbjct  1272  KQSVKRSQILGLTLGLSQGAMYGAYTLTLWFGAYLVKQGKTDFGDVYIIFLILVLSSFSV  1331

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDT+MA   IPAV +IINRRPLIG + + KGRK E SKP DIE +MVTFAYPS
Sbjct  1332  GQLAGLAPDTTMAPTTIPAVFDIINRRPLIG-NFRDKGRKIERSKPLDIELKMVTFAYPS  1390

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+VIVL++F LK+K G+MVALVG SGSGKST+IW++QRFYDP +G+V+M  +DL E+NL
Sbjct  1391  RPEVIVLKDFCLKVKDGSMVALVGPSGSGKSTVIWLVQRFYDPNEGKVMMGGIDLVEINL  1450

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQEPALFAG+I ENIAFG  NA++ EIE+AAKEAYIHKFISGLP+GYET+
Sbjct  1451  KWLRKQIALVGQEPALFAGSIRENIAFGNQNATWGEIEDAAKEAYIHKFISGLPQGYETQ  1510

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILKKS+VLLLDEASSALDLESEKHVQDALR++SKQATTI
Sbjct  1511  VGESGVQLSGGQKQRIAIARAILKKSRVLLLDEASSALDLESEKHVQDALRRVSKQATTI  1570

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             ++AHRLSTI+EAN+IAVVK+GAV EYGSHD L+AS L+G+YA LVRAE+EA AF+
Sbjct  1571  IIAHRLSTIREANMIAVVKDGAVVEYGSHDALLASHLDGVYAGLVRAEREANAFS  1625


 Score =   252 bits (644),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 203/548 (37%), Positives = 307/548 (56%), Gaps = 44/548 (8%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
               + + +++ GL    +V    +     L G +   RIR    +++L+Q+  +FD  E S
Sbjct  453   DVEKICILMSGLATIVVVGAYLEITCWRLVGERSAQRIRTKYLRAVLRQDISFFD-TEVS  511

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG ++  +S +    + V+GD+ +  +  + +   G  + F   W+++L+  ++T     
Sbjct  512   TGDIMHGISTEVAQIQEVMGDKMAHFIHHVFTFICGYTVGFLRSWKVSLVVFSVTPLTMF  571

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G +Y ++   +  K + + Y +A  IA  A+S+IRTV +F  ++++   + + L+    
Sbjct  572   CGIAYKAVYGGLTAK-EEACYRKAGTIAEQAISSIRTVFSFVAEDNLAARYAELLA----  626

Query  1159  TSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---  1013
                 +S  LG+ +GF++GA         Y  + L  W+G+ LV     + GA    F   
Sbjct  627   ----KSVPLGAKIGFAKGAGMGVIYLVTYSTWALAFWYGSILVARKEISGGAAVACFFGV  682

Query  1012  ------LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGS-DPQRKGRKFET  854
                   L L L+ F+  Q A         + A   + +I++R P I   DP+  GR   +
Sbjct  683   NVGGRGLALSLTYFA--QFA-------QGTVAAGRIFDIMDRVPEIDPYDPE--GRTLSS  731

Query  853   SKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDP  674
              +   IEF+ V FAYPSRPD  VL + +L I+    +ALVGASG GKST+  +I+RFYDP
Sbjct  732   VRG-RIEFKGVNFAYPSRPDTTVLSSLNLVIRSLKTLALVGASGGGKSTIFALIERFYDP  790

Query  673   IQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKE  494
              +G + ++  DLR L +KWLR Q  +VGQEP LFA TI EN+  G  NA+  E   A   
Sbjct  791   DKGVITLDGHDLRTLQVKWLRRQIGMVGQEPVLFATTILENVMMGKENATKKEAVAACVA  850

Query  493   AYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesE  314
             A  H FI  LP GY+T+VG  G QLSGGQKQRIA+ARA++K  ++LLLDE +SALD ESE
Sbjct  851   ANAHSFIYDLPLGYDTQVGAKGTQLSGGQKQRIALARALIKDPRILLLDEPTSALDPESE  910

Query  313   KHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYAT  134
               VQ A+ KIS   TTIV+AHRL+T++ AN I V+ +G+V E G+H +LM  E +G Y  
Sbjct  911   AVVQQAIDKISTGRTTIVIAHRLATVRNANTIVVLDQGSVVETGNHRQLM--ERSGAYYK  968

Query  133   LVRAEQEA  110
             LV+   EA
Sbjct  969   LVKLASEA  976



>ref|XP_002529182.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF33196.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1580

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/535 (78%), Positives = 480/535 (90%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+    +++L+LVGLG GCI+TM GQQGLCG AGTKLT R+RN LF+SILKQEPGWFDF+
Sbjct  1047  LKRDVGHIALVLVGLGVGCILTMTGQQGLCGWAGTKLTIRVRNLLFRSILKQEPGWFDFE  1106

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLSID +SFRSVLGDR SVLLMGLSSAAVGLG+SF LEWRLTLLAAALTPF
Sbjct  1107  ENSTGVLVSRLSIDCISFRSVLGDRLSVLLMGLSSAAVGLGMSFFLEWRLTLLAAALTPF  1166

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+NVGPKLDNSSYA+ASNIAAGAVSNIRTV TFS QE IV+SF++AL EPK
Sbjct  1167  TLGASYLSLIINVGPKLDNSSYAKASNIAAGAVSNIRTVTTFSAQEQIVRSFDRALDEPK  1226

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SVRRSQ+LG  LGFSQGAMYGAYTLTLWFGAYLVK+G T+ G VYKIFLILVLSSFSV
Sbjct  1227  KKSVRRSQVLGLTLGFSQGAMYGAYTLTLWFGAYLVKQGKTDFGDVYKIFLILVLSSFSV  1286

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDT+MA  +IP++ +II+R+PLIG+D + KGR+ + SKP DIEF  VTFAYPS
Sbjct  1287  GQLAGLAPDTTMARTSIPSIFDIIHRQPLIGND-REKGRQIDRSKPLDIEFRKVTFAYPS  1345

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+++VLR+F LK+KGG+MVALVG SGSGKST++W+IQRFYDP QG+V +  VDLR+LNL
Sbjct  1346  RPEIMVLRDFYLKVKGGSMVALVGGSGSGKSTVVWLIQRFYDPNQGKVTLGSVDLRDLNL  1405

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQEPALFAG+I ENIAFG P AS+ EIEEAA EAYIHKFIS LP+GYET+
Sbjct  1406  KWLRKQIALVGQEPALFAGSIRENIAFGDPQASWAEIEEAAIEAYIHKFISSLPQGYETQ  1465

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILKKS+VLLLDEASSALDLESEKHVQ+ALR +SKQ+TT+
Sbjct  1466  VGESGVQLSGGQKQRIAIARAILKKSRVLLLDEASSALDLESEKHVQEALRNVSKQSTTV  1525

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EA++IAV+K+GAV EYGSHD L+ S LNG++A LVRAE EA AFA
Sbjct  1526  VVAHRLSTIREADMIAVMKDGAVIEYGSHDALLNSHLNGVFAGLVRAETEATAFA  1580


 Score =   257 bits (657),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 200/515 (39%), Positives = 295/515 (57%), Gaps = 34/515 (7%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  ++D  E STG ++  +S D    + V+G++ +  + 
Sbjct  436   LVGERSAHRIRTMYLRAVLRQDISFYD-TEVSTGDVMHGISSDVAQIQEVMGEKMAHFVH  494

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++T      G +Y  + + +  K + +SY +A  IA
Sbjct  495   QIFTFICGYTVGFLRSWKVSLVVFSVTPLMMFCGMAYKVIYVGLATK-EEASYRKAGGIA  553

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++++ + +   L         +S  +G+ +GF++GA         
Sbjct  554   EQAISSIRTVFSFVAEDNLAEKYADFLF--------KSVPIGAKVGFAKGAGMGVIYLVT  605

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLS----SFSVGQLAGLAPDTSMASAAI  932
             Y  + L  W+G+ LV  G    G+    F  + +     + S+   A  A  T  AS   
Sbjct  606   YSTWALAFWYGSILVARGEITGGSAIACFFGVNVGGRGLALSLTYFAQFAQGTVAASR--  663

Query  931   PAVLEIINRRPLIGSDPQ-RKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKG  755
               V EII+R P I  DP    GR     +   IEF+ V F+YPSRPD ++LR+ +L I  
Sbjct  664   --VYEIIDRIPDI--DPYGSHGRTLPNVRG-RIEFKSVIFSYPSRPDTLILRSLNLVIPS  718

Query  754   GTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPAL  575
                VALVG SG GKST+  +I+RFYDPI+G + ++  DL+ L +KWLR Q  +VGQEP L
Sbjct  719   SKTVALVGTSGGGKSTIFALIERFYDPIKGVITLDGHDLKTLQVKWLRDQIGMVGQEPVL  778

Query  574   FAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRI  395
             FA +I EN+  G  NA+  E   A   A  H FISGL  GY+T+VG  G QLSGGQKQRI
Sbjct  779   FATSILENVMMGKENATEKEAINACIAANAHSFISGLTYGYDTQVGDRGTQLSGGQKQRI  838

Query  394   AIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIA  215
             A+ARAI+K   +LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHRL+T++ AN+I 
Sbjct  839   ALARAIIKDPHILLLDEPTSALDAESESIVQQAIDKISTGRTTIVIAHRLATVRNANIIV  898

Query  214   VVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             V+  G+V E G+H +LM  +  G Y  LV+   EA
Sbjct  899   VLDHGSVVEIGNHRQLM--DKAGAYYDLVKLASEA  931



>gb|KHG28826.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1617

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/535 (75%), Positives = 477/535 (89%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +   L+L LVGLGFG I+ + GQQG CG AGTKLT R+R+ LF+SILKQEPGWFDF+
Sbjct  1084  LKAEVNKLALALVGLGFGSIIFLTGQQGFCGWAGTKLTVRVRDLLFRSILKQEPGWFDFE  1143

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+TG+LVSRLSID +SFRSVLGDR+SVLLMG+S+AAVGLGISF LEWRL L+AAA+TPF
Sbjct  1144  DNATGILVSRLSIDCLSFRSVLGDRYSVLLMGVSAAAVGLGISFYLEWRLALVAAAVTPF  1203

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+N+GP+LDN +Y +AS IA+GA+SNIRTVATFS+QE IV+SF++ALS+P+
Sbjct  1204  TLGASYLNLIINIGPRLDNKAYDKASTIASGAISNIRTVATFSSQEEIVKSFDQALSDPR  1263

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQILG ALG SQGAMY AYTLTLW GA L+K+  T  G VYKIFLILVLSSFSV
Sbjct  1264  KQSVKRSQILGFALGLSQGAMYCAYTLTLWVGASLIKQRITGFGEVYKIFLILVLSSFSV  1323

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGL+PDT+MA+ AIPAV +IINR+PLIG + + KG+K E SKP DIE +MVTFAYPS
Sbjct  1324  GQLAGLSPDTTMAATAIPAVFDIINRKPLIG-NSRDKGKKIERSKPLDIELKMVTFAYPS  1382

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             R  VIVLR+F LK+KGG+MVALVG SGSGKST+IW++QRFYDP QG+V+M  +DL+ELNL
Sbjct  1383  RQQVIVLRDFCLKVKGGSMVALVGGSGSGKSTVIWLVQRFYDPNQGKVMMGGIDLKELNL  1442

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQEPALFAG+I ENIAFG PNA++ EIEEAAKEAYIHKFISGLP+GYET+
Sbjct  1443  KWLRKQVALVGQEPALFAGSIRENIAFGNPNATWGEIEEAAKEAYIHKFISGLPQGYETQ  1502

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKH+QDALR++S+ ATTI
Sbjct  1503  VGESGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHIQDALRRVSRSATTI  1562

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +VAHRLSTI+EAN IAVVK+GAV EYGSHDKL+ S ++G+YA+LVRAE+EA AF+
Sbjct  1563  IVAHRLSTIREANTIAVVKDGAVVEYGSHDKLLTSHVDGVYASLVRAEREANAFS  1617


 Score =   254 bits (650),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 202/519 (39%), Positives = 293/519 (56%), Gaps = 42/519 (8%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  +FD  E STG ++  +S D    + V+G++ +  + 
Sbjct  473   LVGERSAQRIRTKYLRAVLRQDISFFD-TEVSTGDIMHGISSDVAQIQEVMGEKMAHFIH  531

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  A+T      G +Y ++   +  K +  SY +A  IA
Sbjct  532   HVFTFICGYIVGFLASWKVSLVVFAVTPLMMFCGIAYKAIYGGLTAK-EEVSYRKAGTIA  590

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++++   + + L+         S  LG+ +GF++GA         
Sbjct  591   EQAISSIRTVFSFVGEDNLAARYGELLAN--------SVPLGAKIGFAKGAGIGVIYLVT  642

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSM  947
             Y  + L  W+G+ LV     + G     F         L L L+ F+  Q A        
Sbjct  643   YSTWALAFWYGSILVARKEISGGDAIACFFGVNVGGRGLALALTYFA--QFA-------Q  693

Query  946   ASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSL  767
              + A   V +II+R P I  DP     +  +S    IEF+ VTFAYPSRPD  +L + +L
Sbjct  694   GTVAAGRVFDIIDRVPEI--DPYNPEGRMLSSVRGKIEFKGVTFAYPSRPDTTILSSLNL  751

Query  766   KIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQ  587
              I+    +ALVGASG GKST+  +I+RFYDP +G V ++  DL+ L +KWLR Q  +VGQ
Sbjct  752   VIRSAKTLALVGASGGGKSTIFALIERFYDPDKGTVTLDGYDLKTLQVKWLRRQIGMVGQ  811

Query  586   EPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggq  407
             EP LFA TI EN+  G  NA+  E   A   A  H FI  LP GY+T+VG  G QLSGGQ
Sbjct  812   EPVLFATTILENVMMGKENATKKEAVAACVAANAHGFIYDLPLGYDTQVGAKGTQLSGGQ  871

Query  406   kQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEA  227
             KQRIA+ARA++K   +LLLDE +SALD E+E  VQ A+ KISK  TT+V+AHRL+T++ A
Sbjct  872   KQRIALARALIKDPGILLLDEPTSALDSEAEAVVQQAIDKISKGRTTVVIAHRLATVRNA  931

Query  226   NVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             N I V+  G+V+E GSH +LM  E  G Y  LV+   EA
Sbjct  932   NTIVVLDNGSVSESGSHHQLMERE--GAYYKLVKLASEA  968



>gb|KHG28827.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1647

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/535 (75%), Positives = 477/535 (89%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +   L+L LVGLGFG I+ + GQQG CG AGTKLT R+R+ LF+SILKQEPGWFDF+
Sbjct  1114  LKAEVNKLALALVGLGFGSIIFLTGQQGFCGWAGTKLTVRVRDLLFRSILKQEPGWFDFE  1173

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+TG+LVSRLSID +SFRSVLGDR+SVLLMG+S+AAVGLGISF LEWRL L+AAA+TPF
Sbjct  1174  DNATGILVSRLSIDCLSFRSVLGDRYSVLLMGVSAAAVGLGISFYLEWRLALVAAAVTPF  1233

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+N+GP+LDN +Y +AS IA+GA+SNIRTVATFS+QE IV+SF++ALS+P+
Sbjct  1234  TLGASYLNLIINIGPRLDNKAYDKASTIASGAISNIRTVATFSSQEEIVKSFDQALSDPR  1293

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQILG ALG SQGAMY AYTLTLW GA L+K+  T  G VYKIFLILVLSSFSV
Sbjct  1294  KQSVKRSQILGFALGLSQGAMYCAYTLTLWVGASLIKQRITGFGEVYKIFLILVLSSFSV  1353

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGL+PDT+MA+ AIPAV +IINR+PLIG + + KG+K E SKP DIE +MVTFAYPS
Sbjct  1354  GQLAGLSPDTTMAATAIPAVFDIINRKPLIG-NSRDKGKKIERSKPLDIELKMVTFAYPS  1412

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             R  VIVLR+F LK+KGG+MVALVG SGSGKST+IW++QRFYDP QG+V+M  +DL+ELNL
Sbjct  1413  RQQVIVLRDFCLKVKGGSMVALVGGSGSGKSTVIWLVQRFYDPNQGKVMMGGIDLKELNL  1472

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQEPALFAG+I ENIAFG PNA++ EIEEAAKEAYIHKFISGLP+GYET+
Sbjct  1473  KWLRKQVALVGQEPALFAGSIRENIAFGNPNATWGEIEEAAKEAYIHKFISGLPQGYETQ  1532

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKH+QDALR++S+ ATTI
Sbjct  1533  VGESGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHIQDALRRVSRSATTI  1592

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +VAHRLSTI+EAN IAVVK+GAV EYGSHDKL+ S ++G+YA+LVRAE+EA AF+
Sbjct  1593  IVAHRLSTIREANTIAVVKDGAVVEYGSHDKLLTSHVDGVYASLVRAEREANAFS  1647


 Score =   243 bits (621),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 205/548 (37%), Positives = 294/548 (54%), Gaps = 70/548 (13%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  +FD  E STG ++  +S D    + V+G++ +  + 
Sbjct  473   LVGERSAQRIRTKYLRAVLRQDISFFD-TEVSTGDIMHGISSDVAQIQEVMGEKMAHFIH  531

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASY-----------------------  1325
              + +   G  + F   W+++L+  A+T      G +Y                       
Sbjct  532   HVFTFICGYIVGFLASWKVSLVVFAVTPLMMFCGIAYKAIYGGLTAKEEVKMTTIVTGNV  591

Query  1324  -----FSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
                   SLI+     L+   SY +A  IA  A+S+IRTV +F  ++++   + + L+   
Sbjct  592   LQCQLVSLIVFCSIFLELQVSYRKAGTIAEQAISSIRTVFSFVGEDNLAARYGELLAN--  649

Query  1162  RTSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF--  1013
                   S  LG+ +GF++GA         Y  + L  W+G+ LV     + G     F  
Sbjct  650   ------SVPLGAKIGFAKGAGIGVIYLVTYSTWALAFWYGSILVARKEISGGDAIACFFG  703

Query  1012  -------LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFET  854
                    L L L+ F+  Q A         + A   V +II+R P I  DP     +  +
Sbjct  704   VNVGGRGLALALTYFA--QFA-------QGTVAAGRVFDIIDRVPEI--DPYNPEGRMLS  752

Query  853   SKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDP  674
             S    IEF+ VTFAYPSRPD  +L + +L I+    +ALVGASG GKST+  +I+RFYDP
Sbjct  753   SVRGKIEFKGVTFAYPSRPDTTILSSLNLVIRSAKTLALVGASGGGKSTIFALIERFYDP  812

Query  673   IQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKE  494
              +G V ++  DL+ L +KWLR Q  +VGQEP LFA TI EN+  G  NA+  E   A   
Sbjct  813   DKGTVTLDGYDLKTLQVKWLRRQIGMVGQEPVLFATTILENVMMGKENATKKEAVAACVA  872

Query  493   AYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesE  314
             A  H FI  LP GY+T+VG  G QLSGGQKQRIA+ARA++K   +LLLDE +SALD E+E
Sbjct  873   ANAHGFIYDLPLGYDTQVGAKGTQLSGGQKQRIALARALIKDPGILLLDEPTSALDSEAE  932

Query  313   KHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYAT  134
               VQ A+ KISK  TT+V+AHRL+T++ AN I V+  G+V+E GSH +LM  E  G Y  
Sbjct  933   AVVQQAIDKISKGRTTVVIAHRLATVRNANTIVVLDNGSVSESGSHHQLMERE--GAYYK  990

Query  133   LVRAEQEA  110
             LV+   EA
Sbjct  991   LVKLASEA  998



>ref|XP_008228350.1| PREDICTED: ABC transporter B family member 19-like [Prunus mume]
Length=1510

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/534 (76%), Positives = 462/534 (87%), Gaps = 0/534 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++   + L L+LVGLGFG IV M GQQGLCG AGTKLT R+RN LF+SILKQEPGWFD +
Sbjct  977   IKRNIEPLCLVLVGLGFGNIVFMTGQQGLCGWAGTKLTMRVRNLLFRSILKQEPGWFDSE  1036

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENS  VLVSRLSIDSVSFRSV  DR SVLLMGLSS  VGLG+   LEWRL +LAAALTP 
Sbjct  1037  ENSKAVLVSRLSIDSVSFRSVHIDRLSVLLMGLSSGMVGLGLCVYLEWRLAILAAALTPL  1096

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+N+GPKLDN +YA+ASNIA+GAVSNIRTV TFS QE +V+SFEKALS PK
Sbjct  1097  TLGASYLSLIINLGPKLDNEAYAKASNIASGAVSNIRTVTTFSAQEQLVESFEKALSGPK  1156

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               SVRRSQI+G ALGFSQG MYGAYT+TL FGAYL+KEG  N G VYKIFLILVLSSFSV
Sbjct  1157  SKSVRRSQIMGLALGFSQGVMYGAYTVTLLFGAYLIKEGKANFGEVYKIFLILVLSSFSV  1216

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AIPAV +II+RRPLIGS  + K +K + SKP DI+F+MVTFAYPS
Sbjct  1217  GQLAGLAPDTSMAATAIPAVFDIISRRPLIGSSNRDKDKKLDRSKPLDIQFKMVTFAYPS  1276

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDV VL +F LKIKGG+ VAL G SGSGKST+IW+IQRFYDPIQG+V+M  VDLR++N+
Sbjct  1277  RPDVTVLSDFCLKIKGGSTVALAGGSGSGKSTVIWLIQRFYDPIQGKVMMGGVDLRDINV  1336

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQEP LF+GTI ENIAFG PNAS+ EIE+AA+EAYIH FIS LP+GYET+
Sbjct  1337  KWLRKQIALVGQEPTLFSGTIRENIAFGNPNASWAEIEDAAREAYIHNFISSLPQGYETQ  1396

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SG QLSGGQKQRIAIARAILK+SK+LLLDEASSALDLESE+H+QDALRKISK+ATTI
Sbjct  1397  VGESGAQLSGGQKQRIAIARAILKRSKILLLDEASSALDLESERHIQDALRKISKRATTI  1456

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
             +VAHRLSTI+EA++IAV+  GA+ EYGSHD LMAS LNG+YA+LVRAE EA AF
Sbjct  1457  IVAHRLSTIREADMIAVMSNGAITEYGSHDALMASHLNGVYASLVRAETEANAF  1510


 Score =   241 bits (614),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 197/540 (36%), Positives = 294/540 (54%), Gaps = 48/540 (9%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             + L + GL    +V    +     + G +   R+R    +++L+Q+  +FD  E + G +
Sbjct  354   ICLYMAGLAAIVVVGAYMEITCWRMMGERSAQRMRREYLRAVLRQDISFFD-TEVAAGDI  412

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISF--SLEWRltllaaaltpftLGAS  1328
             +  +S D    + VLG++ +  +  + +   G  + F  S +  L + +        G +
Sbjct  413   MHGISSDVAQIQEVLGEKMAHFIHHICTFICGYAVGFIRSRKLSLVVFSVIPLMMFCGIA  472

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE--PKRTS  1154
             Y ++ + +  K +  SY +A ++A  A+S+IRTV +F  ++++ + +   L++  P    
Sbjct  473   YKAVYVGLTTK-EEVSYRKAGSVAEQAISSIRTVFSFVAEDNLAERYANLLADLVP----  527

Query  1153  VRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF-----  1013
                   LG+ +GF++GA         Y  + L  W+G  LV  G    G     F     
Sbjct  528   ------LGARIGFAKGAGVGVIYLVTYSTWALAFWYGGVLVARGEIAGGDAIACFFGVNV  581

Query  1012  ----LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRK-GRKFETSK  848
                 L L LS F+           S  + A   V EII+R P I  DP    GR    ++
Sbjct  582   GGRGLALSLSYFA---------QFSQGTVAASRVFEIIDRVPEI--DPYSSVGRTLPKAR  630

Query  847   PFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQ  668
                IEF+ V+F+YPSR +  +L + +L I     +ALVG+SG GKST+  +I+RFYDP Q
Sbjct  631   G-RIEFKGVSFSYPSRLNAPILHSLNLVIPSSKTLALVGSSGGGKSTIFALIERFYDPNQ  689

Query  667   GRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAY  488
             G V ++  DLR L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   A 
Sbjct  690   GIVTLDGHDLRTLQVKWLRDQIGMVGQEPVLFATSILENVLMGKENATKKEAISACIAAN  749

Query  487   IHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKH  308
              H FISGLP+GYET+VG  G  LSGGQKQRIA+ARA++K  ++LLLDE +SALD ESE  
Sbjct  750   AHSFISGLPQGYETQVGDRGALLSGGQKQRIALARAMIKDPRILLLDEPTSALDPESESV  809

Query  307   VQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             VQ A+ KIS   T IV+AHRLST++ ++ I V+  G+V E G+H +LM  E  G Y +LV
Sbjct  810   VQQAIDKISSGRTAIVIAHRLSTVRNSHTIVVLDSGSVIEIGNHRQLM--EKAGAYYSLV  867



>gb|KDP40662.1| hypothetical protein JCGZ_24661 [Jatropha curcas]
Length=1429

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/535 (77%), Positives = 468/535 (87%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+    N+ L LVGLG GCI+ M GQQGLCG AGTKLT R+RN LF+SILKQEP WFDF+
Sbjct  896   LKRDVGNICLALVGLGIGCILAMTGQQGLCGWAGTKLTMRVRNLLFRSILKQEPAWFDFE  955

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +NSTGVLVSRLS ++VSFRSVLGDRFSVLLMGLSSAAVGLG+SF LEWRL LLA ALTPF
Sbjct  956   DNSTGVLVSRLSTNTVSFRSVLGDRFSVLLMGLSSAAVGLGVSFYLEWRLALLATALTPF  1015

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+NVGPKLDNSSYA+ASNIAAGAVSNIRTV TFS QE I++SF+ AL EPK
Sbjct  1016  TLGASYLSLIINVGPKLDNSSYAKASNIAAGAVSNIRTVTTFSAQEQIIRSFDGALDEPK  1075

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQILG  +GFSQGAMY AYTLTLWFGAYLVK+  TN G VYKIFLILVLSSFSV
Sbjct  1076  KKSVKRSQILGLTIGFSQGAMYCAYTLTLWFGAYLVKQDKTNFGEVYKIFLILVLSSFSV  1135

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDT+MA  A+PA+ +II R+PLIG+D +  GRK + SK +DIE  MVTFAYPS
Sbjct  1136  GQLAGLAPDTTMARTAVPAIFDIIYRKPLIGNDNE-MGRKIDRSKSWDIELRMVTFAYPS  1194

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+++VLR+F LK+KGG+MVALVG SGSGKST+IW+IQRFYDP QG+V M  VDLR LN+
Sbjct  1195  RPEIVVLRDFCLKVKGGSMVALVGGSGSGKSTVIWLIQRFYDPNQGKVTMGGVDLRVLNV  1254

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQEPALF+G+I ENIAFG P AS+ EIEEAA EAYIHKFIS LP+GYET+
Sbjct  1255  KWLRKQIALVGQEPALFSGSIRENIAFGNPQASWAEIEEAAMEAYIHKFISSLPQGYETQ  1314

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SG QLSGGQKQRIAIARAILKKS+VLLLDEASSALDLESEKHVQ+ALR +SKQAT I
Sbjct  1315  VGESGAQLSGGQKQRIAIARAILKKSRVLLLDEASSALDLESEKHVQEALRNVSKQATAI  1374

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EAN+IAVVK+GAV EYGSH+ L+ S LNG+YA+LVRAE EA AFA
Sbjct  1375  VVAHRLSTIREANMIAVVKDGAVVEYGSHNALLNSHLNGVYASLVRAETEATAFA  1429


 Score =   269 bits (687),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 208/520 (40%), Positives = 299/520 (58%), Gaps = 44/520 (8%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  ++D  E STG ++  +S D    + V+G++ +  + 
Sbjct  292   LVGERSAHRIRTMYLRAVLRQDISFYD-TEVSTGDIMHGISSDVAQIQEVMGEKMAHFVH  350

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++T    + G +Y ++ + +  K +  SY +A  +A
Sbjct  351   QICTFICGYTVGFLRSWKVSLVVFSITPLMMSCGMAYKAIYVGLATK-EQISYRKAGGVA  409

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++++ + +   L         +S  +G+ +GF++GA         
Sbjct  410   EQAISSIRTVFSFVAEDNLAEKYSDFLV--------KSVPIGAKIGFAKGAGMGVIYLVT  461

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSM  947
             Y  + L  W+G+ LV  G  N GA    F         L L L+ F     A  A  T  
Sbjct  462   YATWALAFWYGSILVARGEINGGAAIACFFGVNVGGRGLALALTYF-----AQFAQGTVA  516

Query  946   ASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFS  770
             AS     V EII+R P I  DP    GR     +   IEF  V FAYPSRPD ++L + +
Sbjct  517   ASR----VYEIIDRIPDI--DPYSTHGRTLSNVRG-RIEFRSVIFAYPSRPDNLILNSLN  569

Query  769   LKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVG  590
             L I     +ALVGASG GKST+  +I+RFYDPI+G + ++  DLR L +KWLR Q  +VG
Sbjct  570   LVIPSSKTLALVGASGGGKSTIFALIERFYDPIKGVITLDGHDLRTLQVKWLRDQIGMVG  629

Query  589   QEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsgg  410
             QEP LFA +I ENI  G  NA+  E   A   A  H FISGLP GY+T+VG  G QLSGG
Sbjct  630   QEPILFATSILENIMMGKENATKKEAINACIAANAHSFISGLPYGYDTQVGDRGTQLSGG  689

Query  409   qkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKE  230
             QKQRIA+ARAI+K  ++LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHRL+T++ 
Sbjct  690   QKQRIALARAIIKDPQILLLDEPTSALDAESESIVQQAIDKISSSRTTIVIAHRLATVRN  749

Query  229   ANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             AN+I V+ +G+V E G+H +LM  E  G Y  LV+   EA
Sbjct  750   ANIIVVLDQGSVVEIGNHRQLM--ENAGAYYDLVKLASEA  787



>gb|KHN39598.1| ABC transporter B family member 19 [Glycine soja]
Length=1516

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/528 (76%), Positives = 468/528 (89%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L L LVGLGFGCI++M GQQG CG AG+KLT R+R+ LF+SILKQEPGWFDF+ENSTGVL
Sbjct  990   LCLTLVGLGFGCILSMTGQQGFCGWAGSKLTQRVRDLLFQSILKQEPGWFDFEENSTGVL  1049

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             VSRLS+D VSFRSVLGDRFSVLLMGLSSAAVGLG+SF+  WRLTL+AAA+TPF LGASY 
Sbjct  1050  VSRLSLDCVSFRSVLGDRFSVLLMGLSSAAVGLGVSFAFNWRLTLVAAAVTPFALGASYI  1109

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             SLI+NVGP++DN SYA+ASNIA+GAVSNIRTV TFS QE IV+SF++ALSEP+R S+R S
Sbjct  1110  SLIINVGPRVDNDSYAKASNIASGAVSNIRTVTTFSAQEQIVKSFDRALSEPRRKSLRSS  1169

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             Q+ G   G  QG+MYGAYTLTLWFGAYLV+     +G V+KIFLILVLSSFSVGQLAGLA
Sbjct  1170  QLQGLMFGLFQGSMYGAYTLTLWFGAYLVEHDKAKLGDVFKIFLILVLSSFSVGQLAGLA  1229

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDT+MA+AAIPAV +II RRPLI +D + KGR  + SK F+IEF+MVTFAYPSRP+V VL
Sbjct  1230  PDTTMAAAAIPAVQDIIKRRPLIDND-RTKGRIVDRSKRFNIEFKMVTFAYPSRPEVTVL  1288

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+F LK+KGG+ VALVG SGSGKST+IW+ QRFYDP QG+V+M  +DLRE+++KWLR Q 
Sbjct  1289  RDFCLKVKGGSTVALVGPSGSGKSTVIWLTQRFYDPDQGKVMMSGIDLREIDVKWLRRQM  1348

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
             ALVGQEP+LFAG+I ENIAFG PNAS+TEIEEAAKEAYIHKFISGLP+GYET+VG+SGVQ
Sbjct  1349  ALVGQEPSLFAGSIRENIAFGDPNASWTEIEEAAKEAYIHKFISGLPQGYETQVGESGVQ  1408

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILKKS+VLLLDEASSALDLESEKH+Q+AL+K++K+ATTI+VAHRLS
Sbjct  1409  LSGGQKQRIAIARAILKKSRVLLLDEASSALDLESEKHIQEALKKVTKEATTIIVAHRLS  1468

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             TI+EA+ IAV+++G V EYGSHD LMAS  NG+YA LVRAE EA AFA
Sbjct  1469  TIREADKIAVMRDGEVVEYGSHDNLMASNQNGLYACLVRAETEANAFA  1516


 Score =   250 bits (639),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 198/521 (38%), Positives = 293/521 (56%), Gaps = 46/521 (9%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  +FD D N TG ++  ++ D    + V+G++ +  + 
Sbjct  366   LVGERAAQRIRTEYLRAVLRQDITFFDTDIN-TGDIMHGIASDVAQIQEVMGEKMAHFIH  424

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++T      G +Y +L   +  K + +SY +A +IA
Sbjct  425   HIFTFICGYAVGFKRSWKVSLVVFSVTPLTMFCGMAYKALYGGLTAK-EEASYRKAGSIA  483

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  +  +   + + L        ++S  +G+ +GF++G          
Sbjct  484   EQAISSIRTVFSFVAESKLAGKYAELL--------QKSAPIGARVGFAKGIGMGVIYLIT  535

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFS-VGQLAGLAPDTS  950
             Y  + L  W+G+ L+     + G+    F         L L LS F+  GQ         
Sbjct  536   YSTWALAFWYGSVLIARNELDGGSAIACFFGVNVGGRGLALALSYFAQFGQ---------  586

Query  949   MASAAIPAVLEIINRRPLIGS-DPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNF  773
               + A   V  II R P I S  P+  GRK    +   IE + V+FAYPSRPD ++L + 
Sbjct  587   -GTVAASRVFYIIERIPEIDSYSPE--GRKLSGVRG-RIELKSVSFAYPSRPDSLILHSL  642

Query  772   SLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALV  593
             +L +     VALVGASG GKST+  +I+RFYDPI+G + ++  DLR L +KWLR Q  +V
Sbjct  643   NLVLPSSKTVALVGASGGGKSTIFALIERFYDPIEGIITLDGHDLRTLQVKWLRDQIGMV  702

Query  592   GQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsg  413
             GQEP LFA +I EN+  G  NA+  E   A   A  H FIS LP  Y+T+VG  G +LSG
Sbjct  703   GQEPILFATSILENVMMGKDNATKKEAIAACIAADAHSFISSLPLSYDTQVGDRGTKLSG  762

Query  412   gqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIK  233
             GQKQRIA+ARA++K  K+LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHR++T+K
Sbjct  763   GQKQRIALARAMVKDPKILLLDEPTSALDAESESAVQRAIDKISASRTTIVIAHRIATVK  822

Query  232   EANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
              A+ I V++ G+V E G H +LMA    G Y  LV+   EA
Sbjct  823   NAHAIVVLEHGSVTEIGDHRQLMAKA--GAYYNLVKLATEA  861



>ref|XP_003548375.1| PREDICTED: ABC transporter B family member 19-like [Glycine max]
Length=1515

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/528 (76%), Positives = 468/528 (89%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L L LVGLGFGCI++M GQQGLCG AG+KLT R+R+ LF+SILKQEPGWFDF+ENSTGVL
Sbjct  989   LCLTLVGLGFGCILSMTGQQGLCGWAGSKLTQRVRDLLFQSILKQEPGWFDFEENSTGVL  1048

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             VSRLS+D VSFRSVLGDRFSVLLMGLSSAAVGLG+SF+  WRLTL+AAA+TPF LGASY 
Sbjct  1049  VSRLSLDCVSFRSVLGDRFSVLLMGLSSAAVGLGVSFAFNWRLTLVAAAVTPFALGASYI  1108

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             SLI+NVGP++DN SYA+ASNIA+GAVSNIRTV TFS QE IV+SF++ALSEP+R S+R S
Sbjct  1109  SLIINVGPRVDNDSYAKASNIASGAVSNIRTVTTFSAQEQIVKSFDRALSEPRRKSLRSS  1168

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             Q+ G   G  QG+MYGAYTLTLWFGAYLV+     +G V+KIFLILVLSSFSVGQLAGLA
Sbjct  1169  QLQGLMFGLFQGSMYGAYTLTLWFGAYLVEHDKAKLGDVFKIFLILVLSSFSVGQLAGLA  1228

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDT+MA+AAIPAV +II RRPLI +D + KGR  + SK F+IEF+MVTFAYPSRP+V VL
Sbjct  1229  PDTTMAAAAIPAVQDIIKRRPLIDND-RTKGRIVDRSKRFNIEFKMVTFAYPSRPEVTVL  1287

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+F LK+K G+ VALVG SGSGKST+IW+ QRFYDP QG+V+M  +DLRE+++KWLR Q 
Sbjct  1288  RDFCLKVKAGSTVALVGPSGSGKSTVIWLTQRFYDPDQGKVMMSGIDLREIDVKWLRRQM  1347

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
             ALVGQEP+LFAG+I ENIAFG PNAS+TEIEEAAKEAYIHKFISGLP+GYET+VG+SGVQ
Sbjct  1348  ALVGQEPSLFAGSIRENIAFGDPNASWTEIEEAAKEAYIHKFISGLPQGYETQVGESGVQ  1407

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILKKS+VLLLDEASSALDLESEKH+Q+AL+K++K+ATTI+VAHRLS
Sbjct  1408  LSGGQKQRIAIARAILKKSRVLLLDEASSALDLESEKHIQEALKKVTKEATTIIVAHRLS  1467

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             TI+EA+ IAV+++G V EYGSHD LMAS  NG+YA LVRAE EA AFA
Sbjct  1468  TIREADKIAVMRDGEVVEYGSHDNLMASNQNGLYACLVRAETEANAFA  1515


 Score =   250 bits (639),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 198/521 (38%), Positives = 293/521 (56%), Gaps = 46/521 (9%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  +FD D N TG ++  ++ D    + V+G++ +  + 
Sbjct  365   LVGERAAQRIRTEYLRAVLRQDITFFDTDIN-TGDIMHGIASDVAQIQEVMGEKMAHFIH  423

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++T      G +Y +L   +  K + +SY +A +IA
Sbjct  424   HIFTFICGYAVGFKRSWKVSLVVFSVTPLTMFCGMAYKALYGGLTAK-EEASYRKAGSIA  482

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  +  +   + + L        ++S  +G+ +GF++G          
Sbjct  483   EQAISSIRTVFSFVAESKLAGKYAELL--------QKSAPIGARVGFAKGIGMGVIYLIT  534

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFS-VGQLAGLAPDTS  950
             Y  + L  W+G+ L+     + G+    F         L L LS F+  GQ         
Sbjct  535   YSTWALAFWYGSVLIARNELDGGSAIACFFGVNVGGRGLALALSYFAQFGQ---------  585

Query  949   MASAAIPAVLEIINRRPLIGS-DPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNF  773
               + A   V  II R P I S  P+  GRK    +   IE + V+FAYPSRPD ++L + 
Sbjct  586   -GTVAASRVFYIIERIPEIDSYSPE--GRKLSGVRG-RIELKSVSFAYPSRPDSLILHSL  641

Query  772   SLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALV  593
             +L +     VALVGASG GKST+  +I+RFYDPI+G + ++  DLR L +KWLR Q  +V
Sbjct  642   NLVLPSSKTVALVGASGGGKSTIFALIERFYDPIEGIITLDGHDLRTLQVKWLRDQIGMV  701

Query  592   GQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsg  413
             GQEP LFA +I EN+  G  NA+  E   A   A  H FIS LP  Y+T+VG  G +LSG
Sbjct  702   GQEPILFATSILENVMMGKDNATKKEAIAACIAADAHSFISSLPLSYDTQVGDRGTKLSG  761

Query  412   gqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIK  233
             GQKQRIA+ARA++K  K+LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHR++T+K
Sbjct  762   GQKQRIALARAMVKDPKILLLDEPTSALDAESESAVQRAIDKISASRTTIVIAHRIATVK  821

Query  232   EANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
              A+ I V++ G+V E G H +LMA    G Y  LV+   EA
Sbjct  822   NAHAIVVLEHGSVTEIGDHRQLMAKA--GAYYNLVKLATEA  860



>ref|XP_007216167.1| hypothetical protein PRUPE_ppa015387mg [Prunus persica]
 gb|EMJ17366.1| hypothetical protein PRUPE_ppa015387mg [Prunus persica]
Length=1493

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/534 (76%), Positives = 462/534 (87%), Gaps = 0/534 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + L L+LVGLGFG IV M GQQGLCG AGTKLT R+RN LF+SILKQEPGWFD +
Sbjct  960   IKRKIEPLCLVLVGLGFGNIVFMTGQQGLCGWAGTKLTMRVRNLLFRSILKQEPGWFDSE  1019

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENS  VLVSRLSIDSVSFRSV  DR SVLLMGLSS  VGLG+   L WRL +LAAALTP 
Sbjct  1020  ENSKAVLVSRLSIDSVSFRSVHIDRLSVLLMGLSSGMVGLGLCVYLNWRLAILAAALTPL  1079

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+N+GPKLDN +YA+ASNIA+GAVSNIRTV TFS QE +V+SFEKALS PK
Sbjct  1080  TLGASYLTLIINLGPKLDNEAYAKASNIASGAVSNIRTVTTFSAQEQLVKSFEKALSGPK  1139

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               SVRRSQI+G ALGFSQG MYGAYT+TL FGAYL+KEG  N G VYKIFLILVLSSFSV
Sbjct  1140  SKSVRRSQIMGLALGFSQGVMYGAYTVTLLFGAYLIKEGKANFGEVYKIFLILVLSSFSV  1199

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AIPAV +II+RRPLIGS  + K +K + SKP DI+F+MVTFAYPS
Sbjct  1200  GQLAGLAPDTSMAATAIPAVFDIISRRPLIGSSNRDKDKKLDRSKPLDIQFKMVTFAYPS  1259

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDV VL +F LKIKGG+ VALVG SGSGKST++W+IQRFYDPIQG+V+M  VDLR++N+
Sbjct  1260  RPDVTVLSDFCLKIKGGSTVALVGGSGSGKSTVVWLIQRFYDPIQGKVMMGGVDLRDINV  1319

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQEP LF+GTI ENIAFG PNAS+ EIE+AA+EAYIH FIS LP+GYET+
Sbjct  1320  KWLRKQIALVGQEPTLFSGTIRENIAFGNPNASWAEIEDAAREAYIHNFISSLPQGYETQ  1379

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SG QLSGGQKQRIAIARAILK+SKVLLLDEASSALDLESEKH+QDALRKISK+ATTI
Sbjct  1380  VGESGAQLSGGQKQRIAIARAILKRSKVLLLDEASSALDLESEKHIQDALRKISKRATTI  1439

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
             +VAHRLSTI+ A++IAV+  GA+ EYGSHD LMAS LNG+YA+LVRAE EA AF
Sbjct  1440  IVAHRLSTIRGADMIAVMSNGAITEYGSHDALMASHLNGVYASLVRAETEANAF  1493


 Score =   239 bits (609),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 198/548 (36%), Positives = 295/548 (54%), Gaps = 56/548 (10%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   R+R    +++L+Q+  +FD  E + G ++  +S D    + V+G++ +  + 
Sbjct  361   MVGERSAQRMRREYLRAVLRQDVSFFD-TEVAAGDIMHGISSDVAQIQEVMGEKMAHFIH  419

Query  1429  GLSSAAVGLGISF--SLEWRltllaaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F  S +  L + +        G +Y ++ + +  K +  SY +A  +A
Sbjct  420   HICTFICGYAVGFIRSRKLSLVIFSVIPLMMFCGIAYKAVYVGLTTK-EEVSYRKAGTVA  478

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSE--PKRTSVRRSQILGSALGFSQGA-------  1103
               A+S+IRTV +F  ++++ + +   L++  P           G+ +GF++GA       
Sbjct  479   EQAISSIRTVFSFVAEDNLAERYANLLADLVP----------FGARIGFAKGAGVGVIYL  528

Query  1102  -MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDT  953
               Y  + L  W+G  LV  G  + G     F         L L LS F+           
Sbjct  529   VTYSTWALAFWYGGVLVARGEISGGDAIACFFGVNVGGRGLALSLSYFA---------QF  579

Query  952   SMASAAIPAVLEIINRRPLIGSDPQRK-GRKFETSKPFDIEFEMVTFAYPSRPDVIVLRN  776
             S  + A   V EII+R P I  DP    GR    ++   IEF+ V+F+YPSR +  +L +
Sbjct  580   SQGTVAAGRVFEIIDRVPEI--DPYSSVGRTLPKARG-RIEFKGVSFSYPSRLNAPILHS  636

Query  775   FSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTAL  596
              +L I     +ALVG+SG GKST+  +I+RFYDP QG V ++  DLR L +KWLR Q  +
Sbjct  637   LNLVIPSSKTLALVGSSGGGKSTIFALIERFYDPNQGIVTLDGHDLRTLQVKWLRDQIGM  696

Query  595   VGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqls  416
             VGQEP LFA +I EN+  G  NA+  E   A   A  H FISGLP+GYET+VG  G  LS
Sbjct  697   VGQEPVLFATSILENVLMGKENATKKEAISACIAANAHSFISGLPQGYETQVGDRGALLS  756

Query  415   ggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTI  236
             GGQKQRIA+ARA++K  ++LLLDE +SALD ESE  VQ A+ KIS   T IV+AHRLST+
Sbjct  757   GGQKQRIALARAMIKDPRILLLDEPTSALDPESESVVQQAIDKISSGRTAIVIAHRLSTV  816

Query  235   KEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA*DLIIPFS--NLEE  62
             + ++ I V+  G+V E G+H +LM  E  G Y +LV    +       +  PFS  N  E
Sbjct  817   RNSHTIVVLDSGSVVEIGNHRQLM--EKAGAYYSLVELAADG------VTKPFSKQNHTE  868

Query  61    M*TNYIFP  38
               T  + P
Sbjct  869   KGTQLLVP  876



>ref|XP_011073033.1| PREDICTED: ABC transporter B family member 19-like [Sesamum indicum]
Length=1540

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/535 (78%), Positives = 476/535 (89%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+    +L L+LVGLGFGCI++M GQQG CG AGTKLT R+R+ LFK+IL+QEPGWFD  
Sbjct  1007  LKKDVGHLCLLLVGLGFGCIISMTGQQGFCGWAGTKLTKRVRDLLFKAILRQEPGWFDSS  1066

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG+LVSRLS+D VSFRSVLGDR +VLLMGLSSA VGLG+SF LEWRLTLLAAA+TPF
Sbjct  1067  ENSTGILVSRLSMDCVSFRSVLGDRITVLLMGLSSAGVGLGVSFVLEWRLTLLAAAVTPF  1126

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +L++N+GPK+DN SYARAS IAAGAVS+IRTVATF TQE IVQSF++AL EPK
Sbjct  1127  TLGASYLNLLINIGPKIDNESYARASTIAAGAVSSIRTVATFGTQELIVQSFDQALYEPK  1186

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             +TSVR+SQILG  LG SQGAMYGAYTLTL+FGAYLVK+GYTN G VYKIFLILVLSSFSV
Sbjct  1187  KTSVRKSQILGLVLGLSQGAMYGAYTLTLYFGAYLVKQGYTNFGVVYKIFLILVLSSFSV  1246

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AIPAV +I+NRRP IG++  +K RK E+SKP D+EF+ VTFAYPS
Sbjct  1247  GQLAGLAPDTSMATTAIPAVFDILNRRPSIGNN-GKKTRKLESSKPVDLEFKHVTFAYPS  1305

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             R +V VL NFSLKIKGGTMVALVG SGSGKST+IW+IQRFYDPI+GRVLM  +DLREL+L
Sbjct  1306  RLNVTVLNNFSLKIKGGTMVALVGGSGSGKSTVIWLIQRFYDPIRGRVLMGGIDLRELDL  1365

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K LR Q ALVGQEP+LFAG+I ENIAFG+PNAS+ EIE AAKEAYIHKFI  LP+GYET+
Sbjct  1366  KGLRRQIALVGQEPSLFAGSIRENIAFGYPNASWAEIEAAAKEAYIHKFICSLPQGYETE  1425

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKH+Q+AL+K S++ATT+
Sbjct  1426  VGESGVQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHIQNALKKASRRATTV  1485

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EAN IAV+K+G VAEYG HDKLMA+ L+GIYA LVR E EA AFA
Sbjct  1486  VVAHRLSTIREANFIAVMKDGVVAEYGDHDKLMAANLDGIYANLVRTETEAMAFA  1540


 Score =   261 bits (668),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 212/547 (39%), Positives = 307/547 (56%), Gaps = 44/547 (8%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
                 + L++ GL    +V    +     + G +   RIR    +++L+Q+ G+FD  E S
Sbjct  370   DVNKVCLLMTGLAAVVMVGAYLEITCWRIVGERSAHRIRTEYLRAVLRQDIGFFD-TELS  428

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             T  ++  +S D    + V+ ++ +  +  + +   G  + F   W+++L   A+TP T+G
Sbjct  429   TSDIMHGISSDVAQIQEVMAEKMAHFVHHIFTFICGYIVGFLKSWKVSLAVLAVTPLTMG  488

Query  1333  A--SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
                +Y ++   +  K +  SY RA +IA  A+S+IRTV +F  ++ + + +   L     
Sbjct  489   CGIAYKAIYGGLTAK-EEGSYRRAGSIAEQAISSIRTVISFVAEDTLAEKYADFL-----  542

Query  1159  TSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---  1013
                ++S  LG+ LGF++GA         Y  + L  W+G+ LV       G     F   
Sbjct  543   ---KKSVPLGAKLGFAKGAGIGVIYLVTYSTWALAFWYGSLLVSRNELKGGDAIACFFGV  599

Query  1012  ------LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFET  854
                   L L LS F+           S  + A   V E+I+R P I  DP   +GRK  +
Sbjct  600   NVGGRGLALALSYFA---------QFSQGTVAASRVFEVIDRIPEI--DPYSPEGRK-PS  647

Query  853   SKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDP  674
             S    IEF  V+FAYPSRP + +L++ +L I     +ALVGASG GKST+  +I+RFYDP
Sbjct  648   SMRGKIEFRGVSFAYPSRPTIPILQSLNLVIPASKTLALVGASGGGKSTIFALIERFYDP  707

Query  673   IQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKE  494
              QG + ++  DLR L +KWLR+Q  +VGQEP LFA TI EN+  G  NA+  E   A   
Sbjct  708   NQGFITVDGYDLRTLQVKWLRNQIGMVGQEPVLFATTILENVMMGKENATKNEAITACMA  767

Query  493   AYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesE  314
             A  H FISGLP+GY+T+VG  G QLSGGQKQRIA+ARA++K  K+LLLDEA+SALD ESE
Sbjct  768   ANAHNFISGLPQGYDTEVGDRGTQLSGGQKQRIALARAMIKDPKILLLDEATSALDPESE  827

Query  313   KHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYAT  134
               VQ A+ KIS   TTIV+AHRL+T++ A+ I V+  G+V E G+H +LM  E  G Y  
Sbjct  828   VMVQKAIDKISVGRTTIVIAHRLATVRNAHTIVVLDRGSVVEIGNHQQLM--EKAGAYFD  885

Query  133   LVRAEQE  113
             LV+   E
Sbjct  886   LVKLATE  892



>ref|XP_006466134.1| PREDICTED: ABC transporter B family member 19-like [Citrus sinensis]
Length=1560

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/535 (79%), Positives = 476/535 (89%), Gaps = 3/535 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+   + LSL LVGLGFGCI+ M GQQG CG AGTKLT R+R  LF+SILKQEPGWFDF+
Sbjct  1029  LRRDVRYLSLALVGLGFGCIIFMTGQQGFCGWAGTKLTMRVRELLFRSILKQEPGWFDFE  1088

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLSIDS+SFRSVLGDRFSVLLMGLSSAAVGLG+S  L WRLTL+AAALTPF
Sbjct  1089  ENSTGVLVSRLSIDSISFRSVLGDRFSVLLMGLSSAAVGLGVSLVLNWRLTLVAAALTPF  1148

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+NVGPK+DNSSYA+AS+IA+GAVSNIRTV TFS QE I+ SF+KALSEPK
Sbjct  1149  TLGASYLSLIINVGPKIDNSSYAKASSIASGAVSNIRTVTTFSAQEQIINSFDKALSEPK  1208

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQILG  LGFSQGAMY AYT TLWFGAYLVK+G+ + G VYKIFLILVLSSFSV
Sbjct  1209  KKSVKRSQILGLTLGFSQGAMYVAYTFTLWFGAYLVKQGHASFGVVYKIFLILVLSSFSV  1268

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AIPAVL+I  R+PLI +    KGRK E SKP  IE +MVTFAYPS
Sbjct  1269  GQLAGLAPDTSMAATAIPAVLDITKRKPLIDN---VKGRKLERSKPLGIELKMVTFAYPS  1325

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+V VL++F LK+KGG+MVALVG SGSGKST+IW+IQRFYDP QG+V++E VDLRE+N+
Sbjct  1326  RPEVTVLKDFCLKVKGGSMVALVGGSGSGKSTVIWLIQRFYDPNQGKVMIEGVDLREINV  1385

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALVGQEPALFAGTI +NIA G P AS+ EIEEAA+EAYIHKFIS LP+GYET+
Sbjct  1386  KWLRKQTALVGQEPALFAGTIRDNIALGNPKASWAEIEEAAEEAYIHKFISSLPQGYETQ  1445

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILK S+VLLLDEASSALDLESEKHVQDALRK+SK+ATTI
Sbjct  1446  VGESGVQLSGGQKQRIAIARAILKGSRVLLLDEASSALDLESEKHVQDALRKVSKRATTI  1505

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EAN+IAVV++GAV EYGSH+ L+AS LNG+YA+LVRAE EA AF+
Sbjct  1506  VVAHRLSTIREANMIAVVRDGAVVEYGSHETLLASHLNGVYASLVRAETEANAFS  1560


 Score =   263 bits (672),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 209/520 (40%), Positives = 303/520 (58%), Gaps = 44/520 (8%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+ G+FD  E ST  ++  +S D    + V+G++ +    
Sbjct  418   LVGERSAQRIRTKYLRAVLRQDIGFFD-TEVSTSDIMHGISSDIAQIQEVMGEKVAHFAH  476

Query  1429  GLSSAAVGLGISFSLEWRltllaaaltpftL--GASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++TP  +  G +Y ++ + +  K + +SY RA ++A
Sbjct  477   NIFTFICGYTVGFLRSWKVSLVVLSVTPLMMFCGMAYKAVYVGLTSK-EEASYRRAGSVA  535

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++H    +   L++        S   G+ LGF++GA         
Sbjct  536   EQAISSIRTVFSFVVEDHFAVRYAGLLAD--------SIPFGAKLGFAKGAGMGVIYLVT  587

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSM  947
             Y  + L  W+G+ LV     + GA    F         L L LS F+  Q A        
Sbjct  588   YATWALAFWYGSILVARKELSGGAAIACFFGVNVGGRGLALSLSYFA--QFA-------Q  638

Query  946   ASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFS  770
              + A   V EII+R P I  DP   +GRK  +S    IEF+ VTFAYPSRP+ ++LR+ +
Sbjct  639   GTVAATRVFEIIDRVPEI--DPYNSEGRKL-SSVSGKIEFKGVTFAYPSRPETVILRSLN  695

Query  769   LKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVG  590
             L I     +ALVGASG GKST+  +I+RFYDP +G + ++  DL+ L +KWLR+Q  +VG
Sbjct  696   LVIPSSKTLALVGASGGGKSTVFALIERFYDPTKGLITLDGHDLKSLQVKWLRTQIGMVG  755

Query  589   QEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsgg  410
             QEP LFA +I EN+  G  NA+  E   A K A  H FIS LP GY+T+VG  G QLSGG
Sbjct  756   QEPILFATSILENVLMGKENATMKEAVAACKAASAHSFISELPLGYDTQVGDRGTQLSGG  815

Query  409   qkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKE  230
             QKQRIA+ARA++K  ++LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHRL+T+K 
Sbjct  816   QKQRIALARAMIKDPRILLLDEPTSALDSESESIVQQAIDKISVGRTTIVIAHRLATVKN  875

Query  229   ANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             AN I V+ +G+V E G+H +L+  E  G Y  LV+   EA
Sbjct  876   ANTIVVLDQGSVVEIGNHRQLL--ERGGAYHDLVKLASEA  913



>ref|XP_006426752.1| hypothetical protein CICLE_v10027300mg [Citrus clementina]
 gb|ESR39992.1| hypothetical protein CICLE_v10027300mg [Citrus clementina]
Length=1541

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/535 (78%), Positives = 475/535 (89%), Gaps = 3/535 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+   + LSL LVGLGFGCI+ M GQQG CG AGTKLT R+R  LF+SILKQEPGWFDF+
Sbjct  1010  LRRDVRYLSLALVGLGFGCIIFMTGQQGFCGWAGTKLTMRVRELLFRSILKQEPGWFDFE  1069

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLSIDS+SFRSVLGDRFSVLLMGLSSAAVGLG+S  L WRLTL+AAALTPF
Sbjct  1070  ENSTGVLVSRLSIDSISFRSVLGDRFSVLLMGLSSAAVGLGVSLVLNWRLTLVAAALTPF  1129

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+NVGPK+DNSSYA+AS+IA+GAVSNIRTV TFS QE I+ SF+KALS+PK
Sbjct  1130  TLGASYLSLIINVGPKIDNSSYAKASSIASGAVSNIRTVTTFSAQEQIINSFDKALSKPK  1189

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQILG  LGFSQGAMY AYT TLWFGAYLVKEG+ + G VYKIFLILVLSSFSV
Sbjct  1190  KKSVKRSQILGLTLGFSQGAMYVAYTFTLWFGAYLVKEGHASFGVVYKIFLILVLSSFSV  1249

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AIPAVL+I  R+PLI +    KGRK E SKP  IE +MVTF YPS
Sbjct  1250  GQLAGLAPDTSMAATAIPAVLQITKRKPLIDN---VKGRKLERSKPLGIELKMVTFTYPS  1306

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+V VL++F LK+KGG+MVALVG SGSGKST+IW+IQRFYDP QG+V++E VDLRE+N+
Sbjct  1307  RPEVTVLKDFCLKVKGGSMVALVGGSGSGKSTVIWLIQRFYDPNQGKVMIEGVDLREINV  1366

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALVGQEPALFAGTI +NIA G P AS+ EIEEAA+EAYIHKFIS LP+GYET+
Sbjct  1367  KWLRKQTALVGQEPALFAGTIRDNIALGNPKASWAEIEEAAEEAYIHKFISSLPQGYETQ  1426

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILK S+VLLLDEASSALDLESEKHVQDALRK+SK+ATTI
Sbjct  1427  VGESGVQLSGGQKQRIAIARAILKGSRVLLLDEASSALDLESEKHVQDALRKVSKRATTI  1486

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EAN+IAVV++GAV EYGSH+ L+AS LNG+YA+LVRAE EA AF+
Sbjct  1487  VVAHRLSTIREANMIAVVRDGAVVEYGSHETLLASHLNGVYASLVRAETEANAFS  1541


 Score =   259 bits (662),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 207/520 (40%), Positives = 301/520 (58%), Gaps = 44/520 (8%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  +FD  E ST  ++  +S D    + V+G++ +    
Sbjct  399   LVGERSAQRIRTKYLRAVLRQDIAFFD-TEVSTSDIMHGISSDIAQIQEVMGEKVAHFAH  457

Query  1429  GLSSAAVGLGISFSLEWRltllaaaltpftL--GASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++TP  +  G +Y ++ + +  K + +SY RA ++A
Sbjct  458   NIFTFICGYTVGFLRSWKVSLVVLSVTPLMMFCGMAYKAVYVGLTSK-EEASYRRAGSVA  516

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++H    +   L++        S   G+ LGF++GA         
Sbjct  517   EQAISSIRTVFSFVAEDHFAVRYAGLLAD--------SIPFGAKLGFAKGAGMGVIYLVT  568

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSM  947
             Y  + L  W+G+ LV     + GA    F         L L LS F+  Q A        
Sbjct  569   YATWALAFWYGSILVARKELSGGAAIACFFGVNVGGRGLALSLSYFA--QFA-------Q  619

Query  946   ASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFS  770
              + A   V EII+R P I  DP   +GRK  +S    IEF+ VTFAYPSRP+ ++LR+ +
Sbjct  620   GTVAATRVFEIIDRVPEI--DPYNSEGRKL-SSVSGKIEFKGVTFAYPSRPETVILRSLN  676

Query  769   LKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVG  590
             L I     +ALVG SG GKST+  +I+RFYDP +G + ++  DL+ L +KWLR+Q  +VG
Sbjct  677   LVIPSSKTLALVGTSGGGKSTVFALIERFYDPTKGLITLDGHDLKSLQVKWLRTQIGMVG  736

Query  589   QEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsgg  410
             QEP LFA +I EN+  G  NA+  E   A K A  H FIS LP GY+T+VG  G QLSGG
Sbjct  737   QEPILFATSILENVLMGKENATMKEAVAACKAASAHSFISELPLGYDTQVGDRGTQLSGG  796

Query  409   qkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKE  230
             QKQRIA+ARA++K  ++LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHRL+T+K 
Sbjct  797   QKQRIALARAMIKDPRILLLDEPTSALDSESESIVQQAIDKISVGRTTIVIAHRLATVKN  856

Query  229   ANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             AN I V+ +G+V E G+H +L+  E  G Y  LV+   EA
Sbjct  857   ANTIVVLDQGSVVEIGNHRQLL--ERGGAYHDLVKLASEA  894



>ref|XP_010104606.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC01337.1| ABC transporter B family member 19 [Morus notabilis]
Length=2625

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/528 (78%), Positives = 475/528 (90%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L L+LVGLG GCI++M GQQGLCG AGTKLT R+R+ LF+SILKQEPGWFDF+ENSTGVL
Sbjct  2099  LCLVLVGLGIGCILSMTGQQGLCGWAGTKLTLRVRDLLFRSILKQEPGWFDFEENSTGVL  2158

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             VSRLSID VSFRSVLGDR SVLLMGLSSA VGLG+ F LEWRLTLLAAA+TPFTLGASY 
Sbjct  2159  VSRLSIDCVSFRSVLGDRLSVLLMGLSSAMVGLGVCFFLEWRLTLLAAAVTPFTLGASYL  2218

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +LI+N+GP+LDN++YA+ASNIA+GAVSNIRTV TFS QE +V+SF++ALSEPKR SV+RS
Sbjct  2219  NLIINIGPRLDNNAYAKASNIASGAVSNIRTVTTFSAQEQLVKSFDRALSEPKRKSVKRS  2278

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             QILG  LGFSQ AMYGAYTLTLWFGAYL+KE   + G VYKIFLILVLSSFSVGQLAGLA
Sbjct  2279  QILGLTLGFSQAAMYGAYTLTLWFGAYLMKENKASFGDVYKIFLILVLSSFSVGQLAGLA  2338

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDTSMA++AIPAV ++INR+PLIG+D Q KGRK E SK +DIE + VTFAYPSRP+VIVL
Sbjct  2339  PDTSMAASAIPAVFDVINRKPLIGND-QEKGRKIERSKAWDIELKKVTFAYPSRPEVIVL  2397

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+F LK+KGG+MVALVG SGSGKST+IW+IQRFYDP QG+V++  VDLRE+++KWLR QT
Sbjct  2398  RDFCLKVKGGSMVALVGGSGSGKSTVIWLIQRFYDPNQGKVMIGGVDLREIDVKWLRRQT  2457

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
             ALVGQEPALF+G+I ENIA G P +S+ EIE+AA+EAYIHKFISGLP+GYETKVG+SGVQ
Sbjct  2458  ALVGQEPALFSGSIRENIAIGNPTSSWAEIEDAAREAYIHKFISGLPQGYETKVGESGVQ  2517

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILKKS++LLLDEASSALDLESE+HVQ+AL+ +SK+ATTIVVAHRLS
Sbjct  2518  LSGGQKQRIAIARAILKKSRILLLDEASSALDLESERHVQEALKMVSKRATTIVVAHRLS  2577

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             TI+EA+ IAVV  G V+EYGSHD LMAS LNG+YA LVRAE EA AF+
Sbjct  2578  TIREADTIAVVSNGTVSEYGSHDTLMASHLNGVYARLVRAETEANAFS  2625


 Score =   246 bits (628),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 193/515 (37%), Positives = 294/515 (57%), Gaps = 34/515 (7%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+ G+FD  + STG ++  +S D    + V+G++ ++ + 
Sbjct  1482  LVGERSAQRIRTEYLRAVLRQDVGFFD-TQISTGDIMHGISSDVAQIQEVMGEKMALFIH  1540

Query  1429  GLSSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  +        G +Y ++ + +  K +   Y RA ++A
Sbjct  1541  NVFTFICGYIVGFIGSWKVSLVVFSVIPLMMFCGIAYKAVYVGLTAK-EEVLYRRAGSVA  1599

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++H+   + + L+        +S   G+ +GF++GA         
Sbjct  1600  EQAISSIRTVFSFVAEDHLAARYAELLA--------KSVPFGAKIGFAKGAGMGVIYLVT  1651

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLS----SFSVGQLAGLAPDTSMASAAI  932
             Y  + L  W+GA LV     + GA    F  + +     + S+   A  A  T  AS   
Sbjct  1652  YSTWALAFWYGAILVFRKEISGGAAIACFFGVNVGGRGLALSLSYFAQFAQGTVAASR--  1709

Query  931   PAVLEIINRRPLIGSDPQRK-GRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKG  755
               V E+I R P I  DP    GR     +   IEF+ V+F+YPSRP+  VL + +L I  
Sbjct  1710  --VFEVIERVPEI--DPYSPVGRALSNVRG-RIEFKSVSFSYPSRPEAQVLNSLNLVIPS  1764

Query  754   GTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPAL  575
                 ALVG+SG GKST+  +I+RFYDP +G + ++  DLR L +KWLR Q  +VGQEP L
Sbjct  1765  SKTTALVGSSGGGKSTIFALIERFYDPNKGTITLDGHDLRTLQVKWLRGQIGMVGQEPVL  1824

Query  574   FAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRI  395
             F  TI EN+  G  NA+  +   A   A  H FIS LP+G++T++G  G QLSGGQKQRI
Sbjct  1825  FGTTILENVMMGKENATKKDAIAACVAANAHSFISSLPQGFDTQLGDRGTQLSGGQKQRI  1884

Query  394   AIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIA  215
             A+ARA++K  K+LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHRL+T++ ++ IA
Sbjct  1885  ALARAMIKDPKILLLDEPTSALDPESESVVQQAIDKISSGRTTIVIAHRLATVRNSDTIA  1944

Query  214   VVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             V++ G++ E G+H +LM  E  G Y  L++   EA
Sbjct  1945  VLERGSIVEIGNHRQLM--EKYGAYYNLIKLASEA  1977



>gb|KDO45716.1| hypothetical protein CISIN_1g000406mg [Citrus sinensis]
Length=1560

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/535 (78%), Positives = 475/535 (89%), Gaps = 3/535 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+   + LSL LVGLGFGCI+ M GQQG CG AGTKLT R+R  LF+SILKQEPGWFDF+
Sbjct  1029  LRRDVRYLSLALVGLGFGCIIFMTGQQGFCGWAGTKLTMRVRELLFRSILKQEPGWFDFE  1088

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVSRLSIDS+SFRSVLGDRFSVLLMGLSSAAVGLG+S  L WRLTL+AAALTPF
Sbjct  1089  ENSTGVLVSRLSIDSISFRSVLGDRFSVLLMGLSSAAVGLGVSLVLNWRLTLVAAALTPF  1148

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+NVGPK+DNSSYA+AS+IA+GAVSNIRTV TFS QE I+ SF+KALSEPK
Sbjct  1149  TLGASYLSLIINVGPKIDNSSYAKASSIASGAVSNIRTVTTFSAQEQIINSFDKALSEPK  1208

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQILG  LGFSQGAMY AYT TLWFGAYLVK+G+ + G VYKIFLILVLSSFSV
Sbjct  1209  KKSVKRSQILGLTLGFSQGAMYVAYTFTLWFGAYLVKQGHASFGVVYKIFLILVLSSFSV  1268

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AIPAVL+I  R+PLI +    KGRK E SKP  IE +MVTF YPS
Sbjct  1269  GQLAGLAPDTSMAATAIPAVLQITKRKPLIDN---VKGRKLERSKPLGIELKMVTFTYPS  1325

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+V VL++F LK+KGG+MVALVG SGSGKST+IW+IQRFYDP QG+V++E VDLRE+N+
Sbjct  1326  RPEVTVLKDFCLKVKGGSMVALVGGSGSGKSTVIWLIQRFYDPNQGKVMIEGVDLREINV  1385

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALVGQEPALFAGTI +NIA G P AS+ EIEEAA+EAYIHKFIS LP+GYET+
Sbjct  1386  KWLRKQTALVGQEPALFAGTIRDNIALGNPKASWAEIEEAAEEAYIHKFISSLPQGYETQ  1445

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILK S+VLLLDEASSALDLESEKHVQDALRK+SK+ATTI
Sbjct  1446  VGESGVQLSGGQKQRIAIARAILKGSRVLLLDEASSALDLESEKHVQDALRKVSKRATTI  1505

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+EAN+IAVV++GAV EYGSH+ L+AS LNG+YA+LVRAE EA AF+
Sbjct  1506  VVAHRLSTIREANMIAVVRDGAVVEYGSHETLLASHLNGVYASLVRAETEANAFS  1560


 Score =   259 bits (661),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 207/520 (40%), Positives = 301/520 (58%), Gaps = 44/520 (8%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  +FD  E ST  ++  +S D    + V+G++ +    
Sbjct  418   LVGERSAQRIRTKYLRAVLRQDIAFFD-TEVSTSDIMHGISSDIAQIQEVMGEKVAHFAH  476

Query  1429  GLSSAAVGLGISFSLEWRltllaaaltpftL--GASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++TP  +  G +Y ++ + +  K + +SY RA ++A
Sbjct  477   NIFTFICGYTVGFLRSWKVSLVVLSVTPLMMFCGMAYKAVYVGLTSK-EEASYRRAGSVA  535

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++H    +   L++        S   G+ LGF++GA         
Sbjct  536   EQAISSIRTVFSFVAEDHFAVRYAGLLAD--------SIPFGAKLGFAKGAGMGVIYLVT  587

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSM  947
             Y  + L  W+G+ LV     + GA    F         L L LS F+  Q A        
Sbjct  588   YATWALAFWYGSILVARKELSGGAAIACFFGVNVGGRGLALSLSYFA--QFA-------Q  638

Query  946   ASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFS  770
              + A   V EII+R P I  DP   +GRK  +S    IEF+ VTFAYPSRP+ ++LR+ +
Sbjct  639   GTVAATRVFEIIDRVPEI--DPYNSEGRKL-SSVSGKIEFKGVTFAYPSRPETVILRSLN  695

Query  769   LKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVG  590
             L I     +ALVG SG GKST+  +I+RFYDP +G + ++  DL+ L +KWLR+Q  +VG
Sbjct  696   LVIPSSKTLALVGTSGGGKSTVFALIERFYDPTKGLITLDGHDLKSLQVKWLRTQIGMVG  755

Query  589   QEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsgg  410
             QEP LFA +I EN+  G  NA+  E   A K A  H FIS LP GY+T+VG  G QLSGG
Sbjct  756   QEPILFATSILENVLMGKENATMKEAVAACKAASAHSFISELPLGYDTQVGDRGTQLSGG  815

Query  409   qkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKE  230
             QKQRIA+ARA++K  ++LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHRL+T+K 
Sbjct  816   QKQRIALARAMIKDPRILLLDEPTSALDSESESIVQQAIDKISVGRTTIVIAHRLATVKN  875

Query  229   ANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             AN I V+ +G+V E G+H +L+  E  G Y  LV+   EA
Sbjct  876   ANTIVVLDQGSVVEIGNHRQLL--ERGGAYHDLVKLASEA  913



>ref|XP_006369112.1| hypothetical protein POPTR_0001s16560g [Populus trichocarpa]
 gb|ERP65681.1| hypothetical protein POPTR_0001s16560g [Populus trichocarpa]
Length=1547

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/535 (77%), Positives = 475/535 (89%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+     L LILVGLGFGCI++M GQQGLCG AGTKLT RIR+ LF+SILKQEPGWFDF+
Sbjct  1014  LKRDVGRLCLILVGLGFGCIISMTGQQGLCGWAGTKLTVRIRDLLFRSILKQEPGWFDFE  1073

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENS GVLVS+LSID +SFRSVLGDR SVLLMGLSSAAVGLG+SF L+WRL LLAAALTPF
Sbjct  1074  ENSVGVLVSKLSIDCISFRSVLGDRLSVLLMGLSSAAVGLGLSFYLQWRLALLAAALTPF  1133

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+NVGPKLDNSSYA+AS IAAGAVS+IRTVATFS Q+ IV+SF++AL+EPK
Sbjct  1134  TLGASYLSLIINVGPKLDNSSYAKASTIAAGAVSSIRTVATFSAQDQIVESFDRALAEPK  1193

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQ+LG  LGFSQGAMYGAYTLTLWFGAYLVK+G TNIG VYKIFLILVLSSFSV
Sbjct  1194  KKSVKRSQVLGLTLGFSQGAMYGAYTLTLWFGAYLVKQGETNIGVVYKIFLILVLSSFSV  1253

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AI A+ +II+R+PLI SD  R G+K + S   DIE +MVTFAYPS
Sbjct  1254  GQLAGLAPDTSMAAPAIAAIFDIIHRKPLIRSDRDR-GKKIDRSNLLDIELKMVTFAYPS  1312

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP++IVLR+F LK+KGG+ VALVG SGSGKST++W+IQRFYDP QG+V M  VDLR+ N+
Sbjct  1313  RPEIIVLRDFCLKVKGGSTVALVGGSGSGKSTVVWLIQRFYDPNQGKVTMGGVDLRDFNV  1372

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLRSQTALVGQEPALF+G+I ENIAFG PNAS  EIEEAA EAYIHKFI  LP+GYET+
Sbjct  1373  KWLRSQTALVGQEPALFSGSIRENIAFGNPNASRAEIEEAASEAYIHKFICSLPQGYETQ  1432

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILK+S+VLLLDEASSALDLESEK+VQ+ALRKISK+ATT+
Sbjct  1433  VGESGVQLSGGQKQRIAIARAILKRSRVLLLDEASSALDLESEKNVQEALRKISKRATTV  1492

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +VAHRLSTI+EA++IAVVK+GAV EYGSHD L+ S  NG+YA++VRAE E  AFA
Sbjct  1493  IVAHRLSTIREADMIAVVKDGAVVEYGSHDALLNSHRNGLYASMVRAETETNAFA  1547


 Score =   258 bits (660),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 204/547 (37%), Positives = 305/547 (56%), Gaps = 42/547 (8%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + + + L++ G+    +V    +     L G +   RIRN    ++L+Q+  ++D  + S
Sbjct  377   EVERICLLMTGVAALVVVGAYLEITCWRLVGERSAHRIRNLYLSAVLRQDITFYD-TKVS  435

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             T  ++  +S D    + V+G++ +  +  + +   G  + F   W+++L+  ++T     
Sbjct  436   TSDIMHGISSDVAQIQEVMGEKMAHFIHHIFTFICGYWVGFLRSWKVSLVVLSVTPLTMF  495

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G +Y ++ + +  K +  SY +A  +A  A+S+IRTV +F  ++ + + +   L     
Sbjct  496   CGIAYKAIYVGLATK-EEVSYRKAGGVAEQAISSIRTVFSFVAEDKLARKYADLL-----  549

Query  1159  TSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---  1013
                 +S  +G+ +GF++GA         Y  + L  W+G+ LV     + G     F   
Sbjct  550   ---MKSVPIGAKIGFAKGAGMGVIYLVTYSTWALAFWYGSILVARKEISGGDAIACFFGV  606

Query  1012  ------LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETS  851
                   L L LS F+  Q A         + A   V EII+R P I  DP     +  ++
Sbjct  607   NVGGRGLALSLSYFA--QFA-------QGTVAATRVYEIIDRIPDI--DPYSPHGRILST  655

Query  850   KPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPI  671
                 IE + VTFAYPSRP+ ++LR+ +L I     +ALVGASG GKST+  +I+RFYDPI
Sbjct  656   VGGRIEIKGVTFAYPSRPETVILRSLNLVIPSAKTLALVGASGGGKSTVFALIERFYDPI  715

Query  670   QGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEA  491
              G V ++  DLR L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   A
Sbjct  716   NGVVTLDGNDLRTLQVKWLRGQIGMVGQEPVLFATSILENVMMGKENATKKEAINACIAA  775

Query  490   YIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEK  311
               H FISGLP GY+T+VG  G QLSGGQKQRIA+ARA++K  ++LLLDE +SALD ESE 
Sbjct  776   NAHSFISGLPFGYDTQVGDRGTQLSGGQKQRIALARAMIKNPRILLLDEPTSALDQESES  835

Query  310   HVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATL  131
              VQ A+ KIS   TTIV+AHRL+T++ AN IAV+ +G+V E G H +LM  E  G Y  L
Sbjct  836   VVQQAIDKISTGRTTIVIAHRLATVRNANTIAVLDQGSVVEIGDHRQLM--ENAGAYYDL  893

Query  130   VRAEQEA  110
             V+   EA
Sbjct  894   VKLATEA  900



>ref|XP_011048586.1| PREDICTED: ABC transporter B family member 1-like [Populus euphratica]
Length=1547

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/535 (77%), Positives = 474/535 (89%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+    +L LILVGLGFGCI++M GQQGLCG AGTKLT RIR+ LF+SILKQEPGWFDF+
Sbjct  1014  LKRDVGSLCLILVGLGFGCIISMTGQQGLCGWAGTKLTVRIRDLLFRSILKQEPGWFDFE  1073

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENS GVLVS+LSID +SFRSVLGDR SVLLMGLSSAAVGLG+SF L+WRL LLAAALTPF
Sbjct  1074  ENSVGVLVSKLSIDCISFRSVLGDRLSVLLMGLSSAAVGLGLSFYLQWRLALLAAALTPF  1133

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+NVGPKLDNSSYA+AS IAAGAVS+IRTV TFS Q+ IV+SF++AL+EPK
Sbjct  1134  TLGASYLSLIINVGPKLDNSSYAKASTIAAGAVSSIRTVTTFSAQDQIVESFDRALAEPK  1193

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV+RSQ+LG  LGFSQG MYGAYTLTLWFGAYLVK+G TNIG VYKIFLILVLSSFSV
Sbjct  1194  KKSVKRSQVLGLTLGFSQGVMYGAYTLTLWFGAYLVKQGETNIGVVYKIFLILVLSSFSV  1253

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AI A+  II+R+PLI SD  R G+K + S   DIE +MVTFAYPS
Sbjct  1254  GQLAGLAPDTSMAAPAIAAIFYIIHRKPLICSDRDR-GKKIDRSNLLDIELKMVTFAYPS  1312

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP++IVLR+F LK+KGG+ VALVG SGSGKST++W++QRFYDP QG+V M  +DLR+ N+
Sbjct  1313  RPEIIVLRDFCLKVKGGSTVALVGGSGSGKSTVVWLVQRFYDPNQGKVTMGGLDLRDFNV  1372

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLRSQTALVGQEPALF+G+I ENIAFG PNAS  EIEEAA EAYIHKFI  LP+GYET+
Sbjct  1373  KWLRSQTALVGQEPALFSGSIRENIAFGNPNASRAEIEEAASEAYIHKFICSLPQGYETQ  1432

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILK+S+VLLLDEASSALDLESEK+VQ+ALRKISK+ATT+
Sbjct  1433  VGESGVQLSGGQKQRIAIARAILKRSRVLLLDEASSALDLESEKNVQEALRKISKRATTV  1492

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +VAHRLSTI+EA++IAVVK+GAV EYGSHD L+ S  NG+YA++VRAE E+ AFA
Sbjct  1493  IVAHRLSTIREADMIAVVKDGAVVEYGSHDALLNSHRNGLYASMVRAETESNAFA  1547


 Score =   263 bits (671),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 207/547 (38%), Positives = 306/547 (56%), Gaps = 42/547 (8%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + + + L++ G+    +V    +     L G +   RIRN    ++L+Q+  ++D  + S
Sbjct  377   EVERICLLMTGVAALVVVGAYLEITCWRLVGERSAHRIRNLYLSAVLRQDITFYD-TKVS  435

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             T  ++  +S D    + V+G++    +  + +   G  + F   W+++L+  ++T     
Sbjct  436   TSDIMHGISSDVAQIQEVMGEKMPHFIHHIFTFICGYCVGFLRSWKVSLVVLSVTPLTMF  495

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G +Y ++ + +  K +  SY +A  +A  A+S+IRTV +F  ++++ + +   L     
Sbjct  496   CGIAYKAIYVGLATK-EEVSYRKAGGVAEQAISSIRTVFSFVAEDNLARKYGDLL-----  549

Query  1159  TSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---  1013
                 +S  +G+ +GF++GA         Y  + L  W+G+ LV     + G     F   
Sbjct  550   ---MKSVPIGAKIGFAKGAGMGVIYLVTYSTWALAFWYGSILVARKEISGGDAIACFFGV  606

Query  1012  ------LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETS  851
                   L L LS F+  Q A         + A   V EII+R P I  DP     +  +S
Sbjct  607   NVGGRGLALSLSYFA--QFA-------QGTVAATRVYEIIDRIPDI--DPYSPHGRILSS  655

Query  850   KPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPI  671
                 IEF+ VTFAYPSRP+ ++LR+ +L I     +ALVGASG GKST+  +I+RFYDPI
Sbjct  656   VGGRIEFKGVTFAYPSRPETVILRSLNLVIPSAKTLALVGASGGGKSTVFALIERFYDPI  715

Query  670   QGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEA  491
              G V ++  DLR L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   A
Sbjct  716   NGVVTLDGNDLRTLQVKWLRGQIGMVGQEPVLFATSILENVKMGKENATKKEAINACIAA  775

Query  490   YIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEK  311
               H FISGLP GYET+VG  G QLSGGQKQRIA+ARA++K  ++LLLDE +SALD ESE 
Sbjct  776   NAHSFISGLPFGYETQVGDRGTQLSGGQKQRIALARAMIKNPRILLLDEPTSALDPESES  835

Query  310   HVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATL  131
              VQ A+ KIS   TTIV+AHRL+T++ AN IAV+ +G+V E G H +LM  E  G Y  L
Sbjct  836   VVQQAIDKISTGRTTIVIAHRLATVRNANTIAVLDQGSVVEIGDHRQLM--ENAGAYYAL  893

Query  130   VRAEQEA  110
             V+   EA
Sbjct  894   VKLASEA  900



>ref|XP_009336717.1| PREDICTED: ABC transporter B family member 19-like [Pyrus x bretschneideri]
Length=1207

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/529 (76%), Positives = 456/529 (86%), Gaps = 2/529 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L L LVGLG G I+ M GQQGLCG AGTKLT R+RN LF+SILKQEPGWFD +ENS  VL
Sbjct  679   LCLALVGLGLGNILLMTGQQGLCGWAGTKLTLRVRNLLFRSILKQEPGWFDSEENSKAVL  738

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             VSRLS+DSVSFRSV  DR SVLLMGLSSA VGLG+S  +   LTLLAAALTP TLGASY 
Sbjct  739   VSRLSVDSVSFRSVHIDRLSVLLMGLSSAIVGLGLSLWINRWLTLLAAALTPLTLGASYL  798

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             SLI+N+GPKLDN +YA+ASNIA+GAVSNIRTV TFS Q+ +V+SFE+ALS PKR SV+RS
Sbjct  799   SLIINLGPKLDNDAYAKASNIASGAVSNIRTVTTFSAQQQLVKSFERALSGPKRKSVKRS  858

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             QI+G  LGFSQG MYGAYTLTLWFG YLVKEG  + G VY+IFLILVLSSFSVGQLAGLA
Sbjct  859   QIMGLTLGFSQGVMYGAYTLTLWFGGYLVKEGKASFGDVYQIFLILVLSSFSVGQLAGLA  918

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDP--QRKGRKFETSKPFDIEFEMVTFAYPSRPDVI  788
             PDTSMAS AIPAV +II R+PLI S    + K RK + SKP DI+F+MVTFAYPSRPDV 
Sbjct  919   PDTSMASTAIPAVFDIITRKPLISSSSSSREKERKLDRSKPLDIQFKMVTFAYPSRPDVT  978

Query  787   VLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRS  608
             VL +F LK+KGG+ VAL G SGSGKST++W+IQRFYDPIQG+V+M  VDLRE+NLKWLR 
Sbjct  979   VLSDFCLKVKGGSTVALAGGSGSGKSTVVWLIQRFYDPIQGKVMMGGVDLREINLKWLRR  1038

Query  607   QTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
             Q ALVGQEP LFAGT+ ENIAFG PNAS++EIE+AA+EAYIH FIS LP+GYET+VG+SG
Sbjct  1039  QIALVGQEPTLFAGTMRENIAFGNPNASWSEIEDAAREAYIHNFISSLPQGYETQVGESG  1098

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
              QLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESE+H+Q+AL+KISK+ATTI+VAHR
Sbjct  1099  AQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESERHIQEALKKISKRATTIIVAHR  1158

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
             LSTI+EA++IAV+  GA+ EYGSHD LMAS LNG+YA+LVRAE EA AF
Sbjct  1159  LSTIREADMIAVMSNGAITEYGSHDALMASHLNGVYASLVRAETEANAF  1207


 Score =   252 bits (643),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 197/531 (37%), Positives = 295/531 (56%), Gaps = 26/531 (5%)
 Frame = -1

Query  1687  QNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTG  1508
             + ++L + GL    IV    +     + G +   RIR    +++L+Q+  +FD  E + G
Sbjct  49    ETIALYMAGLAAIVIVGAYMEITCWRMVGERSAQRIRREYLRAVLRQDISFFD-TEIAAG  107

Query  1507  VLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaal--tpftLG  1334
              ++  +S D    + V+G++ +  +  L +   G  + F   W+++L+  ++       G
Sbjct  108   DIMHGISSDVAQIQEVMGEKMAHFIHHLCTFICGYTVGFLRSWKISLVVLSVIPLMMFCG  167

Query  1333  ASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTS  1154
              +Y ++ + +  K +  SY +A N+A  A+S+IRTV +F  ++ + + +   L++     
Sbjct  168   IAYKAVYVGLTTK-EEVSYLKAGNVAEQAISSIRTVFSFVAEDLLAERYADLLNKLVPFG  226

Query  1153  VRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILV  1001
              R     G+ +G      Y  + L  W+G+ LV +G  + GA    F         L L 
Sbjct  227   ARIGFAKGAGVGIIYVVSYSTWALAFWYGSALVSKGEISGGAAIACFFGVNVGGRGLALS  286

Query  1000  LSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMV  821
             LS F+           S  + A   V EII+R P I  DP         S    IEF+ V
Sbjct  287   LSYFA---------QFSQGTVAAGRVFEIIDRVPEI--DPYSSVGSTLPSTQGRIEFKGV  335

Query  820   TFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVD  641
             +F+YPSR D  +LR+ +L I     VALVGASG GKST+  +I+RFYDP QG + ++  D
Sbjct  336   SFSYPSRMDAPILRSLNLVIPSRKSVALVGASGGGKSTIFALIERFYDPNQGTITLDGHD  395

Query  640   LRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLP  461
             LR L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   A  + FISGLP
Sbjct  396   LRTLQVKWLRDQIGMVGQEPVLFATSILENVLMGKENATKKEAISACIAANANSFISGLP  455

Query  460   EGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKIS  281
             +GY+T+VG  G  LSGGQKQRIA+ARA++K  ++LLLDE +SALD ESE  VQ A+ KIS
Sbjct  456   QGYDTQVGDRGALLSGGQKQRIALARAMIKDPRILLLDEPTSALDPESEAAVQKAIDKIS  515

Query  280   KQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
                T+IV+AHRLST++ ++ I V+  G+V E G+H +LM  E  G Y +LV
Sbjct  516   SGRTSIVIAHRLSTVRNSHTIVVLDSGSVVEIGNHRQLM--EKAGAYYSLV  564



>ref|XP_009378366.1| PREDICTED: ABC transporter B family member 19-like [Pyrus x bretschneideri]
Length=1204

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/534 (75%), Positives = 457/534 (86%), Gaps = 1/534 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + L L LVGLG G I+ M GQQGLCG AGTKLT R+RN LF+SILKQEPGWFD +
Sbjct  672   IKKKVEPLCLALVGLGIGNILFMTGQQGLCGWAGTKLTMRVRNLLFRSILKQEPGWFDCE  731

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +NS  VLVSRLSIDSVSFRSV  DR SVLLMGLSS  VGLG+ F L+  LTLLAAAL P 
Sbjct  732   KNSKAVLVSRLSIDSVSFRSVHVDRLSVLLMGLSSGIVGLGLCFWLDKWLTLLAAALAPL  791

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SLI+N+GPKLDN +YA+ASNIAAGAVSNIRTV TFS Q+ +V+SFE+ALS PK
Sbjct  792   TLGASYLSLIINLGPKLDNDAYAKASNIAAGAVSNIRTVTTFSAQQQLVKSFERALSGPK  851

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             R SV+RSQI+G  LGFS+GAMYGAYTLTLWFG YLVKEG  + G VYKIFLILVLSSFSV
Sbjct  852   RKSVKRSQIMGLTLGFSEGAMYGAYTLTLWFGGYLVKEGKASFGDVYKIFLILVLSSFSV  911

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AIPAV +II R+PLI S  + K RK + SKP+DI+F+MVTFAYPS
Sbjct  912   GQLAGLAPDTSMAATAIPAVFDIITRKPLI-SCSREKERKLDRSKPWDIQFKMVTFAYPS  970

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDV VL NF LK+K  + VALVG SGSGKST+IW+IQRFYDPIQG+V+M  VDLRE+N 
Sbjct  971   RPDVNVLSNFGLKVKCRSTVALVGGSGSGKSTVIWLIQRFYDPIQGKVMMGGVDLREINP  1030

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQEP LFAGTI ENIAFG P+AS  EIEEAA+EAYIH+FIS LP+GYET+
Sbjct  1031  KWLRRQIALVGQEPTLFAGTIRENIAFGNPSASRVEIEEAAREAYIHEFISSLPQGYETQ  1090

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SG QLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESE+H+QDAL+KISKQATTI
Sbjct  1091  VGESGAQLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESERHIQDALKKISKQATTI  1150

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
             +VAHRLSTI+EA++IAV+  GA+ EYGSH+ LMAS  NG+YA+LVRAE EA AF
Sbjct  1151  IVAHRLSTIREADMIAVMSNGAITEYGSHETLMASHFNGVYASLVRAETEANAF  1204


 Score =   247 bits (630),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 198/542 (37%), Positives = 300/542 (55%), Gaps = 48/542 (9%)
 Frame = -1

Query  1687  QNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTG  1508
             + + L + GL    +V    +     + G +   RIR    K++L+Q+  +FD  E + G
Sbjct  49    ETICLYMAGLASIVVVGAYMEITCWRMVGERSAQRIRREYLKAVLRQDISFFD-TEIAAG  107

Query  1507  VLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaal--tpftLG  1334
              ++  +S D    + V+G++ +  +  + +   G  + F   W+++L+  ++       G
Sbjct  108   DIMHGISSDVAQIQEVMGEKMAHFVHHICTFICGYTVGFLRSWKISLVVFSVIPLMMFCG  167

Query  1333  ASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE--PKR  1160
              +Y ++ + +  K +  SY +A ++A  A+S+IRTV +F  ++H+ + +   L++  P  
Sbjct  168   IAYKAVYVGLTTK-EEVSYRKAGSVAEQAISSIRTVLSFVAEDHLAEKYTDLLNKLVP--  224

Query  1159  TSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---  1013
                      G+ +GF++GA         Y  + L  W+G+ LV +G    GA    F   
Sbjct  225   --------FGARIGFAKGAGVGVIYLVSYSTWALAFWYGSVLVAKGEITGGAAIACFFGV  276

Query  1012  ------LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRK-GRKFET  854
                   L L LS F+  Q A         + A   V EII+R P I  DP    GR   +
Sbjct  277   NVGGRGLALSLSYFA--QFA-------QGTVAAGRVFEIIDRVPEI--DPYSSVGRTLPS  325

Query  853   SKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDP  674
             ++   IEF+ V+F+YPSR +  +L + +L I     +ALVGASG GKST+  +I+RFYDP
Sbjct  326   ARG-RIEFKDVSFSYPSRLNAPILHSLNLVIPSSKTLALVGASGGGKSTIFALIERFYDP  384

Query  673   IQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKE  494
              QG + ++  DLR L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   
Sbjct  385   NQGTITLDGYDLRTLQVKWLRDQIGMVGQEPVLFATSILENVLMGKENATKKEAISACIA  444

Query  493   AYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesE  314
             A  + FIS LP+GYET+VG  G  LSGGQKQRIA+ARA++K  ++LLLDE +SALD ESE
Sbjct  445   ANANSFISDLPQGYETQVGDKGTLLSGGQKQRIALARAMIKDPRILLLDEPTSALDPESE  504

Query  313   KHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYAT  134
               VQ A+ KIS   T IV+AHRLST++ ++ I V+  G V E G+H +LM  E  G Y +
Sbjct  505   AAVQKAIDKISSGRTAIVIAHRLSTVRNSHTIVVLDSGFVVEIGNHRQLM--EKAGAYYS  562

Query  133   LV  128
             LV
Sbjct  563   LV  564



>ref|XP_008380772.1| PREDICTED: ABC transporter B family member 2-like [Malus domestica]
Length=1152

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/528 (76%), Positives = 454/528 (86%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L L LVGLG G I+ M GQQGLCG AGTKLT R+RN LF+SILKQEPGWFD +ENS  VL
Sbjct  625   LCLALVGLGLGNILLMTGQQGLCGWAGTKLTLRVRNLLFRSILKQEPGWFDSEENSKSVL  684

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             VSRLS+DSVSFRSV  DR SVLLMGLSSA VGLG+S  +   LTLLAAALTP TLGASY 
Sbjct  685   VSRLSVDSVSFRSVHIDRLSVLLMGLSSAIVGLGLSLWINRWLTLLAAALTPLTLGASYL  744

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             SLI+N+GPKLDN +YA+ASNIA+GAVSNIRTV TFS Q+ +V+SFE+AL  PKR SV+RS
Sbjct  745   SLIINLGPKLDNDAYAKASNIASGAVSNIRTVTTFSAQQQLVKSFERALLGPKRKSVKRS  804

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             QI+G  LGFSQG MYGAYTLTLWFG YLVKEG  + G VY+IFLILVLSSFSVGQLAGLA
Sbjct  805   QIMGLTLGFSQGVMYGAYTLTLWFGGYLVKEGKASFGDVYQIFLILVLSSFSVGQLAGLA  864

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRK-FETSKPFDIEFEMVTFAYPSRPDVIV  785
             PDTSMAS AIPAV +II R+PLI S   R+  +  + SKP DI+F+MVTFAYPSRPDV V
Sbjct  865   PDTSMASIAIPAVFDIITRKPLISSSSSREKERKLDRSKPLDIQFKMVTFAYPSRPDVTV  924

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
             L +F LK+KGG+ VAL G SGSGKST+IW+IQRFYDPIQG+VLM  VDLRE+NLKWLR Q
Sbjct  925   LSDFCLKVKGGSTVALAGGSGSGKSTVIWLIQRFYDPIQGKVLMGGVDLREINLKWLRRQ  984

Query  604   TALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              ALVGQEP LFAGT+ ENIAFG PNAS++EIE+AA+EAYIH FIS LP+GYET+VG+SG 
Sbjct  985   IALVGQEPTLFAGTMRENIAFGNPNASWSEIEDAAREAYIHNFISSLPQGYETQVGESGT  1044

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESE+H+Q+AL+KISK+ATTI+VAHRL
Sbjct  1045  QLSGGQKQRIAIARAILKKSKVLLLDEASSALDLESERHIQEALKKISKRATTIIVAHRL  1104

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
             STI+EA++IAV+  GA+ EYGSHD LMAS LNG+YA+LVRAE EA AF
Sbjct  1105  STIREADMIAVMSNGAITEYGSHDALMASHLNGVYASLVRAETEANAF  1152


 Score =   250 bits (639),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 195/516 (38%), Positives = 293/516 (57%), Gaps = 48/516 (9%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   RIR    +++L+Q+  +FD  E + G ++  +S D    + V+G++ +  + 
Sbjct  21    MVGERSAQRIRREYLRAVLRQDISFFD-TEIAAGDIMHGISSDVAQIQEVMGEKMAHFIH  79

Query  1429  GLSSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++       G +Y ++ + +  K +  SY +A N+A
Sbjct  80    HICTFICGYTVGFLKSWKISLVVLSVIPLMMFCGIAYKAVYVGLATK-EEVSYRKAGNVA  138

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSE--PKRTSVRRSQILGSALGFSQGA-------  1103
               A+S+IRTV +F  ++ + + +   L++  P           G+ +GF++GA       
Sbjct  139   EQAISSIRTVFSFVAEDLLAERYADLLNKLVP----------FGARIGFAKGAGVGVIYL  188

Query  1102  -MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDT  953
               Y  + L  W+G+ LV +G  + GA    F         L L LS F+           
Sbjct  189   VSYSTWALAFWYGSILVSKGEISGGAAIACFFGVNVGGRGLALSLSYFA---------QF  239

Query  952   SMASAAIPAVLEIINRRPLIGSDPQRK-GRKFETSKPFDIEFEMVTFAYPSRPDVIVLRN  776
             S  + A   V EII+R P I  DP    GR   +++   IEF+ V+F+YPSR D  +L +
Sbjct  240   SQGTVAAGRVFEIIDRVPEI--DPYSSVGRTLPSTRG-RIEFKGVSFSYPSRMDAPILHS  296

Query  775   FSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTAL  596
              SL I     VALVGASG GKST+  +I+RFYDP QG + ++  DLR L +KWLR Q  +
Sbjct  297   LSLVIPSSKSVALVGASGGGKSTIFALIERFYDPNQGTITLDGHDLRMLQVKWLRDQIGM  356

Query  595   VGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqls  416
             VGQEP LFA +I EN+  G  NA+  E   A   A  + FISGLP+GY+T+VG  G  LS
Sbjct  357   VGQEPVLFATSILENVLMGKENATKKEAISACIAANANSFISGLPQGYDTQVGDRGTLLS  416

Query  415   ggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTI  236
             GGQKQRIA+ARA++K  ++LLLDE +SALD ESE  VQ A+ KIS   T+IV+AHRLST+
Sbjct  417   GGQKQRIALARAMIKDPRILLLDEPTSALDPESEAAVQKAIDKISSGRTSIVIAHRLSTV  476

Query  235   KEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             + ++ I V+  G+V E G+H +LM  E  G Y +LV
Sbjct  477   RNSHTIVVLDSGSVVEIGNHRQLM--EKAGAYYSLV  510



>gb|EYU21290.1| hypothetical protein MIMGU_mgv1a000189mg [Erythranthe guttata]
Length=1460

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/535 (74%), Positives = 464/535 (87%), Gaps = 3/535 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +  NL LILVGLGF CI +M GQQG CG +GTKLT R+R+ LFK+IL+QEPGWFD  
Sbjct  929   MKREVGNLCLILVGLGFACIFSMTGQQGFCGYSGTKLTKRVRDSLFKAILRQEPGWFDSS  988

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTGVLVS+LSID +SFR+VLGDRFSVLLMG SSAAVGLGI+F L+WRLTLLAAA+TP 
Sbjct  989   ENSTGVLVSKLSIDCISFRNVLGDRFSVLLMGASSAAVGLGIAFYLQWRLTLLAAAVTPL  1048

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +LI+N+GPKLDN+SYARAS IAA AVS+IRTVATF TQE IVQSF +AL EPK
Sbjct  1049  TLGASYLNLIINIGPKLDNASYARASTIAASAVSSIRTVATFGTQEQIVQSFNQALDEPK  1108

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             R SV++SQILG  LG SQGAMYGAYTLTL+FGAYLVK+ YTN G VYKIFLILVLSSFSV
Sbjct  1109  RASVKKSQILGLVLGLSQGAMYGAYTLTLYFGAYLVKKDYTNFGVVYKIFLILVLSSFSV  1168

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTS A++AIP++ +I++RRPLI +  ++K  K   +   +IEF+ VTFAYPS
Sbjct  1169  GQLAGLAPDTSSAASAIPSIFDILHRRPLIVNGNRKKVNKITKA---NIEFKRVTFAYPS  1225

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+V+VL NFSLKIK GT VALVG SGSGKST+IWM+QRFYDP+ GRVL+  VDLR+ +L
Sbjct  1226  RPEVVVLNNFSLKIKSGTTVALVGGSGSGKSTVIWMVQRFYDPVNGRVLIGGVDLRDFDL  1285

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR + ALVGQEP+LFAG+I ENIAFG  NAS++EIE AAKEAYIHKFIS LP+GYET+
Sbjct  1286  KWLRKEIALVGQEPSLFAGSIRENIAFGDGNASWSEIEAAAKEAYIHKFISSLPQGYETE  1345

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VGQSGVQLSGGQKQRIAIARAILKKSK+LLLDEASSALDLESEKH+Q A ++ SK+ATTI
Sbjct  1346  VGQSGVQLSGGQKQRIAIARAILKKSKILLLDEASSALDLESEKHIQSAFKRASKRATTI  1405

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             VVAHRLSTI+E++ IAV+K GAVAEYG HD L+++ L+GIYA L+RAE EA AFA
Sbjct  1406  VVAHRLSTIRESDFIAVMKNGAVAEYGDHDSLLSANLDGIYANLIRAETEAMAFA  1460


 Score =   256 bits (654),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 201/518 (39%), Positives = 289/518 (56%), Gaps = 42/518 (8%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   RIR    + +L+Q+ G+FD  E ST  ++  +S D    + ++ D+ +  + 
Sbjct  329   MVGERSAHRIRTEYLRGVLRQDIGFFD-TEISTSDIMHGISSDVAQIQEMMADKMAHFIH  387

Query  1429  GLSSAAVGLGISF--SLEWRltllaaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F  S +  L + A        G +Y ++   +  K +  SY  A  IA
Sbjct  388   HIFTFICGYIVGFLKSPKVSLAVFAVTPLTMFCGIAYKAIYGGLAAK-EEGSYRNAGGIA  446

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++ + + + + L         +S  LG+ LGF++GA         
Sbjct  447   EQAISSIRTVISFVAEDTLAEKYSENL--------EKSVPLGAKLGFAKGAGIGIIYLVT  498

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSM  947
             Y  + L  W+G+ LV +   + G     F         L L LS F+           S 
Sbjct  499   YSTWALAFWYGSILVSKNQLSGGDAIACFFGVNVGGRGLALALSYFA---------QFSQ  549

Query  946   ASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSL  767
             A+ A   V E+I+R P I  DP     +  TS    IEF+ V+FAYPSRP + +LR+ +L
Sbjct  550   ATVAASRVFEVIDRIPEI--DPYSPEGRIPTSMRGKIEFKSVSFAYPSRPTMQILRSLNL  607

Query  766   KIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQ  587
              I     +ALVG SG GKST+  +I+RFYDPIQG + ++  DLR L +KWLR+Q  +VGQ
Sbjct  608   VIPHSKSLALVGVSGGGKSTIFALIERFYDPIQGFITVDGYDLRTLQVKWLRNQIGMVGQ  667

Query  586   EPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggq  407
             EP LFA TI EN+  G  NA+  E   A   A  H FIS LP+GY+T+VG  G QLSGGQ
Sbjct  668   EPVLFATTILENVLIGKENATKKEAITACMAANAHSFISSLPQGYDTEVGDRGTQLSGGQ  727

Query  406   kQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEA  227
             KQR+A+ARA++K  K+LLLDEA+SALD ESE  VQ A+ KIS   TTI++AHRL+T++ A
Sbjct  728   KQRLALARAMIKDPKILLLDEATSALDAESEIIVQKAIDKISTGRTTIIIAHRLATVRNA  787

Query  226   NVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             + I V++ G+V E G+H  LM  E  G Y  LV+   E
Sbjct  788   HTIVVLEAGSVIETGNHQNLM--EKTGAYFDLVKMASE  823



>ref|XP_004155963.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1450

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/536 (73%), Positives = 464/536 (87%), Gaps = 2/536 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +  +L ++LVGLG GCI+ M GQQG CG AGTKLT R+R+ LF+SIL+QEPGWFDF 
Sbjct  916   MKAKVGHLCIVLVGLGIGCILFMTGQQGFCGWAGTKLTVRVRDLLFRSILRQEPGWFDFP  975

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG+L+SRLSID ++FRS LGDR SVLLMG+S+AAVGLG+SF LEWRLTLLAAALTPF
Sbjct  976   ENSTGILISRLSIDCINFRSFLGDRISVLLMGVSAAAVGLGLSFWLEWRLTLLAAALTPF  1035

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SL++N+GPKLD ++YA+ASNIA+GAVSNIRTV TFS QE +V++F ++LSEPK
Sbjct  1036  TLGASYISLVINIGPKLDENAYAKASNIASGAVSNIRTVTTFSAQEQLVKAFNRSLSEPK  1095

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV++SQILG   G SQG MYGAYTLTLWF + L+++G T+ G VYKIFLILVLSSFSV
Sbjct  1096  KKSVKKSQILGLTFGLSQGGMYGAYTLTLWFASRLIEQGKTSFGDVYKIFLILVLSSFSV  1155

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA  AIPAVL+IINRRPLIG D + K +K E  K F +EF+MVTFAYPS
Sbjct  1156  GQLAGLAPDTSMAETAIPAVLDIINRRPLIGDD-KGKSKKREQLKSFGVEFKMVTFAYPS  1214

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP++IVLR+F LK+KG + VALVG SGSGKST+IW+ QRFYDPI+G+VLM   DLRE+N+
Sbjct  1215  RPEMIVLRDFCLKVKGCSTVALVGESGSGKSTVIWLTQRFYDPIRGKVLMGGTDLREINV  1274

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALVGQEPALFAG+I +NIAF  PNAS+TEIEEAA++AYIHKFIS LP+GYET+
Sbjct  1275  KWLRRQTALVGQEPALFAGSIKDNIAFANPNASWTEIEEAARDAYIHKFISSLPQGYETQ  1334

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILKKS VLLLDEASSALDLESEKHVQ ALRK+SK+ATTI
Sbjct  1335  VGESGVQLSGGQKQRIAIARAILKKSSVLLLDEASSALDLESEKHVQAALRKVSKEATTI  1394

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMA-SELNGIYATLVRAEQEAYAFA  98
             +VAHRLSTI  A+ IAVV+ G+V E+GSHD LMA + L G+YA +V AE EA AF+
Sbjct  1395  IVAHRLSTIHHADTIAVVRNGSVIEHGSHDSLMAKAHLGGVYANMVHAESEATAFS  1450


 Score =   245 bits (625),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 198/545 (36%), Positives = 299/545 (55%), Gaps = 44/545 (8%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              + L + GL    +V    +     L G +   RIR    +++L+Q+  +FD  + STG 
Sbjct  289   TICLFMTGLAAIVVVGAYMEITCWRLVGDRSAQRIRTKYLRAVLRQDISFFD-TKISTGD  347

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGA  1331
             ++  +S D    + V+G++ +  +  + +   G  + F   W+++L+  ++T      G 
Sbjct  348   IMHGISSDVAQIQEVMGEKMAHFIHHIFTFICGYVVGFLRSWKVSLVVFSVTPLMMFCGI  407

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
             +Y ++ + +  K + +SY +A  +A  ++S+IRTV +F  ++++   + + L        
Sbjct  408   AYKAIYVGLTSK-EEASYRKAGGVAEQSISSIRTVFSFVAEDNLGAKYAELL--------  458

Query  1150  RRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF------  1013
               S   G  +GFS+G          Y  + L  W+GA LV       G     F      
Sbjct  459   ENSVPFGKRIGFSKGVGMGVIYLVTYSTWALAFWYGAILVARKEITGGDAIACFFGVNVG  518

Query  1012  ---LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGS-DPQRKGRKFETSKP  845
                L L LS F+  Q A         + A   V  II+R P I S  P   GR     + 
Sbjct  519   GRGLALSLSYFA--QFA-------QGTVAAGRVFTIIDRVPEIDSYSPM--GRTLRNVRG  567

Query  844   FDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQG  665
               IEF+ V+F+YPSRPD ++L + +L       +ALVG SG GKST+  +I+RFYDPIQG
Sbjct  568   -RIEFKGVSFSYPSRPDSLILNSLNLVFPSSKTLALVGPSGGGKSTIFALIERFYDPIQG  626

Query  664   RVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYI  485
              ++++  D+R L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   A  
Sbjct  627   TIILDGRDIRTLQIKWLRDQIGMVGQEPILFATSIIENVMMGKENATEKEAIAACIAANA  686

Query  484   HKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHV  305
               FISGLP+GY+T+VG  G  LSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE  V
Sbjct  687   DNFISGLPQGYDTQVGDRGALLSGGQKQRIALARAMIKDPKILLLDEPTSALDPESESTV  746

Query  304   QDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             Q A+ ++S   TTIV+AHRL+T++ A+ IAV++ G++ E G+H +LM  E  G Y  LV+
Sbjct  747   QKAIDQLSLGRTTIVIAHRLATVRNAHAIAVIERGSLVEIGTHRQLMERE--GAYNNLVK  804

Query  124   AEQEA  110
                EA
Sbjct  805   LASEA  809



>ref|XP_004141818.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1450

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/536 (73%), Positives = 464/536 (87%), Gaps = 2/536 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +  +L ++LVGLG GCI+ M GQQG CG AGTKLT R+R+ LF+SIL+QEPGWFDF 
Sbjct  916   MKAKVGHLCIVLVGLGIGCILFMTGQQGFCGWAGTKLTVRVRDLLFRSILRQEPGWFDFP  975

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG+L+SRLSID ++FRS LGDR SVLLMG+S+AAVGLG+SF LEWRLTLLAAALTPF
Sbjct  976   ENSTGILISRLSIDCINFRSFLGDRISVLLMGVSAAAVGLGLSFWLEWRLTLLAAALTPF  1035

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SL++N+GPKLD ++YA+ASNIA+GAVSNIRTV TFS QE +V++F ++LSEPK
Sbjct  1036  TLGASYISLVINIGPKLDENAYAKASNIASGAVSNIRTVTTFSAQEQLVKAFNRSLSEPK  1095

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV++SQILG   G SQG MYGAYTLTLWF + L+++G T+ G VYKIFLILVLSSFSV
Sbjct  1096  KKSVKKSQILGLTFGLSQGGMYGAYTLTLWFASRLIEQGKTSFGDVYKIFLILVLSSFSV  1155

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA  AIPAVL+IINRRPLIG D + K +K E  K F +EF+MVTFAYPS
Sbjct  1156  GQLAGLAPDTSMAETAIPAVLDIINRRPLIGDD-KGKSKKREQLKSFGVEFKMVTFAYPS  1214

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP++IVLR+F LK+KG + VALVG SGSGKST+IW+ QRFYDPI+G+VLM   DLRE+N+
Sbjct  1215  RPEMIVLRDFCLKVKGCSTVALVGESGSGKSTVIWLTQRFYDPIRGKVLMGGTDLREINV  1274

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALVGQEPALFAG+I +NIAF  PNAS+TEIEEAA++AYIHKFIS LP+GYET+
Sbjct  1275  KWLRRQTALVGQEPALFAGSIKDNIAFANPNASWTEIEEAARDAYIHKFISSLPQGYETQ  1334

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILKKS VLLLDEASSALDLESEKHVQ ALRK+SK+ATTI
Sbjct  1335  VGESGVQLSGGQKQRIAIARAILKKSSVLLLDEASSALDLESEKHVQAALRKVSKEATTI  1394

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMA-SELNGIYATLVRAEQEAYAFA  98
             +VAHRLSTI  A+ IAVV+ G+V E+GSHD LMA + L G+YA +V AE EA AF+
Sbjct  1395  IVAHRLSTIHHADTIAVVRNGSVIEHGSHDSLMAKAHLGGVYANMVHAESEATAFS  1450


 Score =   244 bits (624),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 198/545 (36%), Positives = 299/545 (55%), Gaps = 44/545 (8%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              + L + GL    +V    +     L G +   RIR    +++L+Q+  +FD  + STG 
Sbjct  289   TICLFMTGLAAIVVVGAYMEITCWRLVGDRSAQRIRTKYLRAVLRQDISFFD-TKISTGD  347

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGA  1331
             ++  +S D    + V+G++ +  +  + +   G  + F   W+++L+  ++T      G 
Sbjct  348   IMHGISSDVAQIQEVMGEKMAHFIHHIFTFICGYVVGFLRSWKVSLVVFSVTPLMMFCGI  407

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
             +Y ++ + +  K + +SY +A  +A  ++S+IRTV +F  ++++   + + L        
Sbjct  408   AYKAIYVGLTSK-EEASYRKAGGVAEQSISSIRTVFSFVAEDNLGAKYAELL--------  458

Query  1150  RRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF------  1013
               S   G  +GFS+G          Y  + L  W+GA LV       G     F      
Sbjct  459   ENSVPFGKRIGFSKGVGMGVIYLVTYSTWALAFWYGAILVARKEITGGDAIACFFGVNVG  518

Query  1012  ---LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGS-DPQRKGRKFETSKP  845
                L L LS F+  Q A         + A   V  II+R P I S  P   GR     + 
Sbjct  519   GRGLALSLSYFA--QFA-------QGTVAAGRVFTIIDRVPEIDSYSPM--GRTLRNVRG  567

Query  844   FDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQG  665
               IEF+ V+F+YPSRPD ++L + +L       +ALVG SG GKST+  +I+RFYDPIQG
Sbjct  568   -RIEFKGVSFSYPSRPDSLILNSLNLVFPSSKTLALVGPSGGGKSTIFALIERFYDPIQG  626

Query  664   RVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYI  485
              ++++  D+R L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   A  
Sbjct  627   TIILDGRDIRTLQIKWLRDQIGMVGQEPILFATSIIENVMMGKENATEKEAIAACIAANA  686

Query  484   HKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHV  305
               FISGLP+GY+T+VG  G  LSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE  V
Sbjct  687   DNFISGLPQGYDTQVGDRGALLSGGQKQRIALARAMIKDPKILLLDEPTSALDPESESTV  746

Query  304   QDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             Q A+ ++S   TTIV+AHRL+T++ A+ IAV++ G++ E G+H +LM  E  G Y  LV+
Sbjct  747   QKAIDQLSLGRTTIVIAHRLATVRNAHAIAVIERGSLVEIGTHRQLMERE--GAYNNLVK  804

Query  124   AEQEA  110
                EA
Sbjct  805   LASEA  809



>gb|KGN45464.1| hypothetical protein Csa_7G448750 [Cucumis sativus]
Length=1464

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/536 (73%), Positives = 464/536 (87%), Gaps = 2/536 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +  +L ++LVGLG GCI+ M GQQG CG AGTKLT R+R+ LF+SIL+QEPGWFDF 
Sbjct  930   MKAKVGHLCIVLVGLGIGCILFMTGQQGFCGWAGTKLTVRVRDLLFRSILRQEPGWFDFP  989

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG+L+SRLSID ++FRS LGDR SVLLMG+S+AAVGLG+SF LEWRLTLLAAALTPF
Sbjct  990   ENSTGILISRLSIDCINFRSFLGDRISVLLMGVSAAAVGLGLSFWLEWRLTLLAAALTPF  1049

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SL++N+GPKLD ++YA+ASNIA+GAVSNIRTV TFS QE +V++F ++LSEPK
Sbjct  1050  TLGASYISLVINIGPKLDENAYAKASNIASGAVSNIRTVTTFSAQEQLVKAFNRSLSEPK  1109

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + SV++SQILG   G SQG MYGAYTLTLWF + L+++G T+ G VYKIFLILVLSSFSV
Sbjct  1110  KKSVKKSQILGLTFGLSQGGMYGAYTLTLWFASRLIEQGKTSFGDVYKIFLILVLSSFSV  1169

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA  AIPAVL+IINRRPLIG D + K +K E  K F +EF+MVTFAYPS
Sbjct  1170  GQLAGLAPDTSMAETAIPAVLDIINRRPLIGDD-KGKSKKREQLKSFGVEFKMVTFAYPS  1228

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP++IVLR+F LK+KG + VALVG SGSGKST+IW+ QRFYDPI+G+VLM   DLRE+N+
Sbjct  1229  RPEMIVLRDFCLKVKGCSTVALVGESGSGKSTVIWLTQRFYDPIRGKVLMGGTDLREINV  1288

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALVGQEPALFAG+I +NIAF  PNAS+TEIEEAA++AYIHKFIS LP+GYET+
Sbjct  1289  KWLRRQTALVGQEPALFAGSIKDNIAFANPNASWTEIEEAARDAYIHKFISSLPQGYETQ  1348

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILKKS VLLLDEASSALDLESEKHVQ ALRK+SK+ATTI
Sbjct  1349  VGESGVQLSGGQKQRIAIARAILKKSSVLLLDEASSALDLESEKHVQAALRKVSKEATTI  1408

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMA-SELNGIYATLVRAEQEAYAFA  98
             +VAHRLSTI  A+ IAVV+ G+V E+GSHD LMA + L G+YA +V AE EA AF+
Sbjct  1409  IVAHRLSTIHHADTIAVVRNGSVIEHGSHDSLMAKAHLGGVYANMVHAESEATAFS  1464


 Score =   244 bits (622),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 194/520 (37%), Positives = 291/520 (56%), Gaps = 44/520 (8%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    +++L+Q+  +FD  + STG ++  +S D    + V+G++ +  + 
Sbjct  328   LVGDRSAQRIRTKYLRAVLRQDISFFD-TKISTGDIMHGISSDVAQIQEVMGEKMAHFIH  386

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++T      G +Y ++ + +  K + +SY +A  +A
Sbjct  387   HIFTFICGYVVGFLRSWKVSLVVFSVTPLMMFCGIAYKAIYVGLTSK-EEASYRKAGGVA  445

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               ++S+IRTV +F  ++++   + + L          S   G  +GFS+G          
Sbjct  446   EQSISSIRTVFSFVAEDNLGAKYAELL--------ENSVPFGKRIGFSKGVGMGVIYLVT  497

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSM  947
             Y  + L  W+GA LV       G     F         L L LS F+  Q A        
Sbjct  498   YSTWALAFWYGAILVARKEITGGDAIACFFGVNVGGRGLALSLSYFA--QFA-------Q  548

Query  946   ASAAIPAVLEIINRRPLIGS-DPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFS  770
              + A   V  II+R P I S  P   GR     +   IEF+ V+F+YPSRPD ++L + +
Sbjct  549   GTVAAGRVFTIIDRVPEIDSYSPM--GRTLRNVRG-RIEFKGVSFSYPSRPDSLILNSLN  605

Query  769   LKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVG  590
             L       +ALVG SG GKST+  +I+RFYDPIQG ++++  D+R L +KWLR Q  +VG
Sbjct  606   LVFPSSKTLALVGPSGGGKSTIFALIERFYDPIQGTIILDGRDIRTLQIKWLRDQIGMVG  665

Query  589   QEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsgg  410
             QEP LFA +I EN+  G  NA+  E   A   A    FISGLP+GY+T+VG  G  LSGG
Sbjct  666   QEPILFATSIIENVMMGKENATEKEAIAACIAANADNFISGLPQGYDTQVGDRGALLSGG  725

Query  409   qkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKE  230
             QKQRIA+ARA++K  K+LLLDE +SALD ESE  VQ A+ ++S   TTIV+AHRL+T++ 
Sbjct  726   QKQRIALARAMIKDPKILLLDEPTSALDPESESTVQKAIDQLSLGRTTIVIAHRLATVRN  785

Query  229   ANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             A+ IAV++ G++ E G+H +LM  E  G Y  LV+   EA
Sbjct  786   AHAIAVIERGSLVEIGTHRQLM--EREGAYNNLVKLASEA  823



>ref|XP_004510541.1| PREDICTED: ABC transporter B family member 19-like [Cicer arietinum]
Length=1500

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/528 (75%), Positives = 465/528 (88%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L L+LVGLGFGCI++M GQQGLCG AG+KLT R+RN LF+SIL+QEPGWFDFDENSTGVL
Sbjct  974   LCLVLVGLGFGCILSMTGQQGLCGWAGSKLTLRVRNLLFQSILRQEPGWFDFDENSTGVL  1033

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLG+SF   W+LTL+AAA+TP TLGASY 
Sbjct  1034  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGVSFVFNWKLTLVAAAVTPLTLGASYI  1093

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +LI+N+GPK+DN+SYA+ASNIA+GAVSNIRTVATFS QE IV SF++ALSEP++ S++ S
Sbjct  1094  NLIINIGPKVDNNSYAKASNIASGAVSNIRTVATFSAQEQIVNSFDRALSEPRKKSLKSS  1153

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             Q+ G   GF QGAMY AYTLTLWFGAYLVK    +   VYKIFLILVLSSFSVGQLAGLA
Sbjct  1154  QLQGLVFGFFQGAMYAAYTLTLWFGAYLVKLNKGDFEDVYKIFLILVLSSFSVGQLAGLA  1213

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDTSMA+ AIP+V ++INR+PLIG+D  RK RK + SKPF IEF+MVTFAYPSRP+V VL
Sbjct  1214  PDTSMAATAIPSVQDVINRKPLIGND-GRKSRKVDRSKPFKIEFKMVTFAYPSRPEVTVL  1272

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+F LK+KGG+ VALVG SGSGKST++W+ QRFYDP QG V+M  VDLRE+++KWLR Q 
Sbjct  1273  RDFCLKVKGGSTVALVGPSGSGKSTVVWLTQRFYDPDQGNVMMGGVDLREIDVKWLRRQI  1332

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
              LVGQEPALFAG+I ENIAFG  +AS+ EIE AAKEAYIHKFISGLP+GYET+VG+SGVQ
Sbjct  1333  GLVGQEPALFAGSIRENIAFGDQSASWAEIEAAAKEAYIHKFISGLPQGYETQVGESGVQ  1392

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKH+Q+AL+ +SK+ATTI+VAHRLS
Sbjct  1393  LSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHIQEALKNVSKEATTIIVAHRLS  1452

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             TI++A+ IAV++ G V EYGSHD L++S  NG+YA+LVRAE EA AF+
Sbjct  1453  TIRDADKIAVMRNGEVVEYGSHDTLISSIQNGLYASLVRAETEANAFS  1500


 Score =   251 bits (642),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 196/520 (38%), Positives = 295/520 (57%), Gaps = 44/520 (8%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +   RIR    ++IL+Q+  +FD + N TG ++  ++ D    + V+G++ +  + 
Sbjct  354   LVGERSAQRIRTEYLRAILRQDISFFDTEIN-TGDIMHGIASDVAQIQEVMGEKMAHFIH  412

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W+++L+  ++T      G +Y +L   +  K + +SY +A +IA
Sbjct  413   HVFTFICGYAVGFRRSWKVSLVVFSVTPLTMFCGMAYKALYGGLTAK-EEASYRKAGSIA  471

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  +  + + + + L        ++S  +G+ +GF++GA         
Sbjct  472   EQAISSIRTVFSFVAESQLGEKYSEQL--------QKSAPIGAKIGFAKGAGMGVIYLVT  523

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSM  947
             Y  + L  W+G+ L+ +G  + G+    F         L L LS F+  Q A        
Sbjct  524   YSTWALAFWYGSILIAKGELDGGSAIACFFGVNVGGRGLALALSYFA--QFA-------Q  574

Query  946   ASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFS  770
              + A   V  II R P I  DP   +G K  + +   IE + V+FAYPSRPD ++L + +
Sbjct  575   GTVAASRVFFIIERVPEI--DPYNPEGGKLSSVRG-RIELKNVSFAYPSRPDSLILNSIN  631

Query  769   LKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVG  590
             L       +ALVGASG GKST+  +I+RFYDPI+G + ++  DLR L +KWLR Q  +VG
Sbjct  632   LVFPSSKTLALVGASGGGKSTIFALIERFYDPIEGIITLDGHDLRTLQVKWLRDQIGMVG  691

Query  589   QEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsgg  410
             QEP LFA +I EN+  G  NA+  E   A   A  H FIS LP  Y+T+ G  G +LSGG
Sbjct  692   QEPILFATSILENVMMGKDNATKEEAISACIAADAHNFISNLPLRYDTQAGDRGTKLSGG  751

Query  409   qkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKE  230
             QKQRIA+ARA++K  K+LLLDE +SALD ESE  VQ A+ KIS   TTIV+AHR++T+K 
Sbjct  752   QKQRIALARAMIKNPKILLLDEPTSALDAESESAVQRAIDKISAGRTTIVIAHRIATVKN  811

Query  229   ANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             A+ I V++ G+V E G H +LMA    G Y  LV+   E+
Sbjct  812   ADAIVVLEHGSVTEIGDHRQLMAKA--GTYYNLVKLATES  849



>ref|XP_008342433.1| PREDICTED: ABC transporter B family member 11-like [Malus domestica]
Length=1077

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/534 (74%), Positives = 452/534 (85%), Gaps = 1/534 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + L L LVGLG G I+ M GQQGLCG AGTKLT R+RN LF+SILKQEPGWFD +
Sbjct  545   IKKKVEPLCLALVGLGIGNILFMTGQQGLCGWAGTKLTMRVRNLLFRSILKQEPGWFDSE  604

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +NS  VLVS LSIDSVSFRSV  DR SVLLMGLSS  VGL + F L+  LTLLAAAL P 
Sbjct  605   KNSKAVLVSMLSIDSVSFRSVHVDRLSVLLMGLSSGIVGLCLCFWLDKWLTLLAAALAPL  664

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASYFSLI+N+GPKLDN +YA+ASNIAAGAVSNIRTV TFS Q+ +V SFE+AL  PK
Sbjct  665   TLGASYFSLIINLGPKLDNDAYAKASNIAAGAVSNIRTVTTFSAQQQLVXSFERALLGPK  724

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             R SV+RSQI+G  LGFS+GA+YGAYTLTLWFG YLVKEG  + G VYKIFLILVLSSFSV
Sbjct  725   RKSVKRSQIMGLTLGFSEGALYGAYTLTLWFGGYLVKEGKASFGNVYKIFLILVLSSFSV  784

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA+ AIPAV +II R+PLI S  + K  K + SKP DI+F+MVTFAYPS
Sbjct  785   GQLAGLAPDTSMAATAIPAVFDIITRKPLISSS-REKEMKLDRSKPLDIQFKMVTFAYPS  843

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDV VL NF LK+KGG+ VALVG SGSGKST+IW+IQRFYDPIQG+V+M  VDLRE+NL
Sbjct  844   RPDVNVLSNFCLKVKGGSTVALVGGSGSGKSTVIWLIQRFYDPIQGKVMMGGVDLREINL  903

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR Q ALVGQE  LFAGTI ENIAFG P+AS  EIEEAA+EAYIH+FIS LP+GYET+
Sbjct  904   KWLRGQIALVGQELTLFAGTIRENIAFGNPSASRGEIEEAAREAYIHEFISSLPQGYETQ  963

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SG Q+SGGQKQRIAIARAILKKSKVLLLDEASSALDLESE+H+Q ALRKISK+ATTI
Sbjct  964   VGESGAQISGGQKQRIAIARAILKKSKVLLLDEASSALDLESERHIQYALRKISKRATTI  1023

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
             +VAHRL TI+EA++IAV+  GA+ EYGSH+ LMAS LNG+YA+LVRAE E  AF
Sbjct  1024  IVAHRLLTIREADMIAVMSNGAITEYGSHETLMASHLNGVYASLVRAETEVNAF  1077


 Score =   225 bits (573),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 234/396 (59%), Gaps = 26/396 (7%)
 Frame = -1

Query  1282  SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE--PKRTSVRRSQILGSALGFSQ  1109
             SY +  ++A  A+S+IRTV +F  ++H+ + +   L++  P           G+ +GF++
Sbjct  57    SYRKTGSVAEQAISSIRTVFSFVAEDHLAEKYADLLNKLVP----------FGATIGFAK  106

Query  1108  GA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDT  953
             GA         Y  + L  W+GA LV +G    GA    F  + +   ++          
Sbjct  107   GAGVGVIYLVSYSTWALAFWYGAVLVAKGEITGGAAIACFFGVNVGGRALALSLSYFAQF  166

Query  952   SMASAAIPAVLEIINRRPLIGSDPQRK-GRKFETSKPFDIEFEMVTFAYPSRPDVIVLRN  776
             +  + A   V EII+R P I  DP    GR   +++   IEF+ V+F+YPSR +  +L +
Sbjct  167   AQGTVAAGRVFEIIDRVPEI--DPYSSVGRTLPSARG-RIEFKDVSFSYPSRLNAPILYS  223

Query  775   FSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTAL  596
              +L I     +ALVGASG GKST+  +I+RFYDP QG + ++  DLR L +KWLR Q  +
Sbjct  224   LNLVIPSSKTLALVGASGGGKSTIFALIERFYDPNQGTITLDGYDLRTLQVKWLRDQIGM  283

Query  595   VGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqls  416
             VGQEP LFA +I EN+  G  NA+  E   A   A  + FIS LP+GY+T+VG  G  LS
Sbjct  284   VGQEPVLFATSILENVLMGKENATKKEAISACIAANANSFISDLPQGYDTQVGDKGTLLS  343

Query  415   ggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTI  236
             GGQKQRIA+ARA++K  ++LLLDE +SALD ESE  VQ A+ KIS   T IV+AHRLST+
Sbjct  344   GGQKQRIALARAMIKDPRILLLDEPTSALDXESEAAVQKAIDKISXGRTAIVIAHRLSTV  403

Query  235   KEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             + ++ I V+  G+V E G+H +LM  E  G Y +LV
Sbjct  404   RNSHTIVVLDSGSVVEIGNHRQLM--EKAGAYYSLV  437



>ref|XP_008462268.1| PREDICTED: ABC transporter B family member 19-like [Cucumis melo]
Length=1451

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/536 (72%), Positives = 463/536 (86%), Gaps = 2/536 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +  +L ++LVGLG GCI+ M GQQG CG AGTKLT R+R+ LF+SILKQEPGWFDF 
Sbjct  917   MKTKVGHLCIVLVGLGIGCILFMTGQQGFCGWAGTKLTVRVRDLLFRSILKQEPGWFDFP  976

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG+L+SRLSID ++FRS LGDR SVLLMG+S+AAVGLG+SF LEWRLTLLAAALTPF
Sbjct  977   ENSTGILISRLSIDCINFRSFLGDRISVLLMGVSAAAVGLGLSFWLEWRLTLLAAALTPF  1036

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY SL++N+GPKLD ++YA+ASNIA+GAVSNIRTV TFS QE +V++F ++LSEPK
Sbjct  1037  TLGASYISLVINIGPKLDENAYAKASNIASGAVSNIRTVTTFSAQEQLVKAFNRSLSEPK  1096

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + S+++SQ LG   G SQG MYGAYTLTLWF A L+++G T+ G VYKIFLILVLSSFSV
Sbjct  1097  KKSIKKSQFLGLTFGLSQGGMYGAYTLTLWFAARLIEQGKTSFGDVYKIFLILVLSSFSV  1156

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTSMA  AIPAVL+IINRRPLIG D     +K +  K F +EF+MVTFAYPS
Sbjct  1157  GQLAGLAPDTSMAETAIPAVLDIINRRPLIGDDKGESKKKAQL-KSFGVEFKMVTFAYPS  1215

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP++IVLR+F LK+KG + +ALVG SGSGKST+IW+ QRFYDPI+G+VLM  VDLRE+N+
Sbjct  1216  RPEMIVLRDFCLKVKGCSTMALVGESGSGKSTVIWLTQRFYDPIRGKVLMGGVDLREINV  1275

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR QTALVGQEPALFAG+I +NIAF  PNAS+TEIEEAA++AYIHKFIS LP+GYET+
Sbjct  1276  KWLRRQTALVGQEPALFAGSIRDNIAFANPNASWTEIEEAARDAYIHKFISSLPQGYETQ  1335

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILK S VLLLDEASSALDLESEKHVQ ALRK+SK+ATTI
Sbjct  1336  VGESGVQLSGGQKQRIAIARAILKNSSVLLLDEASSALDLESEKHVQAALRKVSKEATTI  1395

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMA-SELNGIYATLVRAEQEAYAFA  98
             +VAHRLSTI++A+ IAVV+ G+V E+GSHD LMA + L G+YA ++ AE EA AF+
Sbjct  1396  IVAHRLSTIRDADTIAVVRNGSVIEHGSHDSLMAKAHLGGVYANMIHAESEATAFS  1451


 Score =   244 bits (623),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 198/545 (36%), Positives = 299/545 (55%), Gaps = 44/545 (8%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              + L + GL    +V    +     L G +   RIR    +++L+Q+  +FD  + STG 
Sbjct  290   TICLFMTGLAAIVVVGAYMEITCWRLVGDRSAQRIRTKYLRAVLRQDISFFD-TKISTGD  348

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGA  1331
             ++  +S D    + V+G++ +  +  + +   G  + F   W+++L+  ++T      G 
Sbjct  349   IMHGISSDVAQIQEVMGEKMAHFIHHIFTFICGYVVGFLRSWKVSLVVFSVTPLMMFCGI  408

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
             +Y ++ + +  K + +SY +A  +A  A+S+IRTV +F  ++++   + + L        
Sbjct  409   AYKAIYVGLTSK-EEASYRKAGGVAEQAISSIRTVFSFVAEDNLGAKYAELL--------  459

Query  1150  RRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF------  1013
               S   G  +GFS+G          Y  + L  W+GA LV       G     F      
Sbjct  460   ENSVPFGKRIGFSKGVGMGVIYLVTYSTWALAFWYGAILVARKEITGGDAIACFFGVNVG  519

Query  1012  ---LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGS-DPQRKGRKFETSKP  845
                L L LS F+  Q A         + A   V  II+R P I S  P   GR     + 
Sbjct  520   GRGLALSLSYFA--QFA-------QGTVAAGRVFTIIDRVPEIDSYSPM--GRTLRNVRG  568

Query  844   FDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQG  665
               IEF+ V+F+YPSRPD ++L + +L        ALVGASG GKST+  +I+RFYDPIQG
Sbjct  569   -RIEFKGVSFSYPSRPDSLILNSLNLVFPSSKTFALVGASGGGKSTIFALIERFYDPIQG  627

Query  664   RVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYI  485
              ++++  D+R L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   A  
Sbjct  628   TIILDGRDIRTLQIKWLRDQIGMVGQEPILFATSIIENVMMGKENATEKEAIAACIAANA  687

Query  484   HKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHV  305
               FISGLP+GY+T+VG  G  LSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE  V
Sbjct  688   DHFISGLPQGYDTQVGDRGALLSGGQKQRIALARAMIKDPKILLLDEPTSALDPESESTV  747

Query  304   QDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             Q A+ ++S   TTI++AHRL+T++ ++ IAV++ G++ E G+H +LM  E  G Y  LV+
Sbjct  748   QKAIDQLSLGRTTIIIAHRLATVRNSHAIAVIEGGSLVEIGTHRQLM--EREGAYNNLVK  805

Query  124   AEQEA  110
                EA
Sbjct  806   LASEA  810



>ref|XP_003627370.1| ABC transporter B family member [Medicago truncatula]
 gb|AET01846.1| ABC transporter B family-like protein [Medicago truncatula]
Length=1488

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/528 (75%), Positives = 464/528 (88%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L L+LVGLGFGCI++M GQQGLCG AG+KLT R+RN LF+SIL+QEPGWFDFDENSTGVL
Sbjct  962   LCLVLVGLGFGCILSMTGQQGLCGWAGSKLTLRVRNLLFQSILRQEPGWFDFDENSTGVL  1021

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             VS+LSID+VSFRSVLGDRFSVLLMGLSSAAVGLG+SF   W LTL+AAA+TP TLGASY 
Sbjct  1022  VSKLSIDAVSFRSVLGDRFSVLLMGLSSAAVGLGVSFVFNWELTLVAAAVTPLTLGASYI  1081

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +LI+N+GPK++N+SYARASNIA+GAVSNIRTVATFS QE IV +F+KALSEP++ S++ S
Sbjct  1082  NLIINIGPKINNNSYARASNIASGAVSNIRTVATFSAQEQIVNAFDKALSEPRKKSLKSS  1141

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             Q+ G   G  QGAMY AYTLTLWFGAYLVK    +   VYKIFLILVLSSFSVGQLAGLA
Sbjct  1142  QLQGLVFGLFQGAMYAAYTLTLWFGAYLVKNNRGDFDDVYKIFLILVLSSFSVGQLAGLA  1201

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDTSMA+++IPAV ++INR+PLIG+D  RK +K + SK F IEF+MVTFAYPSRP+V VL
Sbjct  1202  PDTSMAASSIPAVQDVINRKPLIGND-GRKTKKVDRSKAFKIEFKMVTFAYPSRPEVTVL  1260

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             RNF LK++GG+ VALVG SGSGKST++W+ QRFYDP QG+V+M  VDLRE+++KWLR Q 
Sbjct  1261  RNFCLKVQGGSTVALVGPSGSGKSTVVWLTQRFYDPDQGKVMMSGVDLREIDVKWLRRQI  1320

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
             ALVGQEPALFAG+I ENIAFG  +AS+ EIE AA EAYIHKFISGLP+GYET+VG+SGVQ
Sbjct  1321  ALVGQEPALFAGSIRENIAFGDQSASWAEIEAAAMEAYIHKFISGLPQGYETQVGESGVQ  1380

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKH+Q+AL+ +SK+ATTI+VAHRLS
Sbjct  1381  LSGGQKQRIAIARAILKKSKVLLLDEASSALDLESEKHIQEALKNVSKEATTIIVAHRLS  1440

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             TI+EA+ IAV++ G V EYGSHD L++S  NG+YA+LVRAE EA AF+
Sbjct  1441  TIREADKIAVMRNGEVVEYGSHDTLISSIQNGLYASLVRAETEANAFS  1488


 Score =   254 bits (648),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 201/548 (37%), Positives = 304/548 (55%), Gaps = 44/548 (8%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
               + + + + GL    +V    +     L G +   RIR    ++IL+Q+  +FD D N 
Sbjct  315   DVEQICIFMTGLAAVVVVGAYMEITCWRLVGERSAQRIRTEYLRAILRQDISFFDTDIN-  373

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG ++  ++ D    + V+G++ +  +  + +   G  + F   W+++L+  ++T     
Sbjct  374   TGDIMHGIASDVAQIQEVMGEKMAHFIHHVFTFICGYAVGFRRSWKVSLVVFSVTPLTMF  433

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G +Y +L   +  K + +SY +A +IA  A+S+IRTV +F  +  + + + + L     
Sbjct  434   CGMAYKALYGGLTAK-EEASYRKAGSIAEQAISSIRTVFSFVAESQLGEKYSELL-----  487

Query  1159  TSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF---  1013
                ++S  +G+ +GF++GA         Y  + L  W+G+ L+  G  + G+    F   
Sbjct  488   ---QKSAPIGAKIGFAKGAGMGVIYLVTYSTWALAFWYGSILIARGELDGGSAIACFFGV  544

Query  1012  ------LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFET  854
                   L L LS F+  Q A         + A   V  II R P I  DP   +GRK  +
Sbjct  545   NVGGRGLALALSYFA--QFA-------QGTVAASRVFYIIERIPEI--DPYNPEGRKLSS  593

Query  853   SKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDP  674
              +   IE + V FAYPSRPD ++L + +L       +ALVGASG GKST+  +I+RFYDP
Sbjct  594   VRG-RIELKNVIFAYPSRPDSLILNSINLVFPSSKTLALVGASGGGKSTIFALIERFYDP  652

Query  673   IQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKE  494
             I+G + ++  DLR L +KWLR Q  +VGQEP LFA +I EN+  G  NA+  E   A   
Sbjct  653   IEGIITLDGHDLRTLQVKWLRDQIGMVGQEPILFATSILENVMMGKDNATKEEAISACIA  712

Query  493   AYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesE  314
             A  H FIS LP  Y+T+VG  G +LSGGQKQRIA+ARA++K  K+LLLDE +SALD ESE
Sbjct  713   ADAHNFISKLPLRYDTQVGDRGTKLSGGQKQRIALARAMIKNPKILLLDEPTSALDAESE  772

Query  313   KHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYAT  134
               VQ A+ KIS   TTIV+AHR++T+K A+ I V++ G+V E G H +LM+    G Y  
Sbjct  773   AAVQRAIDKISAGRTTIVIAHRIATVKNADSIVVLEHGSVTEIGDHRQLMSKA--GTYFN  830

Query  133   LVRAEQEA  110
             LV+   E+
Sbjct  831   LVKLATES  838



>ref|XP_004305767.1| PREDICTED: ABC transporter B family member 1-like [Fragaria vesca 
subsp. vesca]
Length=1545

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/528 (75%), Positives = 458/528 (87%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L L+LV LGFG I+ M GQQGLCG AGTKLT R+RN LF+SILKQEPGWFDF+ENS  VL
Sbjct  1019  LCLVLVALGFGNILFMTGQQGLCGWAGTKLTMRVRNLLFRSILKQEPGWFDFEENSRAVL  1078

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             +SR+++DSV FR+V  DR SV+ MGLSSA VGLGISF LEWRLTLLAAALTPFTLGASY 
Sbjct  1079  ISRITMDSVLFRAVHVDRLSVMFMGLSSAMVGLGISFFLEWRLTLLAAALTPFTLGASYL  1138

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +LI+N+GPKLDN +YA+ASNIA+GA+SNIRTVATFS Q+ +++SF+ ALS+PK  S+RRS
Sbjct  1139  TLIINMGPKLDNDAYAKASNIASGAISNIRTVATFSAQDQLIKSFDSALSDPKTKSMRRS  1198

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             QI+G ALGFSQG MY AYTLTL +GA+L+KE  TN G VYKIFLILVLSSFSVGQLAGLA
Sbjct  1199  QIMGLALGFSQGVMYVAYTLTLLYGAFLMKENKTNFGDVYKIFLILVLSSFSVGQLAGLA  1258

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDTSMA  AIPAV +I+ R+PLI S  + K +K E SK  DI F+ VTFAYPSRP+V VL
Sbjct  1259  PDTSMAETAIPAVFDIMTRKPLISSG-RGKDKKIERSKLLDIHFKTVTFAYPSRPEVTVL  1317

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
               FSLKIKGG+ VALVG SGSGKST+IW+IQRFYDP QG+V+M  VDLRE ++KWLR Q 
Sbjct  1318  NEFSLKIKGGSTVALVGGSGSGKSTVIWLIQRFYDPTQGKVMMGGVDLRETDVKWLRRQI  1377

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
             ALVGQEP LFAGTI ENIAFG  NAS+ EIE+AA+EAYIH FISGLP+GY+T+VG+SGVQ
Sbjct  1378  ALVGQEPTLFAGTIRENIAFGNQNASWAEIEDAAREAYIHSFISGLPQGYDTQVGESGVQ  1437

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILKKSK+LLLDEASSALDLESE+H+QDALRKISK+ATTI+VAHRLS
Sbjct  1438  LSGGQKQRIAIARAILKKSKILLLDEASSALDLESERHIQDALRKISKRATTIIVAHRLS  1497

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             TI+EA++IAV+K+GA+ EYGSHD LM S LNG+YA+LVRAE EA AFA
Sbjct  1498  TIREADMIAVMKDGAITEYGSHDTLMTSHLNGVYASLVRAETEANAFA  1545


 Score =   256 bits (654),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 205/544 (38%), Positives = 306/544 (56%), Gaps = 48/544 (9%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
               + + L++ GL    +V    Q     + G +   RIR    +++L+Q+  +FD  E  
Sbjct  385   DVERICLLMTGLAAIVVVGAYMQITCWRMVGERSAQRIRREYLRAVLRQDITFFD-TEIG  443

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftL-  1337
              G ++  +S D  + + V+G++ ++ +  L +   G  + F   W+++L+  ++ P  + 
Sbjct  444   AGDIMHGISSDVAAIQEVMGEKMALFIHHLCTFICGYIVGFIRSWKISLVVLSVIPLMMF  503

Query  1336  -GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE--P  1166
              G +Y ++ + +  K +  SY  A ++A  A+ +IRTV +F  ++H+ + +   L++  P
Sbjct  504   CGIAYKAVYVGLTTK-EEVSYRTAGSVAEQAIGSIRTVLSFVAEDHLAEKYAALLADLVP  562

Query  1165  KRTSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIF-  1013
                        G+ +GF++GA         Y  + L  W+G+ LV +G    GA    F 
Sbjct  563   ----------FGAKIGFAKGAGVGVIYLVTYSTWALAFWYGSILVAKGEITGGAAIACFF  612

Query  1012  --------LILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRK-GRKF  860
                     L L LS F+  Q A         + A   V EII+R P I  DP    GRK 
Sbjct  613   GVNVGGRGLALSLSYFA--QFA-------QGTVAAGRVFEIIDRVPEI--DPYSPVGRKL  661

Query  859   ETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFY  680
                +   IEF+ ++FAYPSRPD  +L + +L I     +ALVGASG GKST+  +I+RFY
Sbjct  662   SNVRG-RIEFKGISFAYPSRPDTQILHSLNLVIPSSKTLALVGASGGGKSTIFALIERFY  720

Query  679   DPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAA  500
             DPI+G V ++  DLR L++KWLRSQ  +VGQEP LFA +I EN+  G  NA+  E   A 
Sbjct  721   DPIKGTVTLDGHDLRSLHVKWLRSQIGMVGQEPVLFATSILENVLMGKENATKKEAIAAC  780

Query  499   KEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldle  320
               A    FISGLP GY+T+VG  G  LSGGQKQRIA+ARA++K  ++LLLDE +SALD E
Sbjct  781   IAANADNFISGLPYGYDTQVGDRGTLLSGGQKQRIALARAMIKDPRILLLDEPTSALDPE  840

Query  319   sEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIY  140
             SE  VQ A+ KIS   TTIV+AHRLST++ ++ I V+  G+V E G+H +LM  E  G Y
Sbjct  841   SETVVQQAIDKISSGRTTIVIAHRLSTVRNSHAIVVLDGGSVIEIGNHRQLM--EKAGAY  898

Query  139   ATLV  128
              +LV
Sbjct  899   YSLV  902



>ref|XP_010034721.1| PREDICTED: ABC transporter B family member 19-like [Eucalyptus 
grandis]
 gb|KCW53384.1| hypothetical protein EUGRSUZ_J02615 [Eucalyptus grandis]
Length=1559

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/516 (76%), Positives = 453/516 (88%), Gaps = 1/516 (0%)
 Frame = -1

Query  1645  IVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFR  1466
             I+++ GQQG CG AGTKLT+R+R+ LF SILKQEPGWFDF+ENSTG+LVSRLS D +SFR
Sbjct  1045  IISITGQQGFCGWAGTKLTTRVRSLLFHSILKQEPGWFDFEENSTGILVSRLSSDCISFR  1104

Query  1465  SVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLDN  1286
             SVLGDRFSVL MGLS+AA GLG+SF L+WRL+L+A A+TP TLGASY SLI+ +GPKLDN
Sbjct  1105  SVLGDRFSVLFMGLSAAAAGLGVSFYLQWRLSLVATAVTPITLGASYLSLIIGIGPKLDN  1164

Query  1285  SSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQG  1106
              +Y  ASNIAAGA+SNIRTV TFS QE +++SF++ALSEPK+ SVRRSQ+LG   GF+QG
Sbjct  1165  EAYGVASNIAAGAISNIRTVTTFSAQEQLIESFDRALSEPKKKSVRRSQVLGLTSGFAQG  1224

Query  1105  AMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPA  926
             AMYGAYTLTLWFGAYLVKE     G V KIFLILVLSSFSVGQLAGLAPDTSMA+ A+PA
Sbjct  1225  AMYGAYTLTLWFGAYLVKEDKAKFGDVSKIFLILVLSSFSVGQLAGLAPDTSMAATAVPA  1284

Query  925   VLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTM  746
             VLEIINRRP IG+D +R GRK E SKP+DIE + V FAYPSRP+V VLR+F LK+K G+ 
Sbjct  1285  VLEIINRRPQIGNDKER-GRKLERSKPWDIELKKVNFAYPSRPEVTVLRDFYLKVKAGSK  1343

Query  745   VALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAG  566
             VALVG+SGSGKST+IW++QRFYDP QG+VLM  VDLRE+N+KWLR QTALV QEPALF G
Sbjct  1344  VALVGSSGSGKSTVIWLVQRFYDPNQGKVLMGGVDLREMNVKWLRRQTALVSQEPALFGG  1403

Query  565   TIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIA  386
             +I ENIAFG PNAS+ EIEEAAKEAYIHKFIS LP+GYET+VG+SGVQLSGGQKQRIAIA
Sbjct  1404  SIRENIAFGNPNASWAEIEEAAKEAYIHKFISALPQGYETEVGESGVQLSGGQKQRIAIA  1463

Query  385   RAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVK  206
             RA+LKKS+VLLLDEASSALDLESE+HVQDALR  SK+ATTIVVAHR+STI+EA++IAVVK
Sbjct  1464  RAMLKKSRVLLLDEASSALDLESERHVQDALRTASKRATTIVVAHRMSTIREADMIAVVK  1523

Query  205   EGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             EG V EYGSHD LM S +NG+YA+LVRAE EA AF+
Sbjct  1524  EGKVTEYGSHDTLMGSHVNGLYASLVRAESEAVAFS  1559


 Score =   264 bits (675),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 202/540 (37%), Positives = 302/540 (56%), Gaps = 28/540 (5%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
                 + L++ GL    +V    Q     L G +   RIR    +++L+Q+ G+FD  + S
Sbjct  387   HVDEVCLLMTGLAAVVVVGAYMQITCWRLVGDRAAQRIRTNYLRAVLRQDIGFFD-TQVS  445

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftL-  1337
             TG ++  +S D    + V+G++ +  +  + +   G  + F   W+++L   A+TP T+ 
Sbjct  446   TGDIMHGISSDVAQIQEVMGEKMAYFVYHIFAFICGYAVGFFQSWKVSLAVFAVTPLTMF  505

Query  1336  -GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE--P  1166
              G +Y ++ + +  K +  SY RA ++A  AVS+IRTV +F  ++++   + + LS   P
Sbjct  506   CGIAYKAVYVGLASK-EEVSYRRAGSVAEQAVSSIRTVFSFVAEDNLAARYAELLSSLIP  564

Query  1165  KRTSVRRSQILGSALGFSQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIFL  1010
                       +G+ +GF++GA         Y  + L  W+G+ LV  G  + G     F 
Sbjct  565   ----------IGAKVGFAKGAGIGVIYLVTYSTWALAFWYGSILVARGELSGGQAIACFF  614

Query  1009  ILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEF  830
              + L    +             + A   V E+I+R P I  DP     +  +     IEF
Sbjct  615   GVNLGGRGLALSLSYFAQFGQGTVAATRVFEVIDRVPEI--DPYDPSGRMLSHVRGKIEF  672

Query  829   EMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLME  650
               V+FAYP+RPD  +LR+ SL I     +ALVG SG GKST+  +I+RFYDPI+G + ++
Sbjct  673   RGVSFAYPARPDAPILRSLSLVIPSSKTLALVGVSGGGKSTIFALIERFYDPIKGTIALD  732

Query  649   EVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFIS  470
               D+R L +KWLRSQ  ++GQEP LFA +I EN+  G  NA+  E   A   A    FI 
Sbjct  733   GHDIRSLQVKWLRSQIGMLGQEPVLFAVSIIENVMMGKENATRKEAMAACVTASASNFIL  792

Query  469   GLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALR  290
             GLPEGY+T+VG  G  LSGGQKQRIA+ARA++K  ++LLLDE +SALD ESE  VQ+A+ 
Sbjct  793   GLPEGYDTQVGDRGTLLSGGQKQRIALARAMIKDPRILLLDEPTSALDPESEIIVQEAID  852

Query  289   KISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             KIS   T IV+AHRL+T++ A+ IAV+ +G+V E G H +LM  E  G Y  LV+   EA
Sbjct  853   KISTNRTAIVIAHRLATVRNAHTIAVLDQGSVVEIGDHRQLM--EKGGAYYDLVKLASEA  910



>ref|XP_006843855.1| hypothetical protein AMTR_s00007p00263610 [Amborella trichopoda]
 gb|ERN05530.1| hypothetical protein AMTR_s00007p00263610 [Amborella trichopoda]
Length=1523

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/515 (73%), Positives = 435/515 (84%), Gaps = 2/515 (0%)
 Frame = -1

Query  1654  FGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSV  1475
             FGCI+TM GQQG CG AGTKL+ R+R+  F+SI +QEPGWFD +ENS+GVLVSRLS D  
Sbjct  1005  FGCIITMTGQQGFCGWAGTKLSRRVRDLFFQSIFRQEPGWFDSEENSSGVLVSRLSADCT  1064

Query  1474  SFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPK  1295
             SFR+ LGDRFSV+LMGL SAAVGL ISF + WRL+LLA ALTPFTLGASYFSLI+N+GPK
Sbjct  1065  SFRAALGDRFSVILMGLGSAAVGLTISFMINWRLSLLATALTPFTLGASYFSLIINLGPK  1124

Query  1294  LDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGF  1115
             L N SYA+ASNIA+GA+SNIRTVATFS Q+ +V SF KALSEP + SVRRS I+G ALG 
Sbjct  1125  LSNDSYAKASNIASGAISNIRTVATFSAQDTLVTSFNKALSEPMKKSVRRSHIMGLALGI  1184

Query  1114  SQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAA  935
             SQGAMYGAYTLTLW+GA L KEG    G VYKIFLILVLSSFSVGQLAGLAPDTS A+ A
Sbjct  1185  SQGAMYGAYTLTLWYGAVLNKEGRATFGEVYKIFLILVLSSFSVGQLAGLAPDTSAAAVA  1244

Query  934   IPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKG  755
             IP+VL  I R+PLI +  +R+G++   SK F IEF+ V+FAYP R DV+VLR+FSLK+KG
Sbjct  1245  IPSVLSTIKRKPLIDTS-ERRGKRLGDSK-FSIEFKKVSFAYPCRLDVVVLRDFSLKVKG  1302

Query  754   GTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPAL  575
             G+MV LVG SGSGKST++W++QRFYD  QG+VL+  VD+RE+N++WLR Q  LVGQEPAL
Sbjct  1303  GSMVGLVGESGSGKSTVVWLVQRFYDANQGKVLVGGVDVREINVRWLRGQMGLVGQEPAL  1362

Query  574   FAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRI  395
             F+GTI ENIAFG P AS+TEIEEAAK AYIH FISGLPEGYET VG+SGVQLSGGQKQRI
Sbjct  1363  FSGTIRENIAFGDPRASWTEIEEAAKAAYIHIFISGLPEGYETPVGESGVQLSGGQKQRI  1422

Query  394   AIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIA  215
             AIARAILKK +VLLLDEASSALD+ESEKHVQ ALRKISK  TTIVVAHRL+TI+EA+ IA
Sbjct  1423  AIARAILKKPRVLLLDEASSALDIESEKHVQQALRKISKDTTTIVVAHRLATIREADRIA  1482

Query  214   VVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             VV+ G V E+GSH+ LMAS  NG YA LVRAE E+
Sbjct  1483  VVRGGTVVEFGSHESLMASHSNGAYANLVRAELES  1517


 Score =   268 bits (686),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 205/505 (41%), Positives = 294/505 (58%), Gaps = 28/505 (6%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +    IR    +++L+Q+ G+FD D N TG ++  +S D    + V+G++ +  + 
Sbjct  388   LVGERSAQTIRREYLRAVLRQDMGFFDADVN-TGDIMHGISSDVAHIQEVMGEKMAHFMH  446

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G G+ F   W++ L+  A+T      G  Y +L + +  K +  SY +A +IA
Sbjct  447   HVFTFLTGYGVGFYRSWKIALVVLAVTPLMMLCGILYKALYVGLTAK-EEVSYRKAGSIA  505

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTL  1076
               A+ ++RTV +F  +EH+   + + L +     V+     G+ +G      Y  + L  
Sbjct  506   EQAIRSVRTVFSFVAEEHLASKYAELLDKSVPFGVKIGFAKGAGMGVIYWVTYATWALAF  565

Query  1075  WFGAYLVKEGYTNIGAVYKIF---------LILVLSSFSVGQLAGLAPDTSMASAAIPAV  923
             W+G+ LV +G  + GA    F         L L LS F+  Q A         + A   V
Sbjct  566   WYGSILVAKGEIDGGAAIACFFGVNVGGRGLALSLSYFA--QFA-------QGTVAAARV  616

Query  922   LEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTM  746
               II+R P I  DP   +GR   T +   IEF  V+FAYPSR ++ +LR+ +L +     
Sbjct  617   FGIIDRVPEI--DPYDSQGRILSTLRG-KIEFRNVSFAYPSRLNIPILRSLNLVVPASKT  673

Query  745   VALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAG  566
             +A+VGASGSGKSTL  +I+RFYDP +G +L++  DLR L LKWLR+Q  +VGQEP LFA 
Sbjct  674   IAIVGASGSGKSTLFALIERFYDPNKGEILLDGEDLRRLQLKWLRNQIGMVGQEPVLFAT  733

Query  565   TIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIA  386
             TI ENI  G   AS  E   A   +  H FI+ LP GY+T+VG+ G QLSGGQKQRIAIA
Sbjct  734   TIMENILLGKEGASRKEAVTACIGSNAHTFITQLPHGYDTQVGERGTQLSGGQKQRIAIA  793

Query  385   RAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVK  206
             RA++K  KVLLLDEA+SALD +SE  VQ A+ KIS   TT+V+AHRLSTIK A+ I V+ 
Sbjct  794   RAMIKSPKVLLLDEATSALDAQSEGAVQQAIEKISLGRTTLVIAHRLSTIKNAHTIIVMD  853

Query  205   EGAVAEYGSHDKLMASELNGIYATL  131
             +G++ E G H++LMA +  G+Y  L
Sbjct  854   QGSIIETGDHNRLMAKK--GVYFNL  876



>ref|XP_010937363.1| PREDICTED: ABC transporter B family member 19-like [Elaeis guineensis]
Length=1493

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/528 (70%), Positives = 446/528 (84%), Gaps = 1/528 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L+L LVGLG G IV+M GQQG CG AGT+LT R+ N LF+SIL+QEP WFDF+ENS G L
Sbjct  967   LALGLVGLGVGSIVSMTGQQGFCGWAGTRLTVRVCNLLFRSILRQEPAWFDFEENSAGAL  1026

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             +SRLS D  +FRS+LGDR+SVLLMGL SAAVGLGISF L WRLTL+A A+TPFTLGASY 
Sbjct  1027  ISRLSADCTAFRSMLGDRYSVLLMGLGSAAVGLGISFILSWRLTLVAMAMTPFTLGASYL  1086

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             SL++NVGPKLDNS++ARAS IAAGAVSNIRTV TFS QE IV SF++ALSEP R S+RR+
Sbjct  1087  SLLINVGPKLDNSAFARASTIAAGAVSNIRTVMTFSAQEKIVSSFDRALSEPTRKSMRRT  1146

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
             QI+G  LG SQGAMY AYTLTL+ GAYL+K+   N GAVYKIF+ILVLSSFSVGQLAGLA
Sbjct  1147  QIMGLGLGLSQGAMYAAYTLTLFVGAYLIKKELANFGAVYKIFMILVLSSFSVGQLAGLA  1206

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDTS A  AI  V  I+ R P I  D +R GR  +  K  D+E + VTFAYPSRPD++VL
Sbjct  1207  PDTSGAPMAIDRVFSILKRTPSINVD-RRNGRVIKGGKLLDVELKRVTFAYPSRPDMMVL  1265

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+FS+K+K G+ VA+VG SGSGKST+IWM+QRFYDP  GRV++  VD+RE+++KWLR++ 
Sbjct  1266  RDFSIKVKAGSTVAIVGGSGSGKSTVIWMVQRFYDPDVGRVMVGGVDVREMDVKWLRTEC  1325

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
             ALVGQEPALF GTI ENI FG P AS+ EIEEAA +A+IHKFISGLP+GYET+VG+SGVQ
Sbjct  1326  ALVGQEPALFGGTIRENIGFGSPKASWAEIEEAAADAHIHKFISGLPQGYETQVGESGVQ  1385

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARA+LK+S++LLLDEA+SALD+ESE++VQ+AL+K+SK ATTIVVAHRL+
Sbjct  1386  LSGGQKQRIAIARAMLKRSRILLLDEATSALDVESERYVQEALKKLSKHATTIVVAHRLA  1445

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             TI+EA+ IAVV++G VAE+GSHD L+A+ L+G+YA +VRAE EA A +
Sbjct  1446  TIREAHNIAVVRDGKVAEFGSHDALLANHLDGVYAAMVRAEMEAQALS  1493


 Score =   261 bits (668),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 191/508 (38%), Positives = 291/508 (57%), Gaps = 32/508 (6%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G     RIR    +++L+Q+ G+FD  E STG ++  +S D    + V+G++ +  + 
Sbjct  347   MVGESSAQRIRREYLRAVLRQDIGFFD-TEVSTGDVMHGISSDVAQIQEVIGEKMAHFVH  405

Query  1429  GLSSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W++ L+  +        G +Y ++ + +  K + +SY +A+N+A
Sbjct  406   HIFTFICGYLVGFIKAWKVALVVFSVTPLMMFCGIAYKAVYVGLTAK-EEASYRKATNVA  464

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++ + + + + L         ++  +G  +GF++GA         
Sbjct  465   QQAISSIRTVLSFVMEDQMAKKYTEWL--------EKAAPIGMKIGFAKGAGMGVIYLVT  516

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLS----SFSVGQLAGLAPDTSMASAAI  932
             Y  + L  W+G+ LV +G    GA    F  + +     + S+   A  AP T  A    
Sbjct  517   YSQWALAFWYGSLLVAKGEITGGAAIACFFAVNVGGRGLALSLSYFAQFAPGTVAAGR--  574

Query  931   PAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGG  752
               V EII+R P I  DP     +  +S    IE + +TFAYPSRP   +L++ +L I   
Sbjct  575   --VFEIIDRVPEI--DPYGSDGRTLSSVRGRIELKGITFAYPSRPQAPILQDLNLTIPAS  630

Query  751   TMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALF  572
               +ALVGASG GKST+  +I+RFYDP QG + ++  D+R L LKWLR Q  LVGQEP LF
Sbjct  631   KTLALVGASGGGKSTIFALIERFYDPDQGSICLDGHDIRTLRLKWLREQIGLVGQEPMLF  690

Query  571   AGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIA  392
               +I EN+  G  NA+  E   A   A +H FISGLPEGY T+VG  G QLSGGQKQRIA
Sbjct  691   PTSIIENVMMGKVNATRKEALAACVAANVHTFISGLPEGYNTQVGDRGTQLSGGQKQRIA  750

Query  391   IARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAV  212
             +AR +++  ++LLLDE +SALD ESE  VQ A+ +IS   TT+++AHRL+T++ A+ I V
Sbjct  751   LARVMMRNPRILLLDEPTSALDPESEAVVQQAIDRISVGRTTVIIAHRLATVRNADTIVV  810

Query  211   VKEGAVAEYGSHDKLMASELNGIYATLV  128
             +  G++ E G H  LM  +  G+YA+LV
Sbjct  811   LDHGSIVESGRHRDLM--DGAGVYASLV  836



>ref|XP_008787010.1| PREDICTED: ABC transporter B family member 19-like [Phoenix dactylifera]
Length=1577

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/512 (71%), Positives = 438/512 (86%), Gaps = 1/512 (0%)
 Frame = -1

Query  1645  IVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFR  1466
             IV+M GQQG CG AGT+LT ++ N LF+SIL+QEPGWFDF+ENS GVLVSRLS D  +FR
Sbjct  1007  IVSMTGQQGFCGWAGTRLTVKVCNLLFQSILRQEPGWFDFEENSAGVLVSRLSADCTAFR  1066

Query  1465  SVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLDN  1286
             S+LGDR+S+LLMGL SAAVGLGISF L+WRLTL+A ALTPFTLGASY SL++NVGPKLDN
Sbjct  1067  SMLGDRYSILLMGLGSAAVGLGISFILDWRLTLVAVALTPFTLGASYLSLLINVGPKLDN  1126

Query  1285  SSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQG  1106
             S+YARAS IAAGAVSNIRTV TFS QE I  SFE+ALSEP   S++RSQI+G  LG SQG
Sbjct  1127  SAYARASTIAAGAVSNIRTVMTFSAQEKIASSFEQALSEPTSKSMKRSQIMGLGLGLSQG  1186

Query  1105  AMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPA  926
             AMY AYTLTL+ GAYL+K+  +N G VYKIFLILVLSSF+VGQLAGLAPDTS A  AI  
Sbjct  1187  AMYAAYTLTLFVGAYLIKKRLSNFGDVYKIFLILVLSSFAVGQLAGLAPDTSGAPMAIDR  1246

Query  925   VLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTM  746
             V  I+ RRPLI  D Q  GR  +  K  D+E + VTFAYP+RP V+VLR+FS+K+K G+ 
Sbjct  1247  VFSIVKRRPLINGDRQ-NGRVMKGGKLLDVELKRVTFAYPTRPYVMVLRDFSMKVKAGST  1305

Query  745   VALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAG  566
             VA+VG SGSGKST+IW++QRFYDP  GRV++  VD+RE+++KWLR + ALVGQEPALF G
Sbjct  1306  VAVVGGSGSGKSTVIWLVQRFYDPDVGRVMVGGVDVREMDVKWLRGECALVGQEPALFGG  1365

Query  565   TIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIA  386
             TI ENIAFG P AS+ EIEEAAKEA+IHKFISGLP+GYET+VG+SGVQLSGGQKQRIAIA
Sbjct  1366  TIRENIAFGGPKASWAEIEEAAKEAHIHKFISGLPQGYETQVGESGVQLSGGQKQRIAIA  1425

Query  385   RAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVK  206
             RAILK+S++LLLDEA+SALD+ESEKHVQ+AL+++S++ATTI+VAHRL+TIKEA+ IAVV+
Sbjct  1426  RAILKRSRILLLDEATSALDVESEKHVQEALKEVSRRATTIIVAHRLATIKEADSIAVVR  1485

Query  205   EGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             +G VAE+GSHD L+A+ L+G+YA +VRAE EA
Sbjct  1486  DGKVAEFGSHDALLANHLDGMYAAMVRAEMEA  1517


 Score =   268 bits (686),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 199/510 (39%), Positives = 292/510 (57%), Gaps = 34/510 (7%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   RIR    + IL+Q+ G+FD  E STG ++  +S D    + V+G++ +  + 
Sbjct  381   MVGERSAQRIRREYLRGILRQDIGFFD-TEVSTGDVMHGISSDVAQIQEVIGEKMAHFVH  439

Query  1429  GLSSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W++  +  +        G +Y ++ + +  K + +SY +A+N+A
Sbjct  440   HIFTFICGYLVGFIKAWKVAFVVFSVTPLMMLCGIAYKAVYVGLTAK-EEASYQKATNVA  498

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++ I   + + L         +S  +G  +GF++GA         
Sbjct  499   QQAISSIRTVLSFVMEDQIANKYARCL--------EKSSPIGMKIGFAKGAGVGVIYLVT  550

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLS----SFSVGQLAGLAPDTSMASAAI  932
             Y  + L  W+G+ LV +G    GA    F  + +     + S+   A  A  T  AS   
Sbjct  551   YSQWALAFWYGSLLVAKGEITGGAAIACFFAVNVGGRGLALSLSYFAQFAQGTVAASR--  608

Query  931   PAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKG  755
               V EII+R P I  DP   +GR   ++K   IEF+ + FAYPSRP   +LR+F+L I  
Sbjct  609   --VFEIIDRVPEI--DPYSSEGRTLSSTKG-RIEFKGIKFAYPSRPQAPILRDFNLTIPA  663

Query  754   GTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPAL  575
                VALVGASG GKST+  +I+RFYDP QG + ++  D+R L LKWLR Q  LVGQEP L
Sbjct  664   SKTVALVGASGGGKSTIFALIERFYDPDQGSICLDGHDIRTLRLKWLREQMGLVGQEPML  723

Query  574   FAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRI  395
                +I EN+  G  NA+  E   A   A  H FISGLPEGY+T+VG  G QLSGGQKQRI
Sbjct  724   LPTSILENVMVGKVNATKKEAIAACVAANAHTFISGLPEGYDTQVGDRGAQLSGGQKQRI  783

Query  394   AIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIA  215
             A+ARA+++  ++LLLDE +SALD ESE  VQ A+ +IS   TTI++AHRL+T++ A+ I 
Sbjct  784   ALARAMVRNPRILLLDEPTSALDSESEAVVQQAIDRISVGRTTIIIAHRLATVRNADTIV  843

Query  214   VVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             V+  G++ E G H  LM     G YA+LV+
Sbjct  844   VLDHGSIVESGCHRDLMGRA--GPYASLVK  871



>ref|XP_010230241.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1318

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/535 (63%), Positives = 428/535 (80%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ Q   L+L +VGLG  CI+TM GQQG CG AG +LT R+R+ LF++I++QEP WFD D
Sbjct  785   MRRQVGYLALAVVGLGVACILTMTGQQGFCGWAGARLTMRVRDRLFRAIMRQEPAWFDED  844

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+ GVLV+RL+ D+V+FRS+ GDR++VLLM + SA VGLGI F L+ RLTL+A A TP 
Sbjct  845   DNAMGVLVTRLARDAVAFRSMFGDRYAVLLMAVGSAGVGLGICFGLDVRLTLVAMACTPL  904

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +L++N+G + D+ +YARAS+IAAGAVSN+RTVA    Q  IV +F +AL  P 
Sbjct  905   TLGASYLNLLINLGARSDDGAYARASSIAAGAVSNVRTVAALCAQGGIVGTFNRALDGPS  964

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               + RRSQ +G  LG SQGAMYGAYT+TLW GAY +K+G ++ G V KIFLILVLSSFSV
Sbjct  965   AKAQRRSQYMGLILGISQGAMYGAYTVTLWAGAYFIKKGQSSFGDVSKIFLILVLSSFSV  1024

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTS A  AI  +L I+ RRP I S+   K R  +  KP D+E   V FAYPS
Sbjct  1025  GQLAGLAPDTSGAPTAIAGILAILKRRPAI-SEEGSKRRAIKEGKPMDVELRKVVFAYPS  1083

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP++ VL +FSL++K G+ VALVGASGSGKST++W++QRFYDP+ G V++  +D+R+L+L
Sbjct  1084  RPEITVLNDFSLRVKSGSTVALVGASGSGKSTVVWLVQRFYDPLGGTVMVGGLDVRDLDL  1143

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR + ALVGQEPALF+G+I ENI FG P AS+ EIE+AAKEA IHKFI+GLP+GY+T+
Sbjct  1144  KWLRGECALVGQEPALFSGSIRENIGFGNPKASWAEIEDAAKEANIHKFIAGLPQGYDTQ  1203

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAILK S++LLLDEASSALDLESEKHVQ+ALR++S++ATTI
Sbjct  1204  VGESGVQLSGGQKQRIAIARAILKGSRILLLDEASSALDLESEKHVQEALRRVSRRATTI  1263

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
              VAHRLST++EA+ IAVV  G   E+GSHD L+AS  +G+YA +V+AE EA AFA
Sbjct  1264  TVAHRLSTVREADRIAVVSAGRTVEFGSHDGLLASHRDGLYAAMVKAEIEAQAFA  1318


 Score =   278 bits (712),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 199/497 (40%), Positives = 291/497 (59%), Gaps = 24/497 (5%)
 Frame = -1

Query  1585  RIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVG  1406
             R+R    K++L+QE G+FD  E STG ++  +S D    + V+GD+ +  +  + +   G
Sbjct  184   RVRREYLKAVLRQEIGFFD-TEVSTGEVMQSISSDVAQIQEVMGDKMAGFVHHVFTFIFG  242

Query  1405  LGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIR  1232
               + F   WR+TL   A+T      G +Y ++   +  K + +SY RA N+A  A+S+IR
Sbjct  243   YVVGFKTSWRITLAVLAVTPLMMACGLAYKAIYGGLTAK-EEASYQRAGNVAQQAISSIR  301

Query  1231  TVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------MYGAYTLTL  1076
             TV +F  ++ +   +   L        +RS  +G  +GF++GA         Y  + L L
Sbjct  302   TVLSFVMEDRLADKYADWL--------QRSSPIGVKMGFAKGAGMGMIYLVTYSQWALAL  353

Query  1075  WFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPL  896
             W+GA LV +G    G     F  +++    +      +   +  +AA   V EII+R P 
Sbjct  354   WYGAKLVAQGEIKGGDAIACFFGVMVGGRGLALSLSYSAQFAQGTAAAGRVFEIIDRAPE  413

Query  895   IGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSG  716
             I  DP     +  +S    IEF+ V FAYPSRPD ++L N +L +    M+ALVG SG G
Sbjct  414   I--DPYGTAGRALSSVRGRIEFKDVEFAYPSRPDSLILYNLNLTVPAAKMLALVGVSGGG  471

Query  715   KSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGF  536
             KST+  +I+RFYDP +G + ++  +L  LNLKWLRSQ  LVGQEP LFA +I EN+  G 
Sbjct  472   KSTVFALIERFYDPTRGTITLDGQELGSLNLKWLRSQIGLVGQEPILFATSIIENVMMGK  531

Query  535   PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVl  356
              NA+  E   A  +A  H F+ GLP+GY+T+VG  G Q+SGGQKQRIA+ARAI+++ ++L
Sbjct  532   ENATRQEAVAACTKANAHTFVLGLPDGYDTQVGDRGTQMSGGQKQRIALARAIIREPRIL  591

Query  355   lldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSH  176
             LLDE +SALD ESE  VQ ++ ++S   T +V+AHRL+T++ A+ IAV+  GAV E G H
Sbjct  592   LLDEPTSALDAESEAVVQQSIDRLSVGRTVLVIAHRLATVRNADTIAVLDRGAVVESGRH  651

Query  175   DKLMASELNGIYATLVR  125
               LM    NG YA LV+
Sbjct  652   ADLMTR--NGPYAGLVK  666



>emb|CBI35827.3| unnamed protein product [Vitis vinifera]
Length=1140

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/509 (71%), Positives = 409/509 (80%), Gaps = 60/509 (12%)
 Frame = -1

Query  1624  QGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRF  1445
             QG CG AGTKLT R+R+ LF+SILKQEP                          VLGDRF
Sbjct  692   QGFCGWAGTKLTKRVRDRLFRSILKQEP--------------------------VLGDRF  725

Query  1444  SVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLDNSSYARAS  1265
             SVLL GLSSAAVGLGISF L+WRLTLLAAALTP TLGASYFSLI+NVGP+LDNSSYARAS
Sbjct  726   SVLLTGLSSAAVGLGISFFLDWRLTLLAAALTPLTLGASYFSLIINVGPRLDNSSYARAS  785

Query  1264  NIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYT  1085
             NIAAGAVSNIRTV TFS Q+ +V +F++ALSEPK+ SV+RSQ+LG ALGFSQGAMYGAYT
Sbjct  786   NIAAGAVSNIRTVTTFSAQQQLVHTFDQALSEPKKKSVKRSQVLGLALGFSQGAMYGAYT  845

Query  1084  LTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINR  905
             LTLWFG YL+KE   N G V+KIFLILV+SSFSVGQLAGLAPDTSMA+ A+         
Sbjct  846   LTLWFGTYLIKEDKANFGDVFKIFLILVMSSFSVGQLAGLAPDTSMAATAL---------  896

Query  904   RPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGAS  725
                                      +MVTFAYPSRP+V VLR F LK+KGG+MVALVG S
Sbjct  897   -------------------------KMVTFAYPSRPEVTVLREFCLKVKGGSMVALVGGS  931

Query  724   GSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIA  545
             GSGKST++W+IQRFYDP QG+VLM  VD++E+N+KWLR Q ALVGQEPALFAG+I ENIA
Sbjct  932   GSGKSTVVWLIQRFYDPNQGKVLMGGVDIKEMNVKWLRRQIALVGQEPALFAGSIRENIA  991

Query  544   FGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKS  365
             FG PNAS+ EIEEAA EAYIHKFIS LP+GYET+VG+SG QLSGGQKQRIAIARAILKKS
Sbjct  992   FGNPNASWAEIEEAANEAYIHKFISSLPQGYETQVGESGAQLSGGQKQRIAIARAILKKS  1051

Query  364   KVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEY  185
             KVLLLDEASSALDLESEKHVQDALRK+S++ATTIVVAHRLSTI+EA++IAVVK+GAV EY
Sbjct  1052  KVLLLDEASSALDLESEKHVQDALRKVSERATTIVVAHRLSTIREAHMIAVVKDGAVTEY  1111

Query  184   GSHDKLMASELNGIYATLVRAEQEAYAFA  98
             GSHD L+AS LNG+YA+LVRAE EA AF+
Sbjct  1112  GSHDTLLASHLNGVYASLVRAETEASAFS  1140


 Score =   268 bits (684),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 201/528 (38%), Positives = 306/528 (58%), Gaps = 34/528 (6%)
 Frame = -1

Query  1648  CIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSF  1469
              ++T + +     + G + + RIR    +++L+Q+ G+FD  + STG ++  +S D    
Sbjct  133   VLITGLAEITCWRIVGERSSQRIRTKYLRAVLRQDIGFFD-TQISTGNIMHGISSDVAQI  191

Query  1468  RSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPK  1295
             + V+G++ +  +  + +   G  + F   W+++L+  ++       G +Y ++ + +  K
Sbjct  192   QEVMGEKMAHFIHHVFTFICGYAVGFWRSWKVSLVVLSVIPLMMFCGIAYKAIYVGLTAK  251

Query  1294  LDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGF  1115
              +  SY  A ++A  A+S+IRTV +F  ++H+ + + + L        ++S   G  LGF
Sbjct  252   -EEVSYRIAGSVAEQAISSIRTVFSFVAEDHLAERYAELL--------QKSVPFGVKLGF  302

Query  1114  SQGA--------MYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLS----SFSVGQLA  971
             ++GA         Y  + L  W+G+ LV  G  + GA    F  + L     + S+   A
Sbjct  303   AKGAGMGVIYLVTYSTWALAFWYGSILVARGEISGGAAIACFFGVNLGGRGLALSLSYFA  362

Query  970   GLAPDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
               A  T  AS     V EII+R P I  DP   +GRK  + +   IEF+ VTFAYPSRP 
Sbjct  363   QFAQGTVAASR----VFEIIDRVPEI--DPYSPEGRKLPSIRG-RIEFKGVTFAYPSRPT  415

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
               +LR+ +L++     +ALVG+SG GKST+  +I+RFYDP++G + ++  D+R L +KWL
Sbjct  416   AAILRSLNLEVPSSKTLALVGSSGGGKSTIFALIERFYDPVKGIITLDGHDIRTLQVKWL  475

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             R Q  +VGQEP LF  +I EN+  G  NA+  E   A   A  H FISGLP+GY+T+VG 
Sbjct  476   RGQIGMVGQEPVLFTTSILENVMMGKENATKKEAIAACVAANAHSFISGLPQGYDTQVGD  535

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              G QLSGGQKQRIA+ARA+    ++LLLDE +SALD ESE  VQ A+ KIS   TT+V+A
Sbjct  536   RGTQLSGGQKQRIALARALTTDPRILLLDEPTSALDPESESVVQQAIDKISAGRTTLVIA  595

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             HRL+T++ A+ I V+  GAV E G+H KLM  E +G Y  LV+   EA
Sbjct  596   HRLATVRNAHTIVVLNHGAVVETGNHHKLM--EKSGAYYNLVKLASEA  641



>gb|EMT16661.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1288

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/535 (62%), Positives = 427/535 (80%), Gaps = 1/535 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ Q   L+L +VGLGF CI+TM GQQG CG AG +LT R+R+ LF++I++QEP WFD +
Sbjct  755   MRRQIGYLALAVVGLGFACILTMTGQQGFCGWAGARLTMRVRDRLFRAIMRQEPAWFDEE  814

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+ GVLV+RL+ D+++FRS+ GDR++VLLM + SA VGLGI F L+WRLTL+A A TP 
Sbjct  815   DNAMGVLVTRLARDAIAFRSMFGDRYAVLLMAVGSAGVGLGICFGLDWRLTLIAMACTPL  874

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +L++NVG + D ++YARAS+IAAGAVSN+RTVA    Q  IV +F +AL  P 
Sbjct  875   TLGASYLNLLINVGARSDEAAYARASSIAAGAVSNVRTVAALCAQGGIVGTFNRALDGPS  934

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               + R+SQ +G  LG SQGAMYGAYT+TLW GAY + +G++  G V KIFLILVLSSFSV
Sbjct  935   AKAQRKSQYMGIILGLSQGAMYGAYTVTLWAGAYFITKGWSTFGDVSKIFLILVLSSFSV  994

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTS A  AI  +L I+ RRP I  +  ++ R  +  KP D+E   V FAYPS
Sbjct  995   GQLAGLAPDTSGAPTAIAGILSILKRRPTINEEGTKR-RTIKDGKPMDVELRKVIFAYPS  1053

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPDV VL +FSL++K G+ VA+VG SGSGKST++W++QRFYDP+ G V +  +D+REL+L
Sbjct  1054  RPDVTVLNDFSLRVKFGSTVAVVGPSGSGKSTVVWLVQRFYDPLGGTVTVGGMDVRELDL  1113

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR + A+VGQEPALF+G+I ENI FG P A++ EIE AAKEA IHKFI+GLP+GY+T+
Sbjct  1114  KWLRGECAMVGQEPALFSGSIRENIGFGNPKAAWAEIENAAKEANIHKFIAGLPQGYDTQ  1173

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARA+LK+S++LLLDEASSALDLESEKHVQ+ALR++S++ATTI
Sbjct  1174  VGESGVQLSGGQKQRIAIARAVLKQSRILLLDEASSALDLESEKHVQEALRRVSQRATTI  1233

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
              VAHRLSTI++A+ IAVV  G   E+GSH+ L+A+  +G+YA +V+AE EA AFA
Sbjct  1234  TVAHRLSTIRDADRIAVVSAGRTVEFGSHETLLANHRDGLYAAMVKAEIEAQAFA  1288


 Score =   265 bits (677),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 199/519 (38%), Positives = 300/519 (58%), Gaps = 31/519 (6%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   R+R    K++L+QE G+FD  E STG ++  +S D    + V+G++ +  + 
Sbjct  160   IVGERSALRVRREYLKAVLRQEIGFFD-TEVSTGEVMQSISSDVAQIQEVMGEKMAGFVH  218

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   WR+ L   A+T      G +Y ++   +    + +SY  A ++A
Sbjct  219   HVFTFIFGYVVGFRTSWRIALAVLAVTPVMMACGIAYKAIYGGLAAN-EEASYQPAGSVA  277

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S+IRTV +F  ++ +   + + L        R++  +G  +GF++GA         
Sbjct  278   QQAISSIRTVLSFVMEDRLADRYAEWL--------RKASPIGVKMGFAKGAGMGMIYLVT  329

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMA------SA  938
             Y  + L LW+GA LV +G    G     F  +++      +  GLA   S +      +A
Sbjct  330   YSQWALALWYGAKLVAQGEIKGGDAIACFFGVMVGGRQA-RRRGLALSLSYSAQFAQGTA  388

Query  937   AIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIK  758
             A   V EII+R P I  DP   G +  ++    +EF+ V FAYPSRP+ ++L N +L + 
Sbjct  389   AAGRVFEIIDREPEI--DPYGAGGRALSAVRGRMEFKDVEFAYPSRPESLILYNLNLIVP  446

Query  757   GGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPA  578
                M+ALVG SG GKST+  +I+RFYDP +G + ++  DL  LNLKWLRSQ  LVGQEP 
Sbjct  447   AAKMLALVGISGGGKSTVFALIERFYDPTRGTITLDGQDLGSLNLKWLRSQIGLVGQEPI  506

Query  577   LFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQR  398
             LFA +I EN+  G  NA+  E   A  +A  H F+ GLP+GY+T+VG  G QLSGGQKQR
Sbjct  507   LFAVSIIENVMMGKENATRQEAIAACTKANAHTFVLGLPDGYDTQVGDRGTQLSGGQKQR  566

Query  397   IAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVI  218
             IA+ARAI+++ ++LLLDE +SALD ESE  VQ ++ ++S   T +V+AHRL+T++ A+ I
Sbjct  567   IALARAIIREPRILLLDEPTSALDAESEAVVQQSIDRLSVGRTVLVIAHRLATVRNADTI  626

Query  217   AVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
             AV+  GAV E G H  LMA    G YA LV+   ++ +F
Sbjct  627   AVLDRGAVVESGRHADLMAR--GGPYAGLVKIASDSGSF  663



>ref|XP_008669709.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
Length=1405

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/539 (62%), Positives = 428/539 (79%), Gaps = 4/539 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ Q   L+  +VGLG  CI+ M GQQGLCG AG +LT R+R+ LF++IL+QEP WFD +
Sbjct  867   MKRQVGALATAVVGLGVACILAMTGQQGLCGWAGARLTMRVRDRLFRAILRQEPAWFDEE  926

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+ GVLV+RL+ D+V+FRS+ GDR++VLLM + SA VGLGI F+L+WRLTL+A   TP 
Sbjct  927   DNAMGVLVTRLARDAVAFRSMFGDRYAVLLMAVGSAGVGLGICFALDWRLTLVAMGCTPL  986

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +L++NVGP+ D+ +YARAS+IAAGAVSN+RTVA    Q +IV +F +AL  P 
Sbjct  987   TLGASYLNLLINVGPRADDGAYARASSIAAGAVSNVRTVAALCAQGNIVGAFNRALDGPA  1046

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               + RRSQ++G  LG SQGAMYGAYT TLW GA  +K   +  G V KIFLILVLSSFSV
Sbjct  1047  SKARRRSQVMGVILGLSQGAMYGAYTATLWAGALFIKRDLSKFGDVSKIFLILVLSSFSV  1106

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLI----GSDPQRKGRKFETSKPFDIEFEMVTF  815
             GQLAGLAPDTS A  AI  +L I+ RRP I    GS   ++ R  +  +P ++E + V F
Sbjct  1107  GQLAGLAPDTSGAPVAIAGILSILKRRPAISDEDGSGSGKRRRMIKDGRPIEVELKRVVF  1166

Query  814   AYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLR  635
             AYPSRPDV VL  FS+++K G+ VA+VGASGSGKST++W++QRFYDP  G+V++  +D+R
Sbjct  1167  AYPSRPDVTVLNEFSVRVKAGSTVAVVGASGSGKSTVVWLVQRFYDPAGGKVMVGGIDVR  1226

Query  634   ELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEG  455
             EL+LKWLR + ALV QEPALF+G+I ENI FG P AS+ EIEEAAKEA IHKFI+GLP+G
Sbjct  1227  ELDLKWLRGECALVSQEPALFSGSIRENIGFGNPKASWAEIEEAAKEANIHKFIAGLPQG  1286

Query  454   YETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQ  275
             Y+T+VG+SGVQLSGGQKQRIAIARAI+K+S++LLLDEASSALDLESEKHVQ+ALRK+S++
Sbjct  1287  YDTQVGESGVQLSGGQKQRIAIARAIVKQSRILLLDEASSALDLESEKHVQEALRKVSRR  1346

Query  274   ATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             ATTIVVAHRLST++EA+ IAVV  G V E+G H +L+A+  +G+YA +V+AE EA AFA
Sbjct  1347  ATTIVVAHRLSTVREADRIAVVAGGRVVEFGGHQELLATHRDGLYAAMVKAEVEAQAFA  1405


 Score =   271 bits (692),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 197/505 (39%), Positives = 291/505 (58%), Gaps = 24/505 (5%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   R+R    K++L+QE G+FD  E STG ++  +S D    + V+GD+ +  + 
Sbjct  245   MIGERSALRMRREYLKAVLRQEVGFFD-TEVSTGEVMQSISSDVAQIQDVMGDKMAGFVH  303

Query  1429  GLSSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + FS  W++ L   AA     + G +Y ++   +  K D +SY RA ++A
Sbjct  304   HVFTFIFGYAVGFSKSWKIALAVFAATPVMMSCGLAYKAIYGGLTAK-DEASYKRAGSVA  362

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S++RTV +F  ++ +   + + L         R+  +G  +GF++GA         
Sbjct  363   QQAISSVRTVLSFVMEDRLADRYAERLD--------RAAPIGIKMGFAKGAGMGVIYLVT  414

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVL  920
             Y  + L LW G+ LV  G    G     F  +++    +          +   AA   V 
Sbjct  415   YSQWALALWLGSRLVARGDIKGGDAIACFFGVMVGGRGLALSLSYYAQFAQGRAAAGRVF  474

Query  919   EIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVA  740
             EI++R P I  D    G +  +S    IEF+ V FAYPSRP+ +VL N +L I  G M+A
Sbjct  475   EIVDRVPDI--DAYGGGGRSLSSVRGRIEFKDVEFAYPSRPEAMVLYNLNLTIPAGKMLA  532

Query  739   LVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTI  560
             LVG SG GKST+  +++RFYDP +G + ++  DL  LNL+WLRSQ  LVGQEP LFA +I
Sbjct  533   LVGVSGGGKSTMFALLERFYDPTRGTITLDGQDLSSLNLRWLRSQMGLVGQEPVLFATSI  592

Query  559   GENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARA  380
              EN+  G  +A+  E   A  +A  H F+ GLP+GY+T+VG  G QLSGGQKQRIA+ARA
Sbjct  593   IENVMMGKEDATRQEAIAACAKANAHTFVLGLPDGYDTQVGDRGTQLSGGQKQRIALARA  652

Query  379   ILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEG  200
             I++  +VLLLDE +SALD ESE  VQ ++ ++S   T +V+AHRL+T++ A+ IAV+  G
Sbjct  653   IIRDPRVLLLDEPTSALDAESEAVVQQSIERLSAGRTVVVIAHRLATVRNADTIAVLDRG  712

Query  199   AVAEYGSHDKLMASELNGIYATLVR  125
             AV E G HD L+A    G YA LV+
Sbjct  713   AVVESGRHDDLLAR--GGPYAALVK  735



>tpg|DAA38661.1| TPA: hypothetical protein ZEAMMB73_035779 [Zea mays]
Length=1517

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/539 (62%), Positives = 428/539 (79%), Gaps = 4/539 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ Q   L+  +VGLG  CI+ M GQQGLCG AG +LT R+R+ LF++IL+QEP WFD +
Sbjct  979   MKRQVGALATAVVGLGVACILAMTGQQGLCGWAGARLTMRVRDRLFRAILRQEPAWFDEE  1038

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+ GVLV+RL+ D+V+FRS+ GDR++VLLM + SA VGLGI F+L+WRLTL+A   TP 
Sbjct  1039  DNAMGVLVTRLARDAVAFRSMFGDRYAVLLMAVGSAGVGLGICFALDWRLTLVAMGCTPL  1098

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +L++NVGP+ D+ +YARAS+IAAGAVSN+RTVA    Q +IV +F +AL  P 
Sbjct  1099  TLGASYLNLLINVGPRADDGAYARASSIAAGAVSNVRTVAALCAQGNIVGAFNRALDGPA  1158

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               + RRSQ++G  LG SQGAMYGAYT TLW GA  +K   +  G V KIFLILVLSSFSV
Sbjct  1159  SKARRRSQVMGVILGLSQGAMYGAYTATLWAGALFIKRDLSKFGDVSKIFLILVLSSFSV  1218

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLI----GSDPQRKGRKFETSKPFDIEFEMVTF  815
             GQLAGLAPDTS A  AI  +L I+ RRP I    GS   ++ R  +  +P ++E + V F
Sbjct  1219  GQLAGLAPDTSGAPVAIAGILSILKRRPAISDEDGSGSGKRRRMIKDGRPIEVELKRVVF  1278

Query  814   AYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLR  635
             AYPSRPDV VL  FS+++K G+ VA+VGASGSGKST++W++QRFYDP  G+V++  +D+R
Sbjct  1279  AYPSRPDVTVLNEFSVRVKAGSTVAVVGASGSGKSTVVWLVQRFYDPAGGKVMVGGIDVR  1338

Query  634   ELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEG  455
             EL+LKWLR + ALV QEPALF+G+I ENI FG P AS+ EIEEAAKEA IHKFI+GLP+G
Sbjct  1339  ELDLKWLRGECALVSQEPALFSGSIRENIGFGNPKASWAEIEEAAKEANIHKFIAGLPQG  1398

Query  454   YETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQ  275
             Y+T+VG+SGVQLSGGQKQRIAIARAI+K+S++LLLDEASSALDLESEKHVQ+ALRK+S++
Sbjct  1399  YDTQVGESGVQLSGGQKQRIAIARAIVKQSRILLLDEASSALDLESEKHVQEALRKVSRR  1458

Query  274   ATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             ATTIVVAHRLST++EA+ IAVV  G V E+G H +L+A+  +G+YA +V+AE EA AFA
Sbjct  1459  ATTIVVAHRLSTVREADRIAVVAGGRVVEFGGHQELLATHRDGLYAAMVKAEVEAQAFA  1517


 Score =   270 bits (690),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 197/505 (39%), Positives = 291/505 (58%), Gaps = 24/505 (5%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   R+R    K++L+QE G+FD  E STG ++  +S D    + V+GD+ +  + 
Sbjct  357   MIGERSALRMRREYLKAVLRQEVGFFD-TEVSTGEVMQSISSDVAQIQDVMGDKMAGFVH  415

Query  1429  GLSSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + FS  W++ L   AA     + G +Y ++   +  K D +SY RA ++A
Sbjct  416   HVFTFIFGYAVGFSKSWKIALAVFAATPVMMSCGLAYKAIYGGLTAK-DEASYKRAGSVA  474

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+S++RTV +F  ++ +   + + L         R+  +G  +GF++GA         
Sbjct  475   QQAISSVRTVLSFVMEDRLADRYAERLD--------RAAPIGIKMGFAKGAGMGVIYLVT  526

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVL  920
             Y  + L LW G+ LV  G    G     F  +++    +          +   AA   V 
Sbjct  527   YSQWALALWLGSRLVARGDIKGGDAIACFFGVMVGGRGLALSLSYYAQFAQGRAAAGRVF  586

Query  919   EIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVA  740
             EI++R P I  D    G +  +S    IEF+ V FAYPSRP+ +VL N +L I  G M+A
Sbjct  587   EIVDRVPDI--DAYGGGGRSLSSVRGRIEFKDVEFAYPSRPEAMVLYNLNLTIPAGKMLA  644

Query  739   LVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTI  560
             LVG SG GKST+  +++RFYDP +G + ++  DL  LNL+WLRSQ  LVGQEP LFA +I
Sbjct  645   LVGVSGGGKSTMFALLERFYDPTRGTITLDGQDLSSLNLRWLRSQMGLVGQEPVLFATSI  704

Query  559   GENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARA  380
              EN+  G  +A+  E   A  +A  H F+ GLP+GY+T+VG  G QLSGGQKQRIA+ARA
Sbjct  705   IENVMMGKEDATRQEAIAACAKANAHTFVLGLPDGYDTQVGDRGTQLSGGQKQRIALARA  764

Query  379   ILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEG  200
             I++  +VLLLDE +SALD ESE  VQ ++ ++S   T +V+AHRL+T++ A+ IAV+  G
Sbjct  765   IIRDPRVLLLDEPTSALDAESEAVVQQSIERLSAGRTVVVIAHRLATVRNADTIAVLDRG  824

Query  199   AVAEYGSHDKLMASELNGIYATLVR  125
             AV E G HD L+A    G YA LV+
Sbjct  825   AVVESGRHDDLLAR--GGPYAALVK  847



>ref|XP_002447460.1| hypothetical protein SORBIDRAFT_06g001440 [Sorghum bicolor]
 gb|EES11788.1| hypothetical protein SORBIDRAFT_06g001440 [Sorghum bicolor]
Length=1568

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/558 (58%), Positives = 422/558 (76%), Gaps = 23/558 (4%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ Q   L++ +VGLG  CI+ M GQQGLCG AG +LT R+R+ LF++I++QEP WFD +
Sbjct  1011  MKRQVGALAMAMVGLGVACILAMTGQQGLCGWAGARLTMRVRDRLFRAIMRQEPAWFDEE  1070

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+ G+LV+RL+ D+V+FRS+ GDR++VLLM + SA VGLGI F+L+WRLTL+A A TP 
Sbjct  1071  DNAMGILVTRLARDAVAFRSMFGDRYAVLLMAVGSAGVGLGICFALDWRLTLVAMACTPL  1130

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
             TLGASY +L++NVG K D+  +YARAS+IAAGAVSN+RTVA    Q +IV +F +AL  P
Sbjct  1131  TLGASYLNLLINVGAKTDDDGAYARASSIAAGAVSNVRTVAALCAQGNIVGTFNRALDVP  1190

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
                + RRSQ++G  LG SQGAMYGAYT+TLW GA  + +  +  G V KIFLILVLSSFS
Sbjct  1191  VSKARRRSQVMGVILGLSQGAMYGAYTVTLWAGALFINKDQSKFGDVSKIFLILVLSSFS  1250

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKG--RKFETSKPFDIEFEMVTFA  812
             VGQLAGLAPDTS A+ AI  +L I+NRRP I  D    G  R  +  KP D+E + V FA
Sbjct  1251  VGQLAGLAPDTSGAAVAIAGILSILNRRPTITDDGSSGGKRRTIKDGKPMDVELKSVVFA  1310

Query  811   YPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRE  632
             YPSRP+V VL  FS+++K G+ VA+VGASGSGKST++WM+QRFYDP+ G+V++  +D+RE
Sbjct  1311  YPSRPEVRVLNEFSVRVKAGSTVAVVGASGSGKSTVVWMVQRFYDPVDGKVMVGGIDVRE  1370

Query  631   LNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGY  452
             L+LKWLR + A+VGQEPALF+G+I ENI FG   AS+ EIEEAAKEA IHKFI+GLP+GY
Sbjct  1371  LDLKWLRGECAMVGQEPALFSGSIRENIGFGNAKASWAEIEEAAKEANIHKFIAGLPQGY  1430

Query  451   ETkvgqsgvqlsggq--------------------kQRIAIARAILKKSKVllldeassa  332
             ET+   +  Q                         KQRIAIARAI+K+S++LLLDEASSA
Sbjct  1431  ETQKIMNSEQNLTVMIFIFLDEKVGESGVQLSGGQKQRIAIARAIVKQSRILLLDEASSA  1490

Query  331   ldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASEL  152
             LDLESEK VQ+ALRK++++ATTIVVAHRLSTI++A+ +AVV  G VAE+GSH +L+A+  
Sbjct  1491  LDLESEKQVQEALRKVARRATTIVVAHRLSTIRDADRVAVVSNGKVAEFGSHQELLATHR  1550

Query  151   NGIYATLVRAEQEAYAFA  98
             +G+YA +V+AE EA AFA
Sbjct  1551  DGMYAAMVKAEVEAQAFA  1568


 Score =   258 bits (659),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 195/505 (39%), Positives = 288/505 (57%), Gaps = 24/505 (5%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   RIR    K++L+QE G+FD  E STG ++  +S D    + V+GD+ +  + 
Sbjct  378   MIGERSALRIRREYLKAVLRQEIGFFD-TEVSTGEVMQSISSDVAQIQDVMGDKMAGFVH  436

Query  1429  GLSSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W++ L   AA     + G +Y ++   +  K D +SY RA ++A
Sbjct  437   HVFTFIFGYVVGFIKSWKIALAVFAATPVMMSCGLAYKAIYGGLTAK-DEASYKRAGSVA  495

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGA--------M  1100
               A+ +IRTV +F  ++ +   + + L+        R+  +G  LGF++GA         
Sbjct  496   QQAIFSIRTVLSFVMEDRLADRYAEWLN--------RAAPIGIKLGFAKGAGMGVIYLVT  547

Query  1099  YGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVL  920
             Y  + L LW G+ LV  G    G     F  +++    +          +    A   V 
Sbjct  548   YSQWALALWLGSRLVATGDIKGGDAIACFFGVMVGGRGLALSLSYFAQFAQGRVAAGRVF  607

Query  919   EIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVA  740
             EI++R P I +     GR   + +   IEF+ V FAYPSRP+ ++L N +L I    MVA
Sbjct  608   EIVDRVPDIDAYGG-AGRSLSSVRG-RIEFKDVEFAYPSRPEAMILYNLNLTIPASKMVA  665

Query  739   LVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTI  560
             LVG SG GKST+  +++RFYDP +G + ++  DL  LNL+WLRSQ  LVGQEP LFA +I
Sbjct  666   LVGVSGGGKSTMFALLERFYDPTRGIITLDGHDLSSLNLRWLRSQMGLVGQEPVLFATSI  725

Query  559   GENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARA  380
              EN+  G  NA+  E   A  +A  H F+ GLP+GY+T+VG  G QLSGGQKQRIA+ARA
Sbjct  726   VENVMMGKENATRQEAIAACAKANAHTFVLGLPDGYDTQVGDRGTQLSGGQKQRIALARA  785

Query  379   ILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEG  200
             I++  ++LLLDE +SALD ESE  VQ ++ ++S   T +V+AHRL+T++ A+ IAV+  G
Sbjct  786   IIRDPRILLLDEPTSALDAESEAVVQQSIERLSVGRTVVVIAHRLATVRNADTIAVLDRG  845

Query  199   AVAEYGSHDKLMASELNGIYATLVR  125
             AV E G HD L+A    G YA LV+
Sbjct  846   AVVESGRHDDLVAR--GGPYAALVK  868



>gb|AAN65444.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94318.1| ABC transporter family protein, expressed [Oryza sativa Japonica 
Group]
Length=1482

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/534 (62%), Positives = 421/534 (79%), Gaps = 0/534 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ Q + L++ +VGLG  CI+TM GQQGLCG AG +LT R+R+ LF++I++QEP WFD +
Sbjct  948   MKRQVEYLAMAVVGLGVACILTMTGQQGLCGWAGARLTMRVRDRLFRAIMRQEPAWFDEE  1007

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+ GVLV+RL+ D+V+FRS+ GDR++VLLM + SA VGLGI F L+WRLTL+A A TP 
Sbjct  1008  DNAMGVLVTRLARDAVAFRSMFGDRYAVLLMAVGSAGVGLGICFGLDWRLTLVATACTPL  1067

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +L++NVG + D+ +YARAS IAAGAVSN+RTVA    Q  +V +F +AL  P 
Sbjct  1068  TLGASYLNLLINVGARSDDGAYARASGIAAGAVSNVRTVAALCAQGSVVGTFNRALDGPA  1127

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               + RRSQ++G  LG SQGAMYGAYT TL  GA+ +  G +  G V KIFLILVLSSFSV
Sbjct  1128  AKASRRSQLMGVILGLSQGAMYGAYTATLCAGAHFINNGVSTFGDVSKIFLILVLSSFSV  1187

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTS A AAI  +L I+ RRP I  D  ++    +  KP D+E   VTFAYPS
Sbjct  1188  GQLAGLAPDTSGAPAAIAGILTILKRRPAITGDSTKRRITIKDGKPIDVELRKVTFAYPS  1247

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+V VL  FSL++K GT VA+VGASGSGKST++W++QRFYDP  G+V++  VD REL+L
Sbjct  1248  RPEVTVLSGFSLRVKAGTTVAVVGASGSGKSTVVWLVQRFYDPGDGKVVVGGVDARELDL  1307

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR + A+VGQEPALF+G+I +NI FG P AS+ EIEEAAKEA IHKFIS LP+GYET+
Sbjct  1308  KWLRGECAMVGQEPALFSGSIRDNIGFGNPKASWAEIEEAAKEANIHKFISALPQGYETQ  1367

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAI+K++++LLLDEASSALDLESE+HVQ+ALR+ S++AT I
Sbjct  1368  VGESGVQLSGGQKQRIAIARAIVKQARILLLDEASSALDLESERHVQEALRRASRRATAI  1427

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
              VAHRLST+++A+ IAVV  G V E+G HD L+A   +G+YA +V+AE EA AF
Sbjct  1428  TVAHRLSTVRDADRIAVVSAGRVVEFGGHDALLAGHGDGLYAAMVKAETEAQAF  1481


 Score =   232 bits (591),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 188/554 (34%), Positives = 282/554 (51%), Gaps = 72/554 (13%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +   R+R    K++L+QE G+FD  E STG ++  +S D    + V+G++    +  +
Sbjct  296   GERSALRMRREYLKAVLRQEIGFFD-TEVSTGEVMHSISGDVAQIQEVMGEKIPGFVHHV  354

Query  1423  SSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
              +   G  + F+  WR+ L   A        G +Y ++   +  K + +SY RA ++A  
Sbjct  355   FTFVFGYVVGFAKSWRIALAVFAVTPAMMACGMAYKAIYGGLTAK-EEASYQRAGDVAQQ  413

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A+S+IRTV +F  +E +   + + L +     V+     G+ +G      Y  + L LW+
Sbjct  414   AISSIRTVMSFVMEERLAGEYAEWLDKAAPIGVKMGFAKGAGMGVIYLVTYSQWALALWY  473

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTS--------------------  950
             G+ LV  G    G     F  +++     G+ A   P T+                    
Sbjct  474   GSRLVANGEIKGGDAIACFFGVMVG----GRHAHQPPRTASCCRQWRRSPEFRGWGLALT  529

Query  949   --------MASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
                       + A   V E+I+R P I  D    G +   +    +EF+ V FAYPSRPD
Sbjct  530   LSYMAQFAQGTVAAGRVFEVIDRVPEI--DAYGAGGRALPAVKGRMEFKDVEFAYPSRPD  587

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGR----------------  662
              +VL N +L I     +ALVG SG GKST+  +I+RFYDP +G                 
Sbjct  588   AMVLYNLNLVIPAAKTLALVGVSGGGKSTMFALIERFYDPTRGEREWPLTRTQSTTMARS  647

Query  661   ----------------VLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
                             + ++  DL  LNL+WLRSQ  LVGQEP LF+ +I EN+  G  N
Sbjct  648   SVIDDEAFASVGCAGSITLDGHDLASLNLRWLRSQIGLVGQEPVLFSTSIIENVMMGKEN  707

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  +   A   A +H F+  LP+GY+T+VG  G QLSGGQKQRIA+ARAI++  ++LLL
Sbjct  708   ATRHDAISACAMANVHTFVLALPDGYDTQVGDRGAQLSGGQKQRIALARAIIRDPRILLL  767

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DE +SALD +SE  VQ ++ +++   T +V+AHRL+T++ A+ IAV+  GAV E G H  
Sbjct  768   DEPTSALDTQSEAVVQQSIDRLAAGRTVVVIAHRLATVRNADTIAVLDRGAVVESGRHAD  827

Query  169   LMASELNGIYATLV  128
             LMA    G Y+ LV
Sbjct  828   LMARR--GPYSALV  839



>gb|EEE58440.1| hypothetical protein OsJ_09662 [Oryza sativa Japonica Group]
Length=1522

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/534 (62%), Positives = 420/534 (79%), Gaps = 0/534 (0%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ Q + L++ +VGLG  CI+TM GQQGLCG AG +LT R+R+ LF++I++QEP WFD +
Sbjct  988   MKRQVEYLAMAVVGLGVACILTMTGQQGLCGWAGARLTMRVRDRLFRAIMRQEPAWFDEE  1047

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+ GVLV+RL+ D+V+FRS+ GDR++VLLM + SA VGLGI F L+WRLTL+A A TP 
Sbjct  1048  DNAMGVLVTRLARDAVAFRSMFGDRYAVLLMAVGSAGVGLGICFGLDWRLTLVATACTPL  1107

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
             TLGASY +L++NVG + D+ +YARAS IAAGAVSN+RTVA    Q  +V +F +AL  P 
Sbjct  1108  TLGASYLNLLINVGARSDDGAYARASGIAAGAVSNVRTVAALCAQGSVVGTFNRALDGPA  1167

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               + RRSQ++G  LG SQGAMYGAYT TL  GA+ +  G +  G V KIFLILVLSSFSV
Sbjct  1168  AKASRRSQLMGVILGLSQGAMYGAYTATLCAGAHFINNGVSTFGDVSKIFLILVLSSFSV  1227

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTS A AAI  +L I+ RRP I  D  ++    +  KP D+E   VTFAYPS
Sbjct  1228  GQLAGLAPDTSGAPAAIAGILTILKRRPAITGDSTKRRITIKDGKPIDVELRKVTFAYPS  1287

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+V VL  FSL++K GT VA+VGASGSGKST++W++QRFYDP  G+V++  VD REL+L
Sbjct  1288  RPEVTVLSGFSLRVKAGTTVAVVGASGSGKSTVVWLVQRFYDPGDGKVVVGGVDARELDL  1347

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR + A+VGQEPALF+G+I +NI FG P AS+ EIEEAAKEA IHKFIS LP+GYET+
Sbjct  1348  KWLRGECAMVGQEPALFSGSIRDNIGFGNPKASWAEIEEAAKEANIHKFISALPQGYETQ  1407

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAI+K++++LLLDEASSALDLESE+HVQ+ALR+ S++AT I
Sbjct  1408  VGESGVQLSGGQKQRIAIARAIVKQARILLLDEASSALDLESERHVQEALRRASRRATAI  1467

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
              VAHRLST+++A+ IAVV  G V E+G HD L+A   +G+YA +V+AE EA  F
Sbjct  1468  TVAHRLSTVRDADRIAVVSAGRVVEFGGHDALLAGHGDGLYAAMVKAETEAQGF  1521


 Score =   232 bits (591),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 188/554 (34%), Positives = 282/554 (51%), Gaps = 72/554 (13%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +   R+R    K++L+QE G+FD  E STG ++  +S D    + V+G++    +  +
Sbjct  336   GERSALRMRREYLKAVLRQEIGFFD-TEVSTGEVMHSISGDVAQIQEVMGEKIPGFVHHV  394

Query  1423  SSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
              +   G  + F+  WR+ L   A        G +Y ++   +  K + +SY RA ++A  
Sbjct  395   FTFVFGYVVGFAKSWRIALAVFAVTPAMMACGMAYKAIYGGLTAK-EEASYQRAGDVAQQ  453

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A+S+IRTV +F  +E +   + + L +     V+     G+ +G      Y  + L LW+
Sbjct  454   AISSIRTVMSFVMEERLAGEYAEWLDKAAPIGVKMGFAKGAGMGVIYLVTYSQWALALWY  513

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTS--------------------  950
             G+ LV  G    G     F  +++     G+ A   P T+                    
Sbjct  514   GSRLVANGEIKGGDAIACFFGVMVG----GRHAHQPPRTASCCRQWRRSPEFRGWGLALT  569

Query  949   --------MASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
                       + A   V E+I+R P I  D    G +   +    +EF+ V FAYPSRPD
Sbjct  570   LSYMAQFAQGTVAAGRVFEVIDRVPEI--DAYGAGGRALPAVKGRMEFKDVEFAYPSRPD  627

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGR----------------  662
              +VL N +L I     +ALVG SG GKST+  +I+RFYDP +G                 
Sbjct  628   AMVLYNLNLVIPAAKTLALVGVSGGGKSTMFALIERFYDPTRGEREWPLTRTQSTTMARS  687

Query  661   ----------------VLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
                             + ++  DL  LNL+WLRSQ  LVGQEP LF+ +I EN+  G  N
Sbjct  688   SVIDDEAFASVGCAGSITLDGHDLASLNLRWLRSQIGLVGQEPVLFSTSIIENVMMGKEN  747

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  +   A   A +H F+  LP+GY+T+VG  G QLSGGQKQRIA+ARAI++  ++LLL
Sbjct  748   ATRHDAISACAMANVHTFVLALPDGYDTQVGDRGAQLSGGQKQRIALARAIIRDPRILLL  807

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DE +SALD +SE  VQ ++ +++   T +V+AHRL+T++ A+ IAV+  GAV E G H  
Sbjct  808   DEPTSALDTQSEAVVQQSIDRLAAGRTVVVIAHRLATVRNADTIAVLDRGAVVESGRHAD  867

Query  169   LMASELNGIYATLV  128
             LMA    G Y+ LV
Sbjct  868   LMARR--GPYSALV  879



>ref|XP_009389871.1| PREDICTED: ABC transporter B family member 19-like [Musa acuminata 
subsp. malaccensis]
Length=1457

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/529 (63%), Positives = 430/529 (81%), Gaps = 1/529 (0%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L++ +VGLG GCI+TM GQ GLCG AGT+LT R+RN LF+SIL+QEPGWFD  ENSTG L
Sbjct  929   LAVAIVGLGVGCILTMTGQHGLCGWAGTRLTIRVRNRLFRSILRQEPGWFDLAENSTGAL  988

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
             +S LS+D  +FRS+LGDR SVLLMGL S A GLG SF+L+WRLTL+A A+ PFTLGASYF
Sbjct  989   ISWLSVDCAAFRSMLGDRHSVLLMGLGSVAAGLGASFALDWRLTLVAMAVAPFTLGASYF  1048

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             SL++N+GP+ D+ +YA AS++AAGAVS +RT+A FS Q+ IV +F++ LSEP   S+ R+
Sbjct  1049  SLLVNLGPRSDDGAYAAASSVAAGAVSGVRTIAAFSAQQRIVSTFDRVLSEPMNKSMNRA  1108

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              ++G  LG SQGAMYGAYTL LW GA ++K GY++ G V KIFLILVLSSFSVGQLAGLA
Sbjct  1109  HLMGLGLGLSQGAMYGAYTLILWAGARMMKSGYSSFGDVCKIFLILVLSSFSVGQLAGLA  1168

Query  961   PDTSMASAAIPAVLEIINRRP-LIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
             P+TS A AAI  VL II RRP ++ ++  +KGR+ E  +  ++E   VTF+YPSRP V V
Sbjct  1169  PNTSRAPAAIDRVLRIIKRRPSMMDTEGPQKGRRVEGGRLMEVELRRVTFSYPSRPGVAV  1228

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
             LR FS++++ G+ VALVG SGSGKST++W++QRFYDP  GRV++  +D+RE ++KWLR +
Sbjct  1229  LREFSMRVRAGSTVALVGDSGSGKSTVVWLVQRFYDPEAGRVVVGGLDVREADVKWLRKE  1288

Query  604   TALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              ALVGQEP LF G+I +NI FG  +AS+ EIEEAA+ A+IHKFISGLP+GYET+VG+ GV
Sbjct  1289  CALVGQEPCLFGGSIRDNIRFGDQSASWAEIEEAAEAAHIHKFISGLPQGYETQVGEGGV  1348

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARAILK+S++LLLDEA+SALD+ESE+ VQ+ALRK SK+ATTI++AHRL
Sbjct  1349  QLSGGQKQRIAIARAILKRSRILLLDEATSALDVESERQVQEALRKASKRATTIIIAHRL  1408

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             + +++A+ +AVV++G V E+GSH  L+ + ++G+YA +VR E EA A A
Sbjct  1409  AAVRDADRVAVVRDGTVVEFGSHRSLLENHVDGVYAAMVRRESEAQALA  1457


 Score =   251 bits (642),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 181/497 (36%), Positives = 278/497 (56%), Gaps = 8/497 (2%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +   RIR    ++ L+Q+ G+FD  E STG ++  +S D    + V+G++ +  + 
Sbjct  317   MVGERSAQRIRREYLRAALRQDIGFFD-TEMSTGDVMLGISSDVALIQEVMGEKVAHFVH  375

Query  1429  GLSSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIA  1256
              + +   G  + F   W++ L+  +        G +Y ++   +    + +SY RA ++A
Sbjct  376   HIFTFICGYMVGFLEAWKVALVVFSVTPVMMFCGIAYKAIYGGLAAA-EEASYRRAGDVA  434

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTL  1076
               A+++IRTV +F  ++ +   +E+ L +     V+     G+ +G      Y  + L  
Sbjct  435   QQAITSIRTVLSFVMEDEMAAKYEEGLQKSAPIGVKTGFAKGAGMGVIYLVTYSQWALAF  494

Query  1075  WFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPL  896
             W+G+ LV +G    GA    F  + +    +          +  + A   V E+I+R P 
Sbjct  495   WYGSLLVAKGEITGGAAIACFFAVNVGGRGLALSLSYYAQFAQGTVAAGRVFEVIDRTPE  554

Query  895   IGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSG  716
             I  DP     +   S    +EF  V FAYPSRPD ++LR+  L I     +ALVGASG G
Sbjct  555   I--DPYSSDGRALASVRGRVEFRGVDFAYPSRPDTMILRDLDLTIPASKTLALVGASGGG  612

Query  715   KSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGF  536
             KST+  +I+RFYDP +G + ++  DLR L ++WLR Q AL+GQEP LF+ +I EN+  G 
Sbjct  613   KSTIFALIERFYDPCRGSIRLDGHDLRTLRIQWLREQIALLGQEPVLFSTSILENVMMGR  672

Query  535   PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVl  356
              +A+  E   A        FISGLPEGY+T+VG+ G QLSGGQKQRIA+ARA+++  ++L
Sbjct  673   EDATRKEAIAACAAVNADTFISGLPEGYDTQVGERGAQLSGGQKQRIALARAMIRNPRIL  732

Query  355   lldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSH  176
             LLDE +SALD ESE  VQ A+ + S   TT+V+AHRL+T++ A+ I V+  G+V E G H
Sbjct  733   LLDEPTSALDPESEATVQRAIDRFSAGRTTVVIAHRLATVRSADTIVVLDSGSVVESGGH  792

Query  175   DKLMASELNGIYATLVR  125
               LM     G YA LV+
Sbjct  793   HDLMGRA--GPYAALVK  807



>gb|EEC74635.1| hypothetical protein OsI_10267 [Oryza sativa Indica Group]
Length=1524

 Score =   558 bits (1437),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 322/534 (60%), Positives = 409/534 (77%), Gaps = 13/534 (2%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ Q + L++ +VGLG  CI+TM GQQGLCG AG +LT R+R+ LF++I++QEP WFD +
Sbjct  1003  MKRQVEYLAMAVVGLGVACILTMTGQQGLCGWAGARLTMRVRDRLFRAIMRQEPAWFDEE  1062

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N+ GVLV+RL+ D+V+FRS+ GDR+ VLLM + SA VGLGI F L+WRLTLL       
Sbjct  1063  DNAMGVLVTRLARDAVAFRSMFGDRYPVLLMAVGSAGVGLGICFGLDWRLTLLP------  1116

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
                     L++NVG + D+ +YARAS IAAGAVSN+RTVA    Q  +V +F +AL  P 
Sbjct  1117  -------HLLINVGARSDDGAYARASGIAAGAVSNVRTVAALCAQGSVVGTFNRALDGPA  1169

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
               + RRSQ++G  LG SQGAMYGAYT TL  GA+ +  G +  G V KIFLILVLSSFSV
Sbjct  1170  AKASRRSQLMGVILGLSQGAMYGAYTATLCAGAHFINNGVSTFGDVSKIFLILVLSSFSV  1229

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
             GQLAGLAPDTS A AAI  +L I+ RRP I  D  ++    +  KP D+E   VTFAYPS
Sbjct  1230  GQLAGLAPDTSGAPAAIAGILTILKRRPAITGDSTKRRITIKDGKPIDVELRKVTFAYPS  1289

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP+V VL  FSL++K GT VA+VGASGSGKST++W++QRFYDP  G+V++  VD REL+L
Sbjct  1290  RPEVTVLSGFSLRVKAGTTVAVVGASGSGKSTVVWLVQRFYDPGDGKVVVGGVDARELDL  1349

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             KWLR + A+VGQEPALF+G+I +NI FG P AS+ EIEEAAKEA IHKFIS LP+GYET+
Sbjct  1350  KWLRGECAMVGQEPALFSGSIRDNIRFGNPKASWAEIEEAAKEANIHKFISALPQGYETQ  1409

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+SGVQLSGGQKQRIAIARAI+K++++LLLDEASSALDLESE+HVQ+ALR+ S++AT I
Sbjct  1410  VGESGVQLSGGQKQRIAIARAIVKQARILLLDEASSALDLESERHVQEALRRASRRATAI  1469

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAF  101
              VAHRLST+++A+ IAVV  G V E+G HD L+A   +G+YA +V+AE EA AF
Sbjct  1470  TVAHRLSTVRDADRIAVVSAGRVVEFGGHDALLAGHGDGLYAAMVKAETEAQAF  1523


 Score =   232 bits (591),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 191/550 (35%), Positives = 284/550 (52%), Gaps = 64/550 (12%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +   R+R    K++L+QE G+FD  E STG ++  +S D    + V+G++    +  +
Sbjct  351   GERSALRMRREYLKAVLRQEIGFFD-TEVSTGEVMHSISGDVAQIQEVMGEKMPGFVHHV  409

Query  1423  SSAAVGLGISFSLEWRltll--aaaltpftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
              +   G  + F+  WR+ L   A        G +Y ++   +  K + +SY RA ++A  
Sbjct  410   FTFVFGYVVGFAKSWRIALAVFAVTPAMMACGMAYKAIYGGLTAK-EEASYQRAGDVAQQ  468

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A+S+IRTV +F  +E +   + + L +     V+     G+ +G      Y  + L LW+
Sbjct  469   AISSIRTVMSFVMEERLAGEYAEWLDKAAPIGVKMGFAKGAGMGVIYLVTYSQWALALWY  528

Query  1069  GAYLVKEGYTNIGAVYKIFLILVL----------SSFSVGQLA--------GLAPDTS--  950
             G+ LV  G    G     F  +++          ++F   Q          GLA   S  
Sbjct  529   GSRLVANGEIKGGDAIACFFGVMVGGRHAHQPPRTAFCCRQWRRSPEFRGWGLALTLSYM  588

Query  949   ----MASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
                   + A   V E+I+R P I  D    G +   +    +EF+ V FAYPSRPD +VL
Sbjct  589   AQFAQGTVAAGRVFEVIDRVPEI--DAYGAGGRALPAVKGRMEFKDVEFAYPSRPDAMVL  646

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGR--------------------  662
              N +L I     +ALVG SG GKST+  +I+RFYDP +G                     
Sbjct  647   YNLNLVIPAAKTLALVGVSGGGKSTMFALIERFYDPTRGEREWPLTRTQSTTMARSSVID  706

Query  661   ------------VLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYT  518
                         + ++  DL  LNL+WLRSQ  LVGQEP LF+ +I EN+  G  NA+  
Sbjct  707   DEAFASLGCAGSITLDGHDLASLNLRWLRSQIGLVGQEPVLFSTSIIENVMMGKENATRH  766

Query  517   EIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeas  338
             +   A   A +H F+  LP+GY+T+VG  G QLSGGQKQRIA+ARAI++  ++LLLDE +
Sbjct  767   DAISACAMANVHTFVLALPDGYDTQVGDRGAQLSGGQKQRIALARAIIRDPRILLLDEPT  826

Query  337   saldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMAS  158
             SALD ESE  VQ ++ +++   T +V+AHRL+T++ A+ IAV+  GAV E G H  LMA 
Sbjct  827   SALDTESEAVVQQSIDRLAAGRTVVVIAHRLATVRNADTIAVLDRGAVVESGRHADLMAR  886

Query  157   ELNGIYATLV  128
                G Y+ LV
Sbjct  887   R--GPYSALV  894



>ref|XP_007135398.1| hypothetical protein PHAVU_010G1262001g, partial [Phaseolus vulgaris]
 gb|ESW07392.1| hypothetical protein PHAVU_010G1262001g, partial [Phaseolus vulgaris]
Length=381

 Score =   513 bits (1322),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 280/381 (73%), Positives = 331/381 (87%), Gaps = 1/381 (0%)
 Frame = -1

Query  1240  NIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAY  1061
             +IRTV TFS QE IV+SF++ALSEP++ S+R SQ+ G   G  QG+MYGAYTLTLWFG+Y
Sbjct  2     HIRTVTTFSAQEQIVKSFDRALSEPRKKSLRSSQLQGFVFGLFQGSMYGAYTLTLWFGSY  61

Query  1060  LVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDP  881
             LV+     +G V+KIFLILVLSSFSVGQLAGLAPDTSMA+ AIPAV +II RRPLI +D 
Sbjct  62    LVEHDKAKLGDVFKIFLILVLSSFSVGQLAGLAPDTSMAATAIPAVQDIIKRRPLINND-  120

Query  880   QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLI  701
             + K RK + SKPF+IEF+MVTFAYPSRP+V VLR+F LK+KGG+ VALVG SGSGKST+I
Sbjct  121   RTKVRKVDKSKPFNIEFKMVTFAYPSRPEVTVLRDFCLKVKGGSTVALVGPSGSGKSTVI  180

Query  700   WMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASY  521
             W+ QRFYDP QG+V++  VDLRE+++KWLR Q ALVGQEP LFAG+I ENIAFG PNAS+
Sbjct  181   WLTQRFYDPDQGKVMLSGVDLREIDVKWLRRQMALVGQEPTLFAGSIRENIAFGDPNASW  240

Query  520   TEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldea  341
             TEIEEAAKEAYIHKFISGLP+GYET+VG+SGVQLSGGQKQRIAIARAILK+S+VLLLDEA
Sbjct  241   TEIEEAAKEAYIHKFISGLPQGYETQVGESGVQLSGGQKQRIAIARAILKRSRVLLLDEA  300

Query  340   ssaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMA  161
             SSALDLESEKHVQ+AL+ + K+ATTI+VAHRLSTI+EA  IAV+++G V EYGSHD LMA
Sbjct  301   SSALDLESEKHVQEALKNVGKEATTIIVAHRLSTIREAGKIAVMRDGEVVEYGSHDTLMA  360

Query  160   SELNGIYATLVRAEQEAYAFA  98
             S  NG+YA+LVRAE EA AF+
Sbjct  361   STQNGLYASLVRAETEANAFS  381



>gb|EMS48444.1| ABC transporter B family member 19 [Triticum urartu]
Length=352

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 251/329 (76%), Gaps = 1/329 (0%)
 Frame = -1

Query  1432  MGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
             M + SA VGLGI F L+WRLTL+A A TP TLGASY +L++NVG + D ++YARAS+IAA
Sbjct  1     MAVGSAGVGLGICFGLDWRLTLIAMACTPLTLGASYLNLLINVGARSDEAAYARASSIAA  60

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
             GAVSN+RTVA    Q  IV +F +AL  P   + R+SQ +G  LG SQGAMYGAYT+TLW
Sbjct  61    GAVSNVRTVAALCAQGGIVGTFNRALDGPSAKAQRKSQYMGIILGLSQGAMYGAYTVTLW  120

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
              GAY + +G++  G V KIFLILVLSSFSVGQLAGLAPDTS A  AI  +L I+ RRP I
Sbjct  121   AGAYFITKGWSTFGDVSKIFLILVLSSFSVGQLAGLAPDTSGAPTAIAGILSILKRRPTI  180

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
               +  ++ R  +  KP D+E   V FAYPSRPDV VL +FSL++K G+ VA+VG SGSGK
Sbjct  181   NEEGTKR-RTIKDGKPMDVELRKVIFAYPSRPDVTVLNDFSLRVKFGSTVAVVGPSGSGK  239

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST++W++QRFYDP+ G V +  +D+REL+LKWLR + A+VGQEPALF+G+I ENI FG P
Sbjct  240   STVVWLVQRFYDPLGGTVTVGGMDVRELDLKWLRGECAMVGQEPALFSGSIRENIGFGNP  299

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYET  446
              A++ EIE AAKEA IHKFI+GLP+GY+T
Sbjct  300   KAAWAEIENAAKEANIHKFIAGLPQGYDT  328



>ref|XP_001757525.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
 gb|EDQ77582.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
Length=1251

 Score =   376 bits (966),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 232/530 (44%), Positives = 333/530 (63%), Gaps = 4/530 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + + LI      G +V  + Q    GL G  LT R+R  LF SIL QE GWFD +
Sbjct  713   VEHEVRKICLIFSAATVGTVVIYVLQHYYYGLMGEILTMRVRKMLFSSILTQEVGWFDEE  772

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
              N++ ++ +RLS D+   ++ +GDR S ++   S       ISF L+W++  +     P 
Sbjct  773   SNNSNLVSARLSSDATLVKAAVGDRMSTIVQNFSLVVTAFCISFYLQWKVAGVVLLTFPL  832

Query  1342  tLGASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              +GA+    +   G   D   +Y RAS +A  AV NIRTVA F  ++ ++  F + L EP
Sbjct  833   LVGAAVGEQLFLKGFGGDLGKAYGRASMVAGEAVGNIRTVAAFCAEDKVLDLFIRELDEP  892

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ +  R Q+ G   G SQ  +Y +Y L LW+ + LVK    +   V K+F++L++++F 
Sbjct  893   RKRTFLRGQLSGIGYGLSQFFLYSSYGLALWYSSVLVKSSKAHFSEVLKVFMVLIITAFG  952

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAPD    SAA+ +V EI++R+  I  DP     +  T    +IE + V+FAYP
Sbjct  953   VAETLALAPDIVKGSAALASVFEILDRKTAI--DPDSPLGEEVTRVQGEIELKHVSFAYP  1010

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
              RPD+ +  NF LK+K G  +ALVG SGSGKS++I +IQRFYDP+ G V ++ +D+R++ 
Sbjct  1011  QRPDIHIFTNFDLKVKKGRSLALVGQSGSGKSSVIALIQRFYDPLSGAVFVDGIDIRKMR  1070

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR    LV QEP+LFA +I ENI +G   AS +E+ EAAK A  H FISGLP GY+T
Sbjct  1071  LKSLRRHIGLVSQEPSLFACSIYENILYGKEGASESEVIEAAKTANAHSFISGLPNGYQT  1130

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
             +VG+ G+QLSGGQKQR+AIARA+LK   +LLLDEA+SALD +SEK VQ+AL ++  + TT
Sbjct  1131  EVGERGMQLSGGQKQRVAIARAVLKDPSILLLDEATSALDSQSEKLVQEALDRMMYRRTT  1190

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             +V+AHRLSTI+  N IAV+K G V E G+H  LMA+  +G Y  LV+ + 
Sbjct  1191  VVIAHRLSTIRNVNAIAVIKAGKVVEQGTHSALMANA-DGAYTQLVKLQH  1239


 Score =   271 bits (694),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 200/498 (40%), Positives = 302/498 (61%), Gaps = 9/498 (2%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++R+R    K++L Q+ G+FD D  +TG  VSR+S D++  +  + ++    +  +
Sbjct  102   GERQSARMRVAYLKAMLAQDVGFFDTDA-TTGETVSRISSDTLLVQDAISEKAGNYVHYM  160

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             +    G  + F+  W+LTL+  A+       G SY  +++ +  +    +Y++A  IA  
Sbjct  161   ARFISGFAVGFTSVWQLTLVTVAVVPLIAIAGGSYAVVMIGLTSR-SQKAYSKAGEIAEE  219

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A+S IRTV +F  ++  V+ +  AL    +   +     G  +G + G ++GA+ L LW+
Sbjct  220   AISQIRTVYSFVGEKKAVKKYSNALETTLQLGKKGGLAKGLGVGCTYGLLFGAWALLLWY  279

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                LV    TN G  +   L +++S  ++GQ A          AA   +L +I ++PL+ 
Sbjct  280   AHILVLHNVTNGGEAFTTILNVIISGIALGQAAPNLTTFGKGKAAGYNILSMIAKKPLVN  339

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              +  R G      +   I+ + V F+YPSRPDV + +N  L I  G   ALVG SGSGKS
Sbjct  340   RN--RDGSILCQVRG-QIQLKNVAFSYPSRPDVQIFQNLCLTIPAGKSAALVGGSGSGKS  396

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T+I +I+RFYDP  G VL++  +++ L L+WLR Q  LV QEPALFA +I ENI +G   
Sbjct  397   TVIALIERFYDPSSGEVLLDGFNIKNLELQWLREQIGLVNQEPALFATSILENILYGKDG  456

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  EI++AAK A  H FI  LP GY+T+VG+ GVQLSGGQKQR+AIARA+LK   +LLL
Sbjct  457   ATIQEIQDAAKAANAHAFIDSLPNGYDTQVGEKGVQLSGGQKQRVAIARAMLKNPSILLL  516

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTIK A++IAV+++G V E G+H +
Sbjct  517   DEATSALDSGSESIVQEALDRLMLGRTTVVVAHRLSTIKNADMIAVLQQGVVVETGTHGE  576

Query  169   LMASELNGIYATLVRAEQ  116
             L++   +G YA LV+ ++
Sbjct  577   LLSQ--DGAYAQLVKMQE  592



>dbj|BAJ53110.1| JHL20J20.17 [Jatropha curcas]
Length=1135

 Score =   374 bits (961),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 330/530 (62%), Gaps = 3/530 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + ++ I VGL    I   + Q     L G +LT+R+R  +F +IL  E GWFD D
Sbjct  604   MKHEIRRVAFIFVGLAVVTIPIYLLQHYFYTLMGERLTARVRLSMFTAILSNEIGWFDLD  663

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN+TG L S L+ D+   RS L DR S ++  ++  A    I+F+L WR+  +  A  P 
Sbjct  664   ENNTGSLTSTLAADATLVRSALADRLSTIVQNVALTATACVIAFTLSWRIAAVVVASFPL  723

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
              +GAS   L+   G   D  +Y++A+++A  A++NIRTVA F  +E I   F   L++P 
Sbjct  724   LIGASIAELLFLKGFGGDYQAYSKATSLAREALTNIRTVAAFGAEERISFEFASQLNKPN  783

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + ++ R  + G   G +Q   +G+Y L LW+ + L+    +N G + K F++L++++ SV
Sbjct  784   KQALLRGHMSGFGYGLTQLFAFGSYALGLWYASVLITHKESNFGHITKSFMVLIVTALSV  843

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
              +   LAPD    S A+ +V  II+R+  I  DP     K  T    DIEF  VTF YP+
Sbjct  844   AETLALAPDIVKGSQALESVFTIIHRKTAI--DPNNSTSKVVTYINGDIEFRNVTFKYPA  901

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP + +    +L +  G  +A+VG SGSGKST+I +I RFYDPI G VL++  D++ LNL
Sbjct  902   RPHITIFERLNLTVPAGKSLAVVGQSGSGKSTIISLILRFYDPISGTVLIDGCDIKSLNL  961

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K LR +  LV QEPALF+ TI ENI +G  NAS  EI +AAK A  H FIS +PEGY+T 
Sbjct  962   KSLRLKIGLVQQEPALFSTTIYENIKYGNENASEMEIMKAAKAANAHGFISRMPEGYQTH  1021

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG  G+QLSGGQKQR+AIARAILK   +LLLDEA+SALD  SEK VQ+AL  + +  TT+
Sbjct  1022  VGNRGLQLSGGQKQRVAIARAILKDPSILLLDEATSALDTTSEKVVQEALDMLMEGRTTV  1081

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             +VAHRLSTI+ A+ IAV++ G VAE GSH +LM    + IY  LV  +QE
Sbjct  1082  LVAHRLSTIRNADSIAVLQNGRVAEIGSHMQLMGKP-DSIYRQLVSLQQE  1130


 Score =   259 bits (663),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 198/496 (40%), Positives = 292/496 (59%), Gaps = 13/496 (3%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + TSR+R    +S+LK++  +FD +   + ++   +S D++  +  +GD+    +  L
Sbjct  8     GERQTSRLRLKYLQSVLKKDMNFFDTEAGDSNIIF-HISSDAILVQDAIGDKTGHAIRYL  66

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG  + F+  W+LTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  67    SQFVVGFAVGFASVWQLTLLTLAVVPLIAVAGGAY-TIIMSTLSEKGEAAYAEAGKVADE  125

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S IRTV +F  ++  ++++ + L +  +   +     G  +GF+ G ++ A+ L LW+
Sbjct  126   VISQIRTVYSFVGEDKAIETYSRYLKKALKVGKKGGVAKGVGVGFTYGLLFCAWALLLWY  185

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
              + LV+   TN    + + + ++ S F++GQ     P+ +  +    A   II+      
Sbjct  186   ASILVRHHVTNGAKAFTMIINVIFSGFALGQAT---PNLAAIAKGRAAAANIISMIK-TD  241

Query  889   SDPQRKGRKFETSKPFD--IEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSG  716
             S+P +           D  IEF  V F YPSR    V  N S  I  G   A+VG SGSG
Sbjct  242   SNPSKISEDGAELPKIDGKIEFCNVCFTYPSRTGK-VFENLSFSISAGKTFAVVGPSGSG  300

Query  715   KSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGF  536
             KST+I M+QRFYDP  G++L++  D++ L LKWLR Q  LV QEPALFA TI +NI FG 
Sbjct  301   KSTIISMVQRFYDPNSGKILLDGHDIKALRLKWLREQMGLVSQEPALFATTIADNILFGK  360

Query  535   PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVl  356
               AS +++ +AA+ A  H FI  LP+GY T+VG+ G QLSGGQKQRIAIARA+L+  ++L
Sbjct  361   EAASMSQVIQAAEAANAHSFIQQLPDGYHTQVGEGGTQLSGGQKQRIAIARAVLRNPRIL  420

Query  355   lldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSH  176
             LLDEA+SALD ESE  VQ AL KI    TTI+VAHRLSTI++ + I V+K G VAE G+H
Sbjct  421   LLDEATSALDAESELIVQQALDKIMSYRTTIIVAHRLSTIRDVDSIIVLKNGQVAESGNH  480

Query  175   DKLMASELNGIYATLV  128
               L++    G YATLV
Sbjct  481   LDLISK--GGEYATLV  494



>dbj|BAF01897.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=600

 Score =   360 bits (924),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 342/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  71    MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  130

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  131   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  190

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  191   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  250

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  251   QKRSLYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  310

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  311   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  368

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  369   SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  428

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ +AA+ A  H FISGLPEGY+T
Sbjct  429   LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIDAARAANAHGFISGLPEGYKT  488

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  489   PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  548

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  549   VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  596



>gb|KDP36900.1| hypothetical protein JCGZ_08191 [Jatropha curcas]
Length=1221

 Score =   374 bits (960),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 330/530 (62%), Gaps = 3/530 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + ++ I VGL    I   + Q     L G +LT+R+R  +F +IL  E GWFD D
Sbjct  690   MKHEIRRVAFIFVGLAVVTIPIYLLQHYFYTLMGERLTARVRLSMFTAILSNEIGWFDLD  749

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN+TG L S L+ D+   RS L DR S ++  ++  A    I+F+L WR+  +  A  P 
Sbjct  750   ENNTGSLTSTLAADATLVRSALADRLSTIVQNVALTATACVIAFTLSWRIAAVVVASFPL  809

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
              +GAS   L+   G   D  +Y++A+++A  A++NIRTVA F  +E I   F   L++P 
Sbjct  810   LIGASIAELLFLKGFGGDYQAYSKATSLAREALTNIRTVAAFGAEERISFEFASQLNKPN  869

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + ++ R  + G   G +Q   +G+Y L LW+ + L+    +N G + K F++L++++ SV
Sbjct  870   KQALLRGHMSGFGYGLTQLFAFGSYALGLWYASVLITHKESNFGHITKSFMVLIVTALSV  929

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
              +   LAPD    S A+ +V  II+R+  I  DP     K  T    DIEF  VTF YP+
Sbjct  930   AETLALAPDIVKGSQALESVFTIIHRKTAI--DPNNSTSKVVTYINGDIEFRNVTFKYPA  987

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RP + +    +L +  G  +A+VG SGSGKST+I +I RFYDPI G VL++  D++ LNL
Sbjct  988   RPHITIFERLNLTVPAGKSLAVVGQSGSGKSTIISLILRFYDPISGTVLIDGCDIKSLNL  1047

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K LR +  LV QEPALF+ TI ENI +G  NAS  EI +AAK A  H FIS +PEGY+T 
Sbjct  1048  KSLRLKIGLVQQEPALFSTTIYENIKYGNENASEMEIMKAAKAANAHGFISRMPEGYQTH  1107

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG  G+QLSGGQKQR+AIARAILK   +LLLDEA+SALD  SEK VQ+AL  + +  TT+
Sbjct  1108  VGNRGLQLSGGQKQRVAIARAILKDPSILLLDEATSALDTTSEKVVQEALDMLMEGRTTV  1167

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             +VAHRLSTI+ A+ IAV++ G VAE GSH +LM    + IY  LV  +QE
Sbjct  1168  LVAHRLSTIRNADSIAVLQNGRVAEIGSHMQLMGKP-DSIYRQLVSLQQE  1216


 Score =   229 bits (585),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 197/521 (38%), Positives = 285/521 (55%), Gaps = 41/521 (8%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L LV LG    V+           G + TSR+R    +S+LK++  +FD +   + ++ 
Sbjct  97    ALYLVYLGLAVFVSAWMGVAFWMQTGERQTSRLRLKYLQSVLKKDMNFFDTEAGDSNIIF  156

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGASY  1325
               +S D++  +  +GD+    +  LS   VG  + F+  W+LTLL  A+       G +Y
Sbjct  157   -HISSDAILVQDAIGDKTGHAIRYLSQFVVGFAVGFASVWQLTLLTLAVVPLIAVAGGAY  215

Query  1324  FSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
              ++IM+   +   ++YA A  +A   +S IRTV +F  ++  ++++ + L +  +   + 
Sbjct  216   -TIIMSTLSEKGEAAYAEAGKVADEVISQIRTVYSFVGEDKAIETYSRYLKKALKVGKKG  274

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
                 G  +GF+ G ++ A+ L L                             ++GQ    
Sbjct  275   GVAKGVGVGFTYGLLFCAWALLLC----------------------------ALGQAT--  304

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFD--IEFEMVTFAYPSRPDV  791
              P+ +  +    A   II+      S+P +           D  IEF  V F YPSR   
Sbjct  305   -PNLAAIAKGRAAAANIISMIK-TDSNPSKISEDGAELPKIDGKIEFCNVCFTYPSRTGK  362

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
              V  N S  I  G   A+VG SGSGKST+I M+QRFYDP  G++L++  D++ L LKWLR
Sbjct  363   -VFENLSFSISAGKTFAVVGPSGSGKSTIISMVQRFYDPNSGKILLDGHDIKALRLKWLR  421

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              Q  LV QEPALFA TI +NI FG   AS +++ +AA+ A  H FI  LP+GY T+VG+ 
Sbjct  422   EQMGLVSQEPALFATTIADNILFGKEAASMSQVIQAAEAANAHSFIQQLPDGYHTQVGEG  481

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQRIAIARA+L+  ++LLLDEA+SALD ESE  VQ AL KI    TTI+VAH
Sbjct  482   GTQLSGGQKQRIAIARAVLRNPRILLLDEATSALDAESELIVQQALDKIMSYRTTIIVAH  541

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             RLSTI++ + I V+K G VAE G+H  L++    G YATLV
Sbjct  542   RLSTIRDVDSIIVLKNGQVAESGNHLDLISK--GGEYATLV  580



>ref|XP_009398790.1| PREDICTED: putative multidrug resistance protein [Musa acuminata 
subsp. malaccensis]
Length=554

 Score =   356 bits (914),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 231/549 (42%), Positives = 326/549 (59%), Gaps = 41/549 (7%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +  +LI V L     VT + Q    G  G  LT R+R  +   IL  E GWFD DENS
Sbjct  19    KTRTYALIFVALSILSFVTNVVQHYNFGAMGEYLTKRVREKMLSKILTFEVGWFDEDENS  78

Query  1513  TGVLVSRLSIDS------VSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaal  1352
             TG +++RL+ D+      +  RS++GDR S+++   S+ A+   +   + WRL L     
Sbjct  79    TGAVLARLANDANVWLSGIQVRSLVGDRLSLIIQTASAVAIAWTMGLVIAWRLAL-----  133

Query  1351  tpftLGASYFSLIMNVGPKLDNSSYAR-----------------ASNIAAGAVSNIRTVA  1223
                        +I+ V P +  S YAR                 +S IAA AVSN+RT+A
Sbjct  134   -----------VIIAVQPLIIVSFYARRVLLKRLSAKAIKSQSQSSKIAAEAVSNLRTIA  182

Query  1222  TFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGY  1043
              FS+Q+ I+Q F+ A   P+R S+R+S   G  L FSQ  M+  + L  W+G  L+ +GY
Sbjct  183   AFSSQDRILQMFQAAQEGPRRESIRQSWFAGIGLAFSQSVMHCTWALDFWYGGKLIDQGY  242

Query  1042  TNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRK  863
                 A+++ F+ILV +   + +   +  D +  + A+ +V  +++R   I  + Q   R 
Sbjct  243   ITSKALFQTFMILVSTGRVIAEAGSMTTDLAKGADAVGSVFGVLDRDTRIEPNDQEGQRP  302

Query  862   FETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRF  683
              + +   DI+   V FAYP+RPDV+V R+F+L I+ G   ALVG SGSGKST+I +I+RF
Sbjct  303   KKVNG--DIDIRGVDFAYPARPDVVVFRHFTLHIEAGKSTALVGQSGSGKSTIIGLIERF  360

Query  682   YDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEA  503
             YDP++G V ++  D++  NL+ LR    +VGQEP LFAGTI ENIA+G   A+  EIE+A
Sbjct  361   YDPLKGTVKIDGRDIKSYNLRSLRKHIGMVGQEPTLFAGTIQENIAYGTEEATAAEIEDA  420

Query  502   AKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldl  323
             A+ A  H FIS L +GY T  G  GVQLSGGQKQRIAIARAILK   +LLLDEA+SALD 
Sbjct  421   ARAANAHDFISSLKDGYHTYCGDRGVQLSGGQKQRIAIARAILKNPTILLLDEATSALDS  480

Query  322   esEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGI  143
             +SEK VQ+AL ++    T++VVAHRLSTI+  ++IAV+ +G V E G+H  L+A    G 
Sbjct  481   QSEKMVQEALERLMVGRTSVVVAHRLSTIQNCDLIAVLDKGVVVEKGTHASLLAKGPKGS  540

Query  142   YATLVRAEQ  116
             Y  LV  +Q
Sbjct  541   YHALVSLQQ  549



>gb|AFW58472.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=822

 Score =   362 bits (930),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 231/520 (44%), Positives = 333/520 (64%), Gaps = 4/520 (1%)
 Frame = -1

Query  1675  LILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVS  1496
              I +G G   +V  + Q     + G  LT+R+R  +   IL+ + GWFD +EN++ ++ +
Sbjct  302   FIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQEENNSNLVAA  361

Query  1495  RLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSL  1316
             RLS D+   +S + +R SV+L  ++S  V   + F +EWR+ LL     P  + A++   
Sbjct  362   RLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVALLILVTFPLLVLANFAQQ  421

Query  1315  IMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQ  1139
             +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P+  S+RRSQ
Sbjct  422   LSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVPQMHSLRRSQ  481

Query  1138  ILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAP  959
             I G+  G SQ ++Y +  L LWFGA+LV+   +    V K+F++LV+++ SV +   LAP
Sbjct  482   ISGALFGLSQLSLYASEALILWFGAHLVRTHVSTFSKVIKVFVVLVITANSVAETVSLAP  541

Query  958   DTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLR  779
             +      +I +V  ++N R  I  DP     +   S   +I+F  V FAYP+RPDV+V +
Sbjct  542   EIVRGGESIRSVFSVLNSRTRI--DPDDPDAEQVESVRGEIDFRHVDFAYPTRPDVMVFK  599

Query  778   NFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTA  599
             + SL+I+ G   ALVGASGSGKST+I +++RFYDP+ G+V+++  D+R LNLK LR +  
Sbjct  600   DLSLRIRAGQSQALVGASGSGKSTVIALVERFYDPLAGKVMIDGKDIRRLNLKSLRLRIG  659

Query  598   LVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvql  419
             LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LP+GY T VG+ GVQL
Sbjct  660   LVQQEPVLFATSILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYRTPVGERGVQL  719

Query  418   sggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLST  239
             SGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T ++VAHRLST
Sbjct  720   SGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLST  779

Query  238   IKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             I+  + IAVV++G V E GSH  L+ S  +G Y+ L++ +
Sbjct  780   IRGVDSIAVVQDGRVVEQGSHGDLV-SRPDGAYSRLLQLQ  818


 Score = 78.6 bits (192),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  400  RIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANV  221
            RIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++
Sbjct  81   RIAIARAMLKNPKLLLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRCVDM  140

Query  220  IAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
            IAV+++G V E G+HD+L+A   +G YA L+R ++ A
Sbjct  141  IAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQETA  177



>ref|XP_002983053.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
 gb|EFJ15862.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
Length=1232

 Score =   370 bits (950),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 234/500 (47%), Positives = 332/500 (66%), Gaps = 4/500 (1%)
 Frame = -1

Query  1612  GLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLL  1433
             G  G  LT R+RN +F +ILK E GWF+  +N + ++ S+L+ D+   R+ +GDR S+LL
Sbjct  731   GYMGECLTMRVRNMMFSAILKNELGWFEKADNYSSLVSSQLASDATLVRAAVGDRLSILL  790

Query  1432  MGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLDNSS-YARASNIA  1256
                +    G  I+F L+W+LTL+  AL P  + A     +   G  ++ S  YARAS +A
Sbjct  791   QNSALILGGFIIAFVLQWKLTLIVLALFPLLISAHVGEHLFMKGFGVNLSKVYARASVVA  850

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTL  1076
               AVSNIRTVA F  +  +++ F + L   K+ S  R Q+ G   G +Q  +Y +Y L L
Sbjct  851   GEAVSNIRTVAAFCGESKVLELFNRQLEGIKKNSFARGQVAGLGYGLAQCCLYSSYGLAL  910

Query  1075  WFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPL  896
             W+ A L+K+G ++ G V K F++L+ ++F V +   LAPD   +S A+ +V  I++R+  
Sbjct  911   WYAAKLIKDGDSSFGPVIKCFILLIFTAFGVAETLALAPDLMRSSRAVGSVFAILDRKTE  970

Query  895   IGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSG  716
             I  DP     +  T    DIEF+ V F+YPSRPDV +  + +LK++ G+ +ALVGASGSG
Sbjct  971   I--DPDEPDSEIITHIRGDIEFKRVNFSYPSRPDVTIFYDLNLKVRAGSSLALVGASGSG  1028

Query  715   KSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGF  536
             KS+++ +IQRFYDP  G+VL++ +D+R +NLK LR    LV QEPALFA +I EN+A+G 
Sbjct  1029  KSSVVALIQRFYDPSAGKVLIDGMDIRRINLKSLRLHIGLVQQEPALFATSIYENVAYGR  1088

Query  535   PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVl  356
               A+ +E+ EAAK    H FIS LP+GY+T+VG+ G QLSGGQKQR+AIARA+LK   +L
Sbjct  1089  DGATESEVVEAAKAGNAHSFISSLPDGYQTQVGERGTQLSGGQKQRVAIARAVLKNPAIL  1148

Query  355   lldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSH  176
             LLDEA+SALD +SEK VQ+AL ++ +  TT++VAHRLSTI+ A VIAVV+ G + E GSH
Sbjct  1149  LLDEATSALDAQSEKVVQEALDRLMRGRTTVLVAHRLSTIQNAGVIAVVEGGRIVEQGSH  1208

Query  175   DKLMASELNGIYATLVRAEQ  116
              +LMA   +G YA LVR +Q
Sbjct  1209  RELMAKG-DGAYARLVRLQQ  1227


 Score =   301 bits (772),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 219/532 (41%), Positives = 312/532 (59%), Gaps = 6/532 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG   +V    +       G + +SR+R    K++L Q+ G+FD D  +
Sbjct  82    EVSKYSLYFVYLGLVILVAAWLEVSCWTYTGERQSSRMRTHYLKAMLSQDVGFFDTDA-T  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaal--tpft  1340
             TG +V  +S D+   +  +G +    +  ++    G  + F+  W+LTLL  A+      
Sbjct  141   TGEIVIGISSDTALVQEAIGPKAGNYVHYMARFFAGFAVGFTSVWQLTLLTLAVVPAIAV  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G +Y   ++ +  K +  +YARA  IA   +S +RTV +F  +E   +S+ +AL    +
Sbjct  201   AGGAYAYTMVGLTTK-NQKAYARAGEIAEETISQVRTVYSFVGEEKAQESYSRALETTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                      G  LG + G  +G++ L LW+   LV+ G TN G  +   L +V+SS S+G
Sbjct  260   LGKSGGLAKGLGLGATYGLTFGSWALLLWYAGVLVRHGTTNGGEAFTTILNVVISSLSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
               A      +   AA   +LE+I R+P I  +P     K  ++   +IEF  + F+YPSR
Sbjct  320   NAAPNLGAFAKGKAAGYNILEMIKRKPAI--NPNTSDGKTISNVQGNIEFVDIHFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV + +   LKI  G  VA+VG SGSGKST+I +I+RFYDP+ G +L++  D++ L LK
Sbjct  378   PDVTIFQKLCLKIPQGKTVAIVGGSGSGKSTVIALIERFYDPMSGIILLDSHDIKTLQLK  437

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLRSQ  LV QEPALFA TI ENI  G P+AS  EI EAA  A  H FI  LP+GYET+V
Sbjct  438   WLRSQIGLVNQEPALFATTIRENILLGKPDASDDEIFEAATVAGAHAFIQQLPDGYETQV  497

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQR+AI RA++K   +LLLDEA+SALD  SE+ VQ+AL  +    TT+V
Sbjct  498   GEKGVQLSGGQKQRVAITRAMVKNPSILLLDEATSALDAASEQSVQEALDTLMVGRTTVV  557

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYA  104
             VAHRLST++ A++IAVV+ G + E G+H  LMA   +G Y  LVR ++   A
Sbjct  558   VAHRLSTVQNADIIAVVQGGKIVETGTHSALMAKGESGAYCELVRLQEAGKA  609



>gb|AIU41630.1| ABC transporter family protein [Hevea brasiliensis]
Length=1135

 Score =   369 bits (946),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 232/530 (44%), Positives = 327/530 (62%), Gaps = 3/530 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + Q +SLI VGL    +   + Q     L G +LT+R+R  +F +IL  E GWFD +
Sbjct  604   MRHEIQRVSLIFVGLAVVTVPIYLLQHYFYTLMGERLTTRVRLSMFSAILCNEIGWFDLE  663

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN+TG L S LS D+   RS L DR S ++   +       I+F+L WR+  +  A  P 
Sbjct  664   ENNTGSLTSALSADATLVRSALSDRLSTIVQNAALTVTACAIAFTLSWRIAAVVVASLPL  723

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
              +GAS    +   G   D  +Y+RA+ +A  A++NIRTVA F  +E I   F   L++P 
Sbjct  724   LVGASIAEQLFLKGFGGDYHAYSRATAVAREALTNIRTVAAFGAEERISVQFASELNKPN  783

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + ++ R  I G   G +Q   +G+Y L LW+ + L++   +N G + K F++L++++ ++
Sbjct  784   KQALLRGHISGFGYGLTQLFAFGSYALGLWYASVLIRHKESNFGHIIKSFMVLIITALAI  843

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
              +   L PD    S A+ +V  +++R+  I  D      K  T    DIEF  V F YP+
Sbjct  844   AETLALTPDIVKGSQALGSVFNVLHRKTAI--DTNDLSSKVVTDIKGDIEFRNVNFKYPA  901

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             R D+ +    +LK+  G  +A+VG SGSGKST+I +I RFYDPI G VL++  D++ LNL
Sbjct  902   RLDITIFELLNLKVPAGKSLAVVGPSGSGKSTIISLILRFYDPISGTVLIDGCDIKTLNL  961

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K LR +  LV QEPALF+ TI ENI +G  NAS  EI +AAK A  H FIS +PEGY+T 
Sbjct  962   KSLRLKIGLVQQEPALFSTTIYENIKYGNENASEIEIMKAAKAANAHGFISTMPEGYKTH  1021

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG  G+QLSGGQKQR+AIARAILK   +LLLDEA+SALD  SEK VQ+AL K+ +  TT+
Sbjct  1022  VGDRGLQLSGGQKQRVAIARAILKDPSILLLDEATSALDTASEKLVQEALDKLMEGRTTV  1081

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             +VAHRLSTI++A+ IAV++ G VAE GSH +LM      IY  L+  +QE
Sbjct  1082  MVAHRLSTIRDADSIAVLQHGRVAEIGSHKQLMGKP-GSIYKQLISLQQE  1130


 Score =   284 bits (726),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 295/496 (59%), Gaps = 13/496 (3%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R   F+S+LK++  +FD +   + + +  +S D++  +  +GD+    +  L
Sbjct  4     GERQTARLRLEYFQSVLKKDMNFFDTEAGDSNI-IYHISSDAILVQDAIGDKTGHAIRYL  62

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
                 VG  I F+  W+LTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  63    CQFIVGFAIGFASVWQLTLLTLAVVPLIAIAGGAY-TVIMSTLSEKGEAAYAEAGKVADE  121

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S IRTV +F  +   ++++ ++L+   +   +     G  +GF+ G ++ A+ + LW+
Sbjct  122   VISQIRTVYSFVGEHKAIEAYSRSLTSALKLGKKSGIAKGVGVGFTYGLLFCAWAMLLWY  181

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
              + LV+   TN    + + + ++ S F++GQ A   P+ +  +    A   IIN     G
Sbjct  182   SSILVRHHITNGAKAFTMIINVIFSGFALGQAA---PNLAAIAKGRAAAATIINMIE-TG  237

Query  889   SDPQRKGRKFETSKPFD--IEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSG  716
             S+P ++          +  IEF  V FAYPSRP   V  N S  I  G   A+VG SGSG
Sbjct  238   SNPSKRSEHGSELPKVEGKIEFSNVCFAYPSRPSK-VFENLSFTISAGKTFAVVGPSGSG  296

Query  715   KSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGF  536
             KST+I M+QRFYDP  G++L++  DL+ L LKWLR Q  LV QEPALFA TI +NI FG 
Sbjct  297   KSTVISMVQRFYDPNSGKILLDGHDLKTLRLKWLREQMGLVSQEPALFATTIADNILFGK  356

Query  535   PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVl  356
              +A+  +I +AAK A  H FI  LP+GY T+VG+ G QLSGGQKQRIAIARA+L+  K+L
Sbjct  357   EDANMDKIVQAAKAANAHSFIQQLPDGYHTQVGEGGTQLSGGQKQRIAIARAVLRNPKIL  416

Query  355   lldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSH  176
             L DEA+SALD ESE  VQ AL KI    TTI+VAHRLSTI++ + I V+K G VAE GSH
Sbjct  417   LFDEATSALDAESEFIVQQALNKIMSNRTTIIVAHRLSTIRDVDTIIVLKNGQVAESGSH  476

Query  175   DKLMASELNGIYATLV  128
               L+     G YATLV
Sbjct  477   LDLITK--GGDYATLV  490



>ref|XP_002510564.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF52751.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1252

 Score =   370 bits (950),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 229/530 (43%), Positives = 331/530 (62%), Gaps = 3/530 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + Q + LI VGL    I   + Q     L G +LT+R+R  +F +IL  E GWFD D
Sbjct  720   MRHEIQRVVLIFVGLAVITIPIYLLQHYFYTLMGERLTARVRLSMFSAILSNEIGWFDLD  779

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN+TG L S L+ D+   RS L DR S ++  ++       I+F+L WR+  +  A  P 
Sbjct  780   ENNTGSLTSTLAADATLVRSALADRLSTVVQNVALTVTACVIAFTLSWRVASVVVASLPL  839

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
              +GAS    +   G   D  +Y+RA+++A  A++NIRTVA F  +E I   F   L++P 
Sbjct  840   LVGASIAEQLFLKGFGGDYHAYSRATSVAREALTNIRTVAAFGAEERISIQFASELNKPN  899

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             + ++ R  + G   G +Q   +G+Y L LW+ + L+    +N G + K F++L++++ ++
Sbjct  900   KQALLRGHVSGFGYGITQLFAFGSYALGLWYASILITHRDSNFGNIMKSFMVLIITALAI  959

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
              +   L PD    + A+  V  I++R+  I  DP+    K       DI+F  V F YP+
Sbjct  960   AETLALTPDIVKGTQALAPVFSILHRKTAI--DPENPTSKMVADIKGDIDFRNVNFKYPA  1017

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPD+ + +  +LK+  G  +A+VG SGSGKST+I ++ RFYDPI G +L++  +++ LNL
Sbjct  1018  RPDITIFQQLNLKVPAGRSLAVVGQSGSGKSTIIALLLRFYDPISGTILIDGCEIKTLNL  1077

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K LR +  LV QEPALF+ TI ENI +G  NAS  EI +AAK A  H FIS +PEGY+T 
Sbjct  1078  KSLRLKIGLVQQEPALFSTTIYENIRYGNENASEIEIMKAAKAANAHGFISRMPEGYQTH  1137

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG  G+QLSGGQKQR+AIARA+LK   +LLLDEA+SALD ESEK VQ+AL K+ +  TTI
Sbjct  1138  VGDRGLQLSGGQKQRVAIARAMLKNPSILLLDEATSALDTESEKTVQEALNKLMEGRTTI  1197

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             +VAHRLSTI++A+ IAV++ G VAE GSH +L+    + IY  LV  +QE
Sbjct  1198  LVAHRLSTIRDADSIAVLQHGKVAEIGSHTQLIGKP-DSIYKQLVSLQQE  1246


 Score =   275 bits (702),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 203/529 (38%), Positives = 308/529 (58%), Gaps = 13/529 (2%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             +  Q    +L LV LG    V+      L    G + T+R+R    +S+L+++  +FD +
Sbjct  87    MSTQVSKHALYLVYLGLVVFVSAWIGVALWMQTGERQTARLRLKYLQSVLRKDMNFFDTE  146

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--  1349
                + ++   +S D++  +  +GD+    +  LS   VG  I F   W+LTLL  A+   
Sbjct  147   ARDSNIMF-HISSDAILIQDAIGDKTGHAMRYLSQFIVGFAIGFVYVWQLTLLTLAVVPL  205

Query  1348  pftLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE  1169
                 G +Y ++IM+   +   ++YA A  +A   +S IRTV +F  ++  ++++ K+L++
Sbjct  206   IAVAGGAY-TVIMSTLSEKGEAAYAEAGKVAEEVISQIRTVYSFVGEDKAIEAYSKSLNK  264

Query  1168  PKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSF  989
               +   +     G  +GF+ G ++ A+ L LW+ + LV+  + N    + + + ++ S F
Sbjct  265   ALKLGKKSGVAKGVGVGFTYGLLFCAWALLLWYASILVRHHHINGAKAFTMIINVIFSGF  324

Query  988   SVGQLAGLAPDTSMASAAIPAVLEIIN--RRPLIGSDPQRKGRKFETSKPFDIEFEMVTF  815
             ++GQ     P+ +  +    A   IIN  ++    S+    G +        IEF  + F
Sbjct  325   ALGQAT---PNLAAIAKGRAAAANIINMIKKDSCPSNSSEDGIELPEVDG-KIEFCNICF  380

Query  814   AYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLR  635
             +YPSRP+ +V  N S  +  G   A+VG SGSGKST+I M+QRFY+P  G++L++  DL+
Sbjct  381   SYPSRPN-MVFENLSFSVSAGKTFAVVGPSGSGKSTVISMVQRFYEPNSGKILLDGHDLK  439

Query  634   ELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEG  455
              L LKWLR Q  LV QEPALFA TI +NI FG  +    ++ EAAK A  H F+  LP+G
Sbjct  440   TLRLKWLREQLGLVSQEPALFATTIADNILFGKEDGRMDQVIEAAKVANAHSFVQQLPDG  499

Query  454   YETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQ  275
             Y+T+VG+ G QLSGGQKQRIAIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI   
Sbjct  500   YQTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESELIVQQALDKIMSN  559

Query  274   ATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
              TTI+VAHRLSTI++ + I V+K G VAE G+H  L++    G YA+LV
Sbjct  560   RTTIIVAHRLSTIRDVDTIIVLKNGQVAESGNHLDLISK--GGEYASLV  606



>dbj|BAG96130.1| unnamed protein product [Oryza sativa Japonica Group]
Length=989

 Score =   365 bits (936),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 341/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ + GWFD +
Sbjct  460   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQE  519

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RLS D+   +S + +R SV+L  ++S  V   + F +EWR+ +L     P 
Sbjct  520   ENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPL  579

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ ++  F   L  P
Sbjct  580   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVP  639

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LW+GA+LV+   +    V K+F++LV+++ +
Sbjct  640   QMHSLRRSQISGALFGLSQLSLYASEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  699

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+N R  I  DP     +   S   DI+F  V FAYP
Sbjct  700   VAETVSLAPEIVRGGESIRSVFAILNYRTRI--DPDEPETEPVESVRGDIDFRHVDFAYP  757

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  758   SRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLN  817

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             ++ LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LPEGY+T
Sbjct  818   VRSLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKT  877

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  878   PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTA  937

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH +L+ S  +G Y+ L++ +
Sbjct  938   VLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELV-SRPDGAYSRLLQLQ  985


 Score =   257 bits (657),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 224/343 (65%), Gaps = 6/343 (2%)
 Frame = -1

Query  1126  ALGFSQGAMYG----AYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAP  959
             A G   G  YG    ++ L  W+    ++ G T+ G  +      ++   S+GQ      
Sbjct  2     AKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGLSLGQSFSNLG  61

Query  958   DTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLR  779
               S    A   +LE+I +RP I  DP   GR  +     +IEF+ V F+YPSRPDV++ R
Sbjct  62    AFSKGKIAGYKLLEVIRQRPTIVQDPA-DGRCLDEVHG-NIEFKEVAFSYPSRPDVMIFR  119

Query  778   NFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTA  599
             +FSL    G   A+VG SGSGKST++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  
Sbjct  120   DFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIG  179

Query  598   LVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvql  419
             LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP GY T+VG+ G+QL
Sbjct  180   LVNQEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQL  239

Query  418   sggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLST  239
             SGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+VVAHRLST
Sbjct  240   SGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLST  299

Query  238   IKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             I+  ++IAV+++G V E G+HD+L+A   +G YA L+R ++ A
Sbjct  300   IRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQEMA  342



>ref|XP_002965566.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ32986.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1243

 Score =   369 bits (948),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 234/500 (47%), Positives = 332/500 (66%), Gaps = 4/500 (1%)
 Frame = -1

Query  1612  GLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLL  1433
             G  G  LT R+RN +F +ILK E GWF+  +N + ++ S+L+ D+   R+ +GDR S+LL
Sbjct  742   GYMGECLTMRVRNMMFSAILKNELGWFEKADNYSSLVSSQLASDATLVRAAVGDRLSILL  801

Query  1432  MGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLDNSS-YARASNIA  1256
                +    G  I+F L+W+LTL+  AL P  + A     +   G  ++ S  YARAS +A
Sbjct  802   QNSALILGGFIIAFVLQWKLTLIVLALFPLLISAHVGEHLFMKGFGVNLSKVYARASVVA  861

Query  1255  AGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTL  1076
               AVSNIRTVA F  +  +++ F + L   K+ S  R Q+ G   G +Q  +Y +Y L L
Sbjct  862   GEAVSNIRTVAAFCGESKVLELFNRQLEGIKKNSFARGQVAGLGYGLAQCCLYSSYGLAL  921

Query  1075  WFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPL  896
             W+ A L+K+G ++ G V K F++L+ ++F V +   LAPD   +S A+ +V  I++R+  
Sbjct  922   WYAAKLIKDGDSSFGPVIKCFILLIFTAFGVAETLALAPDLMRSSRAVGSVFAILDRKTE  981

Query  895   IGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSG  716
             I  DP     +  T    DIEF+ V F+YPSRPDV +  + +LK++ G+ +ALVGASGSG
Sbjct  982   I--DPDEPDSEVITHIRGDIEFKRVNFSYPSRPDVAIFYDLNLKVRAGSSLALVGASGSG  1039

Query  715   KSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGF  536
             KS+++ +IQRFYDP  G+VL++ +D+R +NLK LR    LV QEPALFA +I EN+A+G 
Sbjct  1040  KSSVVALIQRFYDPSAGKVLIDGMDIRRINLKSLRLHIGLVQQEPALFATSIYENVAYGR  1099

Query  535   PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVl  356
               A+ +E+ EAAK    H FIS LP+GY+T+VG+ G QLSGGQKQR+AIARA+LK   +L
Sbjct  1100  DGATESEVVEAAKAGNAHSFISSLPDGYQTQVGERGTQLSGGQKQRVAIARAVLKNPAIL  1159

Query  355   lldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSH  176
             LLDEA+SALD +SEK VQ+AL ++ +  TT++VAHRLSTI+ A VIAVV+ G + E GSH
Sbjct  1160  LLDEATSALDAQSEKVVQEALDRLMRGRTTVLVAHRLSTIQNAGVIAVVEGGRIVEQGSH  1219

Query  175   DKLMASELNGIYATLVRAEQ  116
              +LMA   +G YA LVR +Q
Sbjct  1220  RELMAKG-DGAYARLVRLQQ  1238


 Score =   246 bits (627),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 199/532 (37%), Positives = 292/532 (55%), Gaps = 8/532 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG   +V    +       G + +SR+R    K++L Q+ G+FD D  +
Sbjct  82    EVSKYSLYFVYLGLVILVAAWLEVSCWTYTGERQSSRMRTHYLKAMLSQDVGFFDTDA-T  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaal--tpft  1340
             TG +V  +S D+   +  +G +    +  ++    G  + F+  W+LTLL  A+      
Sbjct  141   TGEIVIGISSDTALVQEAIGPKAGNYVHYMARFFAGFAVGFTSVWQLTLLTLAVVPAIAV  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G +Y   ++ +  K +  +YARA  IA   +S +RTV +F  +E   + + +AL    +
Sbjct  201   AGGAYAYTMVGLTTK-NQKAYARAGEIAEETISQVRTVYSFVGEEKAQELYSRALETTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                      G  LG + G  +G++ L LW+   LV+ G TN G  +   L +V+SS S+G
Sbjct  260   LGKSGGLAKGLGLGATYGLTFGSWALLLWYAGVLVRHGTTNGGEAFTTILNVVISSLSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
               A      +   AA   +LE+I R+P I  +P     K  ++   +IEF  + F+YPSR
Sbjct  320   NAAPNLGAFAKGKAAGYNILEMIKRKPAI--NPNTSDGKTISNVQGNIEFVDIHFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV + +   LKI  G  VA+VG SGSGKST+I +I+RFYDP+   V       +++  +
Sbjct  378   PDVTIFQKLCLKIPQGKTVAIVGGSGSGKSTVIALIERFYDPMHNLVRFSR--HQDVAAQ  435

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
                           +   TI ENI  G P+AS  EI EAA  A  H FI  LP+GYET+V
Sbjct  436   MATESNWSCESRAGIICTTIRENILLGKPDASDDEIFEAATVAGAHAFIQQLPDGYETQV  495

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQR+AI RA++K   +LLLDEA+SALD  SE+ VQ+AL  +    TT+V
Sbjct  496   GEKGVQLSGGQKQRVAITRAMVKNPSILLLDEATSALDAASEQSVQEALDTLMIGRTTVV  555

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYA  104
             VAHRLST++ A++IAVV+ G + E G+H  LMA   +G Y  LVR ++   A
Sbjct  556   VAHRLSTVQNADIIAVVQGGKIVETGTHSALMAKGESGAYCELVRLQEAGKA  607



>ref|XP_001759716.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
 gb|EDQ75628.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
Length=1301

 Score =   369 bits (948),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 228/530 (43%), Positives = 340/530 (64%), Gaps = 4/530 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +     LI++ LG   ++    Q    G+ G  L  RIR  +F  IL  E GWFD D
Sbjct  771   MKQEIDKFILIVISLGVAALIGSFLQHTFFGVMGENLVKRIREMMFARILTNEVGWFDAD  830

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++  + +RL+ D+ + +  +GDR S+++   +       I+FSL+W++  +     P 
Sbjct  831   ENNSSQVSARLAADATTVKGAIGDRISIIVQNFTLMVAICIIAFSLQWKMAFVVLCTLPL  890

Query  1342  tLGASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D  S+ ARAS +A   V NIRT+A F++Q+ IV+ FE+ L  P
Sbjct  891   QVFATFVEHLFLKGFSGDVASAQARASMVAGEGVINIRTIAAFNSQDRIVKLFEQELRAP  950

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
              R    R Q+ G A G SQ  +Y +Y L LW+GA LVK G +N  ++ ++F++L++++++
Sbjct  951   MRRGFVRGQVAGLAYGISQFFLYSSYALGLWYGAQLVKRGESNFKSIIQVFMVLIIAAYA  1010

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             + +   LAPD      A+ +V  +++R   I +D   K    +T +  +I  + VTFAYP
Sbjct  1011  IAETLALAPDLIKGGQALSSVFYVLDRNTEIDADDP-KAEVVQTVRG-EIRLKDVTFAYP  1068

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPD ++ ++ +L ++ G  +ALVG+SGSGKST+I +++RFYDP+ GRVL++  D+R+LN
Sbjct  1069  TRPDAVIFKDLNLMVRAGKSLALVGSSGSGKSTVIALLERFYDPLSGRVLVDGEDIRKLN  1128

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR + ALV QEP LF  TI ENIA+G   A+  E++ AA  A  H FI+ LP+GY T
Sbjct  1129  LKSLRRRIALVSQEPTLFDTTIYENIAYGREGATEQEVQAAAMAANAHNFITALPDGYNT  1188

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
               G+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESEK VQ+AL ++ K  T+
Sbjct  1189  SAGERGVQLSGGQKQRIAIARAVLKNPAVLLLDEATSALDAESEKIVQEALDRLLKGRTS  1248

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             ++VAHRLSTI+ A+ IAV+++GAV E GSH+ L+A   +G YA LVR + 
Sbjct  1249  VLVAHRLSTIRNAHTIAVIQDGAVVEEGSHNTLLAIP-DGAYANLVRLQN  1297


 Score =   306 bits (784),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 203/498 (41%), Positives = 302/498 (61%), Gaps = 7/498 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +  +RIR    +S+LK++  +FD D   TG +V  +S D++  +  + ++    L  +
Sbjct  171   GERQAARIRVLYLQSMLKKDISYFDVDAR-TGEVVDSISTDTLLIQDAISEKMGQFLHYI  229

Query  1423  SSAAVGLGISFSLEWRl--tllaaaltpftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   G  + FS+ W+L    LA A     +G SY  +I N   + +  +Y  A NI   
Sbjct  230   STCIGGFAVGFSMLWKLGLVTLAVAPAIAIVGGSYAYIITNFTAR-NRKAYEEAGNIVEQ  288

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              ++N+RTV +F  ++  +++F  AL    +   +    +G  +G  Q  ++ AY L LW+
Sbjct  289   NLANVRTVYSFVGEQKALEAFSHALRGTLKLGYKSGLAMGLGIGSIQIILFCAYALLLWY  348

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G  LV+ G  N G        +V++  S+GQ A      + A A    + ++I ++  IG
Sbjct  349   GGVLVRNGEANGGKTLATIFAVVIAGISLGQAAPNITAFARAKAGAFKIFKLIEQQSKIG  408

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              D      K  + +   IE + + F+YPSRPD+ + R+FSL I  G+ VA+VG SGSGKS
Sbjct  409   VDTD-TATKLASVQGL-IELKHIEFSYPSRPDIPIFRDFSLTIPAGSTVAIVGGSGSGKS  466

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T+I +I+RFY+P  G VL++ V+++ ++LKWLRSQ  LV QEPALFA +I ENI +G PN
Sbjct  467   TVISLIERFYEPSAGEVLLDGVNIKHIDLKWLRSQIGLVNQEPALFATSIKENILYGNPN  526

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E+A + A  H FIS  P+GY T+VG+ GVQ+SGGQKQR+AIARAI+K   +LLL
Sbjct  527   ATDQEVEDACRAANAHSFISKFPQGYNTQVGEHGVQMSGGQKQRVAIARAIVKNPSILLL  586

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE+ VQ AL  +    TT+VVAHRLSTI+ A+ IAVV+ G + E G H+ 
Sbjct  587   DEATSALDASSEQIVQAALDNVMVGRTTVVVAHRLSTIRNADAIAVVQNGVIVEMGDHET  646

Query  169   LMASELNGIYATLVRAEQ  116
             ++  E NG YA LVR ++
Sbjct  647   MITQE-NGAYAALVRLQE  663



>ref|XP_010069803.1| PREDICTED: ABC transporter B family member 13-like [Eucalyptus 
grandis]
 gb|KCW58265.1| hypothetical protein EUGRSUZ_H00958 [Eucalyptus grandis]
Length=1253

 Score =   369 bits (946),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 233/528 (44%), Positives = 328/528 (62%), Gaps = 4/528 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +   ++L+ VG+    I   + Q     L G +LT+R+R+ +F +IL  E GWFD DENS
Sbjct  721   EVDRIALLFVGVAAITIPIYLIQHFFYTLMGERLTTRVRSLMFSAILTNEIGWFDLDENS  780

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             TG L + L+ D+   RS L DR S +   ++       I+F L WR+  +  A  P  +G
Sbjct  781   TGSLTTILAADATLVRSALADRLSTITQNVALTVTAFVIAFKLSWRIAAVVIASFPLLVG  840

Query  1333  ASYFSLIMNVGPKLDNSS-YARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             AS    +   G   D S+ Y+RA+++A  A++NIRTVA F  ++ I   F   L++P R 
Sbjct  841   ASITEQLFLKGFGGDYSTAYSRATSLAREAIANIRTVAAFGAEDRISDQFASELAQPNRQ  900

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             ++ R  I G   G SQ   + +Y+L LW+ + L+K   +N G + K F++L++++ +V +
Sbjct  901   ALIRGHISGFGFGISQFFAFCSYSLGLWYASVLIKHRESNFGDIIKSFMVLIVTALAVAE  960

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                L PD      A+ +V  ++ R+  I   P     K   +   +IEF  V+F YP+RP
Sbjct  961   TLALTPDIVKGKQALGSVFRVLKRQTAI--HPYSHMSKMVLTVRGNIEFRSVSFRYPARP  1018

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             DV +  + +LK+  G  +A+VG SGSGKST+I ++ RFYDP  G VL++  D++ LNL+ 
Sbjct  1019  DVRIFEDLNLKVSAGKSLAVVGQSGSGKSTVISLVMRFYDPTSGSVLIDGCDIKSLNLRQ  1078

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR +  LV QEPALFA TI ENI +G   AS  E+ EAAK A  H+FIS +PEGY+T VG
Sbjct  1079  LRLRIGLVQQEPALFATTIYENIKYGNSEASEIEVMEAAKAANAHEFISTMPEGYQTNVG  1138

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
               GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SEK VQDAL K+ K  TTI+V
Sbjct  1139  NRGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTSSEKLVQDALDKLMKGRTTILV  1198

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             AHRL+TI++AN IAV++ G VAE G HD+L+A   +G Y  LV  +QE
Sbjct  1199  AHRLTTIRDANRIAVLQNGRVAEIGRHDQLIAKP-SGPYKKLVSLQQE  1245


 Score =   284 bits (727),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 200/496 (40%), Positives = 302/496 (61%), Gaps = 13/496 (3%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    +++L+++  +FD +     +L   ++ D++  +  +GD+    L  L
Sbjct  127   GERQTARLRLKYLQAVLRKDINFFDTEAKDCNIL-HHITSDAILVQDAIGDKTGHALRYL  185

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG  + F+  W+LTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  186   SQFIVGFAVGFTSVWQLTLLTLAVVPLIAFAGGAY-TIIMSSLSEKGEAAYAEAGKVAEE  244

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S IRTV +F  ++  VQ++ K+L    +   +     G  +GF+   ++ A+ L LW+
Sbjct  245   VISQIRTVYSFVGEDKAVQAYSKSLKVALKLGKKSGFAKGMGVGFTYALLFCAWALLLWY  304

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEII--NRRPL  896
              + LV+  +TN G  +   + ++ S F++GQ A      +   AA+  ++ +I  + +P 
Sbjct  305   ASILVRHHHTNGGKAFTTIINVIFSGFALGQAAPNLAAIAKGQAAVANIISMIQTDNKPS  364

Query  895   IGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSG  716
              GSD   +G K  +    +IEF  V FAYPSRP+ +V  N S  I  G  +A+VG SGSG
Sbjct  365   KGSD---EGTKL-SEVAGEIEFREVCFAYPSRPN-MVFENLSFTIGAGKSIAIVGPSGSG  419

Query  715   KSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGF  536
             KST+I ++QRFYDP  G++L++  DL+ L LKWLR Q  LV QEPALFA TI +NI FG 
Sbjct  420   KSTIISLVQRFYDPTSGQILLDGHDLKTLQLKWLREQMGLVSQEPALFATTIADNILFGK  479

Query  535   PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVl  356
              +A   ++ EAAK +  H FI  LP+ Y T+VG+ G QLSGGQKQRIAIARA+L+  K+L
Sbjct  480   ADAKTEQLVEAAKASNAHSFIQKLPDCYYTQVGEGGTQLSGGQKQRIAIARAVLRNPKIL  539

Query  355   lldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSH  176
             LLDEA+SALD ESE  VQ+AL +I    TTI++AHRLST+++ + I V+K G V E G+H
Sbjct  540   LLDEATSALDAESELVVQEALDRIMTNRTTIIIAHRLSTVRDVDCIVVLKNGQVVESGNH  599

Query  175   DKLMASELNGIYATLV  128
              +L++    G YATLV
Sbjct  600   SELLSK--GGEYATLV  613



>gb|ABX82929.1| LO4 [Solanum pennellii]
Length=1249

 Score =   368 bits (944),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 232/531 (44%), Positives = 343/531 (65%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  720   MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  779

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  780   ENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  839

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ QE I+  F + L  P
Sbjct  840   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVP  899

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQ+ G   G SQ A+YG+  L LW+GA+LV  G +    V K+F++LV+++ S
Sbjct  900   QMQSLRRSQMSGLLFGISQLALYGSEALILWYGAHLVNNGVSTFSKVIKVFVVLVITANS  959

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   +  D   +G   E+ +  DIE   V FAYP
Sbjct  960   VAETVSLAPEIIRGGEAVGSVFSILDRSTRVDPD-DPEGDPVESIRG-DIELRHVDFAYP  1017

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV V ++ +L+I+ G   ALVGASGSGKS++I +I+RFYDP  G+V+++  D+R LN
Sbjct  1018  SRPDVSVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLN  1077

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I ENIA+G   A+  E+ EAA+ A +H F+SGLPEGY+T
Sbjct  1078  LKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYKT  1137

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1138  PVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTT  1197

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + I VV++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1198  VLVAHRLSTIRNVDTIGVVQDGRIVEQGSHSELI-SRPEGAYSRLLQLQHH  1247


 Score =   282 bits (722),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 303/528 (57%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG     +   + G     G +  S +R    +++LKQ+ G+FD D   
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFDTDAR-  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  198   AGGLYAYTLTGLTSK-SRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDAIQNTLK  256

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G ++ G  +      ++   S+G
Sbjct  257   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTAIFSAIVGGMSLG  316

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EII ++P I  D        E S   +IEF+ VTF+YPSR
Sbjct  317   QSFSNLGAFSKGKAAGYKLMEIIKQKPTIVQDTLDGKCLSEVSG--NIEFKNVTFSYPSR  374

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ R+F +    G  VA+VG SGSGKST++ +I+RFYDP  G+VL++ VD++ L L+
Sbjct  375   PDVIIFRDFCIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQLR  434

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E A   +  H FI+ LP GY T+V
Sbjct  435   WLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATCASNAHSFITLLPNGYNTQV  494

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  495   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVV  554

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + IAV+++G V E G+H++L++    G YA+L+R ++
Sbjct  555   VAHRLSTIRNVDSIAVIQQGQVVETGTHEELISKA--GAYASLIRFQE  600



>ref|NP_001234209.1| L04 [Solanum lycopersicum]
 gb|ABX82928.1| L04 [Solanum lycopersicum]
Length=1249

 Score =   367 bits (943),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 232/531 (44%), Positives = 343/531 (65%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  720   MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  779

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  780   ENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  839

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ QE I+  F + L  P
Sbjct  840   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVP  899

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQ+ G   G SQ A+YG+  L LW+GA+LV  G +    V K+F++LV+++ S
Sbjct  900   QMQSLRRSQMSGLLFGISQLALYGSEALILWYGAHLVNNGVSTFSKVIKVFVVLVITANS  959

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   +  D   +G   E+ +  DIE   V FAYP
Sbjct  960   VAETVSLAPEIIRGGEAVGSVFSILDRSTRVDPD-DPEGDPVESIRG-DIELRHVDFAYP  1017

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV V ++ +L+I+ G   ALVGASGSGKS++I +I+RFYDP  G+V+++  D+R LN
Sbjct  1018  SRPDVSVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLN  1077

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I ENIA+G   A+  E+ EAA+ A +H F+SGLPEGY+T
Sbjct  1078  LKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYKT  1137

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1138  PVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTT  1197

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + I VV++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1198  VLVAHRLSTIRNVDTIGVVQDGRIVEQGSHSELI-SRPEGAYSRLLQLQHH  1247


 Score =   282 bits (722),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 303/528 (57%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG     +   + G     G +  S +R    +++LKQ+ G+FD D   
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFDTDAR-  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  198   AGGLYAYTLTGLTSK-SRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDAIQNTLK  256

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G ++ G  +      ++   S+G
Sbjct  257   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTAIFSAIVGGMSLG  316

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EII ++P I  D        E S   +IEF+ VTF+YPSR
Sbjct  317   QSFSNLGAFSKGKAAGYKLMEIIKQKPTIVQDTLDGKCLSEVSG--NIEFKNVTFSYPSR  374

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ R+F +    G  VA+VG SGSGKST++ +I+RFYDP  G+VL++ VD++ L L+
Sbjct  375   PDVIIFRDFCIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQLR  434

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E A   +  H FI+ LP GY T+V
Sbjct  435   WLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATCASNAHNFITLLPNGYNTQV  494

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  495   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVV  554

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + IAV+++G V E G+H++L++    G YA+L+R ++
Sbjct  555   VAHRLSTIRNVDSIAVIQQGQVVETGTHEELISKA--GAYASLIRFQE  600



>gb|KDO84909.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=1082

 Score =   364 bits (935),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 233/527 (44%), Positives = 329/527 (62%), Gaps = 4/527 (1%)
 Frame = -1

Query  1690  CQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENST  1511
                ++LI VGL    I   + Q     L G  LT+R+R  +F +IL  E GWFD DEN+T
Sbjct  552   VDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGWFDLDENNT  611

Query  1510  GVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGA  1331
             G+L+S L+ D+   RS L DR S+++  ++       I+F L WRL  + AA  P  +GA
Sbjct  612   GLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSWRLAAVVAASLPLLIGA  671

Query  1330  SYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTS  1154
                  +   G   D N +Y+RA+++A  A++NIRTVA +  ++ I   F   LS+P + +
Sbjct  672   FVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKRISIQFASELSQPNKQA  731

Query  1153  VRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQL  974
             + R  I G   G SQ     +Y L LW+ + L+K+  +N G + K F++L++++ +V + 
Sbjct  732   LLRGHISGFGYGVSQLLSLCSYALGLWYASVLIKQKGSNFGDIMKSFMVLIITALAVAET  791

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
               LAPD    S A+  V  I+ R+  I   P     K  T    +IE   V+F YP RPD
Sbjct  792   LALAPDIVKGSQALGPVFGILYRKTAI--QPDDPASKEVTEIKGNIELRNVSFKYPVRPD  849

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
             + +  N +LK+  G  +A+VG SGSGKST+I ++ RFYDPI G VL++  D+R LNL+ L
Sbjct  850   ITIFENLNLKVSAGRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDGYDIRTLNLRSL  909

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             R +  LV QEPALF+ TI ENI +G  +AS  E+ +A K A  H FIS +PEGY++ VG 
Sbjct  910   RRKIGLVQQEPALFSTTIYENIKYGNEDASEIELMKATKAANAHGFISRMPEGYQSHVGD  969

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE  +Q+AL K+ +  TTI+VA
Sbjct  970   RGVQLSGGQKQRVAIARAILKNPSILLLDEATSALDTASENLIQEALDKLMEGRTTIMVA  1029

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             HRLSTI+ A+ IAV+++G VAE GSH++L+  E NGIY  L+R +Q+
Sbjct  1030  HRLSTIRNADKIAVLQQGKVAEIGSHEQLLRKE-NGIYKQLIRLQQD  1075


 Score =   240 bits (613),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 182/444 (41%), Positives = 254/444 (57%), Gaps = 11/444 (2%)
 Frame = -1

Query  1426  LSSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
             LS   VG  + F+  W+LTLL  A+       G +Y ++ M+   +   ++Y  A  +A 
Sbjct  10    LSQFFVGFAVGFTSVWQLTLLTLAVVPLIAVAGGAY-TITMSTLSEKGEAAYGEAGKVAE  68

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
               +S +R V  F  +   ++S+  +L E  +   +     G  +G + G ++ A+ L LW
Sbjct  69    EIISQVRAVYAFVGEAKAIESYSHSLKEALKQGKKSGVAKGIGVGLTYGLLFCAWALLLW  128

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             +   LV+ G TN G  +   + ++ S F++GQ A   P+ +  +    A   II+     
Sbjct  129   YAGILVRHGDTNGGKAFTTIINVIFSGFALGQAA---PNLAAIAKGKAAAANIISIIKEN  185

Query  892   GSDPQRKGRKFETSKPF--DIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGS  719
                 +R G    T       IEF  V FAYPSRP  +V  N +  +  G   A VG SGS
Sbjct  186   SHSSERPGDDGITLPKLAGQIEFSEVCFAYPSRPH-MVFENLNFSVDAGKTFAFVGPSGS  244

Query  718   GKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFG  539
             GKST+I M+QR Y+P  G++L++  DL+ L LKWLR Q  LV QEPALFA +I  NI  G
Sbjct  245   GKSTIISMVQRLYEPTSGKILLDGHDLKSLQLKWLREQMGLVSQEPALFATSIANNILLG  304

Query  538   FPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKV  359
               +AS   + EAAK A  H F+ GLP+GY+T+VG+ G QLSGGQKQRIAIARA+L+  K+
Sbjct  305   KEDASMDRVIEAAKAANAHSFVEGLPDGYQTQVGEGGTQLSGGQKQRIAIARAVLRNPKI  364

Query  358   llldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGS  179
             LLLDEA+SALD ESE  VQ AL KI    TTIVVAHRLST+++ + I V+K G V E G+
Sbjct  365   LLLDEATSALDAESELIVQRALEKIMSNRTTIVVAHRLSTVRDVDTIMVLKNGQVVESGT  424

Query  178   HDKLMASELNGIYATLVRAEQEAY  107
             H  L++    G YA LV  +   +
Sbjct  425   HVDLISK--GGEYAALVNLQSSEH  446



>ref|XP_006338462.1| PREDICTED: ABC transporter B family member 19-like [Solanum tuberosum]
Length=1249

 Score =   367 bits (942),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 232/531 (44%), Positives = 340/531 (64%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  720   MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEE  779

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  780   ENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  839

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ QE I+  F + L  P
Sbjct  840   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVP  899

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQ+ G   G SQ A+YG+  L LW+GA+LV  G +    V K+F++LV+++ S
Sbjct  900   QMQSLRRSQMSGLLFGISQLALYGSEALILWYGAHLVNNGVSTFSKVIKVFVVLVITANS  959

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   +  DP         S   DIE   V FAYP
Sbjct  960   VAETVSLAPEIIRGGEAVGSVFSILDRSTRV--DPDDPEADPVESIRGDIELRHVDFAYP  1017

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV V ++ +L+I+ G   ALVGASGSGKS++I +I+RFYDP  G+V+++  D+R LN
Sbjct  1018  SRPDVSVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLN  1077

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I ENIA+G   A+  E+ EAA+ A +H F+SGLPEGY+T
Sbjct  1078  LKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYKT  1137

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1138  PVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTT  1197

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + I VV++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1198  VLVAHRLSTIRNVDTIGVVQDGRIVEQGSHSELI-SRPEGAYSRLLQLQHH  1247


 Score =   283 bits (723),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 304/528 (58%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG     +   + G     G +  S +R    +++LKQ+ G+FD D   
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDAR-  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  198   AGGLYAYTLTGLTSK-SRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDAIQNTLK  256

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G ++ G  +      ++   S+G
Sbjct  257   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTAIFSAIVGGMSLG  316

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EII ++P I  D        E S   +IEF+ VTF+YPSR
Sbjct  317   QSFSNLGAFSKGKAAGYKLMEIIRQKPTIVQDTLDGKCLSEVSG--NIEFKNVTFSYPSR  374

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ R+F++    G  VA+VG SGSGKST++ +I+RFYDP  G+VL++ VD++ L L+
Sbjct  375   PDVIIFRDFNIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQLR  434

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E A   +  H FI+ LP GY T+V
Sbjct  435   WLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATCASNAHSFITLLPNGYNTQV  494

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  495   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVV  554

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + IAV+++G V E G+H++L++    G YA+L+R ++
Sbjct  555   VAHRLSTIRNVDSIAVIQQGQVVETGTHEELISKA--GAYASLIRFQE  600



>ref|XP_010937072.1| PREDICTED: ABC transporter B family member 19 [Elaeis guineensis]
Length=1253

 Score =   367 bits (942),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 235/531 (44%), Positives = 340/531 (64%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  724   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDED  783

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      + F +EWR+ LL  A  P 
Sbjct  784   ENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVGFIVEWRVALLILATFPL  843

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  844   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELRVP  903

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +R S+RRSQ  G   G SQ ++Y +  L LW+GA+LV+ G +    V K+F++LV+++ S
Sbjct  904   QRRSLRRSQTSGLLFGVSQLSLYSSEALILWYGAHLVRTGASTFSKVIKVFVVLVITANS  963

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+NR   I  DP     +   S   +IE   V FAYP
Sbjct  964   VAETVSLAPEIIRGGESIRSVFSILNRATRI--DPDDPEAEPVESIRGEIELRHVDFAYP  1021

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV + ++F+L+I+ G   ALVGASGSGKST+I +I+RFYDP  G+V+++  D+R LN
Sbjct  1022  SRPDVPIFKDFNLRIRAGQSQALVGASGSGKSTVIGLIERFYDPTAGKVMIDGKDIRRLN  1081

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I ENIA+G   A+  E+ EAA+ A +H F+S LPEGY+T
Sbjct  1082  LKSLRLKIGLVQQEPALFAASIFENIAYGKDGATEEEVIEAARAANVHGFVSALPEGYKT  1141

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1142  AVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERLMRGRTT  1201

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             I+VAHRLSTI+  + IAVV++G + E GSH +L+A   +G Y+ L++ +  
Sbjct  1202  ILVAHRLSTIRGVDSIAVVQDGRIVEQGSHSELVA-RADGAYSRLLQLQHH  1251


 Score =   283 bits (723),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 209/530 (39%), Positives = 306/530 (58%), Gaps = 6/530 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG    ++   +       G +    +R    +++LKQ+ G+FD D   
Sbjct  81    EVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQVGTLRRRYLEAVLKQDVGFFDTDAR-  139

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAF  199

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV +F  +   + S+ +A+    +
Sbjct  200   AGGLYAYTLTGLTSK-GRESYANAGIIAEQAIAQVRTVYSFVGESKALTSYSEAIQNTLK  258

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  +G + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  259   LGYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  318

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S    A   ++EII ++P I  D        E     +IEF+ VTF+YPSR
Sbjct  319   QAFSNLGAFSKGKIAGYKLMEIIRQKPSITQDSSDGKCLAEVHG--NIEFKDVTFSYPSR  376

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ R+FSL    G   A+VG SGSGKST++ +I+RFYDP QG+VL++ VD++ L LK
Sbjct  377   PDVIIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLK  436

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FIS LP GY+T+ 
Sbjct  437   WLREQIGLVNQEPALFATTILENILYGKPDATIAEVEAAASAANAHSFISLLPNGYDTQA  496

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  497   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVV  556

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             VAHRLSTIK  ++IAV+++G V E G+H++L+A   +G YA+L+R ++ A
Sbjct  557   VAHRLSTIKNVDMIAVIQQGQVVETGTHEELLAKGSSGAYASLIRFQEMA  606



>ref|XP_006473688.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Citrus sinensis]
Length=1034

 Score =   363 bits (931),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 232/527 (44%), Positives = 328/527 (62%), Gaps = 4/527 (1%)
 Frame = -1

Query  1690  CQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENST  1511
                ++LI VGL    I   + Q     L G  LT+R+R  +F +IL  E GWFD DEN+T
Sbjct  504   VDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGWFDLDENNT  563

Query  1510  GVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGA  1331
             G+L+S L+ D+   RS L DR S+++  ++       I+F L WRL  + AA  P  +GA
Sbjct  564   GLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSWRLAAVVAASLPLLIGA  623

Query  1330  SYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTS  1154
                  +   G   D N +Y+RA+++A  A++NIRTVA +  ++ I   F   LS+P + +
Sbjct  624   FVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKRISIQFASELSQPNKQA  683

Query  1153  VRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQL  974
             + R  I G   G SQ     +Y L LW+ + L+K+  +N G + K F++L++++ +V + 
Sbjct  684   LLRGHISGFGYGVSQLLSLCSYALGLWYASVLIKQKGSNFGDIMKSFMVLIITALAVAET  743

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
               LAPD    S A+  V  I+ R+  I   P     K  T    +IE   V+F YP RPD
Sbjct  744   LALAPDIVKGSQALGPVFGILYRKTAI--QPDDPASKEVTEIKGNIELRNVSFKYPVRPD  801

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
             + +  N +LK+  G  +A+VG SGSGKST+I ++ RFYDPI G VL++  D+R  NL+ L
Sbjct  802   ITIFENLNLKVSAGRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDGYDIRTFNLRSL  861

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             R +  LV QEPALF+ TI ENI +G  +AS  E+ +A K A  H FIS +PEGY++ VG 
Sbjct  862   RRKIGLVQQEPALFSTTIYENIKYGNEDASEIELMKATKAANAHGFISRMPEGYQSHVGD  921

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE  +Q+AL K+ +  TTI+VA
Sbjct  922   RGVQLSGGQKQRVAIARAILKNPSILLLDEATSALDTASENLIQEALDKLMEGRTTIMVA  981

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             HRLSTI+ A+ IAV+++G VAE GSH++L+  E NGIY  L+R +Q+
Sbjct  982   HRLSTIRNADKIAVLQQGKVAEIGSHEQLLRKE-NGIYKQLIRLQQD  1027


 Score =   242 bits (618),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 168/393 (43%), Positives = 229/393 (58%), Gaps = 4/393 (1%)
 Frame = -1

Query  1285  SSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQG  1106
             ++YA A  +A   +S +R V  F  +   ++S+  +L E  +   +     G  +G + G
Sbjct  10    AAYAEAGKVAEEIISQVRAVYAFVGEAKAIESYSHSLKEALKQGKKSGVAKGIGVGLTYG  69

Query  1105  AMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPA  926
              ++ A+ L LW+   LV+ G TN G  +   + ++ S F++GQ A      +   AA   
Sbjct  70    LLFCAWALLLWYAGILVRHGDTNGGKAFTTIINVIFSGFALGQAAPNLAAIAKGKAAAAN  129

Query  925   VLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTM  746
             ++ II         P   G          IEF  V FAYPSRP  +V  N +  +  G  
Sbjct  130   IVSIIKENSHSSERPGDDGITLPKLAG-QIEFCEVCFAYPSRPH-MVFENLNFSVDAGKT  187

Query  745   VALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAG  566
              A VG SGSGKST+I M+QR Y+P  G++L++  DL+ L LKWLR Q  LV QEPALFA 
Sbjct  188   FAFVGPSGSGKSTIISMVQRLYEPTSGKILLDGHDLKSLQLKWLREQMGLVSQEPALFAT  247

Query  565   TIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIA  386
             +I  NI  G  +AS   + EAAK A  H F+ GLP+GY+T+VG+ G QLSGGQKQRIAIA
Sbjct  248   SIANNILLGKEDASMDRVIEAAKAANAHSFVEGLPDGYQTQVGEGGTQLSGGQKQRIAIA  307

Query  385   RAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVK  206
             RA+L+  K+LLLDEA+SALD ESE  VQ AL KI    TTIVVAHRLST+++ + I V+K
Sbjct  308   RAVLRNPKILLLDEATSALDAESELIVQRALEKIMSNRTTIVVAHRLSTVRDVDTIMVLK  367

Query  205   EGAVAEYGSHDKLMASELNGIYATLVRAEQEAY  107
              G V E G+H  L++    G YA LV  +   +
Sbjct  368   NGQVVESGTHVDLISK--GGEYAALVNLQSSEH  398



>gb|EYU34087.1| hypothetical protein MIMGU_mgv1a000781mg [Erythranthe guttata]
Length=988

 Score =   362 bits (928),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 228/515 (44%), Positives = 336/515 (65%), Gaps = 4/515 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   ++  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  458   MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  517

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  518   ENNSSLLANRLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  577

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA FS QE I+  F   L  P
Sbjct  578   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFSAQEKILSLFSNELRLP  637

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+RRSQ  G   G SQ A+Y +  L LW+G++LV +G +    V K+F++LV+++ S
Sbjct  638   QKQSLRRSQCSGLLFGLSQLALYASEALILWYGSHLVSKGVSTFSKVIKVFVVLVITANS  697

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   I  DP     +   S   +IE   V FAYP
Sbjct  698   VAETVSLAPEIIRGGEAVGSVFSILDRPTRI--DPDDTEAETVESIRGEIELRHVDFAYP  755

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++FSL+I+ G   ALVGASGSGKS++I +I+RFYDP+ G+V+++  D+R LN
Sbjct  756   SRPDVMVFKDFSLRIRAGHSQALVGASGSGKSSVIALIERFYDPLSGKVMVDGKDIRRLN  815

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPN-ASYTEIEEAAKEAYIHKFISGLPEGYE  449
             LK LR +  LV QEPALFA +I ENIA+G    A+  E+ EAA+ A +H F+SGLPEGY+
Sbjct  816   LKSLRRRIGLVQQEPALFAASIFENIAYGKDGAATEAEVIEAARAANVHTFVSGLPEGYK  875

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  T
Sbjct  876   TPVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRT  935

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLM  164
             T++VAHRLSTI+  + I VV++G + E GSH++L+
Sbjct  936   TVLVAHRLSTIRGVHSIGVVQDGRIVEQGSHNELI  970


 Score =   240 bits (612),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 162/339 (48%), Positives = 222/339 (65%), Gaps = 4/339 (1%)
 Frame = -1

Query  1132  GSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDT  953
             G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+GQ        
Sbjct  4     GLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLGQSFSNLGAF  63

Query  952   SMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNF  773
             S   AA   ++EII ++P I  D      K  T    +IEF+ VTF+YPSRPDVI+ R+F
Sbjct  64    SKGKAAGFKLMEIIKQKPTIVQDDLDS--KCLTEVNGNIEFKNVTFSYPSRPDVIIFRDF  121

Query  772   SLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALV  593
             S+    G  VA+VG SGSGKST++ +I+RFYDP QG +L++ VD++ L L+WLRSQ  LV
Sbjct  122   SIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGEILLDNVDIKTLQLRWLRSQMGLV  181

Query  592   GQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsg  413
              QEPALFA TI ENI +G P+A+ +E+E A+  A  H FI+ LP GY T+VG+ GVQLSG
Sbjct  182   NQEPALFATTILENILYGKPDATMSEVEAASSAANAHSFITLLPNGYNTQVGERGVQLSG  241

Query  412   gqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIK  233
             GQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+
Sbjct  242   GQKQRIAIARAMLKDPKILLLDEATSALDAGSESIVQEALDRLMIGRTTVVVAHRLSTIR  301

Query  232   EANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
               + IAV+++G V E G+H++L+A      YA L+R ++
Sbjct  302   NVDSIAVIQQGQVVETGTHEELIAKA--AAYANLIRFQE  338



>ref|XP_004304461.1| PREDICTED: ABC transporter B family member 1-like [Fragaria vesca 
subsp. vesca]
Length=1352

 Score =   367 bits (942),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 228/539 (42%), Positives = 342/539 (63%), Gaps = 18/539 (3%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  799   QINKYCYLLIGLSSAALLFNTLQHSFWDIVGENLTKRVREKMLAAVLKNEMAWFDQEENE  858

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +G + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  859   SGRIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  918

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F   L  P R 
Sbjct  919   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEGKIVGLFSSNLQIPLRR  978

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+YG+Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  979   CFWKGQIAGSGFGVAQFALYGSYALGLWYASWLVKHGISDFSKAIRVFMVLMVSANGAAE  1038

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQR-KGRKFETSKPFDIEFEMV  821
                LAPD      A+ +V E+++R+  I  D       P R +G         ++EF+ V
Sbjct  1039  TLTLAPDFIKGGQAMQSVFELLDRKTEIEPDDIDATAVPDRLRG---------EVEFKHV  1089

Query  820   TFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVD  641
              F+YPSRPDV V R+ SL+ + G  +ALVG SG GKS++I ++QRFYDP  GRV+++  D
Sbjct  1090  DFSYPSRPDVPVFRDLSLRARAGKTLALVGPSGCGKSSVISLVQRFYDPTSGRVIIDGKD  1149

Query  640   LRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLP  461
             +R+ NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKF+S LP
Sbjct  1150  IRKYNLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAANLANAHKFVSALP  1209

Query  460   EGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKIS  281
             EGY+T VG+ G+QLSGGQKQRIAIARA+L+K++++LLDEA+SALD ESE+ +Q+AL +  
Sbjct  1210  EGYKTFVGERGIQLSGGQKQRIAIARALLRKAELMLLDEATSALDAESERSIQEALERAC  1269

Query  280   KQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYA  104
                TTIVVAHRLSTI+ ANVIAV+ +G VAE GSH+ L+ +  +G YA +++ ++ +++
Sbjct  1270  SGKTTIVVAHRLSTIRNANVIAVIDDGKVAEQGSHNHLLKNYPDGCYARMIQLQRFSHS  1328


 Score =   275 bits (704),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 191/504 (38%), Positives = 307/504 (61%), Gaps = 6/504 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  176   GERQSTKMRIKYLEAALSQDIQFFDTEVRTSDVVFA-INTDAVIVQDAISEKLGNFIHYM  234

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA + S +  +  K    + ++A +    
Sbjct  235   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAIHMSTLAKLSGK-SQEALSQAGHTVEQ  293

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V  IR V ++  +   ++++  AL   +R   +     G  LG +   ++  Y L LW+
Sbjct  294   TVVQIRVVMSYVGESRALEAYSSALRIAQRLGYKSGFAKGMGLGATYFVVFCCYALLLWY  353

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  +TN G        +++   ++GQ A      + A  A   +  II+ +P + 
Sbjct  354   GGYLVRHHFTNGGLAISTMFSVMIGGLALGQSAPSMGAFAKAKVAAAKIFRIIDHKPGMD  413

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              + +  G + ++     +E + V F+YPSR DV +L NFSL +  G  +ALVG+SGSGKS
Sbjct  414   RNSE-AGVELQSVTGL-VELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSGSGKS  471

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D++ L LKWLR Q  LV QEPALFA TI ENI  G P+
Sbjct  472   TVVSLIERFYDPSSGQVLLDGHDIKTLKLKWLRQQIGLVSQEPALFATTIKENILLGRPD  531

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEAA+ A  H FI  LP+G++T+VG+ GVQLSGGQKQRIAIARA+LK   +LLL
Sbjct  532   ADQVEIEEAARVANAHSFIVKLPDGFDTQVGERGVQLSGGQKQRIAIARAMLKNPAILLL  591

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V+E G+HD+
Sbjct  592   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDE  651

Query  169   LMASELNGIYATLVRAEQEAYAFA  98
             L +   NG+YA L+R ++ A+  A
Sbjct  652   LFSKGENGVYAKLIRMQEAAHETA  675



>ref|XP_006652374.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1255

 Score =   365 bits (938),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 341/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ + GWFD +
Sbjct  726   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQE  785

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RLS D+   +S + +R SV+L  ++S  V   + F +EWR+ +L     P 
Sbjct  786   ENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAILILVTFPL  845

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ ++  F   L  P
Sbjct  846   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVP  905

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LW+GA+LV+   +    V K+F++LV+++ +
Sbjct  906   QMHSLRRSQISGALFGLSQLSLYASEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  965

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+N R  I  DP     +   S   DI+F  V FAYP
Sbjct  966   VAETVSLAPEIVRGGESIRSVFAILNYRTRI--DPDEPDTEPVESVRGDIDFRHVDFAYP  1023

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1024  SRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLN  1083

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             ++ LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LPEGY+T
Sbjct  1084  VRQLRLKIGLVQQEPVLFATSIMENIAYGKDGATEEEVVEAAKVANMHGFVSALPEGYKT  1143

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  1144  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTA  1203

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH +L+ S  +G Y+ L++ +
Sbjct  1204  VLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELV-SRPDGAYSRLLQLQ  1251


 Score =   296 bits (758),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 204/500 (41%), Positives = 299/500 (60%), Gaps = 6/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  113   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  171

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  172   STFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSK-SRESYANAGIIAEQ  230

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  231   AIAQVRTVYSYVGESKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  290

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I 
Sbjct  291   AGVFIRNGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIV  350

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              DP   GR  +     +IEF+ V F+YPSRPDV++ R+FSL    G   A+VG SGSGKS
Sbjct  351   QDPA-DGRCLDEVHG-NIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKS  408

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P+
Sbjct  409   TVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYGKPD  468

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T+VG+ G+QLSGGQKQRIAIARA+LK  K+LLL
Sbjct  469   ATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARAMLKNPKILLL  528

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++IAV+++G V E G+HD+
Sbjct  529   DEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDE  588

Query  169   LMASELNGIYATLVRAEQEA  110
             L+A   +G YA L+R ++ A
Sbjct  589   LLAKGSSGAYAALIRFQEMA  608



>ref|XP_004173903.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
1-like, partial [Cucumis sativus]
Length=703

 Score =   353 bits (907),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 217/516 (42%), Positives = 332/516 (64%), Gaps = 2/516 (0%)
 Frame = -1

Query  1672  ILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSR  1493
             +L+GL    ++    Q     + G  LT R+R  +  +ILK E  WFD +EN +  + +R
Sbjct  189   LLIGLSSAALLFNTIQHFFWDIVGENLTKRVREKMLTAILKNEMAWFDQEENESAKIAAR  248

Query  1492  LSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLI  1313
             L++D+ + RS +GDR SV++   S   V     F L+WRL+L+  A+ P  + A+    +
Sbjct  249   LALDANNVRSAIGDRISVIVQNTSLMLVACTAGFVLQWRLSLVLVAVFPVVVAATVLQKM  308

Query  1312  MNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQI  1136
                G   D  +++A+A+ +A  A++N+RTVA F+++E IV+ F   L  P R    + QI
Sbjct  309   FMTGFSGDLEANHAKATQLAGEAIANVRTVAAFNSEEKIVRLFSTNLEIPLRRCFWKGQI  368

Query  1135  LGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPD  956
              GS  G +Q ++Y +Y L LW+ ++LVK G ++     ++F++L++S+    +   LAPD
Sbjct  369   AGSGFGVAQFSLYASYALGLWYASWLVKHGLSDFSKAIRVFMVLMVSANGAAETLTLAPD  428

Query  955   TSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRN  776
                   A+ +V  +++R+  I  D +            ++E + V F+YP+RPD+ V ++
Sbjct  429   FIKGGRAMRSVFALLDRKTEIEPD-EPDATPVPDKLRGEVELKHVDFSYPTRPDIPVFKD  487

Query  775   FSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTAL  596
              +L+ + G  +ALVG SG GKS++I ++QRFY+P  GRV+++  D+R+ NLK LR   A+
Sbjct  488   LNLRARAGKTLALVGPSGCGKSSVIALVQRFYEPTSGRVMIDGKDIRKFNLKSLRKHIAM  547

Query  595   VGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqls  416
             V QEP LFA +I +NIA+G  +A+ TEI EAA  A  HKFISGLPEGY+T VG+ GVQLS
Sbjct  548   VPQEPCLFAASIYDNIAYGHESATETEIIEAATLANAHKFISGLPEGYKTFVGERGVQLS  607

Query  415   ggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTI  236
             GGQKQRIAIARA+++K++++LLDEA+SALD ESE+ VQ+AL +     TTIVVAHRLSTI
Sbjct  608   GGQKQRIAIARALIRKAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTI  667

Query  235   KEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             + A+VIAV+ +G V+E GSH  L+ +  +G YA ++
Sbjct  668   RNAHVIAVIDDGKVSEQGSHSHLLXNYPDGCYARMI  703


 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  271  TTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
            TT+V+AHRLSTI++A+++AV+++G+V+E G+HD+L A   NG+YA L+R ++ A+  A
Sbjct  1    TTLVIAHRLSTIRKADLVAVLQQGSVSEMGTHDELFAKGENGVYAKLIRMQEMAHETA  58



>ref|XP_008387923.1| PREDICTED: ABC transporter B family member 13-like [Malus domestica]
Length=1245

 Score =   364 bits (935),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 229/524 (44%), Positives = 331/524 (63%), Gaps = 4/524 (1%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             ++LI VGL    +   + Q     L G +LT+R+R  +FK+IL  E GWFD +EN+TG L
Sbjct  719   IALIFVGLAAVTVPIYLLQHYFYTLMGERLTTRVRLLMFKAILSNEVGWFDLEENNTGSL  778

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
              S L+ ++   RS L DR S ++  LS       I+F+  WR+  + +A  P  +GAS  
Sbjct  779   TSTLAANATLVRSALADRLSTIVQNLSLTVTAFVIAFTFSWRMAAVVSASLPLLIGASIT  838

Query  1321  SLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
               +   G   D N +Y+RA+++A  A++NIRTVA+F  +E I   F   L++P + +V R
Sbjct  839   EQLFLKGFGGDYNRAYSRATSVAREAIANIRTVASFGCEERISLQFSLELNKPNKQAVLR  898

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
               I G   G SQ   + +Y L LW+ + L+K+  +N G + K F++L+++S  + +   L
Sbjct  899   GHISGFCYGLSQFFAFCSYALGLWYASVLIKDKDSNFGDIMKSFMVLIVTSLCIAETLAL  958

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
              P+    S A+  +  I+ R   I  D  R       +   DIEF+ V+F YP+RPD+ +
Sbjct  959   TPEIMKGSQALSPIFSILKRETAIHRDDPRS--NVVANVKGDIEFKNVSFWYPARPDITI  1016

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
                 +L++  G  +A+VG SGSGKST+I ++ RFYDP+ GRVL++  D++ LNLK LR +
Sbjct  1017  FDYLNLRVSAGKSLAVVGPSGSGKSTVIALVMRFYDPVSGRVLIDGYDIKSLNLKSLRKR  1076

Query  604   TALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              +LV QEPALF+ TI ENI +G+  AS  E+  AAK A  H FIS +PEGY+T+VG+ GV
Sbjct  1077  MSLVQQEPALFSTTIYENIKYGYEEASEVEVVTAAKAANAHGFISRMPEGYKTQVGEKGV  1136

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQR+AIARAILK   +LLLDEA+SALD ESEK VQ+AL K+ +  TTI+VAHRL
Sbjct  1137  QLSGGQKQRVAIARAILKDPSILLLDEATSALDTESEKLVQEALDKLMEGRTTIMVAHRL  1196

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             STI++AN IA+++ G V E GSH++L+      +Y  LV  +Q+
Sbjct  1197  STIRDANRIALLQNGRVVEMGSHEQLIGRP-GSLYKQLVSLQQQ  1239


 Score =   272 bits (696),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 209/511 (41%), Positives = 294/511 (58%), Gaps = 43/511 (8%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    +S+L ++  +FD +   T ++   +S D++  +  +GD+    L  L
Sbjct  120   GERQTARLRMKYLQSVLNKDINFFDTEARDTNIIF-HISSDAILVQDAIGDKTGHALRYL  178

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG  I F+  W+LTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  179   SQFLVGFAIGFTSVWQLTLLTLAVVPFIAIAGGAY-TIIMSTLSEKGEAAYAEAGKVAEE  237

Query  1249  AVSNIRTVATFSTQEHIVQ----SFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTL  1082
              +S IRTV +F  ++  ++    S  KAL   K+T V +    G  +GF+ G ++ A+ L
Sbjct  238   VISQIRTVYSFGGEDRAIEAYSTSLNKALKLGKKTGVAK----GVGVGFTYGLLFCAWAL  293

Query  1081  TLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRR  902
              LW+ + LV+   TN G  +   + ++ S F++GQ A   P+    +    A   I+   
Sbjct  294   LLWYASILVRHHDTNGGKAFTTIINVIFSGFALGQAA---PNLGAIAKGRAAAANIMT--  348

Query  901   PLIGSD-------------PQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKI  761
              +I SD             P+  G+         I+F  V F YPSR + +V  N S  I
Sbjct  349   -MIDSDSKSCKVTDNGIVLPKVSGQ---------IDFCEVGFTYPSRSN-MVFDNLSFSI  397

Query  760   KGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEP  581
               G   A+VG SGSGKST+I MIQRFY P+ G++L++  +L  L LKWLR Q  LV QEP
Sbjct  398   GAGKTFAVVGPSGSGKSTVISMIQRFYHPVSGKILLDGHELGTLQLKWLREQMGLVSQEP  457

Query  580   ALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQ  401
             ALFA TI  NI FG  +A   +I EAAK A  H FI GLP+GY T+ G+ G QLSGGQKQ
Sbjct  458   ALFATTIASNILFGKEDADLDQIMEAAKAANAHSFIEGLPDGYNTQAGEGGTQLSGGQKQ  517

Query  400   RIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANV  221
             RIAIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI    TT++VAHRLSTI++ + 
Sbjct  518   RIAIARAVLRNPKILLLDEATSALDAESELVVQQALEKIMLHRTTVIVAHRLSTIQDVDT  577

Query  220   IAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             I V+K G VAE G+H  LM+ +  G YA LV
Sbjct  578   IVVLKNGQVAESGNHSDLMSKK--GEYANLV  606



>gb|KDO84908.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=1253

 Score =   364 bits (935),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 233/527 (44%), Positives = 329/527 (62%), Gaps = 4/527 (1%)
 Frame = -1

Query  1690  CQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENST  1511
                ++LI VGL    I   + Q     L G  LT+R+R  +F +IL  E GWFD DEN+T
Sbjct  723   VDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGWFDLDENNT  782

Query  1510  GVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGA  1331
             G+L+S L+ D+   RS L DR S+++  ++       I+F L WRL  + AA  P  +GA
Sbjct  783   GLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSWRLAAVVAASLPLLIGA  842

Query  1330  SYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTS  1154
                  +   G   D N +Y+RA+++A  A++NIRTVA +  ++ I   F   LS+P + +
Sbjct  843   FVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKRISIQFASELSQPNKQA  902

Query  1153  VRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQL  974
             + R  I G   G SQ     +Y L LW+ + L+K+  +N G + K F++L++++ +V + 
Sbjct  903   LLRGHISGFGYGVSQLLSLCSYALGLWYASVLIKQKGSNFGDIMKSFMVLIITALAVAET  962

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
               LAPD    S A+  V  I+ R+  I   P     K  T    +IE   V+F YP RPD
Sbjct  963   LALAPDIVKGSQALGPVFGILYRKTAI--QPDDPASKEVTEIKGNIELRNVSFKYPVRPD  1020

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
             + +  N +LK+  G  +A+VG SGSGKST+I ++ RFYDPI G VL++  D+R LNL+ L
Sbjct  1021  ITIFENLNLKVSAGRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDGYDIRTLNLRSL  1080

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             R +  LV QEPALF+ TI ENI +G  +AS  E+ +A K A  H FIS +PEGY++ VG 
Sbjct  1081  RRKIGLVQQEPALFSTTIYENIKYGNEDASEIELMKATKAANAHGFISRMPEGYQSHVGD  1140

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE  +Q+AL K+ +  TTI+VA
Sbjct  1141  RGVQLSGGQKQRVAIARAILKNPSILLLDEATSALDTASENLIQEALDKLMEGRTTIMVA  1200

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             HRLSTI+ A+ IAV+++G VAE GSH++L+  E NGIY  L+R +Q+
Sbjct  1201  HRLSTIRNADKIAVLQQGKVAEIGSHEQLLRKE-NGIYKQLIRLQQD  1246


 Score =   263 bits (673),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 202/528 (38%), Positives = 295/528 (56%), Gaps = 12/528 (2%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L LV LG   +V+           G + T+R+R    +S+LK++  +FD +   + ++ 
Sbjct  98    ALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVLKKDMSFFDTEARDSNIIF  157

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGASY  1325
               +S D++  +  +GD+    L  LS   VG  + F+  W+LTLL  A+       G +Y
Sbjct  158   -HISSDAILVQDAIGDKTGHALRYLSQFFVGFAVGFTSVWQLTLLTLAVVPLIAVAGGAY  216

Query  1324  FSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
              ++ M+   +   ++Y  A  +A   +S +R V  F  +   ++S+  +L E  +   + 
Sbjct  217   -TITMSTLSEKGEAAYGEAGKVAEEIISQVRAVYAFVGEAKAIESYSHSLKEALKQGKKS  275

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
                 G  +G + G ++ A+ L LW+   LV+ G TN G  +   + ++ S F++GQ A  
Sbjct  276   GVAKGIGVGLTYGLLFCAWALLLWYAGILVRHGDTNGGKAFTTIINVIFSGFALGQAA--  333

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF--DIEFEMVTFAYPSRPDV  791
              P+ +  +    A   II+         +R G    T       IEF  V FAYPSRP  
Sbjct  334   -PNLAAIAKGKAAAANIISIIKENSHSSERPGDDGITLPKLAGQIEFSEVCFAYPSRPH-  391

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
             +V  N +  +  G   A VG SGSGKST+I M+QR Y+P  G++L++  DL+ L LKWLR
Sbjct  392   MVFENLNFSVDAGKTFAFVGPSGSGKSTIISMVQRLYEPTSGKILLDGHDLKSLQLKWLR  451

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              Q  LV QEPALFA +I  NI  G  +AS   + EAAK A  H F+ GLP+GY+T+VG+ 
Sbjct  452   EQMGLVSQEPALFATSIANNILLGKEDASMDRVIEAAKAANAHSFVEGLPDGYQTQVGEG  511

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQRIAIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI    TTIVVAH
Sbjct  512   GTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESELIVQRALEKIMSNRTTIVVAH  571

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAY  107
             RLST+++ + I V+K G V E G+H  L++    G YA LV  +   +
Sbjct  572   RLSTVRDVDTIMVLKNGQVVESGTHVDLISK--GGEYAALVNLQSSEH  617



>ref|XP_006435210.1| hypothetical protein CICLE_v10000054mg [Citrus clementina]
 gb|ESR48450.1| hypothetical protein CICLE_v10000054mg [Citrus clementina]
Length=1253

 Score =   364 bits (935),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 233/527 (44%), Positives = 329/527 (62%), Gaps = 4/527 (1%)
 Frame = -1

Query  1690  CQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENST  1511
                ++LI VGL    I   + Q     L G  LT+R+R  +F +IL  E GWFD DEN+T
Sbjct  723   VDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGWFDLDENNT  782

Query  1510  GVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGA  1331
             G+L+S L+ D+   RS L DR S+++  ++       I+F L WRL  + AA  P  +GA
Sbjct  783   GLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSWRLAAVVAASLPLLIGA  842

Query  1330  SYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTS  1154
                  +   G   D N +Y+RA+++A  A++NIRTVA +  ++ I   F   LS+P + +
Sbjct  843   FVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKRISIQFASELSQPNKQA  902

Query  1153  VRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQL  974
             + R  I G   G SQ     +Y L LW+ + L+K+  +N G + K F++L++++ +V + 
Sbjct  903   LLRGHISGFGYGVSQLLSLCSYALGLWYASVLIKQKGSNFGDIMKSFMVLIITALAVAET  962

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
               LAPD    S A+  V  I+ R+  I   P     K  T    +IE   V+F YP RPD
Sbjct  963   LALAPDIVKGSQALGPVFGILYRKTAI--QPDDPASKEVTEIKGNIELRNVSFKYPVRPD  1020

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
             + +  N +LK+  G  +A+VG SGSGKST+I ++ RFYDPI G VL++  D+R LNL+ L
Sbjct  1021  ITIFENLNLKVSAGRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDGYDIRTLNLRSL  1080

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             R +  LV QEPALF+ TI ENI +G  +AS  E+ +A K A  H FIS +PEGY++ VG 
Sbjct  1081  RRKIGLVQQEPALFSTTIYENIKYGNEDASEIELMKATKAANAHGFISRMPEGYQSHVGD  1140

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE  +Q+AL K+ +  TTI+VA
Sbjct  1141  RGVQLSGGQKQRVAIARAILKNPSILLLDEATSALDTASENLIQEALDKLMEGRTTIMVA  1200

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             HRLSTI+ A+ IAV+++G VAE GSH++L+  E NGIY  L+R +Q+
Sbjct  1201  HRLSTIRNADKIAVLQQGKVAEIGSHEQLLRKE-NGIYKQLIRLQQD  1246


 Score =   263 bits (673),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 202/528 (38%), Positives = 295/528 (56%), Gaps = 12/528 (2%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L LV LG   +V+           G + T+R+R    +S+LK++  +FD +   + ++ 
Sbjct  98    ALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVLKKDMSFFDTEARDSNIIF  157

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGASY  1325
               +S D++  +  +GD+    L  LS   VG  + F+  W+LTLL  A+       G +Y
Sbjct  158   -HISSDAILVQDAIGDKTGHALRYLSQFFVGFAVGFTSVWQLTLLTLAVVPLIAVAGGAY  216

Query  1324  FSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
              ++ M+   +   ++Y  A  +A   +S +R V  F  +   ++S+  +L E  +   + 
Sbjct  217   -TITMSTLSEKGEAAYGEAGKVAEEIISQVRAVYAFVGEAKAIESYSHSLKEALKQGKKS  275

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
                 G  +G + G ++ A+ L LW+   LV+ G TN G  +   + ++ S F++GQ A  
Sbjct  276   GVAKGIGVGLTYGLLFCAWALLLWYAGILVRHGDTNGGKAFTTIINVIFSGFALGQAA--  333

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF--DIEFEMVTFAYPSRPDV  791
              P+ +  +    A   II+         +R G    T       IEF  V FAYPSRP  
Sbjct  334   -PNLAAIAKGKAAAANIISIIKENSHSSERPGDDGITLPKLAGQIEFSEVCFAYPSRPH-  391

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
             +V  N +  +  G   A VG SGSGKST+I M+QR Y+P  G++L++  DL+ L LKWLR
Sbjct  392   MVFENLNFSVDAGKTFAFVGPSGSGKSTIISMVQRLYEPTSGKILLDGHDLKSLQLKWLR  451

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              Q  LV QEPALFA +I  NI  G  +AS   + EAAK A  H F+ GLP+GY+T+VG+ 
Sbjct  452   EQMGLVSQEPALFATSIANNILLGKEDASMDRVIEAAKAANAHSFVEGLPDGYQTQVGEG  511

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQRIAIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI    TTIVVAH
Sbjct  512   GTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESELIVQRALEKIMSNRTTIVVAH  571

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAY  107
             RLST+++ + I V+K G V E G+H  L++    G YA LV  +   +
Sbjct  572   RLSTVRDVDTIMVLKNGQVVESGTHVDLISK--GGEYAALVNLQSSEH  617



>ref|XP_011034998.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Populus euphratica]
Length=1041

 Score =   360 bits (925),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 228/522 (44%), Positives = 321/522 (61%), Gaps = 3/522 (1%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             ++LI VG     +   I Q     L G +L +R+R  +F +IL  E GWFD DENSTG L
Sbjct  516   VALIFVGAAVVTVPIYILQHYFYTLMGERLIARVRLSMFSAILCNEIGWFDLDENSTGSL  575

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
              S L+ D+   RS L DR S ++  +S       I FSL WR++ +  A  P  +GA+  
Sbjct  576   TSTLAADATLVRSTLADRLSTMVQNVSLTVTAFVIGFSLSWRVSAVIIACFPLLIGAAIT  635

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
               +   G   D  SY RA+ +A  A++NIRTVA+F  +E I   F   L++P +  + + 
Sbjct  636   EQLFLKGFGGDYRSYTRANAVAREAIANIRTVASFGAEERIAHQFASELNKPNKQVLLQG  695

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   G SQ     AY L +W+ + ++    ++   V K F++LV++SF++ +   L+
Sbjct  696   HISGIGYGASQFFSLCAYALGIWYASVVISHNESDFNHVMKSFMVLVMTSFAIAETVALS  755

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD    S A+ +V  I++R+  +  DP     K  T    D+E   V+F YP+RPD I+ 
Sbjct  756   PDIMKGSQALESVFSILHRKTAM--DPDDPTSKVITDIKGDVELRHVSFKYPARPDTIIF  813

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
              + +L++  G  +A+VG SGSGKST+I +I RFYDPI G VL++  D++ LNLK LR + 
Sbjct  814   EDLNLEVSAGKSLAVVGQSGSGKSTVIALILRFYDPISGTVLIDGYDVKTLNLKSLRRKI  873

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
              LV QEPALF+ TI ENI +G  NAS  E+ +AAK A  H FIS + EGY+T VG  G+Q
Sbjct  874   GLVQQEPALFSTTIYENIQYGNENASEIEVMKAAKAANAHGFISRMNEGYQTHVGDRGLQ  933

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILK   +LLLDEA+SALD  SEK VQ+AL K+ +  TT++VAHRLS
Sbjct  934   LSGGQKQRIAIARAILKDPSILLLDEATSALDTASEKLVQEALDKLMEGRTTVLVAHRLS  993

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             T+++A+ IAV++ G V E GSH++L+     G+Y  LV  +Q
Sbjct  994   TVRDADSIAVLQHGRVVEIGSHNQLIGKPC-GVYKQLVSLQQ  1034


 Score =   248 bits (632),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 172/400 (43%), Positives = 247/400 (62%), Gaps = 9/400 (2%)
 Frame = -1

Query  1324  FSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
             +++IM+   +   ++YA A  +A  A+S IRTV +F  +E +++ + K+L +  +   + 
Sbjct  8     YTIIMSTLSEKGEAAYAEAGKVADEAISQIRTVYSFVGEEKVLEEYSKSLKKALKLGKKS  67

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
                 G  +G   G ++ A+++ LW+ + LV+ G TN    + + + ++ S F++GQ A  
Sbjct  68    GIAKGVGIGSIHGLLFCAWSMLLWYSSILVRRGDTNGAKAFTVIMNVIFSGFALGQAAPN  127

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRK--FETSKPFDIEFEMVTFAYPSRPDV  791
                 S   AA  +++ +I +     S P +              IEF  V F+YPSR + 
Sbjct  128   IGAISKGRAAAASIMSMIEKD----SSPSKNLEDGIVMPKVSGQIEFCEVCFSYPSRSN-  182

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
             +V  N S  I  G   A+VG SGSGKST+I M+QRFY+P  G++L++  DL+ L LKWLR
Sbjct  183   MVFENLSFSISAGKTFAVVGPSGSGKSTVISMVQRFYEPTSGKILLDGHDLKTLQLKWLR  242

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              Q  LV QEPALFA TI +NI FG  +AS  +I EAAK A +H F+   P+GY T+VG+ 
Sbjct  243   EQMGLVSQEPALFATTIADNILFGKEDASMDQIYEAAKAANVHSFVLQCPDGYHTQVGEG  302

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQR+AIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI    TTIVVAH
Sbjct  303   GTQLSGGQKQRLAIARAVLRNPKILLLDEATSALDAESELTVQQALEKIMANRTTIVVAH  362

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATL  131
             RLSTI++ + I V+K G V E GSH +L++    G YA++
Sbjct  363   RLSTIRDVDTIIVLKNGQVVESGSHLELISK--GGEYASM  400



>gb|EEC77398.1| hypothetical protein OsI_16157 [Oryza sativa Indica Group]
Length=1248

 Score =   364 bits (934),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 341/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ + GWFD +
Sbjct  719   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQE  778

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RLS D+   +S + +R SV+L  ++S  V   + F +EWR+ +L     P 
Sbjct  779   ENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPL  838

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ ++  F   L  P
Sbjct  839   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVP  898

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LW+GA+LV+   +    V K+F++LV+++ +
Sbjct  899   QMHSLRRSQISGALFGLSQLSLYASEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  958

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+N R  I  DP     +   S   DI+F  V FAYP
Sbjct  959   VAETVSLAPEIVRGGESIRSVFAILNYRTRI--DPDEPETEPVESVRGDIDFRHVDFAYP  1016

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1017  SRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLN  1076

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             ++ LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LPEGY+T
Sbjct  1077  VRSLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKT  1136

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  1137  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTA  1196

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH +L+ S  +G Y+ L++ +
Sbjct  1197  VLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELV-SRPDGAYSRLLQLQ  1244


 Score =   286 bits (733),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 203/506 (40%), Positives = 297/506 (59%), Gaps = 12/506 (2%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  100   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  158

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  159   STFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSK-SRDSYANAGIIAEQ  217

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  218   AIAQVRTVYSYVGESKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  277

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I 
Sbjct  278   AGVFIRNGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIV  337

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              DP   GR  +     +IEF+ V F+YPSRPDV++ R+FSL    G   A+VG SGSGKS
Sbjct  338   QDPA-DGRCLDEVHG-NIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKS  395

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P+
Sbjct  396   TVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYGKPD  455

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYE------TkvgqsgvqlsggqkQRIAIARAILKK  368
             A+  E+E AA  A  H FI+ LP GY         VG+ G+QLSGGQKQRIAIARA+LK 
Sbjct  456   ATMAEVEAAATSANAHSFIALLPNGYTLRWVLGLLVGERGLQLSGGQKQRIAIARAMLKN  515

Query  367   SKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAE  188
              K+LLLDEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++IAV+++G V E
Sbjct  516   PKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQGQVVE  575

Query  187   YGSHDKLMASELNGIYATLVRAEQEA  110
              G+HD+L+A   +G YA L+R ++ A
Sbjct  576   TGTHDELLAKGSSGAYAALIRFQEMA  601



>emb|CAD59581.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1256

 Score =   363 bits (933),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 341/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ + GWFD +
Sbjct  727   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQE  786

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RLS D+   +S + +R SV+L  ++S  V   + F +EWR+ +L     P 
Sbjct  787   ENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPL  846

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ ++  F   L  P
Sbjct  847   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVP  906

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LW+GA+LV+   +    V K+F++LV+++ +
Sbjct  907   QMHSLRRSQISGALFGLSQLSLYASEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  966

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+N R  I  DP     +   S   DI+F  V FAYP
Sbjct  967   VAETVSLAPEIVRGGESIRSVFAILNYRTRI--DPDEPETEPVESVRGDIDFRHVDFAYP  1024

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1025  SRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLN  1084

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             ++ LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LPEGY+T
Sbjct  1085  VRSLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKT  1144

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  1145  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTA  1204

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH +L+ S  +G Y+ L++ +
Sbjct  1205  VLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELV-SRPDGAYSRLLQLQ  1252


 Score =   296 bits (758),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 210/533 (39%), Positives = 308/533 (58%), Gaps = 6/533 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+      SL  V LG     +   +       G +    +R    +++L+Q+ G+FD D
Sbjct  81    LRRMTDEYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTD  140

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--  1349
                TG +V  +S D++  +  +G++    +  LS+   GL + F   WRL LL+ A+   
Sbjct  141   AR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPG  199

Query  1348  pftLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE  1169
                 G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+ +A+  
Sbjct  200   IAFAGGLYAYTLTGLTSK-SRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQN  258

Query  1168  PKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSF  989
               +   +     G  +G + G    ++ L  W+    ++ G T+ G  +      ++   
Sbjct  259   TLKLGYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGL  318

Query  988   SVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAY  809
             S+GQ        S    A   +LE+I +RP I  DP   GR  +     +IEF+ V F+Y
Sbjct  319   SLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIVQDPA-DGRCLDEVHG-NIEFKEVAFSY  376

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             PSRPDV++ R+FSL    G   A+VG SGSGKST++ +I+RFYDP QG+VL++ VD++ L
Sbjct  377   PSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTL  436

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
              LKWLR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP GY 
Sbjct  437   QLKWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNGYN  496

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T+VG+ G+QLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    T
Sbjct  497   TQVGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRT  556

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             T+VVAHRLSTI+  ++IAV+++G V E G+HD+L+A   +G YA L+R ++ A
Sbjct  557   TVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQEMA  609



>ref|NP_001052982.1| Os04g0459000 [Oryza sativa Japonica Group]
 dbj|BAF14896.1| Os04g0459000 [Oryza sativa Japonica Group]
 gb|EEE61119.1| hypothetical protein OsJ_15045 [Oryza sativa Japonica Group]
Length=1259

 Score =   364 bits (934),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 341/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ + GWFD +
Sbjct  730   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQE  789

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RLS D+   +S + +R SV+L  ++S  V   + F +EWR+ +L     P 
Sbjct  790   ENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPL  849

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ ++  F   L  P
Sbjct  850   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVP  909

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LW+GA+LV+   +    V K+F++LV+++ +
Sbjct  910   QMHSLRRSQISGALFGLSQLSLYASEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  969

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+N R  I  DP     +   S   DI+F  V FAYP
Sbjct  970   VAETVSLAPEIVRGGESIRSVFAILNYRTRI--DPDEPETEPVESVRGDIDFRHVDFAYP  1027

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1028  SRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLN  1087

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             ++ LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LPEGY+T
Sbjct  1088  VRSLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKT  1147

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  1148  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTA  1207

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH +L+ S  +G Y+ L++ +
Sbjct  1208  VLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELV-SRPDGAYSRLLQLQ  1255


 Score =   296 bits (758),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 204/500 (41%), Positives = 299/500 (60%), Gaps = 6/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  117   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  175

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  176   STFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSK-SRDSYANAGIIAEQ  234

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  235   AIAQVRTVYSYVGESKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  294

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I 
Sbjct  295   AGVFIRNGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIV  354

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              DP   GR  +     +IEF+ V F+YPSRPDV++ R+FSL    G   A+VG SGSGKS
Sbjct  355   QDPA-DGRCLDEVHG-NIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKS  412

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P+
Sbjct  413   TVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYGKPD  472

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T+VG+ G+QLSGGQKQRIAIARA+LK  K+LLL
Sbjct  473   ATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARAMLKNPKILLL  532

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++IAV+++G V E G+HD+
Sbjct  533   DEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDE  592

Query  169   LMASELNGIYATLVRAEQEA  110
             L+A   +G YA L+R ++ A
Sbjct  593   LLAKGSSGAYAALIRFQEMA  612



>ref|XP_009151836.1| PREDICTED: ABC transporter B family member 19 [Brassica rapa]
Length=1252

 Score =   363 bits (933),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 234/529 (44%), Positives = 343/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   ++  + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  723   MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  782

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  783   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  842

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  843   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  902

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S  RSQ  G   G SQ A+YG+  L LW+GA+LV EG +    V K+F++LV+++ S
Sbjct  903   QKRSFYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSEGKSTFSKVIKVFVVLVITANS  962

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DI+F  V FAYP
Sbjct  963   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIDFRHVDFAYP  1020

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1021  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGKDIRRLN  1080

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1081  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVMEAARSANAHGFISGLPEGYKT  1140

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1141  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1200

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1201  VVVAHRLSTIRGVDSIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1248


 Score =   287 bits (735),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 209/528 (40%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  +  +  DIEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGFKLMEIINQRPTIIQDPL-DGKCLDQVRG-DIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ RNFS+    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  378   PDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLK  437

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  438   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  497

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  498   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  557

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A    G YA+L+R ++
Sbjct  558   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAKA--GAYASLIRFQE  603



>emb|CDX86408.1| BnaA06g31250D [Brassica napus]
Length=1237

 Score =   363 bits (932),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 234/529 (44%), Positives = 343/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   ++  + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  708   MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  767

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  768   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  827

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  828   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  887

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S  RSQ  G   G SQ A+YG+  L LW+GA+LV EG +    V K+F++LV+++ S
Sbjct  888   QKRSFYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSEGKSTFSKVIKVFVVLVITANS  947

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DI+F  V FAYP
Sbjct  948   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIDFRHVDFAYP  1005

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1006  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGKDIRRLN  1065

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1066  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVMEAARSANAHGFISGLPEGYKT  1125

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1126  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1185

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1186  VVVAHRLSTIRGVDSIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1233


 Score =   283 bits (723),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 209/529 (40%), Positives = 310/529 (59%), Gaps = 9/529 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  +  +  DIEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGFKLMEIINQRPTIIQDPL-DGKCLDQVRG-DIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQ-GRVLMEEVDLRELNL  623
             PDVI+ RNFS+    G  VA+VG SGSGKST++ +I+RFYDP   G++L++ V+++ L L
Sbjct  378   PDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNAGQILLDGVEIKTLQL  437

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K+LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+
Sbjct  438   KFLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQ  497

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+
Sbjct  498   VGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTV  557

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VVAHRL TI+  + IAV+++G V E G+H++L+A    G YA+L+R ++
Sbjct  558   VVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAKA--GAYASLIRFQE  604



>ref|XP_006473687.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Citrus sinensis]
Length=1260

 Score =   363 bits (933),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 232/527 (44%), Positives = 328/527 (62%), Gaps = 4/527 (1%)
 Frame = -1

Query  1690  CQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENST  1511
                ++LI VGL    I   + Q     L G  LT+R+R  +F +IL  E GWFD DEN+T
Sbjct  730   VDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGWFDLDENNT  789

Query  1510  GVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGA  1331
             G+L+S L+ D+   RS L DR S+++  ++       I+F L WRL  + AA  P  +GA
Sbjct  790   GLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSWRLAAVVAASLPLLIGA  849

Query  1330  SYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTS  1154
                  +   G   D N +Y+RA+++A  A++NIRTVA +  ++ I   F   LS+P + +
Sbjct  850   FVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKRISIQFASELSQPNKQA  909

Query  1153  VRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQL  974
             + R  I G   G SQ     +Y L LW+ + L+K+  +N G + K F++L++++ +V + 
Sbjct  910   LLRGHISGFGYGVSQLLSLCSYALGLWYASVLIKQKGSNFGDIMKSFMVLIITALAVAET  969

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
               LAPD    S A+  V  I+ R+  I   P     K  T    +IE   V+F YP RPD
Sbjct  970   LALAPDIVKGSQALGPVFGILYRKTAI--QPDDPASKEVTEIKGNIELRNVSFKYPVRPD  1027

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
             + +  N +LK+  G  +A+VG SGSGKST+I ++ RFYDPI G VL++  D+R  NL+ L
Sbjct  1028  ITIFENLNLKVSAGRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDGYDIRTFNLRSL  1087

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             R +  LV QEPALF+ TI ENI +G  +AS  E+ +A K A  H FIS +PEGY++ VG 
Sbjct  1088  RRKIGLVQQEPALFSTTIYENIKYGNEDASEIELMKATKAANAHGFISRMPEGYQSHVGD  1147

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE  +Q+AL K+ +  TTI+VA
Sbjct  1148  RGVQLSGGQKQRVAIARAILKNPSILLLDEATSALDTASENLIQEALDKLMEGRTTIMVA  1207

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             HRLSTI+ A+ IAV+++G VAE GSH++L+  E NGIY  L+R +Q+
Sbjct  1208  HRLSTIRNADKIAVLQQGKVAEIGSHEQLLRKE-NGIYKQLIRLQQD  1253


 Score =   268 bits (685),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 202/526 (38%), Positives = 293/526 (56%), Gaps = 8/526 (2%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L LV LG   +V+           G + T+R+R    +S+LK++  +FD +   + ++ 
Sbjct  105   ALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVLKKDMSFFDTEARDSNIIF  164

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGASY  1325
               +S D++  +  +GD+    L  LS   VG  + F+  W+LTLL  A+       G +Y
Sbjct  165   -HISSDAILVQDAIGDKTGHALRYLSQFFVGFAVGFTSVWQLTLLTLAVVPLIAVAGGAY  223

Query  1324  FSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
              ++ M+   +   ++YA A  +A   +S +R V  F  +   ++S+  +L E  +   + 
Sbjct  224   -TITMSTLSEKGEAAYAEAGKVAEEIISQVRAVYAFVGEAKAIESYSHSLKEALKQGKKS  282

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
                 G  +G + G ++ A+ L LW+   LV+ G TN G  +   + ++ S F++GQ A  
Sbjct  283   GVAKGIGVGLTYGLLFCAWALLLWYAGILVRHGDTNGGKAFTTIINVIFSGFALGQAAPN  342

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
                 +   AA   ++ II         P   G          IEF  V FAYPSRP  +V
Sbjct  343   LAAIAKGKAAAANIVSIIKENSHSSERPGDDGITLPKLAG-QIEFCEVCFAYPSRPH-MV  400

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
               N +  +  G   A VG SGSGKST+I M+QR Y+P  G++L++  DL+ L LKWLR Q
Sbjct  401   FENLNFSVDAGKTFAFVGPSGSGKSTIISMVQRLYEPTSGKILLDGHDLKSLQLKWLREQ  460

Query  604   TALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
               LV QEPALFA +I  NI  G  +AS   + EAAK A  H F+ GLP+GY+T+VG+ G 
Sbjct  461   MGLVSQEPALFATSIANNILLGKEDASMDRVIEAAKAANAHSFVEGLPDGYQTQVGEGGT  520

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI    TTIVVAHRL
Sbjct  521   QLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESELIVQRALEKIMSNRTTIVVAHRL  580

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAY  107
             ST+++ + I V+K G V E G+H  L++    G YA LV  +   +
Sbjct  581   STVRDVDTIMVLKNGQVVESGTHVDLISK--GGEYAALVNLQSSEH  624



>ref|XP_002983357.1| hypothetical protein SELMODRAFT_117838 [Selaginella moellendorffii]
 gb|EFJ15699.1| hypothetical protein SELMODRAFT_117838 [Selaginella moellendorffii]
Length=1296

 Score =   364 bits (934),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 235/503 (47%), Positives = 318/503 (63%), Gaps = 3/503 (1%)
 Frame = -1

Query  1669  LVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRL  1490
              +GLG    +  I Q       G  LT R+R  L  S+L  E GWFD +ENSTG L SRL
Sbjct  742   FLGLGVASFIVNIVQHCSFAALGESLTKRVREKLLASMLSFEVGWFDREENSTGALCSRL  801

Query  1489  SIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIM  1310
             + D+   R ++GDR S+L+   S+ +V   +     W+L ++  A+ P  +   Y   I 
Sbjct  802   ASDASMVRGLVGDRISLLVQTASATSVSFIVGLITSWKLAMVIIAIQPLIILCYYVKNIC  861

Query  1309  NVGPKLDNSSYAR-ASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQIL  1133
               G   + ++  R A  IA+ AVS+ RTV  FS+QE ++  F+  L  P R +++RS I 
Sbjct  862   LRGFAQNTAAAQREACKIASEAVSHHRTVTAFSSQERVLAFFKSKLEVPIRETMKRSHIA  921

Query  1132  GSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDT  953
             G +LG +Q  +Y ++ L  W+G  LVK G +  GAV K   ILV +   + +   L+PD 
Sbjct  922   GFSLGVAQFILYASWGLDFWYGGLLVKHGESTFGAVLKTIFILVSTGRVLAEAGTLSPDL  981

Query  952   SMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNF  773
             +   +A+ +V EI++R+  I  D ++   K       D+EF  V FAYPSRPD++VL+NF
Sbjct  982   AKGVSAVKSVFEILDRKTEI--DAEKDSAKCVPVLKGDVEFYDVYFAYPSRPDLLVLKNF  1039

Query  772   SLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALV  593
              L++  G  VALVG SG GKS+ I +I+RFYDPI G+V ++  D+R L+LKWLR Q ALV
Sbjct  1040  RLRVNAGQTVALVGESGCGKSSAIGLIERFYDPIGGKVTIDGRDIRGLSLKWLRRQIALV  1099

Query  592   GQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsg  413
              QEP LFA +I ENIA+G  NAS +E+ EAA+ A  H FIS LP+GY T  G+ G+QLSG
Sbjct  1100  SQEPTLFATSIWENIAYGTENASDSEVVEAARAANAHSFISALPDGYSTFAGEKGLQLSG  1159

Query  412   gqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIK  233
             GQKQRIAIARAILK   +LLLDEA+SALD ESE+ VQ AL  I    TTIVVAHRLSTI+
Sbjct  1160  GQKQRIAIARAILKNPAILLLDEATSALDAESEEIVQQALETIMASRTTIVVAHRLSTIQ  1219

Query  232   EANVIAVVKEGAVAEYGSHDKLM  164
              A+ IAVV++G+V E GSH+ L+
Sbjct  1220  NADSIAVVQDGSVVEQGSHEDLL  1242


 Score =   264 bits (674),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 190/493 (39%), Positives = 288/493 (58%), Gaps = 6/493 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +  +RIR    ++IL+Q  G+FD D  ST  +V  +S+D++  +  + ++    +  L
Sbjct  126   GERQVARIRADYLRAILRQNVGYFDSD-MSTAEVVGNVSVDTLLVQEAISEKVGNFIENL  184

Query  1423  SSAAVGLGISFSLEWRltllaaal-tpftLGASYFSLIMNVGPKLDNSSYARASNIAAGA  1247
             S    G  + F+  WRL L+         +  S +S  ++       S+Y  A  IA   
Sbjct  185   SHFVGGYFVGFTQIWRLALVMLPFFPLLIIPGSLYSKALSEFAIRRQSAYKEAGTIAEQG  244

Query  1246  VSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFG  1067
             +S++RTV +F  ++   + +  AL    +  +++    G A+G S G  +  +    W+G
Sbjct  245   LSSVRTVYSFVAEKKTTEKYSAALDGTVKLGLKQGLAKGLAMG-SSGINFALWAFMAWYG  303

Query  1066  AYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGS  887
             + LV +   N G V      ++    ++G         +    A   + ++I R P I  
Sbjct  304   SELVMQHRANGGQVLTTGFAVLSGGIALGNATPNMKAFAEGRVAGTRIFKMIQRVPPI--  361

Query  886   DPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKST  707
             D      K  +    +++ + V FAYPSRP  +VL++F+L +     VALVG+SGSGKST
Sbjct  362   DTNDSSGKTLSKVEGNLDLKEVEFAYPSRPGALVLKSFTLHVPAKKTVALVGSSGSGKST  421

Query  706   LIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNA  527
             +I +I+RFYDP+ G+V+++ VD+REL+L WLR Q  LV QEP LFA +I ENI +G  NA
Sbjct  422   IISLIERFYDPVAGQVMLDNVDIRELHLMWLRRQMGLVNQEPGLFATSIRENILYGKENA  481

Query  526   SYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllld  347
             S  EI  AAK A  H FI  +P GY+T+VG+ GVQLSGGQKQRIAIARA+++   +LLLD
Sbjct  482   SMEEITHAAKLANAHDFIQRMPRGYDTQVGERGVQLSGGQKQRIAIARALIRNPPILLLD  541

Query  346   eassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKL  167
             EA+SALD  SE+ VQ AL +   + TT++VAHRLST++EA++I V+  G   E GSH++L
Sbjct  542   EATSALDSLSEQAVQQALERARMERTTVIVAHRLSTVQEADLIVVMDSGIAVESGSHEEL  601

Query  166   MASELNGIYATLV  128
             +A E  G+YA+L+
Sbjct  602   VA-EKTGVYASLL  613



>ref|XP_010655614.1| PREDICTED: ABC transporter B family member 9-like isoform X2 
[Vitis vinifera]
Length=1165

 Score =   362 bits (928),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 233/518 (45%), Positives = 328/518 (63%), Gaps = 4/518 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L+ VGLG   ++ +  Q    G+AG KL  RIR+  F+ ++ QE  WFD   NS+G + 
Sbjct  642   ALMFVGLGVLTLMVVPVQNYFFGVAGGKLIQRIRSLSFEKVVHQEISWFDDPANSSGAVG  701

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ S RS++GD  ++++  L++   GL ISF+  W L L+  A+ P      YF 
Sbjct  702   ARLSTDASSVRSLVGDALALVVQNLTTVIAGLVISFTANWILALIILAVLPLVFLQGYFQ  761

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D    Y  AS +A  AV +IRTVA+F  ++ ++  +++    P +  VR  
Sbjct  762   MKFVKGFSADAKVMYEEASQVANDAVGSIRTVASFCAEKKVMDMYQQKCDAPMKQGVRLG  821

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              + G+  GFS  A+Y       + GA LV+ G    G V+K+F  L +S+  + Q + +A
Sbjct  822   LVSGAGFGFSFFALYCTNAFCFYIGAILVQHGKATFGEVFKVFFALTISAIGISQTSAMA  881

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDT+ A  +   + ++++ +P I S    +G      K  DIEF+ V+F Y +RPDV + 
Sbjct  882   PDTNKAKDSTATIFQLLDSKPTIDSS-SNEGTTLANVKG-DIEFQHVSFKYSTRPDVQIF  939

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+ SL I  G  VALVG SGSGKST+I +I+RFY+P  GR+L++ +++++L L WLR Q 
Sbjct  940   RDLSLSIPSGKTVALVGESGSGKSTVISLIERFYNPESGRILLDGMEIQKLKLSWLRQQM  999

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
              LVGQEP LF  TI  NIA+G   A+  EI  A K A  H FI  LP+GYET VG+ GVQ
Sbjct  1000  GLVGQEPVLFNETIRANIAYGKEGATEDEIIAATKAANAHNFIHSLPQGYETSVGERGVQ  1059

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILK  K+LLLDEA+SALD ESE+ VQ+AL ++  + TT+VVAHRL+
Sbjct  1060  LSGGQKQRIAIARAILKDPKILLLDEATSALDAESERVVQEALDRVMVERTTVVVAHRLT  1119

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             TIK A++IAVVK G +AE GSH++LM S  +G YA+LV
Sbjct  1120  TIKGADIIAVVKNGVIAEKGSHEELM-SITDGPYASLV  1156


 Score =   268 bits (684),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 195/499 (39%), Positives = 294/499 (59%), Gaps = 5/499 (1%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +  +RIR    K+IL+Q+  +FD  E +TG ++ R+S D++  +  +G++    + 
Sbjct  2     VTGERQATRIRGLYLKTILRQDIAFFD-TETTTGEVIGRMSGDTILIQDAMGEKVGKFIQ  60

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt-pftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
              +S+   G  I+F+  W L+L+         +     ++IM+        +YA A N+  
Sbjct  61    LMSTFLGGFIIAFARGWLLSLVLLPSIPLLVISGGTMAIIMSRMSSRGQLAYAEAGNVVE  120

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
               V  IRTVA+F+ ++  +++++  L     ++V++    G  LG     ++G Y L +W
Sbjct  121   QTVGAIRTVASFTGEKKAIKNYDNKLHIAYASTVQQGLASGIGLGTVLLIIFGTYGLAMW  180

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             +G+ LV E   + G V    + ++    S+GQ +      +   AA   + E I R+P I
Sbjct  181   YGSKLVIERGYDGGRVINCIMAIMSGGMSLGQTSPCLNAFAAGQAAAYKMFETIKRKPQI  240

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
              +     G   E  +  +IE + V F YP+RPDV +    SL +  G   ALVG SGSGK
Sbjct  241   DA-YDTSGTVLEDIRG-EIELKDVYFNYPARPDVQIFSGISLHVPSGKTAALVGQSGSGK  298

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST+I +++RFYDP  G VL++ VDL++L LKW+R +  LV QEP LFA TI ENI++G  
Sbjct  299   STVISLLERFYDPHSGEVLIDGVDLKQLQLKWIREKIGLVSQEPILFATTIKENISYGKE  358

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
             +AS  EI  A   A   KFI  LP+G +T VG+ G QLSGGQKQRIAIARAILK  ++LL
Sbjct  359   DASDEEIRTAIVLANAAKFIDKLPKGLDTMVGEHGTQLSGGQKQRIAIARAILKNPRILL  418

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD ESE+ VQDAL  +    TT+VVAHRL+TI+ A++IAVV +G + E G+H 
Sbjct  419   LDEATSALDAESERIVQDALVNVMVNRTTVVVAHRLTTIRNADIIAVVYQGKIVEQGTHG  478

Query  172   KLMASELNGIYATLVRAEQ  116
             +L+  + +G Y  LV  ++
Sbjct  479   ELI-KDPDGAYTQLVHLQE  496



>ref|XP_002967417.1| hypothetical protein SELMODRAFT_87743 [Selaginella moellendorffii]
 gb|EFJ32016.1| hypothetical protein SELMODRAFT_87743 [Selaginella moellendorffii]
Length=1325

 Score =   364 bits (934),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 229/518 (44%), Positives = 325/518 (63%), Gaps = 6/518 (1%)
 Frame = -1

Query  1672  ILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSR  1493
             + V L   C + +  Q       G  L  RIR   FK++L+QE GWFD  ENS+G + SR
Sbjct  807   MFVVLACACFIIIPCQMVSFAYVGQNLIRRIRYLTFKTVLRQEIGWFDARENSSGAISSR  866

Query  1492  LSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLI  1313
             LS D+   R ++GD  ++ +  L++ A GL I+FS  W L L+  AL P         + 
Sbjct  867   LSTDAAYVRGMVGDSLALTVQNLATIAAGLLIAFSATWELALVIFALVPLLSLQGIMQIK  926

Query  1312  MNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQI  1136
             +  G   D    Y  AS++AA A+S+IR+VA+F  +E +++ +E     P +  +R   +
Sbjct  927   VMTGFSADAKVMYEEASHVAADAISSIRSVASFCAEEKMLKLYEDKCRRPLKNGIRLGLV  986

Query  1135  LGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPD  956
              G+  G S   M+ +Y L+ W+GA LVK+  T    V+K+F  + +S+  V   AGLAPD
Sbjct  987   SGAGFGCSNVVMFSSYGLSFWYGAQLVKDRKTTFQKVFKVFFAITMSAIGVSHAAGLAPD  1046

Query  955   TSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLR  779
                   ++ ++  +++R+  I  DP   +G   +     D++F+ V+F YPSRPDV + R
Sbjct  1047  LGKVKTSVISIFSMLDRKSKI--DPADLQGSTLDILHG-DVQFQHVSFKYPSRPDVQIFR  1103

Query  778   NFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTA  599
             +F+L ++ GT  ALVG SG GKST I +IQRFYDP  G++ ++ VD+R L L+WLR Q A
Sbjct  1104  DFTLFVEAGTTAALVGESGCGKSTAISLIQRFYDPDCGKIFIDGVDIRSLQLRWLRQQMA  1163

Query  598   LVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvql  419
             LVGQEP LF+GT+G NI +G    S  EI++AA  A  +KFI  LP+G++T+VG+ G QL
Sbjct  1164  LVGQEPVLFSGTLGSNIGYGKDGVSDDEIKDAAISANAYKFIMDLPDGFDTEVGERGTQL  1223

Query  418   sggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLST  239
             SGGQKQRIAIARAI+K  K+LLLDEA+SALD ESE+ VQ+AL  + +  T +VVAHRLST
Sbjct  1224  SGGQKQRIAIARAIVKNPKILLLDEATSALDAESERLVQEALNLVMQNRTVVVVAHRLST  1283

Query  238   IKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             I  A VI+VVK G VAE G H +L+  E NG+Y+ LV+
Sbjct  1284  IVNAGVISVVKNGVVAEQGRHKELLQIE-NGVYSLLVK  1320


 Score =   280 bits (715),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 210/525 (40%), Positives = 310/525 (59%), Gaps = 11/525 (2%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L  + +GLG G    M     +C  AG +  +RIR    KSIL+Q+  +FD    STG +
Sbjct  155   LRYVFLGLGTGAAALMETSFWMC--AGERQAARIRALYLKSILRQDVSFFD-KGISTGEV  211

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGAS  1328
             + R+S D+   +  +G++    +  LS+   G  ++F   WRL L+ +++       GA+
Sbjct  212   LGRMSDDTFLIQDAIGEKVGKFVQLLSTFFGGFILAFIRGWRLALVVSSVLPLLVIAGAT  271

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
                LI     +    +YA A NI   AV  IRTVA+F+ ++  V  ++ AL +  R  V 
Sbjct  272   MAMLISKTSSR-GQMAYADAGNIVQQAVGGIRTVASFTGEDKAVGDYDTALGKAYRAGVY  330

Query  1147  RSQILGSALGFSQGAMYGAYTLTLWFGAYLV-KEGYTNIGAVYKIFLILVLSSFSVGQLA  971
             +    G  +G +   +Y +Y L LW+G+ L+   GYT  GAV  + L +++   ++GQ +
Sbjct  331   QGLSSGFGMGCTLLTLYLSYALALWYGSKLILHNGYTG-GAVINVMLSVLMGGMALGQAS  389

Query  970   GLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDV  791
                   +   AA   + E+I+R P I S    KG    T+   +IE E V F YPSRP V
Sbjct  390   PSLRAFAAGQAAAYKMFEVIHRVPAIDS-YNMKGAIL-TNVQGNIEIESVNFTYPSRPGV  447

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
              +L+ F L I  G   ALVG SGSGKST+I +++RFYDP  G V ++  D+R+L LKWLR
Sbjct  448   QILKGFCLSIPSGMTAALVGQSGSGKSTVISLLERFYDPQSGVVSIDGHDIRKLQLKWLR  507

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              Q  LV QEP LF  ++ EN+A+G   A+  +++ A + A   +FIS +P+GY+T VG  
Sbjct  508   QQIGLVSQEPVLFGVSVWENVAYGKNGATKEDVQAACELANAARFISNMPQGYDTYVGHH  567

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ +L ++    TT++VAH
Sbjct  568   GTQLSGGQKQRIAIARAILKNPRILLLDEATSALDAESERIVQKSLERVMVDRTTVIVAH  627

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             RLSTI++AN I V ++G + E G+H  L+A   +G Y+ L++ ++
Sbjct  628   RLSTIRDANSIFVFQQGKIVESGTHSSLLAIP-DGHYSQLIKLQE  671



>ref|XP_010554005.1| PREDICTED: ABC transporter B family member 19-like [Tarenaya 
hassleriana]
Length=1250

 Score =   363 bits (931),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 233/531 (44%), Positives = 347/531 (65%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  721   MERKTKEFVFIFIGTGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEE  780

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  781   EHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  840

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  841   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFSHELLVP  900

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+RRSQ  G   G SQ A+YG+  L LW+GA LV +G +    V K+F++LV+++ S
Sbjct  901   QKRSLRRSQTSGFLFGLSQLALYGSEALILWYGARLVGKGESTFSKVIKVFVVLVITANS  960

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  +IEF  V FAYP
Sbjct  961   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDPDA-DPVETVRG-EIEFRHVDFAYP  1018

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++F+++I+ G   ALVGASGSGKS++I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1019  SRPDVMVFKDFNVRIRAGQSQALVGASGSGKSSVIALIERFYDPVAGKVMIDGKDIRRLN  1078

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR + ALV QEPALFA  I ENIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1079  LKSLRLKIALVQQEPALFAANIFENIAYGKEGATESEVIEAARAANAHGFISGLPEGYKT  1138

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK  +VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1139  MVGERGVQLSGGQKQRIAIARAVLKNPRVLLLDEATSALDAESECVLQEALERLMRGRTT  1198

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             +VVAHRLSTI+  + I VV++G + E GSH +L+ S  +G Y+ L++ +  
Sbjct  1199  VVVAHRLSTIRGVHKIGVVQDGRIVEEGSHSELI-SRPDGAYSRLLQLQSH  1248


 Score =   270 bits (691),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 201/498 (40%), Positives = 297/498 (60%), Gaps = 8/498 (2%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++LKQ+ G+FD D   TG +V  +S D++  +  + ++    +   
Sbjct  110   GERQVGALRKKYLEAVLKQDVGFFDTDAR-TGDIVFSVSTDTLLVQDAISEKVGNFIHYQ  168

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  169   STFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGITSK-SRESYANAGVIAEQ  227

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+  A+    +   +     G  LG + G    ++ L  W+
Sbjct  228   AIAQVRTVYSYVGESKALSSYSDAIQHTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWY  287

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G ++ G  +      ++   S+GQ        S   AA   ++EIIN++P I 
Sbjct  288   AGVFIRNGQSDGGKAFTAIFSAIVGGMSLGQSFSNLGAFSKGKAAGYKLMEIINQKPSII  347

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              DP   G+  +  +  +IEF+ VTF+YPSRP VI+ RNFS+ +  G  VA+VG SGSGKS
Sbjct  348   QDPL-DGKCLDEVRG-NIEFKDVTFSYPSRPAVIIFRNFSIFLPAGKTVAVVGGSGSGKS  405

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G++L++ VD++ L LK+LR Q  LV QEPALFA TI ENI +G P+
Sbjct  406   TVVSLIERFYDPNDGQILLDGVDIKTLQLKFLRDQIGLVNQEPALFATTILENILYGKPD  465

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   E+E AA  A  H FI+ LP+GY T+VG+ GVQLSGGQKQRIAIARA+LK  K+LLL
Sbjct  466   AKMAEVEAAASAANAHSFITLLPDGYNTQVGERGVQLSGGQKQRIAIARAMLKDPKILLL  525

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTIK  + I V+++G V E G+H++
Sbjct  526   DEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIKNVDSIVVIQQGQVVETGNHEE  585

Query  169   LMASELNGIYATLVRAEQ  116
             L+A    G YA+L+R ++
Sbjct  586   LIAKA--GAYASLIRFQE  601



>ref|XP_002447959.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
 gb|EES12287.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
Length=1262

 Score =   363 bits (931),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 234/529 (44%), Positives = 338/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +   IL+ + GWFD +
Sbjct  733   MESKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQE  792

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RLS D+   +S + +R SV+L  ++S  V   + F +EWR+ LL     P 
Sbjct  793   ENNSNLVTARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVALLILVTFPL  852

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  853   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVP  912

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LWFGA+LV+   +    V K+F++LV+++ S
Sbjct  913   QMHSLRRSQISGALFGASQLSLYASEALILWFGAHLVRTHVSTFSKVIKVFVVLVITANS  972

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+N R  I  DP     +   S   +I+F  V FAYP
Sbjct  973   VAETVSLAPEIVRGGESIRSVFAILNSRTRI--DPDDPDAEQVESVRGEIDFRHVDFAYP  1030

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPDV+V ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1031  TRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMVDGKDIRRLN  1090

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LP+GY T
Sbjct  1091  LKSLRLRIGLVQQEPVLFAASILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYRT  1150

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  1151  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTA  1210

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH  L+ S  +G Y+ L++ +
Sbjct  1211  VLVAHRLSTIRGVDNIAVVQDGRVVEQGSHGDLV-SRPDGAYSRLLQLQ  1258


 Score =   291 bits (745),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 202/500 (40%), Positives = 297/500 (59%), Gaps = 6/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  122   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  180

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  181   ATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSK-SRDSYANAGIIAEQ  239

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  240   AIAQVRTVYSYVGETKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  299

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I 
Sbjct  300   AGVFIRNGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIV  359

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              D    GR  +     +IEF+ V F+YPSRPDV++ R+FSL    G   A+VG SGSGKS
Sbjct  360   QDTA-DGRCLDEVHG-NIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKS  417

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P+
Sbjct  418   TVVALIERFYDPNQGQVLLDNVDIKTLQLKWLREQIGLVNQEPALFATTILENILYGKPD  477

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T VG+ G+QLSGGQKQRIAIARA+LK  K+LLL
Sbjct  478   ATMAEVEAAATSANAHSFIALLPNGYNTHVGERGLQLSGGQKQRIAIARAMLKNPKLLLL  537

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++IAV+++G V E G+HD+
Sbjct  538   DEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDE  597

Query  169   LMASELNGIYATLVRAEQEA  110
             L+A   +G YA L+R ++ A
Sbjct  598   LLAKGSSGAYAALIRFQETA  617



>ref|XP_004975845.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1258

 Score =   362 bits (930),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 338/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +   IL+ + GWFD +
Sbjct  729   MESKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQE  788

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RL+ D+   +S + +R SV+L  ++S  V   + F +EWR+ LL     P 
Sbjct  789   ENNSSLVAARLATDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVALLILITFPL  848

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  849   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCGELRVP  908

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LWFGA+LV+   +    V K+F++LV+++ S
Sbjct  909   QMYSLRRSQISGALFGLSQLSLYASEALILWFGAHLVRTHVSTFSKVIKVFVVLVITANS  968

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+N R  I  DP     +   S   +I+F  V FAYP
Sbjct  969   VAETVSLAPEIVRGGESIRSVFAILNSRTRI--DPDEPDTEQVESVRGEIDFRHVDFAYP  1026

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPDV+V ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1027  TRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGRDIRRLN  1086

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LP+GY T
Sbjct  1087  LKSLRLKIGLVQQEPVLFATSILENIAYGKDGATEEEVVEAAKAANVHGFVSALPDGYRT  1146

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  1147  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTA  1206

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH  L+ S  +G Y+ L++ +
Sbjct  1207  VLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGDLV-SRPDGAYSRLLQLQ  1254


 Score =   292 bits (747),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 202/500 (40%), Positives = 297/500 (59%), Gaps = 6/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  118   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  176

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  177   ATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSK-SRDSYANAGIIAEQ  235

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  236   AIAQVRTVYSYVGETKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  295

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I 
Sbjct  296   AGVFIRNGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIV  355

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              D    GR  +     +IEF+ V F+YPSRPDV++ R+FSL    G   A+VG SGSGKS
Sbjct  356   QDTA-DGRCLDEVHG-NIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKS  413

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P+
Sbjct  414   TVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYGKPD  473

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T VG+ G+QLSGGQKQRIAIARA+LK  K+LLL
Sbjct  474   ATMAEVEAAATSANAHSFIALLPNGYNTHVGERGLQLSGGQKQRIAIARAMLKNPKILLL  533

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++IAV+++G V E G+HD+
Sbjct  534   DEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDE  593

Query  169   LMASELNGIYATLVRAEQEA  110
             L+A   +G YA L+R ++ A
Sbjct  594   LLAKGSSGAYAALIRFQETA  613



>emb|CDY65012.1| BnaCnng45670D [Brassica napus]
Length=1253

 Score =   362 bits (930),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 234/529 (44%), Positives = 343/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   ++  + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  724   MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  783

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  784   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  843

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  844   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  903

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S  RSQ  G   G SQ A+YG+  L LW+GA+LV EG +    V K+F++LV+++ S
Sbjct  904   QKRSFYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSEGKSTFSKVIKVFVVLVITANS  963

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DI+F  V FAYP
Sbjct  964   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIDFRHVDFAYP  1021

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1022  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGKDIRRLN  1081

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1082  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKT  1141

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1142  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECMLQEALERLMRGRTT  1201

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1202  VVVAHRLSTIRGVDSIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1249


 Score =   282 bits (722),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 209/529 (40%), Positives = 310/529 (59%), Gaps = 9/529 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSKYALYFVYLGLIVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  +  +  DIEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGFKLMEIINQRPTIIQDPL-DGKCLDQVRG-DIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQ-GRVLMEEVDLRELNL  623
             PDVI+ RNFS+    G  VA+VG SGSGKST++ +I+RFYDP   G++L++ V+++ L L
Sbjct  378   PDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNAGQILLDGVEIKTLQL  437

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K+LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GYET+
Sbjct  438   KFLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYETQ  497

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+
Sbjct  498   VGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTV  557

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VVAHRL TI+  + IAV+++G V E G+H++L+A    G YA+L+R ++
Sbjct  558   VVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAKA--GAYASLIRFQE  604



>ref|XP_011098607.1| PREDICTED: ABC transporter B family member 19 [Sesamum indicum]
Length=1250

 Score =   362 bits (930),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 231/531 (44%), Positives = 341/531 (64%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  721   MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  780

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  781   ENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  840

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  841   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELRVP  900

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +R S+ RSQ  G   G SQ A+Y +    LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  901   QRRSLCRSQCSGFLFGLSQLALYASEAFILWYGAHLVSKGASTFSKVIKVFVVLVITANS  960

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   I  DP     +   S   +IE   V FAYP
Sbjct  961   VAETVSLAPEIIRGGEAVGSVFSILDRPTRI--DPDEPEAEPVESIRGEIELRHVDFAYP  1018

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++FSL+I+ G   ALVGASGSGKS++I +I+RFYDPI G+V+++  D+R LN
Sbjct  1019  SRPDVMVFKDFSLRIRAGQSQALVGASGSGKSSVIVLIERFYDPIAGKVMIDGKDIRRLN  1078

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I +NIA+G   A+  E+ EAA+ A +H F+SGLPEGY+T
Sbjct  1079  LKSLRLKIGLVQQEPALFAASIFDNIAYGKDGATEAEVIEAARAANVHTFVSGLPEGYKT  1138

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1139  TVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTT  1198

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             +++AHRLSTI+  N I VV++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1199  VLIAHRLSTIRGVNSIGVVQDGRIVEQGSHGELI-SRPEGAYSRLLQLQHH  1248


 Score =   272 bits (695),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 198/498 (40%), Positives = 294/498 (59%), Gaps = 7/498 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++LKQ+ G+FD D   TG +V  +S D++  +  + ++    +  L
Sbjct  109   GERQVGALRKKYLEAVLKQDVGFFDTDAR-TGDIVFSVSTDTLLVQDAISEKVGNFIHYL  167

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  168   STFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSK-SRESYANAGIIAEQ  226

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             +++ +RTV ++  +   + ++   +    +   +     G  LG + G    ++ L  W+
Sbjct  227   SIAQVRTVYSYVGESKALSAYSDLIQNTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWY  286

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S   AA   ++EII ++P I 
Sbjct  287   AGVFIRNGQTDGGKAFTAIFSAIVGGMSLGQSFSNLGAFSKGKAAGYKLMEIIKQKPTIV  346

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              D     +        +IEF+ VTF+YPSRPDVI+ R+FS+    G  VA+VG SGSGKS
Sbjct  347   QDASSDAKCLADVHG-NIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVAVVGGSGSGKS  405

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG +L++ VD++ L L+WLR+Q  LV QEPALFA TI ENI +G P+
Sbjct  406   TVVSLIERFYDPNQGEILLDNVDIKTLQLRWLRNQIGLVNQEPALFATTILENILYGKPD  465

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T+VG+ GVQLSGGQKQRIAIARA+LK  K+LLL
Sbjct  466   ATMAEVEAAASAANAHSFITLLPIGYNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLL  525

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  + IAV+++G V E G+H++
Sbjct  526   DEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDCIAVIQQGQVVETGTHEE  585

Query  169   LMASELNGIYATLVRAEQ  116
             L+A    G YA+L+R ++
Sbjct  586   LIAKA--GAYASLIRFQE  601



>ref|XP_002877137.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53396.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
Length=1252

 Score =   362 bits (929),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 343/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  723   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  782

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  783   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  842

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  843   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  902

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  903   QKRSLYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  962

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  963   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1020

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1021  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1080

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1081  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKT  1140

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1141  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1200

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S  +G Y+ L++ +
Sbjct  1201  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPDGAYSRLLQLQ  1248


 Score =   280 bits (717),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   W+L LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN++P I  DP   G+  +     +IEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGYKLMEIINQKPTIIQDP-LDGKCLDQVHG-NIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ RNF++    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  378   PDVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLK  437

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  438   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  497

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  498   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  557

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  558   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  603



>ref|XP_006290510.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
 gb|EOA23408.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
Length=1252

 Score =   362 bits (928),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 342/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  723   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  782

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  783   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  842

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  843   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFSHELRVP  902

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  903   QKRSLYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSKGESTFSKVIKVFVVLVITANS  962

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  963   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1020

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1021  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1080

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1081  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKT  1140

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1141  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1200

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1201  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1248


 Score =   282 bits (721),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 311/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  + LG     +   +      +G +  + +R    +++L+Q+ G+FD D   
Sbjct  82    EVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLRQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   W+L LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSIAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFAAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  E     +IEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGYKLMEIINQRPTIIQDPL-DGQCLEQVHG-NIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ RNF++    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V++++L LK
Sbjct  378   PDVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKKLQLK  437

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  438   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  497

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  498   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  557

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  558   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  603



>ref|XP_008784383.1| PREDICTED: ABC transporter B family member 19 [Phoenix dactylifera]
Length=1253

 Score =   362 bits (928),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 232/537 (43%), Positives = 341/537 (64%), Gaps = 16/537 (3%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  724   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDED  783

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      + F +EWR+ LL  A  P 
Sbjct  784   ENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVGFIVEWRVALLILATFPL  843

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  844   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELRVP  903

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +R S+RRSQ  G   G SQ ++Y +  L LW+GA+LV+ G +    V K+F++LV+++ S
Sbjct  904   QRRSLRRSQTSGLLFGLSQLSLYSSEALVLWYGAHLVRSGASTFSKVIKVFVVLVITANS  963

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIG-SDPQRKGRKFETSKPFD-----IEFEM  824
             V +   LAP+      +I ++  I+NR   I   DP+        ++P D     IE   
Sbjct  964   VAETVSLAPEIIRGGESIRSIFSILNRGTRIDPDDPE--------AEPIDSIRGEIELRH  1015

Query  823   VTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEV  644
             V FAYPSRPDV + ++F+L+I+ G   ALVGASGSGKST+I +I+RFYDP  G+V+++  
Sbjct  1016  VDFAYPSRPDVPIFKDFNLRIRSGQSQALVGASGSGKSTVIGLIERFYDPTAGKVMVDGK  1075

Query  643   DLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGL  464
             D+R LNLK LR +  LV QEP LFA +I ENIA+G   A+  E+ EAA+ A +H F+S L
Sbjct  1076  DIRRLNLKSLRLKIGLVQQEPVLFAASIFENIAYGKDRATEEEVIEAARAANVHGFVSVL  1135

Query  463   PEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKI  284
             PEGY+T VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++
Sbjct  1136  PEGYKTAVGERGVQLSGGQKQRIAIARAVLKNPAVLLLDEATSALDAESECVLQEALERL  1195

Query  283   SKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
              +  TT++VAHRLSTI+  + IAVV++G + E GSH +L+ +  +G Y+ L++ +  
Sbjct  1196  MRGRTTVLVAHRLSTIRGVDSIAVVQDGRIVEQGSHTELV-TRADGAYSRLLQLQHH  1251


 Score =   285 bits (730),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 212/530 (40%), Positives = 306/530 (58%), Gaps = 6/530 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  + LG    V+   +       G +     R    +++LKQ+ G+FD D   
Sbjct  81    EVSKYALYFIYLGLVVCVSSYAEIACWMYTGERQVGTFRRRYLEAVLKQDVGFFDTDAR-  139

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAF  199

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV +F  +   + S+ +A+    +
Sbjct  200   AGGLYAYTLTGLTSK-GRESYANAGIIAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLK  258

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  +G + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  259   LGYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  318

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S    A   ++EII +RP I  DP       E     +IEF+ VTF+YPSR
Sbjct  319   QAFSNLGAFSKGKIAGYKLMEIIRQRPSIIQDPSDGKCLPEVHG--NIEFKDVTFSYPSR  376

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ R+FSL    G   A+VG SGSGKST++ +I+RFYDP QG+VL++ VD++ L LK
Sbjct  377   PDVIIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLK  436

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FIS LP GY T+ 
Sbjct  437   WLRDQIGLVNQEPALFATTILENILYGKPDATIAEVEAAASAANAHSFISLLPNGYNTQA  496

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALDL SE  VQ+AL ++    TT+V
Sbjct  497   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDLGSESIVQEALDRLMVGRTTVV  556

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             VAHRLSTIK  ++IAV+++G V E G+H++L+A   +G YA+L+R ++ A
Sbjct  557   VAHRLSTIKNVDMIAVMQQGQVVETGTHEELLAKGSSGAYASLIRFQEMA  606



>ref|XP_008369562.1| PREDICTED: ABC transporter B family member 1-like [Malus domestica]
Length=1346

 Score =   362 bits (930),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 228/528 (43%), Positives = 335/528 (63%), Gaps = 4/528 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  793   QINKYCYLLIGLSSAALIFNTXQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  852

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRLTL+  A+ PF + 
Sbjct  853   SARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLTLVLIAVFPFVVA  912

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F + L  P R 
Sbjct  913   ATVLQKLFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEGKIVGLFSRNLQIPLRR  972

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  973   CFWKGQIAGSGFGIAQFALYASYALGLWYASWLVKHGISDFSKTIRVFVVLMVSANGAAE  1032

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSK-PFDIEFEMVTFAYPSR  800
                LAPD      A+ +V E+++R+  I  +P        T +   +IE + V F YP+R
Sbjct  1033  TLTLAPDFINGGRAMRSVFELLDRKTEI--EPDDPDATVVTDRLRGEIELKHVDFTYPTR  1090

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV + R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRVL++  D+R+ NLK
Sbjct  1091  PDVPIFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVLIDGKDIRKYNLK  1150

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
              LR   ALV QEP LFA TI ENIA+G   A+  EI EAA  A  HKFIS LPEGY+T V
Sbjct  1151  SLRRHIALVPQEPCLFATTIYENIAYGHEPATEAEIIEAANLANAHKFISALPEGYKTFV  1210

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQR+AIARA+L+K++V+LLDEA+SALD ESE+ +Q+AL +     TTIV
Sbjct  1211  GERGVQLSGGQKQRVAIARALLRKAEVMLLDEATSALDAESERSIQEALERACSGKTTIV  1270

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1271  VAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1318


 Score =   270 bits (689),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 189/504 (38%), Positives = 304/504 (60%), Gaps = 6/504 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  170   GERQSTKMRIKYLEAALSQDIQYFDTEVRTSDVVFA-INTDTVMVQDAISEKLGNFIHYM  228

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A +    
Sbjct  229   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGGIHTTALGKISGK-SQEALSQAGHTVEQ  287

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V+ IR V ++  +   +Q++  AL   ++   +     G  LG +   ++  Y L LW+
Sbjct  288   TVAQIRVVLSYVGESRALQAYSSALKVAQKLGYKSGFAKGMGLGATYFVVFCCYALLLWY  347

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  +TN G        ++L    +GQ          A  A   + +II+ +P + 
Sbjct  348   GGYLVRHHFTNGGLAIATMFAVMLGGIGLGQSVPSMGAFVKAKVAAAKIFKIIDHKPGMD  407

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              + +  G + E+     +E + V F+YPSR DV +L NFSL +  G  +ALVG+SGSGKS
Sbjct  408   RNSE-AGVELESVTGL-VELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSGSGKS  465

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D++ L LKWLR Q  LV QEPALFA TI ENI  G P+
Sbjct  466   TVVSLIERFYDPSSGQVLLDGHDIKTLKLKWLRQQIGLVSQEPALFATTIKENILLGRPD  525

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEAA+ A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  526   ADQVEIEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  585

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V+E G+HD+
Sbjct  586   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDE  645

Query  169   LMASELNGIYATLVRAEQEAYAFA  98
             L     NG+YA L+R ++ A+  A
Sbjct  646   LFLKGENGVYAKLIRMQEMAHETA  669



>gb|KFM27090.1| ABC transporter B family member 4 [Auxenochlorella protothecoides]
Length=1370

 Score =   362 bits (930),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 231/531 (44%), Positives = 330/531 (62%), Gaps = 8/531 (2%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+   +   L+ +G+G G ++  I Q    GL G +L  R+R  +  ++L+QE GWFD +
Sbjct  839   LKAGTRKWCLVFLGIGLGAMLFSIIQSYAFGLMGQRLGKRVRVLMMTALLRQEVGWFDQE  898

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
              N++GVL S+LS D+++ +   GD   +L   L +   G  ++FS  W++TL+  ++ P 
Sbjct  899   SNNSGVLTSKLSTDALAVKGQFGDTMGLLTQNLVTFIGGYALAFSHGWKMTLVVTSVVPL  958

Query  1342  tLGASYFS--LIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE  1169
              + A++     I +   + D + +A ++  A  AV NIRT+A F+ +  +   +E  L E
Sbjct  959   IVAAAWIQTKYIKDAATREDGA-FAYSNQTAQEAVGNIRTIAAFAMERGVTDLYEGQLVE  1017

Query  1168  PKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSF  989
             P   + RR +  G   GFSQ  ++GAY+L  W+   LV  G + +  V  +F  + L++F
Sbjct  1018  PTHQAKRRGRSGGLGFGFSQFVLFGAYSLAFWYAGLLVSRGESTLEEVLSVFFAIFLAAF  1077

Query  988   SVGQLAGLAPDTSMASAAIPAVLEIINRRPLI-GSDPQRKGRKFETSKPFDIEFEMVTFA  812
              V Q     PD +   AA   V  I++R P I  SDP   G +        IE   V+FA
Sbjct  1078  GVAQSQMFFPDVAKGRAATERVFAIVDRVPAIDASDP--SGDRIADCAG-TIELVDVSFA  1134

Query  811   YPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRE  632
             YP RPD +V R+FSL +  G +VALVG SGSGKST++ +++RFYDP+ G V ++  DLRE
Sbjct  1135  YPLRPDALVFRDFSLSVPAGRVVALVGESGSGKSTVVGLVERFYDPLSGSVRLDGRDLRE  1194

Query  631   LNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGY  452
             LNLKWLRS   LV QEP LF  ++ +NI +G P+AS  E+E AA+ +  HKF++ LPEGY
Sbjct  1195  LNLKWLRSVVGLVSQEPVLFTMSVADNIRYGRPDASMEEVEAAARASNAHKFVARLPEGY  1254

Query  451   ETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQA  272
              T VG+ G+QLSGGQKQRIAIARA++K  KVLLLDEA+SALD ESE  VQ+AL ++    
Sbjct  1255  HTLVGEGGIQLSGGQKQRIAIARAVIKDPKVLLLDEATSALDAESEAVVQEALDRLMANR  1314

Query  271   TTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             TTIVVAHRLSTI+ AN IAVV +G + E G+HD+LM    +G YA LV+ +
Sbjct  1315  TTIVVAHRLSTIRHANSIAVVYKGVIVESGTHDELMGRH-HGAYARLVQHQ  1364


 Score =   297 bits (760),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 222/527 (42%), Positives = 313/527 (59%), Gaps = 9/527 (2%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ Q   +    + +G  C V    Q         + T+RIR    +S+L Q+ G+F+  
Sbjct  123   LKDQVNTIVPQFIYIGIACFVGSCAQMFCWTYTAVRQTNRIRMRYLQSVLLQDVGYFE-S  181

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E S G L+  L+ D ++ +S +GDR    L  L +A +G+ ++F+  W +TL+  A+TP 
Sbjct  182   ETSPGALMQGLNEDCITIQSAIGDRMGRTLFNLFTAIIGIIVAFTRGWSMTLVMLAVTPL  241

Query  1342  tLGASYF--SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE  1169
              + A +   +L+  +  ++ N +YA A+ +A   +SN+RTV  F+ ++  ++ +E +L +
Sbjct  242   LMIAGFLIATLVARLTSRM-NQAYAGANTLATQTLSNVRTVYAFNGEQRSLKGYEASLED  300

Query  1168  PKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSF  989
             P R  +++    G  +GF+    +GAY L LW+G+  +  G    G V  +    ++  F
Sbjct  301   PVRVGIKQGAFAGMIVGFTNLVAFGAYALALWYGSTRILAGEYTGGQVLNVLFAALIGGF  360

Query  988   SVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAY  809
             ++GQ A         + +   V  ++ R PLI  D   +  K E S    I    V F Y
Sbjct  361   ALGQAAPNLQYFQQGATSGARVYAVMEREPLINLDAPGEELK-EVSGALSIV--DVDFNY  417

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPDV VL  FSL+I  G  VALVG SGSGKST+I +++RFYDP  G VL++ VDLR L
Sbjct  418   PARPDVPVLHGFSLEIAAGATVALVGESGSGKSTVIALLERFYDPTAGAVLLDGVDLRSL  477

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
              L+WLR Q +LV QEP LFA +I +NIA G   A+  E+E AA+ A  H FIS LP GY 
Sbjct  478   QLRWLRRQLSLVSQEPMLFATSIRDNIALGRAGATDAEVEAAARAANAHGFISALPSGYA  537

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQ+SGGQKQRIAIARAILK  KVLLLDEA+SALD  SE  VQ AL  + +  T
Sbjct  538   THVGERGVQMSGGQKQRIAIARAILKAPKVLLLDEATSALDARSEYVVQRALDALMRACT  597

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             T+VVAHRLST+  A+VIAVV  G V E G+H  L+A+   G YATLV
Sbjct  598   TVVVAHRLSTVVGADVIAVVGGGRVVEAGTHAGLLAA--GGAYATLV  642



>ref|XP_002271185.1| PREDICTED: ABC transporter B family member 9-like isoform X1 
[Vitis vinifera]
Length=1270

 Score =   361 bits (927),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 233/518 (45%), Positives = 328/518 (63%), Gaps = 4/518 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L+ VGLG   ++ +  Q    G+AG KL  RIR+  F+ ++ QE  WFD   NS+G + 
Sbjct  747   ALMFVGLGVLTLMVVPVQNYFFGVAGGKLIQRIRSLSFEKVVHQEISWFDDPANSSGAVG  806

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ S RS++GD  ++++  L++   GL ISF+  W L L+  A+ P      YF 
Sbjct  807   ARLSTDASSVRSLVGDALALVVQNLTTVIAGLVISFTANWILALIILAVLPLVFLQGYFQ  866

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D    Y  AS +A  AV +IRTVA+F  ++ ++  +++    P +  VR  
Sbjct  867   MKFVKGFSADAKVMYEEASQVANDAVGSIRTVASFCAEKKVMDMYQQKCDAPMKQGVRLG  926

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              + G+  GFS  A+Y       + GA LV+ G    G V+K+F  L +S+  + Q + +A
Sbjct  927   LVSGAGFGFSFFALYCTNAFCFYIGAILVQHGKATFGEVFKVFFALTISAIGISQTSAMA  986

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDT+ A  +   + ++++ +P I S    +G      K  DIEF+ V+F Y +RPDV + 
Sbjct  987   PDTNKAKDSTATIFQLLDSKPTIDSS-SNEGTTLANVKG-DIEFQHVSFKYSTRPDVQIF  1044

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+ SL I  G  VALVG SGSGKST+I +I+RFY+P  GR+L++ +++++L L WLR Q 
Sbjct  1045  RDLSLSIPSGKTVALVGESGSGKSTVISLIERFYNPESGRILLDGMEIQKLKLSWLRQQM  1104

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
              LVGQEP LF  TI  NIA+G   A+  EI  A K A  H FI  LP+GYET VG+ GVQ
Sbjct  1105  GLVGQEPVLFNETIRANIAYGKEGATEDEIIAATKAANAHNFIHSLPQGYETSVGERGVQ  1164

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILK  K+LLLDEA+SALD ESE+ VQ+AL ++  + TT+VVAHRL+
Sbjct  1165  LSGGQKQRIAIARAILKDPKILLLDEATSALDAESERVVQEALDRVMVERTTVVVAHRLT  1224

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             TIK A++IAVVK G +AE GSH++LM S  +G YA+LV
Sbjct  1225  TIKGADIIAVVKNGVIAEKGSHEELM-SITDGPYASLV  1261


 Score =   269 bits (688),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 201/527 (38%), Positives = 304/527 (58%), Gaps = 5/527 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +   +SL  V L  G  +  + Q     + G +  +RIR    K+IL+Q+  +FD  E +
Sbjct  79    EVSRVSLKFVYLAIGSGIASLLQVSSWMVTGERQATRIRGLYLKTILRQDIAFFD-TETT  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftL  1337
             TG ++ R+S D++  +  +G++    +  +S+   G  I+F+  W L+L+         +
Sbjct  138   TGEVIGRMSGDTILIQDAMGEKVGKFIQLMSTFLGGFIIAFARGWLLSLVLLPSIPLLVI  197

Query  1336  GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
                  ++IM+        +YA A N+    V  IRTVA+F+ ++  +++++  L     +
Sbjct  198   SGGTMAIIMSRMSSRGQLAYAEAGNVVEQTVGAIRTVASFTGEKKAIKNYDNKLHIAYAS  257

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +V++    G  LG     ++G Y L +W+G+ LV E   + G V    + ++    S+GQ
Sbjct  258   TVQQGLASGIGLGTVLLIIFGTYGLAMWYGSKLVIERGYDGGRVINCIMAIMSGGMSLGQ  317

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
              +      +   AA   + E I R+P I +     G   E  +  +IE + V F YP+RP
Sbjct  318   TSPCLNAFAAGQAAAYKMFETIKRKPQIDA-YDTSGTVLEDIRG-EIELKDVYFNYPARP  375

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             DV +    SL +  G   ALVG SGSGKST+I +++RFYDP  G VL++ VDL++L LKW
Sbjct  376   DVQIFSGISLHVPSGKTAALVGQSGSGKSTVISLLERFYDPHSGEVLIDGVDLKQLQLKW  435

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             +R +  LV QEP LFA TI ENI++G  +AS  EI  A   A   KFI  LP+G +T VG
Sbjct  436   IREKIGLVSQEPILFATTIKENISYGKEDASDEEIRTAIVLANAAKFIDKLPKGLDTMVG  495

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQDAL  +    TT+VV
Sbjct  496   EHGTQLSGGQKQRIAIARAILKNPRILLLDEATSALDAESERIVQDALVNVMVNRTTVVV  555

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRL+TI+ A++IAVV +G + E G+H +L+  + +G Y  LV  ++
Sbjct  556   AHRLTTIRNADIIAVVYQGKIVEQGTHGELI-KDPDGAYTQLVHLQE  601



>ref|XP_002279471.2| PREDICTED: ABC transporter B family member 13-like [Vitis vinifera]
Length=1254

 Score =   361 bits (926),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 231/531 (44%), Positives = 327/531 (62%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +  ++SLI VG     I   + Q     L G +LT+RIR  +F +IL  E GWFD D
Sbjct  721   IKREVDHISLIFVGAAILTIFIYLLQHYFYTLMGERLTTRIRLLMFSAILSNEIGWFDLD  780

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG L S+L+ D+   RS L DR S ++  ++       I+F+L WR+  +  A  P 
Sbjct  781   ENSTGSLTSKLAADATLVRSALADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIASFPL  840

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              +GAS    +   G   D + +YA+A+ +A  A++NIRTVA F  ++ I   F   L++P
Sbjct  841   LIGASITEQLFLKGFGGDYTRAYAQATAVAREAIANIRTVAAFGAEDRISLQFASELNQP  900

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
              + ++ R  I G   G SQ   + +Y L LW+ + L+K   +N G + K F++L++++FS
Sbjct  901   NKQALLRGHISGFGYGVSQLFAFCSYALGLWYASVLIKHNDSNFGDIIKSFMVLIITAFS  960

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   L PD    S A+ +V  I+ R+  I  D         T    DIEF  V+F YP
Sbjct  961   VAETLALTPDIVKGSQALGSVFSILQRKTAINRD--NPTSSVVTDIQGDIEFRNVSFRYP  1018

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPD+I+ ++ +LKI  G  +A+VG SGSGKST+I ++ RFYDP  G V+++  D++ LN
Sbjct  1019  ARPDLIIFKDLNLKISAGKSLAIVGQSGSGKSTVISLVMRFYDPTSGAVMIDGFDIKGLN  1078

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             L+ LR +  LV QEPALF+ TI ENI +G   AS  EI +AA+ A  H FIS +PEGY+T
Sbjct  1079  LRSLRMKIGLVQQEPALFSTTIYENIRYGNEEASEIEIMKAARAANAHSFISRMPEGYQT  1138

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
             +VG  GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SEK VQ+AL  + +  TT
Sbjct  1139  QVGDRGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTASEKLVQEALDTLMEGRTT  1198

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             I++AHRLSTI  A+ IAV++ G V E G H +L+ +    IY  LV  +QE
Sbjct  1199  ILIAHRLSTIHNADSIAVLQHGKVVETGDHRQLI-TRPGSIYKQLVSLQQE  1248


 Score =   286 bits (733),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 213/528 (40%), Positives = 307/528 (58%), Gaps = 11/528 (2%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L  Q    +L LV LG G + +           G + T+R+R    +S+L+Q+  +FD +
Sbjct  87    LSSQVSRHALYLVYLGLGVLASAWIGVAFWMQTGERQTARLRLKYLQSVLRQDINFFDTE  146

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--  1349
                  +    +S D++  +  +GD+    L  LS   VG  I F+  W+LTLL  A+   
Sbjct  147   ARDKNITF-HISNDAILLQDAIGDKIGHGLRYLSQFFVGFAIGFTSVWQLTLLTVAVVPL  205

Query  1348  pftLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE  1169
                 G +Y ++IM    +   ++YA A  +A  A+S +RTV +F  ++  V+++ ++L +
Sbjct  206   MAIAGGAY-TVIMTTLSEKGEAAYAEAGKVAEEAISQVRTVYSFVGEDRAVETYSRSLQK  264

Query  1168  PKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSF  989
               +   +     G  +GF+ G ++ A+ L LW+ + LV+ G TN G  +   L ++ S F
Sbjct  265   ALKLGKKSGFAKGIGIGFTYGLLFCAWALLLWYASKLVRHGDTNGGKAFTTILNVIFSGF  324

Query  988   SVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSK-PFDIEFEMVTFA  812
             ++GQ A   P+ +  +    A   I+N      +  +R        K    +EF  V FA
Sbjct  325   ALGQAA---PNLAAIAKGRAAAANIVNMIETDSTASKRLDNGIMLPKVAGQLEFCEVCFA  381

Query  811   YPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRE  632
             YPSRP  +V  N S  I  G   A+VG SGSGKST+I M+QRFY+P  G++L++  D++ 
Sbjct  382   YPSRPS-MVFENLSFSIYAGKTFAVVGPSGSGKSTIISMVQRFYEPTSGKILLDGHDIKN  440

Query  631   LNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGY  452
             L LKWLR+Q  LV QEPALFA TI  NI +G  +A   ++ EAAK A  H F+ GLP+GY
Sbjct  441   LRLKWLRAQMGLVSQEPALFATTIAGNILYGKEDADMDQVIEAAKAANAHSFVQGLPDGY  500

Query  451   ETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQA  272
             +T+VG+ G QLSGGQKQRIAIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI    
Sbjct  501   QTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESELIVQKALDKIMLNR  560

Query  271   TTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             TTIVVAHRLSTI++ N I V+K G V E G+H +L++    G YATLV
Sbjct  561   TTIVVAHRLSTIRDVNKIIVLKNGQVVESGTHLELISQ--GGEYATLV  606



>ref|XP_006395333.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
 gb|ESQ32619.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
Length=1255

 Score =   361 bits (926),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 342/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  726   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  785

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  786   EHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  845

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  846   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  905

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV EG +    V K+F++LV+++ S
Sbjct  906   QKRSLYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSEGKSTFSKVIKVFVVLVITANS  965

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DI+F  V FAYP
Sbjct  966   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIDFRHVDFAYP  1023

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1024  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1083

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1084  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKT  1143

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1144  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1203

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1204  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1251


 Score =   284 bits (726),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 207/528 (39%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  85    EVSKYALYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  143

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  144   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  203

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  204   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  262

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  263   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTAIFSAIVGGMSLG  322

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  +     +IEF+ VTF+YPSR
Sbjct  323   QSFSNLGAFSKGKAAGFKLMEIINQRPTIIQDPL-DGKCLDQVHG-NIEFKDVTFSYPSR  380

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ RNFS+    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  381   PDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLK  440

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  441   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  500

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  501   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  560

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  561   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  606



>ref|XP_004499289.1| PREDICTED: ABC transporter B family member 13-like [Cicer arietinum]
Length=1247

 Score =   361 bits (926),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 225/531 (42%), Positives = 338/531 (64%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +  +++LI VG+    I   + Q     L G +LT+R+R  +F +IL  E  WFD D
Sbjct  718   IKQEVAHVALIFVGVAVVTIPIYLLQHYFYSLMGERLTARVRLLMFSAILTNEVAWFDLD  777

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN+TG L + L+ D+   RS L DR S ++  ++       I+F+L W+LTL+ AA  P 
Sbjct  778   ENNTGSLTAMLAADATLVRSTLADRLSTIVQNVALTVTAFVIAFTLSWKLTLVVAACLPL  837

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              +GAS    +   G   D S +Y++A+++A  A++NIRTVA F  ++ I   F   L++P
Sbjct  838   LIGASITEQLFLKGFGGDYSHAYSKATSLAREAIANIRTVAAFGAEDRISIQFASELNKP  897

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
              + +  R  I G   G +Q   + +Y L LW+ + L+K+  +N G + K F++L++++ +
Sbjct  898   NKQAFLRGHISGFGYGVTQLFAFCSYALGLWYASVLIKKKESNFGDIMKSFMVLIITALA  957

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             + +   L PD    S A+ +V  I+ RR  I  +P  +  K  T    +++F+ V F YP
Sbjct  958   IAETLALTPDIVKGSQALGSVFSILYRRTAI--NPNDRNNKMITEVKGEVKFQNVCFKYP  1015

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
              RPD+ + +N +L++  G  +A+VG SGSGKST+I ++ RFYDP  G VL++  D+++LN
Sbjct  1016  MRPDITIFQNLNLRVSAGKSLAVVGQSGSGKSTVIALVMRFYDPNSGSVLIDGCDIKDLN  1075

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             L+ LR +  LV QEPALF+ T+ ENI +G   AS  E+ +AA+ A  H+FIS +PEGY T
Sbjct  1076  LRSLRQRIGLVQQEPALFSTTVYENIKYGKEEASEVEVMKAARAANAHEFISRMPEGYRT  1135

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
             +VG+ GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE+ VQ+AL K+ +  TT
Sbjct  1136  EVGERGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTVSERLVQEALDKLMEGRTT  1195

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             I+VAHRLST+++A+ IAV++ G VAE GSHD+LMA     IY  LV  +Q+
Sbjct  1196  ILVAHRLSTVRDADSIAVLQHGKVAEMGSHDRLMAKP-GSIYKQLVSLQQQ  1245


 Score =   284 bits (727),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 208/501 (42%), Positives = 301/501 (60%), Gaps = 23/501 (5%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    +S+LK++  +FD +E     ++  +S D++  +  +GD+    +  L
Sbjct  119   GERQTARLRLKYLQSVLKKDINFFD-NEARDANIIFHISSDAILVQDAIGDKTGHAMRYL  177

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG GI F+  W+LTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  178   SQFIVGFGIGFTSVWQLTLLTLAVVPFIAIAGGAY-TMIMSTLSEKGEAAYAEAGKVAEE  236

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S +RTV +F  +E  V S+ K+L +  +   +     G  +GF+ G ++ A+ L LW+
Sbjct  237   VISQVRTVYSFVGEEKAVGSYSKSLDKALKLGKKSGFAKGVGVGFTYGLLFCAWALLLWY  296

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEII------N  908
                LV+   TN G  +   + ++ S F++GQ A      +   AA   ++ +I      +
Sbjct  297   AGILVRHHKTNGGKAFTTIINVIFSGFALGQAAPNLGSIAKGRAAAANIMNMIASVSESS  356

Query  907   RRPLIGSD-PQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVG  731
             +R   G+  PQ  G+         I+F  V FAYPSR ++I   N S  +  G  VA+VG
Sbjct  357   KRLDDGTVLPQVAGK---------IDFCEVCFAYPSRSNMI-FENLSFSVNAGKTVAVVG  406

Query  730   ASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGEN  551
              SGSGKST+I +IQRFY+P  G++L++  DL+ + L+WLR Q  LV QEPALFA TI  N
Sbjct  407   PSGSGKSTIISLIQRFYEPSSGKILLDGYDLKNVQLRWLREQMGLVSQEPALFATTIAGN  466

Query  550   IAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILK  371
             I FG  +A   +I EAAK A  H FI+GLP+GY T+VG+ G QLSGGQKQRIAIARA+L+
Sbjct  467   ILFGKEDADMNQIIEAAKAANAHSFIAGLPQGYNTQVGEGGTQLSGGQKQRIAIARAVLR  526

Query  370   KSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVA  191
               K+LLLDEA+SALD ESE  V+ AL KI    TTI+VAHRLSTI++ + I V+K G VA
Sbjct  527   NPKILLLDEATSALDAESEIIVEQALEKIMLNRTTIIVAHRLSTIRDVDTIIVLKNGQVA  586

Query  190   EYGSHDKLMASELNGIYATLV  128
             E GSH +LM+   NG Y +LV
Sbjct  587   ESGSHLELMSK--NGEYVSLV  605



>ref|XP_010514603.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1254

 Score =   361 bits (926),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 342/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  725   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  784

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EW+++LL     P 
Sbjct  785   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWKVSLLILGTFPL  844

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  845   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  904

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  905   QKRSLYRSQTSGILFGLSQLALYGSEALILWYGAHLVSKGESTFSKVIKVFVVLVITANS  964

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  965   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1022

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPD++V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1023  SRPDIMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1082

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +EI EAA+ A  H FISGLPEGY+T
Sbjct  1083  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEIIEAARAANAHGFISGLPEGYKT  1142

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1143  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1202

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V++EG + E GSH +L+ S   G Y+ L++ +
Sbjct  1203  VVVAHRLSTIRGVDCIGVIQEGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1250


 Score =   279 bits (714),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 206/528 (39%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  + LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  84    EVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  142

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   W+L LL+ A+      
Sbjct  143   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  202

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  203   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  261

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  262   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  321

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   +LEIIN+RP I  DP   G+  E     +IEF+ VTF+YPSR
Sbjct  322   QSFSNLGAFSKGKAAGYKLLEIINQRPTIIQDPL-DGKCLEQVHG-NIEFKDVTFSYPSR  379

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ RNF++    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  380   PDVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLK  439

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  440   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANSHSFITLLPKGYDTQV  499

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  500   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  559

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  560   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  605



>ref|XP_002301961.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEE81234.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1219

 Score =   360 bits (924),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 227/530 (43%), Positives = 324/530 (61%), Gaps = 11/530 (2%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +   ++LI VG     +   I Q     L G +L +R+R  +F +IL  E GWFD D
Sbjct  695   MKKEVHLVALIFVGAAVVTVPIYILQHYFYTLMGERLITRVRLSMFSAILCNEIGWFDLD  754

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG L S L+ D+   RS L DR S ++  +S       I FSL WR++ +  A  P 
Sbjct  755   ENSTGSLTSTLAADATLVRSTLADRLSTMVQNVSLTVTAFVIGFSLSWRVSAVIIACFPL  814

Query  1342  tLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPK  1163
              +GA+          + +  SY RA+ +A  A++NIRTVA+F  +E I   F   L++P 
Sbjct  815   LIGAAI--------TEANYRSYTRANAVAREAIANIRTVASFGAEERIAHQFASELNKPN  866

Query  1162  RTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSV  983
             +  + +  I G   G SQ   + AY L +W+ + ++    ++   V K F++LV++S+++
Sbjct  867   KQVLLQGHISGIGYGASQFFCFCAYALGIWYASVVISHNESDFDHVMKSFMVLVMTSYAI  926

Query  982   GQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPS  803
              +   L PD    S A+ +V  I++R+  +  DP     K  T    D+E   V+F YP+
Sbjct  927   AETVALTPDIMKGSQALESVFSILHRKTAM--DPDDPTSKVITDIKGDVELRHVSFKYPA  984

Query  802   RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNL  623
             RPD I+  + +LK+  G  +A+VG SGSGKST+I +I RFYDPI G VL++  D++ LNL
Sbjct  985   RPDTIIFEDLNLKVSAGKSLAVVGQSGSGKSTVIALILRFYDPISGTVLIDGYDVKTLNL  1044

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K LR +  LV QEPALF+ TI ENI +G  NAS  E+ +AAK A  H FIS + EGY T 
Sbjct  1045  KSLRRKIGLVQQEPALFSTTIYENIKYGNKNASEIEVMKAAKAANAHGFISRMHEGYHTH  1104

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG  G+QLSGGQKQRIAIARAILK   +LLLDEA+SALD  SEK VQ+AL K+ +  TT+
Sbjct  1105  VGDRGLQLSGGQKQRIAIARAILKDPSILLLDEATSALDTASEKLVQEALDKLMEGRTTV  1164

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             +VAHRLST+++A+ IAV++ G V E GSH++L+    +G+Y  LV  +QE
Sbjct  1165  LVAHRLSTVRDADSIAVIQHGRVVEIGSHNQLIGKP-SGVYKQLVSLQQE  1213


 Score =   270 bits (689),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 211/535 (39%), Positives = 308/535 (58%), Gaps = 33/535 (6%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLA-----GTKLTSRIRNFLFKSILKQEPGWFD  1529
             Q    SL LV LG G  V      G  G+A     G + T+R+R    +S+L+++  +FD
Sbjct  71    QVSKYSLDLVYLGLGVFVA-----GWIGVASWMQTGERQTARLRLKYLQSVLRKDMNFFD  125

Query  1528  FDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt  1349
              +   + +L   +S D++  +  +GD+    +  LS   +G    F   W+LTLL  A+ 
Sbjct  126   IEARDSNILF-HISSDAILVQDAIGDKTGHAVRYLSQFFIGFVFGFKSVWQLTLLTLAVV  184

Query  1348  --pftLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKAL  1175
                   G +Y ++IM+   +   ++YA A  +A  A+S IRTV +F  +E  ++ + K+L
Sbjct  185   PLMAVAGGAY-TIIMSTLSEKGEAAYAEAGKVADEAISQIRTVYSFVGEEKALEEYSKSL  243

Query  1174  SEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLS  995
              +  +   +     G  +G + G ++ A+++ LW+ + LV+ G TN    + + L ++ S
Sbjct  244   KKALKLGKKSGVAKGVGIGSTYGLLFCAWSMLLWYSSILVRRGDTNGAKAFTVILNVIFS  303

Query  994   SFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQRKGRKFETSKPFDI  836
              F++GQ A      S   AA  +++ +I        +       P+  G+         I
Sbjct  304   GFALGQAAPNIAAISKGRAAAASIMSMIETDSSPSKNLVDGIVMPKVSGQ---------I  354

Query  835   EFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVL  656
             EF  V F+YPSR + +V  N S  I  G   A+VG SGSGKST+I M+QRFY+P  G++L
Sbjct  355   EFCEVCFSYPSRSN-MVFENLSFSISAGKNFAVVGPSGSGKSTVISMVQRFYEPTSGKIL  413

Query  655   MEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKF  476
             ++  DL+ L LKWLR Q  LV QEPALFA TI  NI FG  +AS  +I EAAK A +H F
Sbjct  414   LDGHDLKTLELKWLREQMGLVSQEPALFATTIAGNILFGKEDASMDQIYEAAKAANVHSF  473

Query  475   ISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDA  296
             +  LP+GY T+VG+ G QLSGGQKQR+AIARA+L+  K+LLLDEA+SALD ESE  VQ A
Sbjct  474   VLQLPDGYHTQVGEGGTQLSGGQKQRLAIARAVLRNPKILLLDEATSALDAESELIVQQA  533

Query  295   LRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATL  131
             L KI    TTIVVAHRLSTI++ + I V+K G V E GSH +L++    G YA++
Sbjct  534   LEKIMANRTTIVVAHRLSTIRDVDTIIVLKNGLVVESGSHLELISK--GGEYASM  586



>ref|XP_008221400.1| PREDICTED: ABC transporter B family member 13-like [Prunus mume]
Length=1205

 Score =   360 bits (923),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 226/531 (43%), Positives = 330/531 (62%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + +SLI VG+    +   + Q     L G +LT+R+R  +F ++L  E GWFD D
Sbjct  672   IKQEVKKVSLIFVGVAVATVPIYLLQHYFYTLMGERLTTRVRLLMFTAMLSNEVGWFDLD  731

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN+TG L S L+ ++   RS L DR S ++  L+  A    I+F+L WR+  +  A  P 
Sbjct  732   ENNTGALTSILAANATLVRSALADRLSTIVQNLALTATAFVIAFTLSWRIAAVVIASLPL  791

Query  1342  tLGASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              +GAS    +   G   D N +Y++A+ +A  A++NIRTVA F  +E I   F   L++P
Sbjct  792   LIGASIAEQLFLKGFGGDYNRAYSKATAVAREAIANIRTVAAFGCEERIAIQFSSELNQP  851

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
              + +V R  I G   G SQ   + +Y L LW+ + L+K   +N G + K F++L++++ S
Sbjct  852   NKQAVIRGHISGFCYGLSQFFAFCSYALGLWYASILIKHKDSNFGDIMKSFMVLIITALS  911

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             + +   L PD    S A+ ++  I+ R   I  +P             DIEF  V+F YP
Sbjct  912   IAETLALTPDIVKGSQALGSIFRILKRETAI--NPNAPKSNVVADVKGDIEFRNVSFWYP  969

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPD+ +  N +L++  G  +A+VG SGSGKS++I ++ RFYDPI G V+++  D++ LN
Sbjct  970   ARPDITIFDNLNLRVSAGKSLAVVGPSGSGKSSVIALVMRFYDPISGTVVIDGYDIKSLN  1029

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR + +LV QEPALF+ T+ ENI +G   AS  E+  AAK A    FIS +PEGY+T
Sbjct  1030  LKSLRKKISLVQQEPALFSTTVYENIKYGNEEASDVEVIRAAKAANADSFISRMPEGYKT  1089

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
             +VG+ GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD ESEK VQ+AL K+ +  TT
Sbjct  1090  QVGEKGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTESEKLVQEALDKLMEGRTT  1149

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             I+VAHRLSTI++AN IA+++ G V E GSH++L+      +Y  LV  +QE
Sbjct  1150  ILVAHRLSTIRDANRIALLQNGRVVEMGSHEQLIGRP-GSLYKELVSLQQE  1199


 Score =   237 bits (604),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 180/505 (36%), Positives = 264/505 (52%), Gaps = 70/505 (14%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    +S+LKQ+  +FD +   T ++   +S D++  +  +GD+    L  L
Sbjct  122   GERQTARLRLKYLQSVLKQDINFFDTEARDTNIIF-HISSDAILVQDAIGDKTGHALRYL  180

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG GI F+  W+LTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  181   SQFIVGFGIGFTSVWQLTLLTLAVVPLIAIAGGAY-TIIMSTLSEKGEAAYAEAGKVAEE  239

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S IRTV +F  +   ++++  +L++  +   +     G  +GF+ G ++ A+ L LW+
Sbjct  240   VISQIRTVYSFGGEHRAIEAYSNSLNKALKLGKKGGFAKGVGVGFTYGLLFCAWALLLWY  299

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                LV+   TN G  +   + ++ S F++GQ A   P+ +  +    A   I+    +I 
Sbjct  300   AGILVRHHDTNGGKAFTTIINVIFSGFALGQAA---PNLAAIAKGRAAAANIMK---MIE  353

Query  889   SDPQRKGRKFETSKPFD-----------IEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMV  743
             +D         +SK  D           I+F  V FAYPSRP+  VL N S  I  G   
Sbjct  354   TDSN-------SSKVSDNGIVLPKVSGQIDFCEVGFAYPSRPNR-VLENLSFSIGAGKTF  405

Query  742   ALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGT  563
             A+VG SGSGKST+I MIQRFY+P+ G++L++  D+  L LKWLR Q  LV QEPALFA T
Sbjct  406   AVVGPSGSGKSTIISMIQRFYNPVSGKILLDGHDVGILQLKWLREQMGLVSQEPALFATT  465

Query  562   IGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIAR  383
             I  NI FG  +A   +I EAAK A  H FI GLP+GY T+ G+ G QLSGGQKQR     
Sbjct  466   IAGNILFGKEDADMDQIIEAAKAANAHSFIQGLPDGYYTQAGEGGTQLSGGQKQR-----  520

Query  382   AILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKE  203
                                                  TTI VAHRLSTI++ + I V+K 
Sbjct  521   ----------------------------------SHRTTITVAHRLSTIRDVDTIIVLKN  546

Query  202   GAVAEYGSHDKLMASELNGIYATLV  128
             G V E G+H +L++ +  G Y  LV
Sbjct  547   GQVVESGNHSELISKK--GEYENLV  569



>ref|XP_009339152.1| PREDICTED: ABC transporter B family member 1-like [Pyrus x bretschneideri]
Length=1345

 Score =   362 bits (928),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 228/528 (43%), Positives = 336/528 (64%), Gaps = 4/528 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  792   QINKYCYLLIGLSSAALIFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  851

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRLTL+  A+ PF + 
Sbjct  852   SARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLTLVLIAVFPFVVA  911

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F + L  P R 
Sbjct  912   ATVLQKLFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEGKIVGLFSRNLQIPLRR  971

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  972   CFWKGQIAGSGFGIAQFALYASYALGLWYASWLVKHGISDFSKTIRVFVVLMVSANGAAE  1031

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSK-PFDIEFEMVTFAYPSR  800
                LAPD      A+ +V E+++R+  I  +P        T +   +IE + V F YP+R
Sbjct  1032  TLTLAPDFINGGRAMRSVFELLDRKTEI--EPDDPDATVVTDRLRGEIELKHVDFTYPTR  1089

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRVL++  D+R+ NLK
Sbjct  1090  PDVPVFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVLIDGKDIRKYNLK  1149

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
              LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LPEGY+T V
Sbjct  1150  SLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAANLANAHKFISALPEGYKTFV  1209

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQR+AIARA+L+K++V+LLDEA+SALD ESE+ +Q+AL +     TTIV
Sbjct  1210  GERGVQLSGGQKQRVAIARALLRKAEVMLLDEATSALDAESERSIQEALERACSGKTTIV  1269

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1270  VAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1317


 Score =   275 bits (703),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 191/504 (38%), Positives = 306/504 (61%), Gaps = 6/504 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  169   GERQSTKMRIKYLEAALSQDIQYFDTEVRTSDVVFA-INTDTVMVQDAISEKLGNFIHYM  227

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A +    
Sbjct  228   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGGIHTTALGKISGK-SQEALSQAGHTVEQ  286

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V+ IR V ++  +   +Q++  AL   ++   +     G  LG +   ++  Y L LW+
Sbjct  287   TVAQIRVVLSYVGESRALQAYSSALKVAQKLGYKSGFAKGMGLGATYFVVFCCYALLLWY  346

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  +TN G        ++L    +GQ          A  A   + +II+ RP + 
Sbjct  347   GGYLVRHHFTNGGLAIATMFAVMLGGIGLGQSVPSMGAFVKAKVAAAKIFKIIDHRPSMD  406

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              + +  G + E+     +E + V F+YPSR DV +L NFSL +  G  +ALVG+SGSGKS
Sbjct  407   RNSE-AGVELESVTGL-VELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSGSGKS  464

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D++ LNLKWLR Q  LV QEPALFA TI ENI  G P+
Sbjct  465   TVVSLIERFYDPSSGQVLLDGHDIKTLNLKWLRQQIGLVSQEPALFATTIKENILLGRPD  524

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEAA+ A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  525   ADQVEIEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  584

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V+E G+HD+
Sbjct  585   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDE  644

Query  169   LMASELNGIYATLVRAEQEAYAFA  98
             L +   NG+YA L+R ++ A+  A
Sbjct  645   LFSKGENGVYAKLIRMQEMAHETA  668



>ref|NP_001169660.1| uncharacterized protein LOC100383541 [Zea mays]
 gb|ACN34410.1| unknown [Zea mays]
 gb|AFW58473.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=1264

 Score =   360 bits (925),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 337/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +   IL+ + GWFD +
Sbjct  735   MESKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQE  794

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RLS D+   +S + +R SV+L  ++S  V   + F +EWR+ LL     P 
Sbjct  795   ENNSNLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVALLILVTFPL  854

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  855   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVP  914

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LWFGA+LV+   +    V K+F++LV+++ S
Sbjct  915   QMHSLRRSQISGALFGLSQLSLYASEALILWFGAHLVRTHVSTFSKVIKVFVVLVITANS  974

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  ++N R  I  DP     +   S   +I+F  V FAYP
Sbjct  975   VAETVSLAPEIVRGGESIRSVFSVLNSRTRI--DPDDPDAEQVESVRGEIDFRHVDFAYP  1032

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPDV+V ++ SL+I+ G   ALVGASGSGKST+I +++RFYDP+ G+V+++  D+R LN
Sbjct  1033  TRPDVMVFKDLSLRIRAGQSQALVGASGSGKSTVIALVERFYDPLAGKVMIDGKDIRRLN  1092

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LP+GY T
Sbjct  1093  LKSLRLRIGLVQQEPVLFATSILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYRT  1152

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  1153  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTA  1212

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH  L+ S  +G Y+ L++ +
Sbjct  1213  VLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGDLV-SRPDGAYSRLLQLQ  1260


 Score =   291 bits (745),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 202/500 (40%), Positives = 296/500 (59%), Gaps = 6/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  124   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  182

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  183   ATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSK-SRDSYANAGIIAEQ  241

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  242   AIAQVRTVYSYVGETKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  301

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I 
Sbjct  302   AGVFIRNGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIV  361

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              D    GR  +     +IEF+ V F+YPSRPDV++ R+FSL    G   A+VG SGSGKS
Sbjct  362   QDTA-DGRCLDEVHG-NIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKS  419

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P+
Sbjct  420   TVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYGKPD  479

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T VG  G+QLSGGQKQRIAIARA+LK  K+LLL
Sbjct  480   ATMAEVEAAATSANAHSFIALLPNGYNTHVGDRGLQLSGGQKQRIAIARAMLKNPKLLLL  539

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++IAV+++G V E G+HD+
Sbjct  540   DEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDE  599

Query  169   LMASELNGIYATLVRAEQEA  110
             L+A   +G YA L+R ++ A
Sbjct  600   LLAKGSSGAYAALIRFQETA  619



>gb|ABG56414.1| MDR-like ABC transporter [Taxus cuspidata]
Length=1316

 Score =   361 bits (927),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 233/525 (44%), Positives = 332/525 (63%), Gaps = 5/525 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L+ + L   C +    Q     +AG +L  RIR+  F  ++ QE  WFD +ENS+G + 
Sbjct  795   ALMFIVLAVTCFIVAPTQMYCFSIAGGRLVQRIRSLTFSKVVYQEISWFDDNENSSGAIS  854

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ + RS++GD  S+++  +++   G+ ISF+  W L LL  A+ P      Y  
Sbjct  855   ARLSTDAATVRSLVGDALSLVVQNIATIIAGIVISFTANWLLALLILAIVPLLGLQGYMQ  914

Query  1318  LIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D    Y  AS +A  AV +IRTVA+F  ++ ++  + +  S P ++ V++ 
Sbjct  915   VKFMTGFTADAKLVYEEASQVANDAVGSIRTVASFCAEDKVISLYNEKCSAPLKSGVKQG  974

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G  LGFS   M+  Y L+ W GA LV++G T    V+K+F  L +++  + Q AGL+
Sbjct  975   IIAGLGLGFSNFVMFTQYALSFWVGARLVEDGKTTFDKVFKVFFALSMAAAGISQSAGLS  1034

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD + A ++I +V +I++R   I ++ +  G   +  K  DIEF+ V+F YP+RPDV + 
Sbjct  1035  PDLAKAKSSINSVFKILDRPSKIDANDE-SGTILDNVKG-DIEFQHVSFKYPTRPDVQIF  1092

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+  L +  G  VALVG SGSGKST I +++RFYDP  GR+ ++ V++R+L LKWLR Q 
Sbjct  1093  RDLCLFVHSGKTVALVGESGSGKSTAIALLERFYDPDSGRIFLDGVEIRQLQLKWLRQQM  1152

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTE-IEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              LV QEP LF  TI  NIA+G   A   E I  AA+ A  HKFIS LP+GY   VG+ GV
Sbjct  1153  GLVSQEPVLFNDTIRANIAYGKEGAVTDEQIIAAAEAANAHKFISSLPQGYNINVGERGV  1212

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQDAL ++    +TIV+AHRL
Sbjct  1213  QLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERIVQDALDRVKVNRSTIVIAHRL  1272

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             STIK+A++IAVVK G +AE G HD+L+    NG YA+LV+  + +
Sbjct  1273  STIKDADLIAVVKNGKIAEQGKHDELLKKR-NGAYASLVQLHKSS  1316


 Score =   283 bits (723),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 200/528 (38%), Positives = 316/528 (60%), Gaps = 7/528 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +   L+L  V L  G  V  + Q       G +  +RIR+   K+IL+Q+ G+FD  E S
Sbjct  105   EVSKLALEFVYLACGAGVASLLQVSCWMCTGERQATRIRSLYLKTILRQDIGFFD-SEAS  163

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaal--tpft  1340
             TG ++ R+S D++  +  +G++    +  +++   G  I+F   W+L+L+  ++      
Sbjct  164   TGEVIGRMSGDTILIQDAMGEKVGKFIQFITTFIAGFVIAFIKGWKLSLVMLSMIPLLVV  223

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G S   +I  +  +    +Y+ A+NI    + +IR VA+F+ ++  ++ + K+L+    
Sbjct  224   SGGSMAMIISKMSSR-GQQAYSEAANIVEQTIGSIRMVASFTGEKKSIEGYNKSLAIAYN  282

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                ++  + G  LG     M+  Y L LW+G+ L+ +G    G V  +   +++   S+G
Sbjct  283   AITQQGLVAGVGLGSVLFIMFCGYALALWYGSRLILDGSYTGGDVINVIFAVLMGGMSLG  342

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q +      S   AA   + E I+R+P+I     + G   E  +  DIE + V F YP+R
Sbjct  343   QTSPSLNAFSAGRAAAYKMFETIDRKPVIDV-FDKSGLVLEDIQG-DIELKDVRFTYPAR  400

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV V   FSL+I  GT  ALVG SGSGKST+I +++RFYDP  G VL++ +++++  LK
Sbjct  401   PDVQVFSGFSLEIPSGTTAALVGESGSGKSTVISLVERFYDPQAGEVLIDGINIKKFQLK  460

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             W+R +  LV QEP LF  TI EN+ +G   A+  EI+ AA+ A   KFI+ LP+G++T V
Sbjct  461   WIRQKIGLVSQEPVLFGTTIKENLLYGKDGATLEEIKAAAELANAAKFINKLPQGFDTMV  520

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL +I    TT++
Sbjct  521   GEHGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDTESERVVQEALDRIMVNRTTVI  580

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL+T++ A++IAVV+ G++ E GSH +L+ +  +G Y+ L+  ++
Sbjct  581   VAHRLTTVRNADMIAVVQRGSIVEKGSHSQLITNP-SGAYSQLIHLQE  627



>ref|XP_009339155.1| PREDICTED: ABC transporter B family member 1 [Pyrus x bretschneideri]
Length=1345

 Score =   361 bits (927),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 228/528 (43%), Positives = 336/528 (64%), Gaps = 4/528 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  792   QINKYCYLLIGLSSAALIFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  851

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRLTL+  A+ PF + 
Sbjct  852   SARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLTLVLIAVFPFVVA  911

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F + L  P R 
Sbjct  912   ATVLQKLFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEGKIVGLFSRNLQIPLRR  971

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  972   CFWKGQIAGSGFGIAQFALYASYALGLWYASWLVKHGISDFSKTIRVFVVLMVSANGAAE  1031

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSK-PFDIEFEMVTFAYPSR  800
                LAPD      A+ +V E+++R+  I  +P        T +   +IE + V F YP+R
Sbjct  1032  TLTLAPDFINGGRAMRSVFELLDRKTEI--EPDDPDATVVTDRLRGEIELKHVDFTYPTR  1089

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRVL++  D+R+ NLK
Sbjct  1090  PDVPVFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVLIDGKDIRKYNLK  1149

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
              LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LPEGY+T V
Sbjct  1150  SLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAANLANAHKFISALPEGYKTFV  1209

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQR+AIARA+L+K++V+LLDEA+SALD ESE+ +Q+AL +     TTIV
Sbjct  1210  GERGVQLSGGQKQRVAIARALLRKAEVMLLDEATSALDAESERSIQEALERACSGKTTIV  1269

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1270  VAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1317


 Score =   275 bits (703),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 191/504 (38%), Positives = 306/504 (61%), Gaps = 6/504 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  169   GERQSTKMRIKYLEAALSQDIQYFDTEVRTSDVVFA-INTDTVMVQDAISEKLGNFIHYM  227

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A +    
Sbjct  228   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGGIHTTALGKISGK-SQEALSQAGHTVEQ  286

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V+ IR V ++  +   +Q++  AL   ++   +     G  LG +   ++  Y L LW+
Sbjct  287   TVAQIRVVLSYVGESRALQAYSSALKVAQKLGYKSGFAKGMGLGATYFVVFCCYALLLWY  346

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  +TN G        ++L    +GQ          A  A   + +II+ RP + 
Sbjct  347   GGYLVRHHFTNGGLAIATMFAVMLGGIGLGQSVPSMGAFVKAKVAAAKIFKIIDHRPSMD  406

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              + +  G + E+     +E + V F+YPSR DV +L NFSL +  G  +ALVG+SGSGKS
Sbjct  407   RNSE-AGVELESVTGL-VELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSGSGKS  464

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D++ LNLKWLR Q  LV QEPALFA TI ENI  G P+
Sbjct  465   TVVSLIERFYDPSSGQVLLDGHDIKTLNLKWLRQQIGLVSQEPALFATTIKENILLGRPD  524

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEAA+ A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  525   ADQVEIEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  584

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V+E G+HD+
Sbjct  585   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDE  644

Query  169   LMASELNGIYATLVRAEQEAYAFA  98
             L +   NG+YA L+R ++ A+  A
Sbjct  645   LFSKGENGVYAKLIRMQEMAHETA  668



>ref|XP_010256924.1| PREDICTED: ABC transporter B family member 19 [Nelumbo nucifera]
Length=1249

 Score =   360 bits (924),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 227/531 (43%), Positives = 343/531 (65%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  720   MERKTKEFVFIYIGAGLYAVVAYLTQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  779

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  780   ENNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILATFPL  839

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  840   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELRVP  899

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +R S+RRSQ  GS  G SQ A+Y +  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  900   QRRSLRRSQSAGSMFGVSQLALYASEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  959

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   I  DP     +   S   +IE   V FAYP
Sbjct  960   VAETVSLAPEIIRGGEAVSSVFSILDRTTKI--DPDEPDAETVESVRGEIELRHVDFAYP  1017

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RP+V+V ++ +L+I+ G   ALVGASGSGKS++I +I+RFYDP  G+VL++  D+R LN
Sbjct  1018  TRPEVMVFKDLNLRIRAGQSQALVGASGSGKSSVIVLIERFYDPSAGKVLIDGKDIRRLN  1077

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             +K LR +  LV QEPALFA +I +NIA+G   A+  E+ EAA+ A +H F+S LP+GY+T
Sbjct  1078  MKSLRLKIGLVQQEPALFAASIFDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYKT  1137

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1138  PVGERGVQLSGGQKQRIAIARAVLKNPAILLLDEATSALDAESECVLQEALERLMRGRTT  1197

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + IAVV++G + E GSH +L+ S  +G Y+ L++ +  
Sbjct  1198  VLVAHRLSTIQGVDNIAVVQDGRIVEQGSHSELV-SRADGAYSRLLQLQHH  1247


 Score =   280 bits (717),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 212/525 (40%), Positives = 306/525 (58%), Gaps = 8/525 (2%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L  V LG    ++   +      +G +    +R    +++LKQ+ G+FD D   TG +V
Sbjct  84    ALYFVYLGLVVCLSSYAEIACWMYSGERQVISLRKKYLEAVLKQDVGFFDTDAR-TGDIV  142

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGASY  1325
               +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+       G  Y
Sbjct  143   FSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFLSAWRLALLSVAVIPGIAFAGGLY  202

Query  1324  FSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
                +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +   + 
Sbjct  203   AYTLTGLTSK-SRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKLGYKA  261

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
                 G  +G + G    ++ L  W+    ++ G T+ G  +      ++   S+GQ    
Sbjct  262   GMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLGQSFSN  321

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
                 S    A   ++EII ++P I  DP     K  T    +IEF+ VTF+YPSRPDVI+
Sbjct  322   LGAFSKGKTAGYKLMEIIRQKPSIIQDPSDG--KCLTEVNGNIEFKDVTFSYPSRPDVII  379

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
              R+FS+    G  VA+VG SGSGKST++ +I+RFYDP QG+VL++ VD+R L LKWLR Q
Sbjct  380   FRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIRTLQLKWLRDQ  439

Query  604   TALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
               LV QEPALFA TI ENI +G P+AS  E+E AA  A  H FI+ LP GY T+VG+ GV
Sbjct  440   IGLVNQEPALFATTILENILYGKPDASIAEVEAAAAAANAHSFITLLPNGYNTQVGERGV  499

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+VVAHRL
Sbjct  500   QLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRL  559

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             STI+  + IAV+++G V E G+HD+L+A    G YA+L+R ++ A
Sbjct  560   STIRNVDTIAVIQQGQVVETGTHDELIAKA--GSYASLIRFQEMA  602



>gb|AES81895.2| ABC transporter B family protein [Medicago truncatula]
Length=1338

 Score =   361 bits (927),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 222/524 (42%), Positives = 337/524 (64%), Gaps = 10/524 (2%)
 Frame = -1

Query  1672  ILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSR  1493
             +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN +  + +R
Sbjct  803   LLIGLSSTALIFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENESARISAR  862

Query  1492  LSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLI  1313
             L++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + A+    +
Sbjct  863   LALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPVVVAATVLQKM  922

Query  1312  MNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQI  1136
                G   D  +++A+A+ +A  A++N+RTVA F+++  IV+ F   L  P +    + QI
Sbjct  923   FMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSESKIVRLFASNLETPLQRCFWKGQI  982

Query  1135  LGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPD  956
              GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +   LAPD
Sbjct  983   SGSGYGIAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAETLTLAPD  1042

Query  955   TSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAYPSRPDVI  788
                   A+ +V ++++R+  I  D Q       T  P     ++E + V F+YP+RPD+ 
Sbjct  1043  FIKGGRAMRSVFDLLDRQTEIEPDDQDA-----TPVPDRLRGEVELKHVDFSYPTRPDMP  1097

Query  787   VLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRS  608
             V R+ +L+I+ G  +ALVG SG GKS++I +IQRFYDP  GR++++  D+R+ NLK LR 
Sbjct  1098  VFRDLNLRIRAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRIMIDGKDIRKYNLKSLRR  1157

Query  607   QTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
               ++V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP+GY+T VG+ G
Sbjct  1158  HISVVPQEPCLFATTIYENIAYGHDSATEAEIIEAATLANAHKFISSLPDGYKTFVGERG  1217

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
             VQLSGGQKQRIA+ARA L+K++++LLDEA+SALD ESE+ VQ+AL + S   TTI+VAHR
Sbjct  1218  VQLSGGQKQRIAVARAFLRKAELMLLDEATSALDAESERSVQEALDRASTGKTTIIVAHR  1277

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             LSTI+ ANVIAV+ +G VAE GSH +LM +  +GIYA +++ ++
Sbjct  1278  LSTIRNANVIAVIDDGKVAEQGSHSQLMKNHQDGIYARMIQLQR  1321


 Score =   285 bits (728),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 194/504 (38%), Positives = 306/504 (61%), Gaps = 6/504 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ LKQ+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  173   GERQSTKMRIKYLEAALKQDIEFFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  231

Query  1423  SSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A NI   
Sbjct  232   ATFVSGFVVGFTAVWQLALVTLAVVPMIAVIGGIHTTTLAKLSSK-SQEALSQAGNIVEQ  290

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V  IR V  F  +   +Q +  AL   ++   +     G  LG +   ++  Y L LW+
Sbjct  291   TVVQIRVVLAFVGESRALQGYSSALKVAQKLGYKTGLAKGMGLGATYFVVFCCYALLLWY  350

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+   TN G        +++    +GQ A      + A  A   +  II+ +P I 
Sbjct  351   GGYLVRHHETNGGLAIATMFAVMIGGIGLGQSAPSMAAFTKARVAAAKIFRIIDHQPGID  410

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              + +  G + ET     +E + V F+YPSRP+V++L +FSL +  G  +ALVG+SGSGKS
Sbjct  411   RNSE-SGLELETVTGL-VELKNVDFSYPSRPEVLILNDFSLSVPAGKTIALVGSSGSGKS  468

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+V+++  D++ L LKWLR Q  LV QEPALFA TI ENI  G P+
Sbjct  469   TVVSLIERFYDPTSGQVMLDGHDIKTLKLKWLRQQIGLVSQEPALFATTIRENILLGRPD  528

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  EIEEAA+ A  H FI  LPEG+ET+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  529   ANQVEIEEAARVANAHSFIIKLPEGFETQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  588

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V E G+HD+
Sbjct  589   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVIQQGSVFEIGTHDE  648

Query  169   LMASELNGIYATLVRAEQEAYAFA  98
             L +   NG+YA L++ ++ A+  A
Sbjct  649   LFSKGENGVYAKLIKMQEVAHETA  672



>emb|CDP17032.1| unnamed protein product [Coffea canephora]
Length=1316

 Score =   361 bits (926),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 233/519 (45%), Positives = 332/519 (64%), Gaps = 5/519 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +LI + LG   ++    +  L G+AG KL  RIR+  F+ ++  E GWFD  E+S+GV+ 
Sbjct  782   ALIFMALGVASLLAYPSRTYLFGVAGCKLIRRIRSMCFEKVVHMEVGWFDESEHSSGVIG  841

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             ++LS D+ S R+++GD  + L+   SS  VGL I+FS  W+L L+  A+ P      Y  
Sbjct  842   AKLSADAASVRALVGDALAQLVQDTSSTIVGLAIAFSASWQLALIILAMLPLIGLNGYVQ  901

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D    Y  AS +A  AV +IRTVA+F  +E +++ ++K    P +T +R+ 
Sbjct  902   IKFMKGFSADAKMMYEEASQVANDAVGSIRTVASFCAEEKVMELYKKKCEGPMKTGIRQG  961

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   G S   ++  Y  + + GA LV++G      V+++F  L +++ ++ Q + +A
Sbjct  962   LISGIGFGLSFALLFCVYATSFYAGARLVEDGKITFSDVFRVFFALTMAAMAISQSSSIA  1021

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD+S A  A  ++  I++R+  I +  +  G   E+    +IE + V+F YPSRPDV + 
Sbjct  1022  PDSSKAKGAAASIFAILDRKSKIDASDE-SGMTLESVNG-EIELQRVSFRYPSRPDVQIF  1079

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+ SLKI+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ +++++  +KWLR Q 
Sbjct  1080  RDLSLKIRSGKTVALVGESGSGKSTVIALLQRFYDPDSGHITLDGIEIQKFQVKWLRRQM  1139

Query  601   ALVGQEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              LV QEP LF  TI  NIA+G   N +  EI EAAK A  HKFISGL +GYET VG+ GV
Sbjct  1140  GLVSQEPVLFNDTIRANIAYGKEGNGTEGEIIEAAKLANAHKFISGLQQGYETMVGERGV  1199

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQR+AIARAI+K  KVLLLDEA+SALD ESE+ VQDAL ++    TT+VVAHRL
Sbjct  1200  QLSGGQKQRVAIARAIVKGPKVLLLDEATSALDAESERIVQDALDQVMVNRTTVVVAHRL  1259

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             STIK A+VIAVVK G + E G HD L+  + +G+YA+LV
Sbjct  1260  STIKGADVIAVVKNGVIVEKGKHDALVKIK-DGVYASLV  1297


 Score =   272 bits (695),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 199/524 (38%), Positives = 306/524 (58%), Gaps = 5/524 (1%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              +SL  V L  G  V    Q     + G +  +RIR+   K+IL+Q+ G+FD  E +TG 
Sbjct  121   KVSLKFVYLALGSAVAGFLQVSCWMITGERQAARIRSLYLKTILRQDVGFFD-KETNTGE  179

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltp-ftLGAS  1328
             +V R+S D+V  +  +G++    +  +S+   G  I+F+  W LTL+  +  P   +   
Sbjct  180   VVGRMSGDTVLIQDAMGEKVGKFIQLVSTFIGGFIIAFAKGWLLTLVMLSSIPPLVIAGG  239

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
               SL+++        +YA+A+ +    + +IRTVA+F+ ++  V  ++K+L +  R+ V 
Sbjct  240   LMSLVISRMASHGQEAYAKAAIVVEQTIGSIRTVASFTGEKQAVADYDKSLRKAYRSGVH  299

Query  1147  RSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAG  968
                  G  LG     ++ +Y L +WFGA ++ E     G V  + + ++  S S+GQ + 
Sbjct  300   EGLATGLGLGSVMCLVFCSYALAIWFGAKMIAEKKNTGGEVLNVIIAVLSGSMSLGQASP  359

Query  967   LAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVI  788
                  +   AA   + E INR P I +     G+  +  +  DIE + V F+YP+RPD  
Sbjct  360   CMTAFASGRAAAFKMFETINRTPEIDA-YDASGKTLDDIRG-DIELKDVYFSYPARPDEQ  417

Query  787   VLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRS  608
             +    S+ I  G   ALVG SGSGKST+I +I+RFYDP  G VL++  +L++  LKW+R 
Sbjct  418   IFSGLSVFIPSGHTAALVGQSGSGKSTVISLIERFYDPQAGEVLIDGTNLKDFQLKWIRE  477

Query  607   QTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
             +  LV QEP LF  +I +NIA+     +  +I  AA+ A   KFI  LP+G +T VG+ G
Sbjct  478   KIGLVSQEPVLFTASIKDNIAYSKERVTIEQIRAAAELANAAKFIDKLPKGLDTMVGEHG  537

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
              QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL +I    TT++VAHR
Sbjct  538   TQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERIVQEALDRIMVNRTTVIVAHR  597

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             LST++ A++IAV+  G + E G+H +L  ++  G Y+ L+R ++
Sbjct  598   LSTVRNADMIAVIHRGKIIEKGTHSEL-TNDPEGAYSQLIRLQE  640



>ref|XP_008804466.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Phoenix dactylifera]
Length=946

 Score =   355 bits (910),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 231/532 (43%), Positives = 335/532 (63%), Gaps = 4/532 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    + VG G   +V+ + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  417   MERKTRQYVFMYVGTGLYAVVSYLVQHYFFSIMGENLTTRVRRMMLAAILRNELGWFDEE  476

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ + L+ D+   +SV+ +R SV+L  ++S      + F +EWR+ LL  A  P 
Sbjct  477   ENNSSLVAAHLATDAADVKSVIAERISVILQNMTSLLTSFIVGFIVEWRVALLIIATFPL  536

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++AR S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  537   LVLANFAQQLSLKGFAGDMAKAHARTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELEVP  596

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+RRSQ  G   G SQ ++Y +  L LW+GA+LV  G +    V K+F+ILV+++ S
Sbjct  597   QQCSLRRSQTSGLLFGLSQLSLYSSEALILWYGAHLVHSGASTFSKVIKVFVILVITANS  656

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+NR   I  DP     K   S   +IE   V FAYP
Sbjct  657   VAETVSLAPEIIRGGESIRSVFSILNRLTRI--DPDDPEAKPVGSIRGEIELRHVDFAYP  714

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPD+ V  +F+L+I  G   ALVGASG GKST+I +I+RFYDP  G+V+++  D+R LN
Sbjct  715   SRPDIPVFEDFNLRIHAGLSQALVGASGCGKSTVIALIERFYDPTAGKVMIDGEDIRGLN  774

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEP LFA +I ENIA+G   A+  E+ EAA+ A +H F+S LP+GY+T
Sbjct  775   LKSLRLKIGLVQQEPVLFAASIFENIAYGKDGATEDEVLEAARAANVHGFVSALPKGYKT  834

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  835   PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALEQLMRGRTT  894

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             ++VAHRLSTI+  + IAVV++G + E GSH +L+A   +G Y  L++ +   
Sbjct  895   VLVAHRLSTIRGVDSIAVVQDGHIVEQGSHAELVA-RADGAYVRLLQLQHHC  945


 Score =   227 bits (578),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 206/304 (68%), Gaps = 28/304 (9%)
 Frame = -1

Query  1000 LSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQRKGRKFETSKPF  842
            L +FS G+ AG              ++EII ++P I  D       P+  G         
Sbjct  17   LGAFSKGKAAGYK------------LMEIIQQKPSIIQDLSDGKCLPEVHG---------  55

Query  841  DIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGR  662
            ++EF+ VTF+YPSRPDVI+ R+FSL    G   A+VG SGSGKST++ +I+RFYDP QG+
Sbjct  56   NLEFKDVTFSYPSRPDVIIFRDFSLSFPAGKTTAVVGGSGSGKSTVVVLIERFYDPNQGQ  115

Query  661  VLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIH  482
            +L++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P A+  E+E AA  A  H
Sbjct  116  ILLDNVDIKTLQLKWLREQIGLVSQEPALFATTILENILYGKPGATIAEVEAAASAANAH  175

Query  481  KFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQ  302
             FIS LP GY T+ G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ
Sbjct  176  NFISLLPNGYNTQAGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQ  235

Query  301  DALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRA  122
            +AL ++    TT+VVAHRLSTI+  ++IAV+++G + E G+H++L+A   +G YA+L+R 
Sbjct  236  EALDRLMVGRTTVVVAHRLSTIRNVDMIAVIQQGQIVETGTHEELLAKGTSGAYASLIRF  295

Query  121  EQEA  110
            ++ A
Sbjct  296  QEMA  299



>gb|ABG56413.1| MDR-like ABC transporter [Catharanthus roseus]
Length=1266

 Score =   360 bits (924),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 233/524 (44%), Positives = 326/524 (62%), Gaps = 5/524 (1%)
 Frame = -1

Query  1675  LILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVS  1496
             L+ VGLG   ++ +  Q    G+AG KL  RIR+  F+ ++ QE  WFD  +NS+G + +
Sbjct  745   LMYVGLGIITLLVLPLQNYFFGIAGGKLIERIRSLSFEKVVHQEISWFDDSKNSSGAVGA  804

Query  1495  RLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSL  1316
             RLS D+ + RS++GD  ++++  +++ A GL ISF+  W L L+  A+ P      +  +
Sbjct  805   RLSSDASTLRSLVGDALALVVQNIATVAAGLVISFTANWILALIILAVLPLVGLQGFLQM  864

Query  1315  IMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQ  1139
                 G   D    Y  AS +A  AV +IRTVA+F  +E +++ +++    P +  VR   
Sbjct  865   KFYKGFSADAKVMYEEASQVANDAVGSIRTVASFCAEEKVMEMYQRKCEGPVKQGVRLGM  924

Query  1138  ILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAP  959
             + G+ LG   GA Y A     + GA LV  G    G V+++F  L +S+  V Q   LAP
Sbjct  925   VSGAGLGIGNGANYCASAFCFYIGAVLVFHGKATFGEVFRVFFALTMSAMGVSQAMALAP  984

Query  958   DTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLR  779
             D +    +  +V EI++ +P I S    KG+   + K  DIE + ++F YP+RPD+ + +
Sbjct  985   DVNKTKQSAASVFEILDAKPKIDSS-SNKGQTLASVKG-DIELQHISFKYPTRPDIQIFK  1042

Query  778   NFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTA  599
                L I  G  VALVG SGSGKST+I +I+RFYDP  G + ++ V+L++L + WLR Q  
Sbjct  1043  GLCLSIPCGKTVALVGESGSGKSTVISLIERFYDPDSGNIYLDGVELQKLKISWLRQQMG  1102

Query  598   LVGQEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
             LV QEP LF  +I +NIA+G   NA+  EI  A K +  H FIS LP GY+T VG+ GVQ
Sbjct  1103  LVSQEPVLFNESIRDNIAYGKQGNATEDEIIAATKASNAHSFISSLPNGYDTSVGERGVQ  1162

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQDAL K+    TT+VVAHRLS
Sbjct  1163  LSGGQKQRIAIARAILKDPRILLLDEATSALDAESERIVQDALDKVMVNRTTVVVAHRLS  1222

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             TIK A+VIAVVK G ++E G HD+LM  E NG+YA+LV  +  A
Sbjct  1223  TIKGADVIAVVKNGVISEKGRHDELMKME-NGVYASLVSLQSSA  1265


 Score =   282 bits (721),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 211/527 (40%), Positives = 308/527 (58%), Gaps = 5/527 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q   +SL  V L  G  +    Q     + G +  +RIR    K+IL+Q+ G+FD  E S
Sbjct  79    QVGQVSLKYVYLAIGAGMASFLQMSCWMVTGERQATRIRGLYLKTILRQDIGFFD-TETS  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             TG ++ R+S D++  +  +G++    +   S+   G  I+F   W L L+  A  P  + 
Sbjct  138   TGEVIGRMSGDTILIQEAMGEKVGKFIQFSSTFIGGFLIAFIKGWLLALVLTACLPLLVA  197

Query  1333  -ASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
               +  SL M+        +YA A N+    V  IRTVA+F+ ++  +Q +   L    RT
Sbjct  198   TGAVMSLFMSKMASQGQVAYAEAGNVLEQTVGGIRTVASFTGEKLAIQKYNNKLKVAYRT  257

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +V++    G+  G     ++  Y L +++G+ L+ E   N G V  + + +++   S+GQ
Sbjct  258   TVKQGFASGAGFGTLLLVVFCIYGLAIYYGSRLIIEKGYNGGRVINVMMAIMMGGMSLGQ  317

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
              +      +   AA   + E I R+P I +     G   E  K  +IE + V F YP+RP
Sbjct  318   TSPSLSAFAAGQAAAYKMFETIKRKPQIDA-YDTSGIVLEDIKG-EIELKDVYFRYPARP  375

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             +V +   FSL +  GT  ALVG SGSGKST+I +++RFYDP  G VL++ V+L+++ L+W
Sbjct  376   EVQIFSGFSLYVPSGTTAALVGQSGSGKSTVISLLERFYDPEAGEVLIDGVNLKKMRLRW  435

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR Q  LV QEP LFA TI ENI +G  NA+ +EI  A + A   KFI  LP+G +T VG
Sbjct  436   LREQLGLVSQEPILFATTIKENILYGKSNATDSEIRTAIQLANAAKFIDKLPQGLDTMVG  495

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQDAL  +    TT+VV
Sbjct  496   EHGTQLSGGQKQRIAIARAILKNPRILLLDEATSALDAESERIVQDALDNVMSNRTTVVV  555

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLSTI+ A++IAVV+ G + E G+H +L+  + NG Y+ L+R +Q
Sbjct  556   AHRLSTIRNAHLIAVVQSGKLVEQGTHAELI-KDPNGAYSQLIRMQQ  601



>ref|XP_011034997.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Populus euphratica]
Length=1246

 Score =   360 bits (923),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 228/522 (44%), Positives = 321/522 (61%), Gaps = 3/522 (1%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             ++LI VG     +   I Q     L G +L +R+R  +F +IL  E GWFD DENSTG L
Sbjct  721   VALIFVGAAVVTVPIYILQHYFYTLMGERLIARVRLSMFSAILCNEIGWFDLDENSTGSL  780

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
              S L+ D+   RS L DR S ++  +S       I FSL WR++ +  A  P  +GA+  
Sbjct  781   TSTLAADATLVRSTLADRLSTMVQNVSLTVTAFVIGFSLSWRVSAVIIACFPLLIGAAIT  840

Query  1321  SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
               +   G   D  SY RA+ +A  A++NIRTVA+F  +E I   F   L++P +  + + 
Sbjct  841   EQLFLKGFGGDYRSYTRANAVAREAIANIRTVASFGAEERIAHQFASELNKPNKQVLLQG  900

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   G SQ     AY L +W+ + ++    ++   V K F++LV++SF++ +   L+
Sbjct  901   HISGIGYGASQFFSLCAYALGIWYASVVISHNESDFNHVMKSFMVLVMTSFAIAETVALS  960

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD    S A+ +V  I++R+  +  DP     K  T    D+E   V+F YP+RPD I+ 
Sbjct  961   PDIMKGSQALESVFSILHRKTAM--DPDDPTSKVITDIKGDVELRHVSFKYPARPDTIIF  1018

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
              + +L++  G  +A+VG SGSGKST+I +I RFYDPI G VL++  D++ LNLK LR + 
Sbjct  1019  EDLNLEVSAGKSLAVVGQSGSGKSTVIALILRFYDPISGTVLIDGYDVKTLNLKSLRRKI  1078

Query  601   ALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvq  422
              LV QEPALF+ TI ENI +G  NAS  E+ +AAK A  H FIS + EGY+T VG  G+Q
Sbjct  1079  GLVQQEPALFSTTIYENIQYGNENASEIEVMKAAKAANAHGFISRMNEGYQTHVGDRGLQ  1138

Query  421   lsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLS  242
             LSGGQKQRIAIARAILK   +LLLDEA+SALD  SEK VQ+AL K+ +  TT++VAHRLS
Sbjct  1139  LSGGQKQRIAIARAILKDPSILLLDEATSALDTASEKLVQEALDKLMEGRTTVLVAHRLS  1198

Query  241   TIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             T+++A+ IAV++ G V E GSH++L+     G+Y  LV  +Q
Sbjct  1199  TVRDADSIAVLQHGRVVEIGSHNQLIGKPC-GVYKQLVSLQQ  1239


 Score =   273 bits (699),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 209/535 (39%), Positives = 310/535 (58%), Gaps = 33/535 (6%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLA-----GTKLTSRIRNFLFKSILKQEPGWFD  1529
             Q    SL LV LG G  V      G  G+A     G + T+R+R    +S+L+++  +FD
Sbjct  90    QVSKYSLDLVYLGLGVFVA-----GWIGVASWMQTGERQTARLRLKYLQSVLRKDMNFFD  144

Query  1528  FDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt  1349
              +   + +L   +S D++  +  +GD+    +  LS   +G  + F   W+LTLL  A+ 
Sbjct  145   IEARDSNILF-HISSDAILVQDAIGDKTGHAVRYLSQFFIGFVVGFKSVWQLTLLTLAVV  203

Query  1348  --pftLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKAL  1175
                   G +Y ++IM+   +   ++YA A  +A  A+S IRTV +F  +E +++ + K+L
Sbjct  204   PLMAVAGGAY-TIIMSTLSEKGEAAYAEAGKVADEAISQIRTVYSFVGEEKVLEEYSKSL  262

Query  1174  SEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLS  995
              +  +   +     G  +G   G ++ A+++ LW+ + LV+ G TN    + + + ++ S
Sbjct  263   KKALKLGKKSGIAKGVGIGSIHGLLFCAWSMLLWYSSILVRRGDTNGAKAFTVIMNVIFS  322

Query  994   SFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQRKGRKFETSKPFDI  836
              F++GQ A      S   AA  +++ +I +      +       P+  G+         I
Sbjct  323   GFALGQAAPNIGAISKGRAAAASIMSMIEKDSSPSKNLEDGIVMPKVSGQ---------I  373

Query  835   EFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVL  656
             EF  V F+YPSR + +V  N S  I  G   A+VG SGSGKST+I M+QRFY+P  G++L
Sbjct  374   EFCEVCFSYPSRSN-MVFENLSFSISAGKTFAVVGPSGSGKSTVISMVQRFYEPTSGKIL  432

Query  655   MEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKF  476
             ++  DL+ L LKWLR Q  LV QEPALFA TI +NI FG  +AS  +I EAAK A +H F
Sbjct  433   LDGHDLKTLQLKWLREQMGLVSQEPALFATTIADNILFGKEDASMDQIYEAAKAANVHSF  492

Query  475   ISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDA  296
             +   P+GY T+VG+ G QLSGGQKQR+AIARA+L+  K+LLLDEA+SALD ESE  VQ A
Sbjct  493   VLQCPDGYHTQVGEGGTQLSGGQKQRLAIARAVLRNPKILLLDEATSALDAESELTVQQA  552

Query  295   LRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATL  131
             L KI    TTIVVAHRLSTI++ + I V+K G V E GSH +L++    G YA++
Sbjct  553   LEKIMANRTTIVVAHRLSTIRDVDTIIVLKNGQVVESGSHLELISK--GGEYASM  605



>ref|NP_189528.1| ABC transporter B family member 19 [Arabidopsis thaliana]
 sp|Q9LJX0.1|AB19B_ARATH RecName: Full=ABC transporter B family member 19; Short=ABC transporter 
ABCB.19; Short=AtABCB19; AltName: Full=Multidrug 
resistance protein 11; AltName: Full=P-glycoprotein 19 [Arabidopsis 
thaliana]
 dbj|BAB02129.1| P-glycoprotein; multi-drug resistance related; ABC transporter-like 
protein [Arabidopsis thaliana]
 gb|AEE77498.1| ABC transporter B family member 19 [Arabidopsis thaliana]
Length=1252

 Score =   360 bits (923),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 342/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  723   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  782

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  783   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  842

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  843   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  902

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  903   QKRSLYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  962

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  963   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1020

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1021  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1080

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ +AA+ A  H FISGLPEGY+T
Sbjct  1081  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIDAARAANAHGFISGLPEGYKT  1140

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1141  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1200

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1201  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1248


 Score =   281 bits (718),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   W+L LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + ++  A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSDAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  +     +IEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGYKLMEIINQRPTIIQDPL-DGKCLDQVHG-NIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ RNF++    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  378   PDVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLK  437

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  438   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  497

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  498   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  557

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  558   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  603



>ref|XP_007025208.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025209.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025210.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025211.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025212.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025213.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025214.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27830.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27831.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27832.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27833.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27834.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27835.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27836.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
Length=1272

 Score =   360 bits (924),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 237/515 (46%), Positives = 325/515 (63%), Gaps = 7/515 (1%)
 Frame = -1

Query  1660  LGFGCIVTMIG--QQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLS  1487
             +G G ++ ++G  Q  L G+AG KL  RIR+  F+ ++ QE  WFD   NS+G + +RLS
Sbjct  754   VGMGVVILVVGPVQNYLFGVAGGKLIQRIRSLTFEKVVHQEISWFDDPANSSGAVGARLS  813

Query  1486  IDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMN  1307
              D+ + R+++GD  ++++  +S+ A GL I+FS  WRL L   A++PF L   Y  +   
Sbjct  814   TDASTVRNLVGDTLALIVQNMSTIAAGLIIAFSANWRLALAILAVSPFMLLQGYLQMKFL  873

Query  1306  VGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILG  1130
              G   D    Y  AS +A  AV +IRTVA+F +++ ++  +++    P +  VR   + G
Sbjct  874   KGFSGDAKLMYEEASQVANDAVGSIRTVASFCSEQKVMDLYQEKCKGPMKQGVRLGLVSG  933

Query  1129  SALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTS  950
                GFS  A+Y       + GA LVK G    G V+K+F  L +S+  V Q + LAPDT+
Sbjct  934   LGFGFSFLALYCTNAFCFYIGAVLVKHGKATFGEVFKVFFALTISAIGVSQTSALAPDTN  993

Query  949   MASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFS  770
              A  +  ++ EI++R+P I  D          S   +IE E V+F YP+RPD+ + R+  
Sbjct  994   KAKDSAASIFEILDRKPEI--DSSSTAGTTLPSVTGNIELEHVSFRYPTRPDIQIFRDMC  1051

Query  769   LKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVG  590
             L I  G  VALVG SGSGKST+I +I+RFYDP  GRV ++ +DLR++ L WLR Q  LV 
Sbjct  1052  LSIPSGKTVALVGESGSGKSTVISLIERFYDPDSGRVTLDGMDLRKIRLSWLRQQMGLVS  1111

Query  589   QEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsg  413
             QEP LF  TI  N+A+G   NA+  EI  A K A  H FIS LP+GY+T VG+ GVQLSG
Sbjct  1112  QEPILFNETIRTNLAYGKQGNATEEEIMAATKAANAHNFISSLPQGYDTSVGERGVQLSG  1171

Query  412   gqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIK  233
             GQKQRIAIARAILK  K+LLLDEA+SALD ESE+ VQ+AL ++    TT+VVAHRL+TIK
Sbjct  1172  GQKQRIAIARAILKDPKILLLDEATSALDAESERVVQEALDRVMVNRTTVVVAHRLTTIK  1231

Query  232   EANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
              A++IAVVK G VAE G H+ LM    +G YA+LV
Sbjct  1232  GADIIAVVKNGVVAEKGRHEALMKIT-DGAYASLV  1265


 Score =   285 bits (730),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 202/523 (39%), Positives = 312/523 (60%), Gaps = 20/523 (4%)
 Frame = -1

Query  1654  FGCIVTMIGQQGLCGL-AGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDS  1478
             + C+ +++  Q +C +  G +  +RIR    K+IL+Q+ G+FD  E +TG ++ R+S D+
Sbjct  94    YACVASLL--QVVCWMVTGERQAARIRGLYLKTILRQDIGFFD-TETTTGEVIGRMSGDT  150

Query  1477  VSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGAS-YFSLIMNVG  1301
             +  +  +G++    +  +++   G  I+F+  W+L L+ +A  P    A    ++IM   
Sbjct  151   ILIQEAMGEKVGKFIQLVATFIGGFIIAFAKGWQLALVLSACIPLVAFAGGIMAMIMAKM  210

Query  1300  PKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSAL  1121
                   +YA A N+    +  IRTVA+F+ ++  ++ +   L      +  +  + G  L
Sbjct  211   SSRGQLAYAEAGNVVEQTIGAIRTVASFTGEKQAIEKYNSKLQVAYTATTHQGLVSGVGL  270

Query  1120  GFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMAS  941
             G     ++ +Y L +W+G+ L+ +   N G V  + + ++    S+GQ        +   
Sbjct  271   GTMLVVVFSSYGLAVWYGSKLIADHGYNGGQVINVIIAIMTGGMSLGQTTPSLNAFASGQ  330

Query  940   AAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF--DIEFEM----VTFAYPSRPDVIVLR  779
             AA   + E I R+P I +        ++TS     DIE E+    V F YP+RPDV +  
Sbjct  331   AAAYKMFETIKRKPTIDA--------YDTSGITLEDIEGEINLKDVYFRYPARPDVQIFS  382

Query  778   NFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTA  599
              F+L +  GT  ALVG SGSGKST+I +++RFYDP  G VL++ VDL+++ L+W+R +  
Sbjct  383   GFTLHVPSGTTAALVGQSGSGKSTVISLVERFYDPDSGEVLIDGVDLKKMQLRWIRGKIG  442

Query  598   LVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvql  419
             LV QEP LFA +I ENIA+G  NA+Y EI  A + A   KFI  LP+G +T VG+ G QL
Sbjct  443   LVSQEPILFATSIRENIAYGKENATYEEIRTAIELANAAKFIDKLPQGLDTMVGEHGTQL  502

Query  418   sggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLST  239
             SGGQKQRIAIARAILK  K+LLLDEA+SALD ESE+ VQ+AL K+    TT+VVAHRL+T
Sbjct  503   SGGQKQRIAIARAILKNPKILLLDEATSALDAESERVVQEALVKVMSNRTTVVVAHRLTT  562

Query  238   IKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             I+ A++IAVV +G + E G+H++L+  +  G Y+ LVR ++ A
Sbjct  563   IRNADIIAVVHQGKLVEKGTHEELI-RDPEGAYSQLVRLQEGA  604



>ref|XP_010528330.1| PREDICTED: ABC transporter B family member 19 [Tarenaya hassleriana]
Length=1256

 Score =   360 bits (923),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 232/531 (44%), Positives = 345/531 (65%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  727   MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEE  786

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  787   EHNSSLVAARLATDAADVKSAMAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  846

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  847   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELHVP  906

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+RRSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  907   QKRSLRRSQTSGFLFGLSQLALYGSEALILWYGAHLVGKGASTFSKVIKVFVVLVITANS  966

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R+  I  D        ET +  +IEF  V FAYP
Sbjct  967   VAETVSLAPEIIRGGEAVGSVFSILDRQTRIDPDDPDA-DPVETIRG-EIEFRHVDFAYP  1024

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++F+L+I+ G   ALVGASGSGKS++I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1025  SRPDVMVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPLAGKVMIDGKDIRRLN  1084

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+  E+ EAA+ A  H FISGLP+GY+T
Sbjct  1085  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATEAEVIEAARAANAHGFISGLPDGYKT  1144

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1145  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1204

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1205  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQNH  1254


 Score =   275 bits (703),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 202/498 (41%), Positives = 297/498 (60%), Gaps = 8/498 (2%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++LKQ+ G+FD D   TG +V  +S D++  +  + ++    +  L
Sbjct  116   GERQVGTLRKKYLEAVLKQDVGFFDTDAR-TGDIVFSVSTDTLLVQDAISEKVGNFIHYL  174

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  175   STFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSK-SRESYANAGVIAEQ  233

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   +  +  A+    +   +     G  LG + G    ++ L  W+
Sbjct  234   AIAQVRTVYSYVGESKALSLYSDAIQYTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWY  293

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S   AA   ++EIIN+RP I 
Sbjct  294   AGVFIRNGQTDGGKAFTAIFSAIVGGMSLGQSFSNLGAFSKGKAAGYKLMEIINQRPSII  353

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              DP   G+  +  +  +IEF+ VTF+YPSRPDVI+ RNFS+    G  VA+VG SGSGKS
Sbjct  354   QDPL-DGKCLDEVRG-NIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVAVVGGSGSGKS  411

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G++L++ VD++ L LK+LR Q  LV QEPALFA TI ENI +G P+
Sbjct  412   TVVSLIERFYDPNNGQILLDSVDIKTLQLKFLRDQIGLVNQEPALFATTILENILYGKPD  471

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T+VG+ G+QLSGGQKQRIAIARA+LK  K+LLL
Sbjct  472   ATMAEVEAAASAANAHSFITLLPNGYNTQVGERGIQLSGGQKQRIAIARAMLKDPKILLL  531

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRL TI+  + IAV+++G V E G+H++
Sbjct  532   DEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEE  591

Query  169   LMASELNGIYATLVRAEQ  116
             L+A    G YA+L+R ++
Sbjct  592   LIAKA--GAYASLIRFQE  607



>gb|EYU46880.1| hypothetical protein MIMGU_mgv1a000319mg [Erythranthe guttata]
Length=1260

 Score =   360 bits (923),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 235/520 (45%), Positives = 332/520 (64%), Gaps = 7/520 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             SL+ + LG   ++    +  L G+AG KL  RIR   F+ ++  E GWFD  E+S+GV+ 
Sbjct  736   SLMFMVLGAVSLIAFPARTYLFGVAGNKLIRRIRLMCFEKVVNMEVGWFDEGEHSSGVIG  795

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ S R+++GD  + ++  +S+A VGL I+F   W+L L+  A+ P    + Y  
Sbjct  796   ARLSADAASVRALVGDTLAQMVQDISAAIVGLAIAFEASWQLALIILAMIPLIGLSGYVQ  855

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             ++   G   D    Y  AS +A  AV +IRTVA+F  +E ++  ++K    PK   +R+ 
Sbjct  856   IMFMKGFSADAKVMYEEASQVANDAVGSIRTVASFCAEEKVMDMYKKKCQGPKTNGIRQG  915

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   G S   ++  Y  + + GA LV+ G     AV+++F  L +++ ++ Q + LA
Sbjct  916   LISGVGFGLSFSLLFLVYAASFYAGARLVQAGKITFTAVFRVFFALTMAAVAISQSSSLA  975

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
             PD++ A +A  ++  I++ +  I  DP    G K E  K  DIE   V+F YP+RPDV +
Sbjct  976   PDSTKAKSAAASIFAILDSKSKI--DPSDDSGMKLENVKG-DIELRHVSFKYPTRPDVQI  1032

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
             LR+ +L I+ G  VALVG SGSGKST+I ++QRFYDP  G++ ++ +++ +  LKWLR Q
Sbjct  1033  LRDLTLTIRSGKTVALVGESGSGKSTVISLLQRFYDPESGQITVDGIEIHKFQLKWLRQQ  1092

Query  604   TALVGQEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
               LV QEP LF  TI  NIA+G   NAS  EI EAA+ A  HKFISGL +GYET VG+ G
Sbjct  1093  MGLVSQEPVLFNDTIRANIAYGKEGNASEAEIIEAAELANAHKFISGLEKGYETMVGERG  1152

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
             VQLSGGQKQR+AIARA++K  K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAHR
Sbjct  1153  VQLSGGQKQRVAIARAMIKSPKILLLDEATSALDAESERIVQDALDRVMVNRTTVVVAHR  1212

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             LST+K A+VIAVVK G + E GSHD L+    +G YA+LV
Sbjct  1213  LSTVKGAHVIAVVKNGVIVEKGSHDTLINIR-DGFYASLV  1251


 Score =   276 bits (705),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 199/527 (38%), Positives = 320/527 (61%), Gaps = 10/527 (2%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              ++L  V L  GC V    Q     + G +  +RIR+   ++IL+Q+  +FD  E +TG 
Sbjct  85    KVALKFVYLAIGCGVAAFLQVACWMITGERQAARIRSLYLRTILRQDVSFFD-KETNTGE  143

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftLGAS  1328
             ++ R+S D+V  +  +G++    +  +++   G  ++F   W LTL+  +      +  +
Sbjct  144   VIGRMSGDTVLIQDAMGEKVGKFIQLVATFVGGFVVAFMKGWLLTLVMLSSIPLMVISGA  203

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
               S++++       ++YA+AS +    + +IRTVA+F+ ++  V  +E++L +  ++ V 
Sbjct  204   IMSIVLSKMASRGQNAYAKASIVVEQTIGSIRTVASFTGEKQAVAEYERSLVKAYKSGV-  262

Query  1147  RSQILGSALGFSQGA--MYGAYTLTLWFGAYLV-KEGYTNIGAVYKIFLILVLSSFSVGQ  977
              ++ L S LGF      ++ +Y L +WFGA ++  +GYT  G V  + + ++  S S+GQ
Sbjct  263   -AEGLASGLGFGSVMFIIFCSYALAIWFGAKMILDKGYTG-GEVLNVIIAVLTGSMSLGQ  320

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
              +      +   AA   + E INR+P I +   R G   +     D+E   V F+YP+RP
Sbjct  321   ASPCMTAFAAGQAAAFKMFETINRKPEIDAYDSR-GIILQQDIRGDVELRDVFFSYPTRP  379

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             +  +   FSL I  GT  ALVG SGSGKST+I +I+RFYDP  G++L++  +L++  LKW
Sbjct  380   NQHIFTGFSLFIPSGTTAALVGQSGSGKSTVISLIERFYDPQSGQLLIDGTNLKDFQLKW  439

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             +RS+  LV QEP LF  TI +NI++G   A+  EI  AA+ A   KFI  LP+G ++ VG
Sbjct  440   IRSKIGLVSQEPVLFTATIKDNISYGKYGATTDEIRAAAELANAAKFIDKLPQGLDSMVG  499

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + G QLSGGQKQR+AIARAILK  ++LLLDEA+SALD ESE+ VQ+AL +I    TTI+V
Sbjct  500   EHGTQLSGGQKQRVAIARAILKDPRILLLDEATSALDNESERIVQEALDRIMVNRTTIIV  559

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRL+T++ A++IAV+ +G + E G+H++L+  +  G Y+ L+R ++
Sbjct  560   AHRLTTVRNAHMIAVIHQGKMVEKGTHEELL-QDPEGAYSQLIRLQE  605



>ref|XP_005850708.1| hypothetical protein CHLNCDRAFT_34209 [Chlorella variabilis]
 gb|EFN58606.1| hypothetical protein CHLNCDRAFT_34209 [Chlorella variabilis]
Length=1302

 Score =   360 bits (924),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 230/529 (43%), Positives = 328/529 (62%), Gaps = 12/529 (2%)
 Frame = -1

Query  1690  CQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENST  1511
              Q  SL+ V +G G IV  + Q       G KL  R+R  +F+++L+QE GW+D D NS+
Sbjct  747   AQKWSLVFVAIGVGAIVAAMFQSYSFNYMGQKLALRVRVLMFRALLRQEVGWYDEDRNSS  806

Query  1510  GVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGA  1331
             GVL S+LS D++S +   GD   +L   L +   GL ++F+  W+L+L+  A  P     
Sbjct  807   GVLSSKLSSDALSVKGQFGDTMGLLTQNLVTLIGGLIVAFTNGWKLSLVVVACLPVMACG  866

Query  1330  SYFSLIMNV-GPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTS  1154
             +YF   M +     ++ ++A+A+  A+ A++NI+T+A F  +  + + + K L  P   +
Sbjct  867   AYFHTKMQIQSASKEDDTFAQANQTASEALTNIKTIAAFGMEGQVSELYAKKLRVPTLEA  926

Query  1153  VRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQL  974
              RRS   G+   F Q +++  Y+L  W+G  LV +G +    V  +F  + L++    Q 
Sbjct  927   RRRSNTAGAGFAFGQFSLFATYSLAFWYGGQLVADGESTFKQVMLVFFSIFLAAMGAAQA  986

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAYP  806
                 PD +   AA   V  II+R P I +         E S+P     ++E   VTFAYP
Sbjct  987   QLFFPDVAKGKAATQRVFSIIDRVPKIDA------ASMEGSQPLAVSGEVELRDVTFAYP  1040

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
              RP+V V R+FSL +  G  VALVG SGSGKST++ +I+RFYDP+ G+VL++  D+R+LN
Sbjct  1041  QRPEVKVFRHFSLHVPQGKTVALVGESGSGKSTVVALIERFYDPLAGQVLLDGRDIRDLN  1100

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             L+WLR Q  LVGQEP LF  T+ ENI +G P+AS  ++E AA+ A  H FI+ LPE Y T
Sbjct  1101  LRWLREQIGLVGQEPVLFNMTVTENIRYGRPDASDEQVEAAARAANAHTFIARLPEKYGT  1160

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
             K+G+ G+ LSGGQKQR+AIARAI+K  KVLLLDEA+SALD ESEK VQDAL ++    TT
Sbjct  1161  KLGEGGITLSGGQKQRVAIARAIVKDPKVLLLDEATSALDAESEKVVQDALDRLMVGRTT  1220

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLST+++A+VIAVV  G + E G H++LMA    G Y+ LVR +
Sbjct  1221  VVVAHRLSTVRDADVIAVVNRGKIIEQGPHEELMARP-AGAYSRLVRHQ  1268


 Score =   313 bits (802),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 233/542 (43%), Positives = 317/542 (58%), Gaps = 32/542 (6%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L  Q    SL  V LG G  V    Q  L  L G +  +R+R    KS+L+Q+ G+FD  
Sbjct  39    LTEQVTKYSLYFVYLGVGAFVAAYLQVALWTLTGVRQVNRMRGQYLKSVLRQDVGYFDTT  98

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
               S G L+  L+ D  + +  +GD+   ++  L++A VG+ I+F+  W +TL+  A+TPF
Sbjct  99    ATS-GRLLQGLNEDCQTIQLAIGDKVGHVIFNLTTAVVGIIIAFTKGWDMTLVMLAVTPF  157

Query  1342  tLGASYF-SLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
               G  +  S+ M       N++YA A++IA  A+ NIRTV  F+ +E  ++++  +L  P
Sbjct  158   LAGMGFMISVFMARNTSKINTAYADANSIAQQALGNIRTVYAFNGEERTLEAYSASLQPP  217

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
              +  +R+  + G  +G + G  + AY L LW+G+  V  G  N G V  +    ++  F+
Sbjct  218   LKVGIRQGFLGGLVVGITNGVAFFAYALALWYGSTRVVAGAYNGGDVVNVLFSALIGGFA  277

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFE-------  827
             +GQ A  A     AS            R L+G      GR+     P             
Sbjct  278   LGQAAPNAQYFQQAS------------RQLLG-----MGRRDCGGVPLGRGAAAHARAGR  320

Query  826   ---MVTFAYPS-RPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRV  659
                +     P+ RP V V R F+L +  G  VALVG SGSGKST+I +I+RFYDP  G V
Sbjct  321   PAGLAPLRLPTCRPHVKVFREFNLTVPAGKTVALVGESGSGKSTVIGIIERFYDPQAGEV  380

Query  658   LMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHK  479
             L++ VD+++L L+WLRSQ  LV QEP LFA TI ENI  G P  +  EI EAAK A  H 
Sbjct  381   LIDGVDIKKLQLRWLRSQIGLVSQEPTLFATTISENIRLGKPGCTMEEIVEAAKSANAHN  440

Query  478   FISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQD  299
             FISGLP GY+T+VG+ GVQ+SGGQKQRIAIARAILK  K+LLLDEA+SALD ESE  VQD
Sbjct  441   FISGLPRGYDTQVGEKGVQMSGGQKQRIAIARAILKDPKILLLDEATSALDAESEHVVQD  500

Query  298   ALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             AL ++    TT+VVAHRLST+  A++IAVVK+G + E GSHD+LMA  L G Y TLV  +
Sbjct  501   ALDRLMVGRTTVVVAHRLSTVIGADMIAVVKQGHIVEQGSHDELMA--LGGAYWTLVHTQ  558

Query  118   QE  113
             Q+
Sbjct  559   QQ  560



>gb|KFK33760.1| hypothetical protein AALP_AA5G056700 [Arabis alpina]
Length=1251

 Score =   359 bits (922),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 342/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  722   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  781

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  782   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  841

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  842   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  901

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  902   QKRSLYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSKGESTFSKVIKVFVVLVITANS  961

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DI+F  V FAYP
Sbjct  962   VAETVSLAPEIIRGGEAVGSVFSVLDRQTKIDPDDADA-DPVETIRG-DIDFRHVDFAYP  1019

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1020  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1079

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1080  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARSANAHGFISGLPEGYKT  1139

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1140  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1199

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1200  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1247


 Score =   285 bits (728),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 207/528 (39%), Positives = 311/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q    +L  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  81    QVSKYALYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  139

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  199

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+ +A+    +
Sbjct  200   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSEAIQYTLK  258

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  259   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGTTDGGKAFTAIFSAIVGGMSLG  318

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   +A   ++EIIN+RP I  DP   G+  +  +  +IEF+ VTF+YPSR
Sbjct  319   QSFSNLGAFSKGKSAGYKLMEIINQRPTIIQDPL-DGKCLDQVQG-NIEFKDVTFSYPSR  376

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ RNFS+    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  377   PDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPSNGQILLDGVEIKTLQLK  436

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  437   FLRDQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  496

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  497   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  556

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A    G YA+L+R ++
Sbjct  557   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELVAKA--GAYASLIRFQE  602



>ref|XP_010425667.1| PREDICTED: ABC transporter B family member 19 [Camelina sativa]
Length=1254

 Score =   359 bits (922),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 342/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  725   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  784

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EW+++LL     P 
Sbjct  785   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWKVSLLILGTFPL  844

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  845   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  904

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  905   QKRSLYRSQTSGILFGLSQLALYGSEALILWYGAHLVSKGESTFSKVIKVFVVLVITANS  964

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  965   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1022

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPD++V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1023  SRPDIMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1082

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +EI EAA+ A  H FISGLPEGY+T
Sbjct  1083  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEIIEAARAANAHGFISGLPEGYKT  1142

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1143  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1202

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1203  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1250


 Score =   283 bits (725),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 206/528 (39%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  + LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  84    EVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  142

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   W+L LL+ A+      
Sbjct  143   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  202

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  203   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  261

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  262   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  321

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   +LEIIN+RP I  DP   G+  E     +IEF+ VTF+YPSR
Sbjct  322   QSFSNLGAFSKGKAAGYKLLEIINQRPTIIQDPL-DGKCLEQVHG-NIEFKDVTFSYPSR  379

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ RNF++    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  380   PDVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLK  439

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  440   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  499

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  500   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  559

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  560   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  605



>ref|XP_010502886.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1255

 Score =   359 bits (922),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 342/529 (65%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  726   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  785

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EW+++LL     P 
Sbjct  786   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWKVSLLILGTFPL  845

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  846   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  905

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  906   QKRSLYRSQTSGILFGLSQLALYGSEALILWYGAHLVSKGESTFSKVIKVFVVLVITANS  965

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  966   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1023

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPD++V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1024  SRPDIMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1083

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +EI EAA+ A  H FISGLPEGY+T
Sbjct  1084  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEIIEAARAANAHGFISGLPEGYKT  1143

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1144  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1203

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1204  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1251


 Score =   279 bits (713),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 206/528 (39%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  + LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  85    EVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  143

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   W+L LL+ A+      
Sbjct  144   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  203

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  204   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLK  262

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  263   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  322

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   +LEIIN+RP I  DP   G+  E     +IEF+ VTF+YPSR
Sbjct  323   QSFSNLGAFSKGKAAGYKLLEIINQRPTIIQDPL-DGKCLEQVHG-NIEFKDVTFSYPSR  380

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ RNF++    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  381   PDVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLK  440

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  441   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANSHSFITLLPKGYDTQV  500

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  501   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  560

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  561   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  606



>gb|KHN48276.1| ABC transporter B family member 1 [Glycine soja]
Length=1241

 Score =   359 bits (921),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 222/527 (42%), Positives = 334/527 (63%), Gaps = 2/527 (0%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  690   EIEKYCYLLIGLSSAALLFNTLQHSFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  749

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RLS+D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  750   SARIAARLSLDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  809

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F++++ IV  F   L  P R 
Sbjct  810   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEKKIVGLFTSNLETPLRR  869

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  870   CFWKGQISGSGYGIAQFALYASYALGLWYASWLVKHGISDFSNTIRVFMVLMVSANGAAE  929

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                LAPD      A+ +  ++++RR  I  D          S   ++E + V F+YP+RP
Sbjct  930   TLTLAPDFIKGGHAMRSAFDLLDRRTEIEPDDP-DATPVPDSLRGEVELKHVDFSYPTRP  988

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V RN SL+ + G  +ALVG SG GKS++I +IQRFYDP  G+V+++  D+R+ NLK 
Sbjct  989   DMSVFRNLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGQVMIDGKDIRKYNLKS  1048

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR   A+V QEP LFA TI ENIA+G  +AS  EI EAA  A  HKFIS LP+GY+T VG
Sbjct  1049  LRRHIAVVPQEPCLFATTIYENIAYGHDSASDAEIIEAATLANAHKFISSLPDGYKTFVG  1108

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + GVQLSGGQKQRIAIARA ++K++++LLDEA+SALD ESE+ VQ+AL +     TTI+V
Sbjct  1109  ERGVQLSGGQKQRIAIARAFVRKAELMLLDEATSALDAESERSVQEALERACSGKTTIIV  1168

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLSTI+ AN+IAV+ +G VAE GSH +L+ +  +GIYA +++ ++
Sbjct  1169  AHRLSTIRNANLIAVIDDGKVAEQGSHSQLLKNHPDGIYARMIQLQK  1215


 Score =   288 bits (737),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 196/501 (39%), Positives = 303/501 (60%), Gaps = 6/501 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++R+R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  72    GERQSTRMRIRYLEAALDQDIQFFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  130

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A NI   
Sbjct  131   ATFVSGFVVGFTAVWQLALVTLAVVPIIAVIGGIHTTTLAKLSSK-SQEALSQAGNIVEQ  189

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V  IR V  F  +   +Q +  AL   ++   R     G  LG +   ++  Y L LW+
Sbjct  190   TVVQIRVVLAFVGETRALQGYSSALRIAQKIGYRIGFAKGMGLGATYFVVFCCYALLLWY  249

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  YTN G        +++   ++GQ A      + A  A   +  +I+ +P I 
Sbjct  250   GGYLVRHHYTNGGLAITTMFSVMIGGLALGQSAPSMAAFTKARVAAAKIFRVIDHKPGID  309

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
                +  G + E+     +E   V F+YPSRP+ ++L NFSL +  G  +ALVG+SGSGKS
Sbjct  310   IKSE-SGLELESVTGL-VELRNVDFSYPSRPEFMILHNFSLNVPAGKTIALVGSSGSGKS  367

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEPALFA TI ENI  G P+
Sbjct  368   TVVSLIERFYDPSSGQVLLDGHDVKSLKLRWLRQQIGLVSQEPALFATTIRENILLGRPD  427

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  EIEEAA+ A  H FI  LPEGYET+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  428   ANQVEIEEAARVANAHSFIIKLPEGYETQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  487

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQDAL +     TT+V+AH+LSTI++A+++AV+++G+V E G+HD+
Sbjct  488   DEATSALDSESEKLVQDALDRFMIGRTTLVIAHQLSTIRKADLVAVLQQGSVTEIGTHDE  547

Query  169   LMASELNGIYATLVRAEQEAY  107
             L A   NG+YA L+R ++ A+
Sbjct  548   LFAKGENGVYAKLIRMQEMAH  568



>ref|XP_004485974.1| PREDICTED: ABC transporter B family member 9-like [Cicer arietinum]
Length=1252

 Score =   359 bits (921),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 231/519 (45%), Positives = 329/519 (63%), Gaps = 5/519 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             SL++ GLG   +V +  Q  L G+AG KL  RIR+  F+ ++ QE  WFD   NS+G + 
Sbjct  730   SLLIFGLGCITLVAIPMQNYLFGIAGGKLIERIRSLTFQKVVHQEISWFDHSSNSSGAVS  789

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ + R+++GD  ++++  +++   GL I+FS  W L+ +  A++P  L   Y  
Sbjct  790   ARLSTDASTVRTLVGDTLALIVQNIATVTAGLVIAFSANWILSFVILAVSPLLLIQGYIQ  849

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
                  G   D    Y  AS IA  AV +IRTVA+F  ++ ++  ++K  S P++  VR  
Sbjct  850   TKFLKGFSSDAKVKYEEASQIANDAVGSIRTVASFCAEQKVMDMYQKKCSAPEKQGVRLG  909

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              + G  LGFS  A+Y       + G+ LV+ G    G V+K+F  L +++  V Q + LA
Sbjct  910   LVSGIGLGFSFFALYCTNAFCFYIGSILVQHGKATFGEVFKVFFCLTVTAIGVSQTSALA  969

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PDT+ A  +  ++ EI++ +P I S    +G   ET K  DIE + ++F YP+RP++ + 
Sbjct  970   PDTNKARDSAASIFEILDSKPSIDSS-SNEGMTLETVKG-DIELQEISFRYPTRPNIQIF  1027

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             ++  L I  G  VALVG SGSGKST+I +++RFY+P  G ++++ V++++  L WLR Q 
Sbjct  1028  KDLCLCIPAGKTVALVGESGSGKSTVINLLERFYNPDSGHIVLDGVNVKKFRLSWLRQQM  1087

Query  601   ALVGQEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              LVGQEP LF  +I  NIA+G    A+  EI  AAK A  H FIS LP GYET VG+ G 
Sbjct  1088  GLVGQEPILFNESIHANIAYGKEGGATEDEIISAAKAANAHNFISSLPNGYETSVGERGT  1147

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARAILK  K+LLLDEA+SALD ESE+ VQ+AL ++S   TT+VVAHRL
Sbjct  1148  QLSGGQKQRIAIARAILKDPKILLLDEATSALDAESERIVQEALDRVSMNRTTVVVAHRL  1207

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             +TIK A++IAVVK G +AE G HD LM  +  G+YA+LV
Sbjct  1208  ATIKGADIIAVVKNGLIAEKGRHDLLMKID-GGVYASLV  1245


 Score =   270 bits (689),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 198/529 (37%), Positives = 303/529 (57%), Gaps = 8/529 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +   ++L+ + LG G  +    Q     + G +  +RIR    K+ILKQ+  +FD  E +
Sbjct  76    EVSKVALLFIYLGVGSGIASFLQVTCWMVTGERQAARIRGLYLKTILKQDIAYFD-TEAT  134

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +G ++ R+S D++  +  +G++    +  +SS   G  I+F+  W L+L+  A  P  + 
Sbjct  135   SGEVIGRMSGDTILIQDAMGEKVGKFIQLISSFLGGFVIAFTKGWELSLVLLACIPCIVI  194

Query  1333  ASYFSLIMNVGPKL-DNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
                F  +M         ++Y+ A  +    V  IRTVA+F+ +++ ++ +   L     T
Sbjct  195   VGGFMSMMMAKMSSRGQTAYSEAGVVVEQTVGAIRTVASFTGEKNAIEKYHNKLRIAYNT  254

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +V++    G+ +G     ++  Y L +W+G+ L+ E   + G    +F I++    S+GQ
Sbjct  255   TVQQGLASGTGMGILLLIVFSTYALAMWYGSKLIIEKGYDGG---NVFNIIISGGMSLGQ  311

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                     +    A   + E I R+P I +     G   E  K  +IE + V F YP+RP
Sbjct  312   TTPCLNAFTTGQVAAYKMFETIKRKPKINA-YDTNGVVLEDVKG-NIELKDVYFRYPARP  369

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             DV +   FS  I  GT  ALVG SGSGKST+I +++RFYDP  G VL++ V+++   ++W
Sbjct  370   DVQIFAGFSFYIPSGTTAALVGQSGSGKSTIISLLERFYDPEAGEVLIDGVNMKNFQVRW  429

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             +R Q  LVGQEP LF  +I ENI++G   A+  EI  A   A   KFI  LP+G +T VG
Sbjct  430   IREQIGLVGQEPVLFTASIKENISYGKEGATDEEITTAITLANAKKFIDKLPQGLDTMVG  489

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
               G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL K+  Q TT+VV
Sbjct  490   GHGTQLSGGQKQRIAIARAILKNPRILLLDEATSALDAESERVVQEALEKVMSQRTTVVV  549

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             AHRL+TI+ A++IAVV +G + E G+HD+L+     G Y+ L+  ++ A
Sbjct  550   AHRLTTIRNADIIAVVHQGKIVEKGTHDELIKDPC-GAYSQLISLQEGA  597



>ref|XP_002960296.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ37835.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1360

 Score =   360 bits (924),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 227/518 (44%), Positives = 326/518 (63%), Gaps = 6/518 (1%)
 Frame = -1

Query  1672  ILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSR  1493
             + V L   C + +  Q       G  L  RIR   FK++L+QE GWFD  ENS+G + SR
Sbjct  842   MFVVLACACFIIIPCQMVSFAYVGQNLIRRIRYLTFKTVLRQEIGWFDARENSSGAISSR  901

Query  1492  LSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLI  1313
             LS D+   R ++GD  ++ +  L++ A GL I+FS  W L L+  AL P         + 
Sbjct  902   LSTDAAYVRGMVGDSLALTVQNLATIAAGLLIAFSATWELALVIFALVPLLSLQGIMQIK  961

Query  1312  MNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQI  1136
             +  G   D    Y  AS++AA A+S+IR+VA+F  +E +++ +E+    P +  +R   +
Sbjct  962   VMTGFSADAKVMYEEASHVAADAISSIRSVASFCAEEKMLKLYEEKCRRPLKNGIRLGLV  1021

Query  1135  LGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPD  956
              G+  G S   M+ +Y L+ W+GA LVK+  T    V+K+F  + +S+  V   AGLAPD
Sbjct  1022  SGAGFGCSNVVMFSSYGLSFWYGAQLVKDRKTTFQKVFKVFFAITMSAIGVSHAAGLAPD  1081

Query  955   TSMASAAIPAVLEIINRRPLIGSDPQR-KGRKFETSKPFDIEFEMVTFAYPSRPDVIVLR  779
                   ++ ++  +++R+  I  DP   +G   +     D++F+ V+F YPSRP V + R
Sbjct  1082  LGKVKTSVISIFSMLDRKSKI--DPADLQGSTLDILHG-DVQFQHVSFKYPSRPGVQIFR  1138

Query  778   NFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTA  599
             +F+L ++ GT  ALVG SG GKST I +IQRFYDP  G++ ++ VD+R L L+WLR Q A
Sbjct  1139  DFTLFVEAGTTAALVGESGCGKSTAISLIQRFYDPDCGKIFIDGVDIRSLQLRWLRQQMA  1198

Query  598   LVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvql  419
             LVGQEP LF+GT+G NI +G    S  EI++AA  A  +KFI  LP+G++T+VG+ G QL
Sbjct  1199  LVGQEPVLFSGTLGSNIGYGKDGVSDDEIKDAAISANAYKFIMDLPDGFDTEVGERGTQL  1258

Query  418   sggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLST  239
             SGGQKQRIAIARAI+K  K+LLLDEA+SALD ESE+ VQ+AL  + +  T +VVAHRLST
Sbjct  1259  SGGQKQRIAIARAIVKNPKILLLDEATSALDAESERLVQEALNLVMQNRTVVVVAHRLST  1318

Query  238   IKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             I  A+VI+V+K G VAE G H +L+  E NG+Y+ LV+
Sbjct  1319  IVNADVISVMKNGVVAEQGRHKELLQIE-NGVYSLLVK  1355


 Score =   280 bits (716),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 207/525 (39%), Positives = 308/525 (59%), Gaps = 11/525 (2%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             L  + +GLG G    M     +C  AG +  +RIR    KSIL+Q+  +FD    STG +
Sbjct  189   LRYVFLGLGTGAAALMETSFWMC--AGERQAARIRALYLKSILRQDVSFFD-KGISTGEV  245

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGAS  1328
             + R+S D+   +  +G++    +  LS+   G  ++F   WRL L+ +++       GA+
Sbjct  246   LGRMSDDTFLIQDAIGEKVGKFVQLLSTFFGGFILAFIRGWRLALVVSSVLPLLVIAGAT  305

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
                LI     +    +YA A NI   AV  IRTVA+F+ ++  V  ++ AL +  R  V 
Sbjct  306   MAMLISKTSSR-GQMAYADAGNIVQQAVGGIRTVASFTGEDKAVGDYDTALGKAYRAGVY  364

Query  1147  RSQILGSALGFSQGAMYGAYTLTLWFGAYLV-KEGYTNIGAVYKIFLILVLSSFSVGQLA  971
             +    G  +G +   +Y +Y L LW+G+ L+   GYT  GAV  + L +++   ++GQ +
Sbjct  365   QGLSSGFGMGCTLLTLYLSYALALWYGSKLILHNGYTG-GAVINVMLSVLMGGMALGQAS  423

Query  970   GLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDV  791
                   +   AA   + E+I+R P I  D         T    +IE E V F YPSRP V
Sbjct  424   PSLRAFAAGQAAAYKMFEVIHRVPAI--DSYNMEGAILTDVQGNIEIETVNFTYPSRPGV  481

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
              +L+ F L I  G   AL+G SGSGKST+I +++RFYDP  G V ++  D+R+L LKWLR
Sbjct  482   QILKGFCLSIPSGMTAALIGQSGSGKSTVISLLERFYDPQSGVVSIDGHDIRKLQLKWLR  541

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              Q  LV QEP LF  ++ EN+A+G   A+  +++ A + A   +FIS +P+GY+T VG  
Sbjct  542   QQIGLVSQEPVLFGVSVLENVAYGKDGATKEDVQAACELANAARFISNMPQGYDTHVGHH  601

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ +L ++    TT++VAH
Sbjct  602   GTQLSGGQKQRIAIARAILKNPRILLLDEATSALDAESERIVQKSLERVMVDRTTVIVAH  661

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             RLSTI++AN I V ++G + E G+H  L+A+  +G Y+ L++ ++
Sbjct  662   RLSTIRDANSIFVFQQGKIVESGTHSSLLANP-DGHYSQLIKLQE  705



>emb|CAD40903.1| OSJNBa0036B21.21 [Oryza sativa Japonica Group]
 emb|CBW45777.1| ORW1943Ba0077G13.5 [Oryza rufipogon]
Length=1252

 Score =   359 bits (921),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 233/539 (43%), Positives = 342/539 (63%), Gaps = 14/539 (3%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNF----------LFKSIL  1553
             ++ + +    I +G G   +V  + Q     + G  LT+R+R            LF +IL
Sbjct  713   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVALFDQRLFSAIL  772

Query  1552  KQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRl  1373
             + + GWFD +EN++ ++ +RLS D+   +S + +R SV+L  ++S  V   + F +EWR+
Sbjct  773   RNDVGWFDQEENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRV  832

Query  1372  tllaaaltpftLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIV  1196
              +L     P  + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ ++
Sbjct  833   AVLILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVL  892

Query  1195  QSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKI  1016
               F   L  P+  S+RRSQI G+  G SQ ++Y +  L LW+GA+LV+   +    V K+
Sbjct  893   SLFCTELRVPQMHSLRRSQISGALFGLSQLSLYASEALILWYGAHLVRHHVSTFSKVIKV  952

Query  1015  FLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDI  836
             F++LV+++ +V +   LAP+      +I +V  I+N R  I  DP     +   S   DI
Sbjct  953   FVVLVITANTVAETVSLAPEIVRGGESIRSVFAILNYRTRI--DPDEPETEPVESVRGDI  1010

Query  835   EFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVL  656
             +F  V FAYPSRPDV+V ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+
Sbjct  1011  DFRHVDFAYPSRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVM  1070

Query  655   MEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKF  476
             ++  D+R LN++ LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F
Sbjct  1071  IDGKDIRRLNVRSLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGF  1130

Query  475   ISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDA  296
             +S LPEGY+T VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+A
Sbjct  1131  VSALPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEA  1190

Query  295   LRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             L +I K  T ++VAHRLSTI+  + IAVV++G V E GSH +L+ S  +G Y+ L++ +
Sbjct  1191  LERIMKGRTAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELV-SRPDGAYSRLLQLQ  1248


 Score =   296 bits (757),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 204/500 (41%), Positives = 299/500 (60%), Gaps = 6/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  100   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  158

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  159   STFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSK-SRDSYANAGIIAEQ  217

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  218   AIAQVRTVYSYVGESKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  277

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I 
Sbjct  278   AGVFIRNGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIV  337

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              DP   GR  +     +IEF+ V F+YPSRPDV++ R+FSL    G   A+VG SGSGKS
Sbjct  338   QDPA-DGRCLDEVHG-NIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKS  395

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P+
Sbjct  396   TVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYGKPD  455

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T+VG+ G+QLSGGQKQRIAIARA+LK  K+LLL
Sbjct  456   ATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARAMLKNPKILLL  515

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++IAV+++G V E G+HD+
Sbjct  516   DEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDE  575

Query  169   LMASELNGIYATLVRAEQEA  110
             L+A   +G YA L+R ++ A
Sbjct  576   LLAKGSSGAYAALIRFQEMA  595



>ref|XP_006396373.1| hypothetical protein EUTSA_v10029280mg, partial [Eutrema salsugineum]
 gb|ESQ37826.1| hypothetical protein EUTSA_v10029280mg, partial [Eutrema salsugineum]
Length=597

 Score =   344 bits (883),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 227/526 (43%), Positives = 325/526 (62%), Gaps = 6/526 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             S+I V LG   +V       L  +AG +L  RIR+  F+ ++  E GWFD  ENS+G + 
Sbjct  73    SMIFVLLGVISLVVYPTHMYLFSVAGGRLVRRIRSMCFEKVVHMEVGWFDEPENSSGAMG  132

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+   R+++GD  ++ +   +SA  G+ I+F   W L ++   L P T   +Y  
Sbjct  133   ARLSADAALVRTLVGDSLALTVKNAASAVAGIIIAFVASWELAVIILVLIPLTGINNYVQ  192

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D  + Y  AS +A  AV +IRTVA+F  +E ++  ++K   +P ++++++ 
Sbjct  193   VRFMQGFSADAKAKYEEASQVANDAVGSIRTVASFCAEEKVMDMYKKRCEDPIKSAIKQG  252

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   G S   +Y  Y    + GA LVKEG T    V+++FL L +++  +   +  A
Sbjct  253   LIAGLGFGLSFFVLYSVYATCFYAGARLVKEGRTTYEGVFQVFLALTMTTIGISSASSFA  312

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD+S A  A  ++  II+R+  I S  +  G   E  K  DIE   ++F Y +RPD+ + 
Sbjct  313   PDSSKAKGAAASIFGIIDRKSKIDSRDE-SGMVLENVKG-DIELCHISFTYQTRPDIQIF  370

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+    I+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ V+L++L LKWLR Q 
Sbjct  371   RDLCFSIRAGQTVALVGESGSGKSTVISLLQRFYDPYSGHITLDGVELKKLQLKWLRQQM  430

Query  601   ALVGQEPALFAGTIGENIAFGF--PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
              LVGQEP LF  TI  NIA+G     A+  EI  A++ A  HKFIS + +GY+T VG+ G
Sbjct  431   GLVGQEPVLFNDTIRANIAYGKGGKEATEAEIVAASELANAHKFISSIQKGYDTVVGERG  490

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
             +QLSGGQKQR+AIARAI+K+ ++LLLDEA+SALD ESE+ VQDAL ++    TTIVVAHR
Sbjct  491   IQLSGGQKQRVAIARAIVKEPRILLLDEATSALDAESERVVQDALDRVMVNRTTIVVAHR  550

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             LSTIK A+VIAVVK G +AE G+H  L+  E  G+YA+LV+    A
Sbjct  551   LSTIKNADVIAVVKNGVIAEKGTHQTLINIE-GGVYASLVQLHMSA  595



>ref|XP_006375419.1| multidrug resistant ABC transporter family protein [Populus trichocarpa]
 ref|XP_002320942.2| hypothetical protein POPTR_0014s10880g [Populus trichocarpa]
 gb|ERP53216.1| multidrug resistant ABC transporter family protein [Populus trichocarpa]
 gb|EEE99257.2| hypothetical protein POPTR_0014s10880g [Populus trichocarpa]
Length=1294

 Score =   359 bits (921),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 231/520 (44%), Positives = 323/520 (62%), Gaps = 7/520 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L+ + LG    V    Q  L  +AG KL  RIR+  F+ ++  E GWFD  E+S+G + 
Sbjct  770   ALMFMTLGLASFVVYPTQTYLFSVAGCKLIQRIRSMCFEKVVHMEVGWFDEPEHSSGAIG  829

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ + R+++GD  S L+  ++SA  GL I+FS  W+L L+   L P      +  
Sbjct  830   ARLSADAATVRALVGDSLSQLVQNIASAVAGLVIAFSASWQLALVILVLLPLIGLNGFVQ  889

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D    Y  AS +A  AV +IRTVA+F  +E ++Q + +    P RT +R+ 
Sbjct  890   VKFMKGFSADAKKMYEEASQVANDAVGSIRTVASFCAEEKVMQLYRRKCEGPMRTGIRQG  949

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G+  G S   ++  Y  T + GA LV+ G TN   V+++F  L +++  + Q +  A
Sbjct  950   MISGTGFGVSFFLLFSVYATTFYVGAQLVRHGKTNFADVFRVFFALTMAAIGISQSSSFA  1009

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
             PD+S A  A  ++  II+R+  I  DP    G   +  K  +IE   ++F YPSRPD+ +
Sbjct  1010  PDSSKAKGAAASIFAIIDRKSKI--DPSDESGTTLDNVKG-EIELRHISFKYPSRPDIEI  1066

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
              R+ SL I  G  VALVG SGSGKST+I ++QRFYDP  G + ++ +D++ L LKWLR Q
Sbjct  1067  FRDLSLAIHSGKTVALVGESGSGKSTVISLLQRFYDPDSGHITLDGIDIQSLQLKWLRQQ  1126

Query  604   TALVGQEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
               LV QEP LF  TI  NIA+G   NA+  EI  A++ A  HKFISGL +GY+T VG+ G
Sbjct  1127  MGLVSQEPVLFNETIRANIAYGKEGNATEAEIVAASELANAHKFISGLQQGYDTVVGERG  1186

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
              QLSGGQKQR+AIARA++K  K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAHR
Sbjct  1187  TQLSGGQKQRVAIARAMVKSPKILLLDEATSALDAESERVVQDALDRVMVSRTTVVVAHR  1246

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             LSTIK A+VIAVVK G + E G H+ L+  + +G YA+LV
Sbjct  1247  LSTIKNADVIAVVKNGVIVEKGKHETLIHIK-DGFYASLV  1285


 Score =   281 bits (719),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 206/525 (39%), Positives = 304/525 (58%), Gaps = 7/525 (1%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              ++L  V LG G  V    Q     + G +  +RIR    K+ILKQ+  +FD  E +TG 
Sbjct  110   KVALNFVYLGIGSAVAAFLQVACWMVTGERQAARIRGTYLKTILKQDVAFFD-KETNTGE  168

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEW--RltllaaaltpftLGA  1331
             +V R+S D+V  +  +G++    +  +S+   G  I+F   W   L +L++       GA
Sbjct  169   VVGRMSGDTVLIQDAMGEKVGKFIQLVSTFIGGFIIAFVKGWLLTLVMLSSIPLLVIAGA  228

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
                 +I  +  +   ++YA+A+ +   A+ +IRTVA+F+ ++  + +++K L+    + V
Sbjct  229   GLAIIIARMASR-GQTAYAKAATVVEQAIGSIRTVASFTGEKQAISNYKKFLATAYNSGV  287

Query  1150  RRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLA  971
             +     G  LG     ++ +Y L +WFG  ++ E   N G V  + + ++  S S+GQ +
Sbjct  288   QEGFTAGLGLGIVMLLVFCSYALAIWFGGKMILEKGYNGGDVINVIVAVLTGSMSLGQAS  347

Query  970   GLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDV  791
                   +   AA   + E INR+P I  D      K       D+E   V F YP+RPD 
Sbjct  348   PCMSAFAAGQAAAYKMFETINRKPEI--DSSDTSGKILDDISGDVELRDVYFTYPARPDE  405

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
              +   FSL I  GT  ALVG SGSGKST+I +I+RFYDP  G VL++  +L+E  LKW+R
Sbjct  406   QIFAGFSLFIPSGTTTALVGQSGSGKSTVISLIERFYDPQAGEVLIDGTNLKEFQLKWIR  465

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              +  LV QEP LFA +I +NIA+G   A+  EI  A + A   KFI  LP+G +T VG+ 
Sbjct  466   EKIGLVSQEPVLFASSIKDNIAYGKDGATTEEIRAATELANAAKFIDKLPQGIDTMVGEH  525

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQRIAIARAILK  +VLLLDEA+SALD ESE+ VQ+AL +I    TT++VAH
Sbjct  526   GTQLSGGQKQRIAIARAILKDPRVLLLDEATSALDAESERIVQEALDRIMVNRTTVIVAH  585

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             RLST+  A++IAV+  G + E GSH +L+  +  G Y+ L+R ++
Sbjct  586   RLSTVINADMIAVIYRGKMVEKGSHSELL-KDPEGAYSQLIRLQE  629



>emb|CDY00109.1| BnaC09g01920D [Brassica napus]
Length=1245

 Score =   358 bits (919),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 230/529 (43%), Positives = 340/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   ++  + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  716   MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  775

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  776   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPL  835

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  836   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFSHELRVP  895

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S  RSQ  G   G SQ A+YG+  + LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  896   QKRSFYRSQTSGLLFGLSQLALYGSEAVILWYGAHLVSQGKSTFSKVIKVFVVLVITANS  955

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  956   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPAETIRG-DIEFRHVDFAYP  1013

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V  +F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1014  SRPDVMVFTDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1073

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1074  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKT  1133

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1134  PVGERGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMRGRTT  1193

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E G H +L+ S   G Y+ L++ +
Sbjct  1194  VVVAHRLSTIRGVDCIGVIQDGRIVEQGRHSELV-SRPEGAYSRLLQLQ  1241


 Score =   284 bits (726),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 209/529 (40%), Positives = 312/529 (59%), Gaps = 9/529 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG    V+   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSKYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+ +A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSEAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   +A   ++EIIN+RP I  DP   G+  E     +IEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKSAGYKLMEIINQRPTIVQDPL-DGKCLEQVHG-NIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQ-GRVLMEEVDLRELNL  623
             PDVI+ RNFS+    G  VA+VG SGSGKST++ +I+RFYDP   G++L++ V+++ L L
Sbjct  378   PDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNAGKILLDGVEIKTLQL  437

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K+LR Q  LV QEPALFA TI ENI +G PNA+  E+E AA  A  H FI+ LP+GY+T+
Sbjct  438   KFLREQIGLVNQEPALFATTILENILYGKPNATLDEVEAAASAANAHSFITLLPKGYDTQ  497

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+
Sbjct  498   VGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTV  557

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VVAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  558   VVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGPYASLIRFQE  604



>ref|XP_010693227.1| PREDICTED: ABC transporter B family member 19 [Beta vulgaris 
subsp. vulgaris]
Length=1250

 Score =   358 bits (920),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 228/525 (43%), Positives = 338/525 (64%), Gaps = 4/525 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +I++ E GWFD +
Sbjct  721   MEKKTKEYVFIYIGAGIYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAIMRNEVGWFDEE  780

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ +L +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  781   EHNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  840

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ QE I+  F   L  P
Sbjct  841   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKILSLFCHELRVP  900

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S RRSQ  GS  G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  901   QKRSFRRSQTSGSLFGLSQLALYGSEALILWYGAHLVSKGLSTFSKVIKVFVVLVITANS  960

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   I  DP     +   S   DIEF  V F+YP
Sbjct  961   VAETVSLAPEIIRGGEAVGSVFSILDRCTRI--DPDDSEAEPVESIRGDIEFRHVDFSYP  1018

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPDV+V ++F+L+I+ G   ALVGASGSGKS++I +I+RFYDP  G+V+++  D+R LN
Sbjct  1019  TRPDVLVFQDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPSAGKVMIDGKDIRRLN  1078

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I +NI +G   A+  E+ EAA+ A +H F+S LPEGY+T
Sbjct  1079  LKSLRLKIGLVQQEPALFASSIFDNIVYGKEGATEAEVIEAARAANVHGFVSALPEGYKT  1138

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1139  TVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTT  1198

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATL  131
             ++VAHRLSTI+  + I VV++G + E GSH +L+ S   G Y+ L
Sbjct  1199  VLVAHRLSTIRGVSSIGVVQDGRIVEQGSHSELI-SRPEGAYSRL  1242


 Score =   259 bits (663),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 202/528 (38%), Positives = 301/528 (57%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG    V+   +      +G +    +R    +++L+Q+ G+FD D   
Sbjct  80    EVSKYALYFVYLGLIVCVSSYAEIACWMYSGERQAGALREKYLEAVLRQDVGFFDTDAR-  138

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  198

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  199   AGGLYAYTLTGLTSK-SRQSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDAIQNTLK  257

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G ++ G  +      ++   S+G
Sbjct  258   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTAIFSAIVGGMSLG  317

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EII ++P I  D    G+  E     +IEF+ V+F+YPSR
Sbjct  318   QSFSNLGAFSKGKAAGYKLMEIIKQKPTIVQDLC-DGKCLEEISG-NIEFKNVSFSYPSR  375

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ R+FS+    G  VA+VG SGSGKST++ +I+RFYDP  G+VL++  D+R L L 
Sbjct  376   PDVMIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNNDIRTLQLT  435

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G  +A+  E+E AA  A  H FI+ LP GY T V
Sbjct  436   WLRGQIGLVNQEPALFATTILENILYGKSDATMAEVEAAASSANAHSFIALLPNGYNTHV  495

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  496   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVV  555

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + IAV+++G V E G+H++L+     G YA+L+R ++
Sbjct  556   VAHRLSTIRNVDTIAVIQQGQVVETGTHEELITKA--GAYASLIRFQE  601



>ref|XP_002893495.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69754.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
Length=1246

 Score =   358 bits (919),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 230/527 (44%), Positives = 326/527 (62%), Gaps = 4/527 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
               + +++I VG+G       + Q     L G +LTSR+R  LF +IL  E GWFD DEN+
Sbjct  721   DVEKVAIIFVGVGIVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENN  780

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             TG L S L+ D+   RS L DR S ++  LS     L ++F   WR+  +  A  P  + 
Sbjct  781   TGSLTSILAADATLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIA  840

Query  1333  ASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             AS    +   G   D + +Y+RA+++A  A++NIRTVA F  ++ I + F   LS+P + 
Sbjct  841   ASLTEQLFLKGFGGDYTRAYSRATSVAREAIANIRTVAAFGAEKQIAEQFTCELSKPTKN  900

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +  R  I G   G SQ   + +Y L LW+ +  +K   TN G   K F++L++++FSV +
Sbjct  901   AFVRGHISGFGYGLSQFLAFCSYALGLWYVSVSIKNKETNFGDSIKSFMVLIVTAFSVSE  960

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                L PD    + A+ +V  +++R   I   P +   +  +    DIEF  V+F YP+RP
Sbjct  961   TLALTPDIVKGTQALGSVFRVLHRETEI--PPDQPNSRMVSQIKGDIEFRNVSFVYPTRP  1018

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ + +N +L++  G  +A+VG SGSGKST+I +I RFYDP  G + ++  D++ LNL+ 
Sbjct  1019  DINIFQNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPSHGNLCIDGQDIKTLNLRS  1078

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR + ALV QEPALF+ TI ENI +G  NAS +EI EAAK A  H+FIS + EGY+T VG
Sbjct  1079  LRKKLALVQQEPALFSTTIHENIKYGNENASESEIIEAAKAANAHEFISRMEEGYKTYVG  1138

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
               GVQLSGGQKQR+AIARA+LK   VLLLDEA+SALD  SEK VQ+AL K+ K  TT++V
Sbjct  1139  DKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDKLMKGRTTVLV  1198

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLSTI++A+ IAV+ +G V E GSH +L+ S  NG Y  L   ++
Sbjct  1199  AHRLSTIRKADTIAVLHKGRVVEKGSHRELV-SIPNGFYKQLTNLQE  1244


 Score =   281 bits (718),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 216/528 (41%), Positives = 303/528 (57%), Gaps = 13/528 (2%)
 Frame = -1

Query  1687  QNLSLILVGLGFGCIVTM-IGQQGLCGL-AGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             QN +L LV LG   +V+  IG    C +  G + T+R+R    KSIL ++  +FD +   
Sbjct  92    QN-ALYLVYLGLVNLVSAWIGVS--CWMQTGERQTARLRINYLKSILAKDITFFDTEARD  148

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             +  L+  +S D++  +  +GD+   +L  LS    G  I F   W+LTLL  A+      
Sbjct  149   SN-LIFHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAV  207

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y ++IM+   +   ++YA A  +A   +S +RTV  F  +E  V+S+  +L +  +
Sbjct  208   AGGGY-AIIMSTISEKSETAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSNSLKKALK  266

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                R     G  +G +   ++ ++ L LW+ + LV+ G TN    +   L ++ S F++G
Sbjct  267   LGKRSGLAKGLGVGLTYSLLFCSWALLLWYASLLVRHGKTNGAKAFTTILNVIFSGFALG  326

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q A      +    A   +  +I    L  S+    G   +      IEF  V+FAYPSR
Sbjct  327   QAAPSLSAIAKGRVAAANIFRMIGNNNLESSERLENGTTLQNVAG-RIEFHQVSFAYPSR  385

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             P+ +V  N S  I+ G   A VG SGSGKST+I M+QRFY+P  G++L++  D++ L LK
Sbjct  386   PN-MVFENLSFTIRSGKTFAFVGPSGSGKSTIISMVQRFYEPNSGKILLDGNDIKSLKLK  444

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR    LV QEPALFA TI  NI FG  NA+  +I EAAK A    FI  LP GY T+V
Sbjct  445   WLREHLGLVSQEPALFATTIASNIIFGKENANMDQIIEAAKAANADSFIKSLPNGYNTQV  504

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ G QLSGGQKQRIAIARA+L+  K+LLLDEA+SALD ESEK VQ AL  I++  TTIV
Sbjct  505   GEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDNITENRTTIV  564

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + I V++ G V E GSH +LM+    G YATLV  ++
Sbjct  565   VAHRLSTIRNVDKIVVLRNGQVTETGSHSELMSR--GGDYATLVNCQE  610



>emb|CDY20012.1| BnaA09g02390D [Brassica napus]
Length=1253

 Score =   358 bits (920),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 230/529 (43%), Positives = 340/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   ++  + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  724   MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  783

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  784   EHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPL  843

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  844   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFSHELRVP  903

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S  RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  904   QKRSFYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSQGKSTFSKVIKVFVVLVITANS  963

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  964   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1021

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV++  +F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1022  SRPDVMLFTDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1081

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1082  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKT  1141

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1142  PVGERGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMRGRTT  1201

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E G H +L+ S   G Y+ L++ +
Sbjct  1202  VVVAHRLSTIRGVDCIGVIQDGRIVEQGRHSELV-SRPEGAYSRLLQLQ  1249


 Score =   285 bits (730),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 210/529 (40%), Positives = 312/529 (59%), Gaps = 9/529 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG    V+   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSRYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+ +A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSEAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  E     +IEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGYKLMEIINQRPTIVQDPL-DGKCLEQVHG-NIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQ-GRVLMEEVDLRELNL  623
             PDVI+ RNFS+    G  VA+VG SGSGKST++ +I+RFYDP   G++L++ V+++ L L
Sbjct  378   PDVIIFRNFSIVFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNAGKILLDGVEIKTLQL  437

Query  622   KWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETk  443
             K+LR Q  LV QEPALFA TI ENI +G PNA+  E+E AA  A  H FI+ LP+GY+T+
Sbjct  438   KFLREQIGLVNQEPALFATTILENILYGKPNATLDEVEAAASAANAHSFITLLPKGYDTQ  497

Query  442   vgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTI  263
             VG+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+
Sbjct  498   VGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTV  557

Query  262   VVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VVAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  558   VVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGPYASLIRFQE  604



>ref|XP_009111610.1| PREDICTED: ABC transporter B family member 19-like [Brassica 
rapa]
Length=1252

 Score =   358 bits (919),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 230/529 (43%), Positives = 340/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   ++  + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  723   MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  782

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  783   EHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPL  842

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  843   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFSHELRVP  902

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S  RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  903   QKRSFYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSQGKSTFSKVIKVFVVLVITANS  962

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DI+F  V FAYP
Sbjct  963   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIKFRHVDFAYP  1020

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V  +F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1021  SRPDVMVFTDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1080

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ EAA+ A  H FISGLPEGY+T
Sbjct  1081  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKT  1140

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1141  PVGERGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMRGRTT  1200

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E G H +L+ S   G Y+ L++ +
Sbjct  1201  VVVAHRLSTIRGVDCIGVIQDGRIVEQGRHSELV-SRPEGAYSRLLQLQ  1248


 Score =   290 bits (741),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 210/528 (40%), Positives = 312/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG    V+   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSRYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+ +A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSEAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  E  +  +IEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGYKLMEIINQRPTIVQDPL-DGKCLEQVQG-NIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ RNFS+    G  VA+VG SGSGKST++ +I+RFYDP  G +L++ V+++ L LK
Sbjct  378   PDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGEILLDGVEIKTLQLK  437

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G PNA+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  438   FLREQIGLVNQEPALFATTILENILYGKPNATIDEVEAAASAANAHSFITLLPKGYDTQV  497

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  498   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  557

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  558   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  603



>gb|KHN12634.1| ABC transporter B family member 13 [Glycine soja]
Length=1205

 Score =   357 bits (917),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 222/500 (44%), Positives = 319/500 (64%), Gaps = 4/500 (1%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +LT+R+R  +F +IL  E  WFD DEN+TG L + L+ D+   RS L DR S ++ 
Sbjct  702   LMGERLTARVRLLMFSAILNNEVAWFDKDENNTGSLTAMLAADATLVRSALADRLSTIVQ  761

Query  1429  GLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLD-NSSYARASNIAA  1253
              ++       I F+L W+LT +  A  P  +GAS    +   G   D   +Y+RA+++A 
Sbjct  762   NVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHAYSRATSLAR  821

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
              A++NIRTVA F  ++ +   F   L++P + ++ R  I G   G +Q   + +Y L LW
Sbjct  822   EAIANIRTVAAFGAEDRVSTQFASELNKPNKQALLRGHISGFGYGITQLLAFCSYALGLW  881

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             + + L+K+  +N G + K F++L+++S ++ +   L PD    S A+ +V  II RR  I
Sbjct  882   YASVLIKKNESNFGDIMKSFMVLIITSLAIAETLALTPDIVKGSQALGSVFGIIQRRTAI  941

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
                P     K  T    +IEF  V+F YP RPD+ + +N +L++  G  +A+VG SGSGK
Sbjct  942   --TPNDTNSKIVTDVKGEIEFRNVSFKYPMRPDITIFQNLNLRVPAGKSLAVVGQSGSGK  999

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST+I ++ RFYDP  G VL++E D++ LNL+ LR +  LV QEPALF+ T+ ENI +G  
Sbjct  1000  STVISLVMRFYDPDSGLVLVDECDIKNLNLRSLRLRIGLVQQEPALFSTTVYENIKYGKE  1059

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
              AS  E+ +AAK A  H+FIS +PEGY+T+VG+ GVQLSGGQKQR+AIARAILK   +LL
Sbjct  1060  EASEIEVMKAAKAANAHEFISRMPEGYKTEVGERGVQLSGGQKQRVAIARAILKDPSILL  1119

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD  SE+ VQ+AL K+ +  TTI+VAHRLST+++AN IAV++ G VAE GSH+
Sbjct  1120  LDEATSALDTVSERLVQEALDKLMEGRTTILVAHRLSTVRDANSIAVLQNGRVAEMGSHE  1179

Query  172   KLMASELNGIYATLVRAEQE  113
             +LMA     IY  LV  + E
Sbjct  1180  RLMAKS-GSIYKQLVSLQHE  1198


 Score =   282 bits (722),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 203/499 (41%), Positives = 295/499 (59%), Gaps = 19/499 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    +++LK++  +FD +E     ++  +S D++  +  +GD+    +  L
Sbjct  72    GERQTARLRLKYLQAVLKKDINFFD-NEARDANIIFHISSDAILVQDAIGDKTGHAIRYL  130

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG  I F+  W+LTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  131   SQFIVGFAIGFTSVWQLTLLTLAVVPLIAVAGGAY-TIIMSTLSEKGEAAYAEAGKVAQE  189

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S +RTV +F  +E  V S+ K+L    +   +     G  +GF+ G ++ A+ L LW+
Sbjct  190   VISQVRTVYSFVGEEKAVGSYSKSLDNALKLGKKGGLAKGIGVGFTYGLLFCAWALLLWY  249

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
              + LV+   TN G  +   + ++ S F++GQ A      +   AA   ++ +I       
Sbjct  250   ASILVRNHKTNGGKAFTTIINVIFSGFALGQAAPNLGSIAKGRAAAGNIMNMI-------  302

Query  889   SDPQRKGRKFETSKPF-----DIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGAS  725
             +   R  +KF+          +IEF  V FAYPSR ++I     S  +  G  +A+VG S
Sbjct  303   ASTSRNSKKFDDGNVVPQVAGEIEFCEVCFAYPSRSNMI-FEKLSFSVSAGKTIAIVGPS  361

Query  724   GSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIA  545
             GSGKST++ +IQRFYDP  G++L++  DL+ L LKWLR Q  LV QEPALFA TI  NI 
Sbjct  362   GSGKSTIVSLIQRFYDPTSGKILLDGYDLKNLQLKWLREQMGLVSQEPALFATTIAGNIL  421

Query  544   FGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKS  365
             FG  +A   ++ +AA  A  H FI GLP+GY+T+VG+ G QLSGGQKQRIAIARA+L+  
Sbjct  422   FGKEDADMDKVIQAAMAANAHSFIQGLPDGYQTQVGEGGTQLSGGQKQRIAIARAVLRNP  481

Query  364   KVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEY  185
             KVLLLDEA+SALD ESE  VQ AL KI    TTIVVAHRLSTI++ + I V+K G V E 
Sbjct  482   KVLLLDEATSALDAESELIVQQALEKIMSNRTTIVVAHRLSTIRDVDTIVVLKNGQVVES  541

Query  184   GSHDKLMASELNGIYATLV  128
             G+H +LM++  NG Y  LV
Sbjct  542   GTHLELMSN--NGEYVNLV  558



>gb|KDO72403.1| hypothetical protein CISIN_1g0408752mg, partial [Citrus sinensis]
Length=607

 Score =   344 bits (882),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 233/521 (45%), Positives = 322/521 (62%), Gaps = 8/521 (2%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             SL   GL    ++T + QQ      G  LT RIR  +   IL  E GWFD DENS+G + 
Sbjct  83    SLCFFGLSIFSLLTNVCQQYYFAYTGEYLTKRIRKNMLSKILTFEVGWFDQDENSSGAIC  142

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             SRL+ D+   RS++GDR ++L+  LSS  +   +S  + WRL L+  A+ P  +   Y  
Sbjct  143   SRLAKDANVVRSLVGDRVALLVQTLSSITIAFTMSLIISWRLALVIIAVQPLVIVCLYGK  202

Query  1318  --LIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
               L+  +  K+  +    +S +AA AVSN+RT+  FS+QE I++  EKA   P+R  VR+
Sbjct  203   EVLLKRMSKKVIKAQ-DESSKLAAEAVSNLRTITAFSSQERILKMLEKAQEAPRREGVRQ  261

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
             S I G  L FS+  +     L  W+G  LV  GY N  ++++IFL+LV +   +     +
Sbjct  262   SWIAGICLAFSRSLVSCVVALAFWYGGRLVARGYINAKSLFEIFLVLVSTGKVIADAGTM  321

Query  964   APDTSMASAAIPAVLEIINRRPLIG-SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVI  788
               D +  S A+ +V  +++R   I   DP  KG + E      IE + V FAYP+RPDVI
Sbjct  322   TTDIAKGSNAVASVFAVLDRDTKINPEDP--KGYRPEKITGH-IELQYVHFAYPARPDVI  378

Query  787   VLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRS  608
             + + FS+ I+     ALVG SGSGKST+I +I+RFYDP++G V ++  D+R  +L+ LR 
Sbjct  379   IFKGFSINIEAEKSTALVGQSGSGKSTIIGLIERFYDPLKGVVKIDGEDIRSYHLRSLRR  438

Query  607   QTALVGQEPALFAGTIGENIAFGFPNA-SYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
               ALV QEPALFA T+ ENI +G  +    +EI EAAK A  H FI+GL EGY+T  G  
Sbjct  439   HVALVSQEPALFAVTVRENITYGASDKIDESEIIEAAKAANAHDFIAGLSEGYDTWCGDR  498

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G+QLSGGQKQRIAIARAILK   VLLLDEA+SALD +SEK VQ+AL ++    T++VVAH
Sbjct  499   GLQLSGGQKQRIAIARAILKNPAVLLLDEATSALDSQSEKLVQEALERLMVGRTSVVVAH  558

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             RLSTI+  ++IAV+++G V E GSH+ L+A    G Y +LV
Sbjct  559   RLSTIQNCDMIAVLEQGRVVEEGSHESLLAKGPAGAYYSLV  599



>ref|XP_010266821.1| PREDICTED: ABC transporter B family member 13-like [Nelumbo nucifera]
Length=1248

 Score =   358 bits (918),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 228/529 (43%), Positives = 332/529 (63%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + + LI++G+G   +   + Q     L G ++TSRIR  +F +IL+ E GWFD D
Sbjct  717   IKHEVRRVCLIMIGVGAITVPIYLLQHYFYTLMGEQITSRIRFLMFSAILRNEIGWFDLD  776

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG L + L++D+   R+ + DR S +L  ++       ISF+L WRL  +  A  PF
Sbjct  777   ENSTGSLTTSLAVDATLVRAAIADRLSTILQNVALTVTAFAISFTLSWRLAAVMVATYPF  836

Query  1342  tLGASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + +S    +   G   D N +Y++   +   A++NIRTVA F  ++H+V+ F   LS+ 
Sbjct  837   LISSSLAEQLFLRGFGGDYNRAYSQDIVVVREAITNIRTVAAFGAEDHVVRQFIHELSQS  896

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             K+ S+ R  I G   G +    + +Y L LW+ + L+K  +++ G V K F++L++++FS
Sbjct  897   KKQSLLRGHISGVCYGLTLFFAFCSYALALWYASLLIKHKHSSFGDVIKCFMVLLVTAFS  956

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             + +   LAP     S A+ +V  I+ R   I  D      +  T     IEF  V+F YP
Sbjct  957   IAETFALAPQVVKGSQALGSVFNILQRETAI--DANSSTSEAVTQVNGLIEFRNVSFKYP  1014

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPD++VL +F+L++  G  +ALVG SGSGKS++I +I RFYDPI G +L++  D+R LN
Sbjct  1015  TRPDILVLDDFNLQVPSGCSLALVGQSGSGKSSVISLILRFYDPISGVILIDGRDIRGLN  1074

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALF+ TI ENI +G  NAS  EI  AAK A  H FIS +P+GY+T
Sbjct  1075  LKGLRMKMGLVQQEPALFSTTIYENIKYGKENASEIEIMNAAKAANAHGFISRMPDGYQT  1134

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ G+QLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE+ VQ+AL ++ +  TT
Sbjct  1135  HVGERGIQLSGGQKQRVAIARAILKDPAILLLDEATSALDTASERVVQEALDRLMEGRTT  1194

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             I+VAHRLSTI  A+ IAV+K G V E GSH+ L+    + +YA L+  +
Sbjct  1195  ILVAHRLSTIHNADNIAVLKHGKVVETGSHETLILRP-DSVYAQLINIQ  1242


 Score =   261 bits (666),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 190/498 (38%), Positives = 288/498 (58%), Gaps = 7/498 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +  + +R    +S+LK++  +FD +     ++   +S D++  +  +GD+    L  L
Sbjct  120   GERQAACLRLKYLQSVLKRDIDFFDREARDENIIFC-ISSDAILVQDAIGDKTGHALRYL  178

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             +   VG+ I F+  W+L+L+  A+       G  Y ++IM+   +   ++YA A   A  
Sbjct  179   AQFCVGIVIGFTTVWQLSLVILAVVPLIVIAGGGY-AIIMSTLSRKGEAAYAEAGKDAEE  237

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S +RTV +F  ++  ++ + ++L++      +   + G  +G   G ++ ++ L LW+
Sbjct  238   IISQVRTVYSFVGEDKAIEKYSRSLTKALNLGKKSGIVKGVGIGSIYGLLFCSWALLLWY  297

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
              + LV+   T+ G  +   L ++ S  ++GQ A          AA   ++ +I       
Sbjct  298   ASILVRHRDTDGGKAFSTILNVIFSGLALGQAAPSLGAIGKGRAATSNIISMIQTDS--S  355

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
             S  Q             IEF  V+F+YPSRP+  V  + S  I  G   ALVG SGSGKS
Sbjct  356   SSQQMDNGIILPDVSGKIEFSEVSFSYPSRPNK-VFEDLSFTIHAGQNFALVGQSGSGKS  414

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T+I M++RFYDP  G++L++  DL+ L LKWLR Q  LV QEPALFA +I  NI +G  +
Sbjct  415   TIISMMERFYDPTSGKILLDGHDLKSLQLKWLRKQMGLVNQEPALFAMSIAGNIMYGKVD  474

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   +I EA+K A  H FI GLP+GY T+VG+ G QLSGGQKQRI+IARA+L+  K+LLL
Sbjct  475   AEMEQIIEASKAANAHSFIQGLPDGYHTQVGEGGAQLSGGQKQRISIARAVLRNPKILLL  534

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESE  VQ AL KI  + TTI+VAHRLSTI++ N I V+K G + E G+H +
Sbjct  535   DEATSALDTESELIVQQALNKIMSERTTIIVAHRLSTIRDVNKIIVLKNGKIVESGTHIE  594

Query  169   LMASELNGIYATLVRAEQ  116
             LM+   +G YA LV  ++
Sbjct  595   LMSKGADGEYANLVNLQK  612



>ref|XP_010522857.1| PREDICTED: ABC transporter B family member 11-like [Tarenaya 
hassleriana]
Length=1284

 Score =   358 bits (919),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 229/522 (44%), Positives = 330/522 (63%), Gaps = 8/522 (2%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             ++I + LG   ++    Q  L  +AG KL  RIR+  F+ ++  E GWFD  +NS+G + 
Sbjct  760   AMIFLVLGIASVIASPAQTYLFAVAGGKLIRRIRSMCFEKVVHMEVGWFDEPQNSSGAIG  819

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+   R+++GD  S+ +   +SAA GL I+F+  W+L L+   + P      Y  
Sbjct  820   ARLSADAAMIRALVGDALSLAVQNATSAAAGLIIAFTASWQLALIILVMLPLIGINGYVQ  879

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D  + Y  AS +A  AV +IRTVA+F  +E +++ ++K    P +  +++ 
Sbjct  880   VKFLKGFSADAKTKYEEASQVANDAVGSIRTVASFCAEEKVMRMYKKQCEGPIKAGIKQG  939

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   G S   ++  Y  + + GA  V++G T +  V+++F  L +++  + Q +  A
Sbjct  940   VISGLGFGVSFFILFSVYATSFYAGARFVEDGKTTMNDVFRVFFALTMAAIGISQSSSFA  999

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRK-GRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
             PD+S A  A  ++  II+R+  I  DP  + G   E  K  DIE   ++F YP+RPD+ +
Sbjct  1000  PDSSKAKVAAASIFGIIDRKSKI--DPSHESGTVLENVKG-DIELRHISFVYPARPDIHI  1056

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
              R+  L I+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ V+L++L L+WLR Q
Sbjct  1057  FRDLCLSIRAGKTVALVGESGSGKSTVISLLQRFYDPDSGHITLDGVELKKLQLRWLRQQ  1116

Query  604   TALVGQEPALFAGTIGENIAFGF--PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
               LVGQEP LF  TI  NIA+G    NA+  EI  AA+ A  H+FIS L +GYET VG+ 
Sbjct  1117  MGLVGQEPVLFNDTIRANIAYGKGGANATEAEIVAAAELANAHRFISALQQGYETVVGER  1176

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G+QLSGGQKQR+AIARAI+K+ K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAH
Sbjct  1177  GIQLSGGQKQRVAIARAIVKEPKILLLDEATSALDAESERVVQDALDRVMVNRTTVVVAH  1236

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             RLSTIK ANVIAVVK G +AE G+HD L+  E  G+YA+LV+
Sbjct  1237  RLSTIKNANVIAVVKNGVIAEKGTHDSLIHIE-GGVYASLVQ  1277


 Score =   282 bits (721),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 203/524 (39%), Positives = 318/524 (61%), Gaps = 7/524 (1%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             + L  V LG G +     +     + G +  +RIR+   ++IL+Q+  +FD + N TG +
Sbjct  107   VCLKFVYLGLGTLAAAFLEVACWMITGERQAARIRSLYLRTILRQDIAFFDVETN-TGEV  165

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftLGASY  1325
             V R+S D+V  +  +G++    +  +S+   G  ++F   W LTL+  +      +  + 
Sbjct  166   VGRMSGDTVLIQEAMGEKVGKFIQLISTFIGGFAVAFVKGWLLTLVMLSSIPLLAMAGAA  225

Query  1324  FSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
              ++I++       ++YA+A+ +    + +IRTVA+F+ +   ++++ + +    ++SV++
Sbjct  226   IAIIVSRTSSRGQAAYAKAATVVEQTIGSIRTVASFTGERQAIRNYNEFILSAYKSSVQQ  285

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQLAG  968
                 G  LG      +G+Y L +WFG  ++ E GYT  GAV  + + +V  S S+GQ + 
Sbjct  286   GFSTGFGLGVLFLVFFGSYALAIWFGGKMILEKGYTG-GAVINVIIAVVTGSMSLGQTSP  344

Query  967   LAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVI  788
                  +   AA   + E I R+PLI S     G+  E  +  DIE + V F+YP+RPD  
Sbjct  345   CLSAFAAGQAASYKMFETIERKPLIDS-YDVNGKVLEDVRG-DIELKDVYFSYPARPDEQ  402

Query  787   VLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRS  608
             +   FSL I  GT  ALVG SGSGKST+I +I+RFYDP  G VL++ V+L++  LKW+RS
Sbjct  403   IFTGFSLFISSGTTAALVGQSGSGKSTVISLIERFYDPQAGEVLVDGVNLKDFQLKWIRS  462

Query  607   QTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
             +  LV QEP LF+ +I +NI +G   A+  EI+ AA+ A   KFI  LP+G++T VG+ G
Sbjct  463   KIGLVSQEPVLFSSSIKDNIGYGKEKATMEEIKAAAELANAAKFIDKLPQGFDTMVGEHG  522

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
              QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT+VVAHR
Sbjct  523   TQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRVMVNRTTVVVAHR  582

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             LST++ A++IAV+  G + E G+H +L+  +  G Y+ L+R ++
Sbjct  583   LSTVRNADMIAVIHHGKMVEKGTHSELL-KDPEGAYSQLIRLQE  625



>ref|XP_003549468.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score =   358 bits (918),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 222/500 (44%), Positives = 319/500 (64%), Gaps = 4/500 (1%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             L G +LT+R+R  +F +IL  E  WFD DEN+TG L + L+ D+   RS L DR S ++ 
Sbjct  747   LMGERLTARVRLLMFSAILNNEVAWFDKDENNTGSLTAMLAADATLVRSALADRLSTIVQ  806

Query  1429  GLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLD-NSSYARASNIAA  1253
              ++       I F+L W+LT +  A  P  +GAS    +   G   D   +Y+RA+++A 
Sbjct  807   NVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHAYSRATSLAR  866

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
              A++NIRTVA F  ++ +   F   L++P + ++ R  I G   G +Q   + +Y L LW
Sbjct  867   EAIANIRTVAAFGAEDRVSTQFASELNKPNKQALLRGHISGFGYGITQLLAFCSYALGLW  926

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             + + L+K+  +N G + K F++L+++S ++ +   L PD    S A+ +V  II RR  I
Sbjct  927   YASVLIKKNESNFGDIMKSFMVLIITSLAIAETLALTPDIVKGSQALGSVFGIIQRRTAI  986

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
                P     K  T    +IEF  V+F YP RPD+ + +N +L++  G  +A+VG SGSGK
Sbjct  987   --TPNDTNSKIVTDVKGEIEFRNVSFKYPMRPDITIFQNLNLRVPAGKSLAVVGQSGSGK  1044

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST+I ++ RFYDP  G VL++E D++ LNL+ LR +  LV QEPALF+ T+ ENI +G  
Sbjct  1045  STVISLVMRFYDPDSGLVLVDECDIKNLNLRSLRLRIGLVQQEPALFSTTVYENIKYGKE  1104

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
              AS  E+ +AAK A  H+FIS +PEGY+T+VG+ GVQLSGGQKQR+AIARAILK   +LL
Sbjct  1105  EASEIEVMKAAKAANAHEFISRMPEGYKTEVGERGVQLSGGQKQRVAIARAILKDPSILL  1164

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD  SE+ VQ+AL K+ +  TTI+VAHRLST+++AN IAV++ G VAE GSH+
Sbjct  1165  LDEATSALDTVSERLVQEALDKLMEGRTTILVAHRLSTVRDANSIAVLQNGRVAEMGSHE  1224

Query  172   KLMASELNGIYATLVRAEQE  113
             +LMA     IY  LV  + E
Sbjct  1225  RLMAKS-GSIYKQLVSLQHE  1243


 Score =   283 bits (723),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 203/499 (41%), Positives = 295/499 (59%), Gaps = 19/499 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    +++LK++  +FD +E     ++  +S D++  +  +GD+    +  L
Sbjct  117   GERQTARLRLKYLQAVLKKDINFFD-NEARDANIIFHISSDAILVQDAIGDKTGHAIRYL  175

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG  I F+  W+LTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  176   SQFIVGFAIGFTSVWQLTLLTLAVVPLIAVAGGAY-TIIMSTLSEKGEAAYAEAGKVAQE  234

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S +RTV +F  +E  V S+ K+L    +   +     G  +GF+ G ++ A+ L LW+
Sbjct  235   VISQVRTVYSFVGEEKAVGSYSKSLDNALKLGKKGGLAKGIGVGFTYGLLFCAWALLLWY  294

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
              + LV+   TN G  +   + ++ S F++GQ A      +   AA   ++ +I       
Sbjct  295   ASILVRNHKTNGGKAFTTIINVIFSGFALGQAAPNLGSIAKGRAAAGNIMNMI-------  347

Query  889   SDPQRKGRKFETSKPF-----DIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGAS  725
             +   R  +KF+          +IEF  V FAYPSR ++I     S  +  G  +A+VG S
Sbjct  348   ASTSRNSKKFDDGNVVPQVAGEIEFCEVCFAYPSRSNMI-FEKLSFSVSAGKTIAIVGPS  406

Query  724   GSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIA  545
             GSGKST++ +IQRFYDP  G++L++  DL+ L LKWLR Q  LV QEPALFA TI  NI 
Sbjct  407   GSGKSTIVSLIQRFYDPTSGKILLDGYDLKNLQLKWLREQMGLVSQEPALFATTIAGNIL  466

Query  544   FGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKS  365
             FG  +A   ++ +AA  A  H FI GLP+GY+T+VG+ G QLSGGQKQRIAIARA+L+  
Sbjct  467   FGKEDADMDKVIQAAMAANAHSFIQGLPDGYQTQVGEGGTQLSGGQKQRIAIARAVLRNP  526

Query  364   KVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEY  185
             KVLLLDEA+SALD ESE  VQ AL KI    TTIVVAHRLSTI++ + I V+K G V E 
Sbjct  527   KVLLLDEATSALDAESELIVQQALEKIMSNRTTIVVAHRLSTIRDVDTIVVLKNGQVVES  586

Query  184   GSHDKLMASELNGIYATLV  128
             G+H +LM++  NG Y  LV
Sbjct  587   GTHLELMSN--NGEYVNLV  603



>ref|XP_003541417.1| PREDICTED: ABC transporter B family member 1-like [Glycine max]
Length=1341

 Score =   359 bits (921),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 222/527 (42%), Positives = 334/527 (63%), Gaps = 2/527 (0%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  790   EIEKYCYLLIGLSSAALLFNTLQHSFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  849

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RLS+D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  850   SARIAARLSLDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  909

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F++++ IV  F   L  P R 
Sbjct  910   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEKKIVGLFTSNLETPLRR  969

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  970   CFWKGQISGSGYGIAQFALYASYALGLWYASWLVKHGISDFSNTIRVFMVLMVSANGAAE  1029

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                LAPD      A+ +  ++++RR  I  D          S   ++E + V F+YP+RP
Sbjct  1030  TLTLAPDFIKGGHAMRSAFDLLDRRTEIEPDDP-DATPVPDSLRGEVELKHVDFSYPTRP  1088

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V RN SL+ + G  +ALVG SG GKS++I +IQRFYDP  G+V+++  D+R+ NLK 
Sbjct  1089  DMSVFRNLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGQVMIDGKDIRKYNLKS  1148

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR   A+V QEP LFA TI ENIA+G  +AS  EI EAA  A  HKFIS LP+GY+T VG
Sbjct  1149  LRRHIAVVPQEPCLFATTIYENIAYGHDSASDAEIIEAATLANAHKFISSLPDGYKTFVG  1208

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + GVQLSGGQKQRIAIARA ++K++++LLDEA+SALD ESE+ VQ+AL +     TTI+V
Sbjct  1209  ERGVQLSGGQKQRIAIARAFVRKAELMLLDEATSALDAESERSVQEALERACSGKTTIIV  1268

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLSTI+ AN+IAV+ +G VAE GSH +L+ +  +GIYA +++ ++
Sbjct  1269  AHRLSTIRNANLIAVIDDGKVAEQGSHSQLLKNHPDGIYARMIQLQK  1315


 Score =   286 bits (731),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 200/509 (39%), Positives = 305/509 (60%), Gaps = 22/509 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++R+R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  167   GERQSTRMRIRYLEAALDQDIQFFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  225

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A NI   
Sbjct  226   ATFVSGFVVGFTAVWQLALVTLAVVPIIAVIGGIHTTTLAKLSSK-SQEALSQAGNIVEQ  284

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA-------  1091
              V  IR V  F  +   +Q +  AL        R +Q +G  +GF++G   GA       
Sbjct  285   TVVQIRVVLAFVGETRALQGYSSAL--------RIAQKIGYRIGFAKGMGLGATYFVVFC  336

Query  1090  -YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEI  914
              Y L LW+G YLV+  YTN G        +++   ++GQ A      + A  A   +  +
Sbjct  337   CYALLLWYGGYLVRHHYTNGGLAITTMFSVMIGGLALGQSAPSMAAFTKARVAAAKIFRV  396

Query  913   INRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALV  734
             I+ +P I    +  G + E+     +E   V F+YPSRP+ ++L NFSL +  G  +ALV
Sbjct  397   IDHKPGIDRKSE-SGLELESVTGL-VELRNVDFSYPSRPEFMILHNFSLNVPAGKTIALV  454

Query  733   GASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGE  554
             G+SGSGKST++ +I+RFYDP  G+VL++  D++ L  +WLR Q  LV QEPALFA TI E
Sbjct  455   GSSGSGKSTVVSLIERFYDPSSGQVLLDGHDVKSLKPRWLRQQIGLVSQEPALFATTIRE  514

Query  553   NIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAIL  374
             NI  G P+A+  EIEEAA+ A  H FI  LPEGYET+VG+ G+QLSGGQKQRIAIARA+L
Sbjct  515   NILLGRPDANQVEIEEAARVANAHSFIIKLPEGYETQVGERGLQLSGGQKQRIAIARAML  574

Query  373   KKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAV  194
             K   +LLLDEA+SALD ESEK VQDAL +     TT+V+AHRLSTI +A+++AV+++G+V
Sbjct  575   KNPAILLLDEATSALDSESEKLVQDALDRFMIGRTTLVIAHRLSTICKADLVAVLQQGSV  634

Query  193   AEYGSHDKLMASELNGIYATLVRAEQEAY  107
              E G+HD+L A   NG+YA L+R ++ A+
Sbjct  635   TEIGTHDELFAKGENGVYAKLIRMQEMAH  663



>ref|XP_003579896.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1263

 Score =   358 bits (918),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 230/529 (43%), Positives = 337/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +   IL+ + GWFD +
Sbjct  734   MERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDEE  793

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RL+ ++   +S + +R SV+L  ++S  V   + F +EWR+ +L     P 
Sbjct  794   ENNSSLVAARLATEAADVKSAIAERISVILQNMTSLMVSFVVGFIIEWRVAILILVTFPL  853

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  854   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVP  913

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQI G+  G SQ ++Y +  L LWFGA+LV+   +    V K+F++LV+++ S
Sbjct  914   QSHSLRRSQISGALYGLSQLSLYASEALILWFGAHLVRHHISTFSKVIKVFVVLVITANS  973

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  ++N R  I  DP     +   S   +IE   V FAYP
Sbjct  974   VAETVSLAPEIIRGGESIRSVFAVLNSRTRI--DPDEPETEQVESVRGEIELRHVDFAYP  1031

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV++ ++FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1032  SRPDVMIFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLN  1091

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEP LFA +I ENIA+G   A+  E+ EAAK A +H F+S LP+GY T
Sbjct  1092  LKSLRLKIGLVQQEPVLFATSILENIAYGKDGATEEEVIEAAKVANVHGFVSALPDGYRT  1151

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL +I K  T 
Sbjct  1152  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALGRIMKGRTA  1211

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH  L+ S  +G Y+ L++ +
Sbjct  1212  VLVAHRLSTIRCVDSIAVVQDGRVVEQGSHGDLV-SRPDGAYSRLLQLQ  1259


 Score =   281 bits (719),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 203/500 (41%), Positives = 299/500 (60%), Gaps = 6/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  121   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  179

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  IA  
Sbjct  180   ATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSK-SRDSYANAGIIAEQ  238

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  239   AIAQVRTVYSYVGESKALNSYSEAIQSTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  298

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I 
Sbjct  299   AGVFIRSGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIV  358

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              D    GR  +     +IEF+ V+F+YPSRPDV++ R+FSL    G   A+VG SGSGKS
Sbjct  359   QDSA-DGRCLDEVHG-NIEFKEVSFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKS  416

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG+VL++ VD++ L LKWLR Q  LV QEPALFA TI ENI +G P+
Sbjct  417   TVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTIIENILYGKPD  476

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A  H FI+ LP GY T+VG+ G+QLSGGQKQRIAIARA+LK  K+LLL
Sbjct  477   ATMAEVEAAASAANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARAMLKNPKILLL  536

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SE  VQ+AL +I    TT+VVAHRLSTI+  ++IAV+++G V E G+HD+
Sbjct  537   DEATSALDAGSESIVQEALDRIMIGRTTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDE  596

Query  169   LMASELNGIYATLVRAEQEA  110
             L+A   +G YA L+R ++ A
Sbjct  597   LLAKGSSGAYAALIRFQEMA  616



>ref|XP_010108971.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC20611.1| ABC transporter B family member 19 [Morus notabilis]
Length=1249

 Score =   358 bits (918),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 228/531 (43%), Positives = 342/531 (64%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  720   MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  779

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  780   EHNSSLVAARLATDASDVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  839

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  840   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRVP  899

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQ  G   G SQ A+Y +  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  900   QLHSLRRSQTSGLLFGLSQLALYASEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  959

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R+  I  DP     +   S   +IE   V FAYP
Sbjct  960   VAETVSLAPEIIRGGEAVGSVFSILDRQTKI--DPDDPDAEPVESIRGEIELRHVDFAYP  1017

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++ SL+I+ G   ALVGASGSGKS++I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1018  SRPDVMVFKDLSLRIRAGQSQALVGASGSGKSSVIALIERFYDPVVGKVMIDGKDIRRLN  1077

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I +NIA+G   A+ TE+ EAA+ A +H F+SGLP+GY+T
Sbjct  1078  LKSLRLKMGLVQQEPALFAASIFDNIAYGKEGATETEVIEAARAANVHGFVSGLPDGYKT  1137

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1138  PVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTT  1197

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + I VV++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1198  VLVAHRLSTIRGVDTIGVVQDGRIVEQGSHSELV-SRPEGAYSRLLQLQHH  1247


 Score =   293 bits (751),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 209/528 (40%), Positives = 304/528 (58%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG    V+   +       G +    +R    +++LKQ+ G+FD D   
Sbjct  79    EVSKYSLYFVYLGLVVCVSSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVGFFDTDAR-  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  198   AGGLYAYTLTGLTSK-SRQSYANAGVIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLK  256

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G ++ G  +      ++   S+G
Sbjct  257   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTAIFSAIVGGMSLG  316

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN++P I  D        E +   +IEF+ VTF+YPSR
Sbjct  317   QSFSNLGAFSKGKAAGDKLMEIINQKPSITQDASDAKCLAEVNG--NIEFKDVTFSYPSR  374

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV + RNFS+    G  VA+VG SGSGKST++ +I+RFYDP QG+VL++ VD++ L LK
Sbjct  375   PDVFIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLK  434

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E A   A  H FI+ LP GY T+V
Sbjct  435   WLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQV  494

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  495   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVV  554

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + IAV+++G V E G+H++L+A    G YA+L+R ++
Sbjct  555   VAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKP--GAYASLIRFQE  600



>ref|XP_009347047.1| PREDICTED: ABC transporter B family member 19 [Pyrus x bretschneideri]
Length=1250

 Score =   358 bits (918),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 226/531 (43%), Positives = 345/531 (65%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    + VG+G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  721   MERKTKEYVFMYVGVGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  780

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ +L ++L+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  781   EHNSNLLTAKLATDAADVKSAVSERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  840

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  ++  F   L  P
Sbjct  841   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKVLSLFCHELRLP  900

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
                S+RRSQ  G   G SQ A++ +  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  901   LLGSLRRSQTAGVLFGISQFALHASEALILWYGAHLVSKGVSTFSKVIKVFIVLVVTANS  960

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R+  I  DP     +   S   +IE   V FAYP
Sbjct  961   VAETVSLAPEIIRGGEAVGSVFSILDRQTRI--DPDDPEAEVVESVRGEIELRHVDFAYP  1018

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPD++V ++FSL+I+ G   ALVGASGSGKS++I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1019  SRPDIMVFKDFSLRIRTGHSQALVGASGSGKSSVIALIERFYDPLVGKVMIDGKDIRRLN  1078

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I ENIA+G   A+  E+ EAA+ A +H F+SGLP+GY+T
Sbjct  1079  LKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYKT  1138

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK  ++LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1139  PVGERGVQLSGGQKQRIAIARAVLKDPRILLLDEATSALDAESECVLQEALERLMRGRTT  1198

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + I VV++G + E+GSH +L+ S  +G Y+ L++ +  
Sbjct  1199  VLVAHRLSTIRGVDSIGVVQDGRIVEHGSHSELV-SRPDGAYSRLLQLQNH  1248


 Score =   294 bits (752),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 209/523 (40%), Positives = 307/523 (59%), Gaps = 8/523 (2%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L  V LG    VT   +       G +  S +R    +++LKQ+ G+FD D   TG +V
Sbjct  85    ALYFVYLGLIVCVTSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDAR-TGDIV  143

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLGASY  1325
               +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+       G  Y
Sbjct  144   FSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIVFAGGLY  203

Query  1324  FSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
                +  +  K    SYA A  +A  A++ +RTV ++  +   + S+  A+    +   + 
Sbjct  204   AYTLTGLTSK-SRQSYANAGIVADQAIAQVRTVYSYVGESKALNSYSDAIQNTLQLGYKA  262

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
                 G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+GQ    
Sbjct  263   GMAKGLGLGCTYGIACMSWALVYWYAGVFIRNGQTDGGKAFTAIFSAIVGGISLGQSFSN  322

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
                 S   +A   ++EII ++P I  DP     K  +    +IEF+ VTF+YPSRPDVI+
Sbjct  323   LGAFSKGKSAGYKLMEIIKQKPTIVQDPLEG--KCLSDVSGNIEFKEVTFSYPSRPDVII  380

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
              RNFS+    G  VA+VG SGSGKST++ +I+RFYDP QG+VL++ VD++ L LKWLR Q
Sbjct  381   FRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIKTLQLKWLRDQ  440

Query  604   TALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
               LV QEPALFA TI ENI +G P+A+  ++E AA  A  H FI+ LP+GY T+VG+ GV
Sbjct  441   IGLVNQEPALFATTILENILYGKPDATMEDVEVAASSANAHSFITLLPKGYNTQVGERGV  500

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT++VAHRL
Sbjct  501   QLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVIVAHRL  560

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             STI+  + IAV+++G V E G+H++L+A    G YA+L+R ++
Sbjct  561   STIRNVDSIAVIQQGQVVETGTHEELIAKA--GAYASLIRFQE  601



>dbj|BAF02132.1| putative ABC transporter [Arabidopsis thaliana]
Length=804

 Score =   349 bits (895),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 217/535 (41%), Positives = 333/535 (62%), Gaps = 18/535 (3%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    +V    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  257   QIDKYCYLLIGLSSAALVFNTLQHSFWDIVGENLTKRVREKMLSAVLKNEMAWFDQEENE  316

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  317   SARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  376

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+ + +A  A++N+RTVA F+++  IV+ +   L  P + 
Sbjct  377   ATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPLKR  436

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q  +Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  437   CFWKGQIAGSGYGVAQFCLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  496

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQR-KGRKFETSKPFDIEFEMV  821
                LAPD      A+ +V E+++R+  I  D       P R +G         ++E + +
Sbjct  497   TLTLAPDFIKGGQAMRSVFELLDRKTEIEPDDPDTTPVPDRLRG---------EVELKHI  547

Query  820   TFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVD  641
              F+YPSRPD+ + R+ SL+ + G  +ALVG SG GKS++I +IQRFY+P  GRV+++  D
Sbjct  548   DFSYPSRPDIQIFRDLSLRARAGKTLALVGPSGCGKSSVISLIQRFYEPSSGRVMIDGKD  607

Query  640   LRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLP  461
             +R+ NLK +R   A+V QEP LF  TI ENIA+G   A+  EI +AA  A  HKFIS LP
Sbjct  608   IRKYNLKAIRKHIAIVPQEPCLFGTTIYENIAYGHECATEAEIIQAATLASAHKFISALP  667

Query  460   EGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKIS  281
             EGY+T VG+ GVQLSGGQKQRIAIARA+++K++++LLDEA+SALD ESE+ VQ+AL +  
Sbjct  668   EGYKTYVGERGVQLSGGQKQRIAIARALVRKAEIMLLDEATSALDAESERSVQEALDQAC  727

Query  280   KQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
                T+IVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +GIYA +++ ++
Sbjct  728   SGRTSIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNHPDGIYARMIQLQR  782


 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  493  AYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesE  314
            A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE
Sbjct  1    ANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESE  60

Query  313  KHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYAT  134
            K VQ+AL +     TT+++AHRLSTI++A+++AV+++G+V+E G+HD+L +   NG+YA 
Sbjct  61   KLVQEALDRFMIGRTTLIIAHRLSTIRKADLVAVLQQGSVSEIGTHDELFSKGENGVYAK  120

Query  133  LVRAEQEAYAFA  98
            L++ ++ A+  A
Sbjct  121  LIKMQEAAHETA  132



>ref|XP_004164800.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Cucumis sativus]
Length=1248

 Score =   357 bits (917),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 224/528 (42%), Positives = 324/528 (61%), Gaps = 4/528 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +  +++ + VG+    I   + Q     L G +LT+R+R  LF +IL  E GWFDFDEN+
Sbjct  717   EVHHVAFMFVGVAIFTIPIYLLQHYFYTLMGERLTARVRLLLFSAILSNEVGWFDFDENN  776

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             TG L S L+ ++   RS L DR S ++  ++       I+F   WRL  +  A  P  +G
Sbjct  777   TGALTSILASNATLVRSALADRISTIVQNVALTVSAFVIAFIFSWRLAAVVVASLPLLIG  836

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             AS    +   G   D   +Y RA+ +A  A++NIRTVA F  +E I   F   L++P + 
Sbjct  837   ASITEQLFLKGFGGDYGQAYNRATAVAHEAIANIRTVAAFGAEEKISSQFAFELNKPNKQ  896

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +  R  + G   G SQ   + +Y L LW+ + L+K  ++N G + K F++L+++S ++ +
Sbjct  897   AFLRGHVAGFGYGISQFFAFCSYALGLWYASTLIKHRHSNFGDIMKSFMVLIITSLAIAE  956

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                L PD    S A+ +V  I++R+ +I  D      +  T+   DIEF  V+F YP+RP
Sbjct  957   TLALTPDIVKGSQALGSVFNILHRKTII--DSNNPSAEMVTNIIGDIEFNNVSFKYPARP  1014

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V  + +L++  G  +A+VG SGSGKST+I ++ RFYDPI G +L++  D++ LNL+ 
Sbjct  1015  DITVFEDLNLRVSAGKSLAVVGQSGSGKSTVIALVMRFYDPISGTILIDGRDIKSLNLRS  1074

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR +  LV QEPALF+ TI ENI +G   AS  E+ +AAK A  H FIS +P  Y+T VG
Sbjct  1075  LRMKIGLVQQEPALFSTTIYENIKYGNQEASEIEVMKAAKAANAHGFISRMPNSYQTHVG  1134

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
               GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE+ VQ+AL ++ +  TTI+V
Sbjct  1135  DRGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDAASERQVQEALDRLMEGRTTILV  1194

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             AHRL+TI++AN IAV+K G V E GSHD L+ +  + IY  LV  + E
Sbjct  1195  AHRLTTIRDANRIAVLKSGRVVEIGSHDSLLKNP-HSIYKQLVNLQHE  1241


 Score =   263 bits (671),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 202/498 (41%), Positives = 290/498 (58%), Gaps = 19/498 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R     SILK++  +FD +     ++   +S D V  +  +GD+    +   
Sbjct  115   GERQTARLRMKYLNSILKKDINFFDTEAKDFNIMF-HISSDMVLVQDAIGDKTGHAMRYF  173

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG  I F+  W+LTLL  A+       G +Y ++IM+   +   ++YA+A   A  
Sbjct  174   SQFIVGFAIGFTSVWKLTLLTLAIVPLVAIAGVAY-TVIMSTLSQKGEAAYAQAGKTAEE  232

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              ++ IRTV ++  +   ++ + ++L    +   R     G  +GF+   ++ A+ L LW+
Sbjct  233   VIAQIRTVYSYVGESKALEKYSESLQNALKLGKRSGFAKGFGVGFTYSLLFCAWALLLWY  292

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ-LAGLAPDTSMASAAIPAVLEIINRRPLI  893
              + LV    TN G  +   + ++ S F++GQ +  LA   ++A   + A     N   +I
Sbjct  293   ASILVLHHETNGGKAFTTIINVIFSGFALGQAMPNLA---AIAKGRVAAA----NIFSMI  345

Query  892   GSDPQRKGRKFE----TSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGAS  725
              +D +   R       +S    IEF  V+FAYPSRP +I     S  I  G  VA+VG S
Sbjct  346   DADYESSSRSNNGVALSSVAGKIEFSEVSFAYPSRPQLI-FDKLSFSISAGRTVAVVGPS  404

Query  724   GSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIA  545
             GSGKST++ M+QRFY+P  G++L++  DLR L LKWLR Q  LV QEPALF  TI  NI 
Sbjct  405   GSGKSTIVSMVQRFYEPSSGKILLDGHDLRTLELKWLRRQMGLVSQEPALFNTTIAANIL  464

Query  544   FGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKS  365
             FG  NA+  EI  AA+ A  H FI  LP+GY T+VG+ G+QLSGGQKQRIAIARA+L+  
Sbjct  465   FGQENATMDEIIAAAEVANAHSFIQELPDGYSTQVGERGIQLSGGQKQRIAIARAVLRNP  524

Query  364   KVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEY  185
             K+LLLDEA+SALD ESE  VQ AL +I    TTI++AHRLSTI+EA+ I V+K G + E 
Sbjct  525   KILLLDEATSALDSESELIVQQALVRIMLNRTTIIIAHRLSTIQEADTIFVLKNGQIVES  584

Query  184   GSHDKLMASELNGIYATL  131
             G+H +LM+   NG YA L
Sbjct  585   GNHSELMSK--NGEYAAL  600



>ref|XP_007204682.1| hypothetical protein PRUPE_ppa000269mg [Prunus persica]
 gb|EMJ05881.1| hypothetical protein PRUPE_ppa000269mg [Prunus persica]
Length=1371

 Score =   359 bits (921),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 225/535 (42%), Positives = 335/535 (63%), Gaps = 18/535 (3%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  818   QINKYCYLLIGLSSAALLFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  877

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  878   SARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPVVVA  937

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D   ++A+A+ +A  A++N+RTVA F+++  IV  F   L  P R 
Sbjct  938   ATVLQKMFMTGFSGDLEGAHAKATQLAGEAIANVRTVAAFNSEGKIVGLFSSNLQIPLRR  997

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+YG+Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  998   CFWKGQIAGSGFGIAQFALYGSYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1057

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQR-KGRKFETSKPFDIEFEMV  821
                LAPD      A+ +V ++++R+  I  D       P R +G         ++E + V
Sbjct  1058  TLTLAPDFIKGGRAMRSVFDLLDRKTEIEPDDPDATVVPDRLRG---------EVELKHV  1108

Query  820   TFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVD  641
              F+YP+RPDV V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D
Sbjct  1109  DFSYPTRPDVPVFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMVDGKD  1168

Query  640   LRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLP  461
             +R+ NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP
Sbjct  1169  IRKYNLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAANMANAHKFISALP  1228

Query  460   EGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKIS  281
             EGY+T VG+ GVQLSGGQKQR+AIARA+L+K++++LLDEA+SALD ESE+ +Q+AL +  
Sbjct  1229  EGYKTFVGERGVQLSGGQKQRVAIARALLRKAELMLLDEATSALDAESERSIQEALDRAC  1288

Query  280   KQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
                TTIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1289  SGKTTIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1343


 Score =   280 bits (717),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 192/504 (38%), Positives = 308/504 (61%), Gaps = 6/504 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  195   GERQSTKMRIKYLEAALNQDIQYFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  253

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA + + +  +  K    + ++A +    
Sbjct  254   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAIHTTTLGKLSGK-SQEALSQAGHTVEQ  312

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V  IR V +F  +   +Q++  AL   +R   +     G  LG +   ++  Y L LW+
Sbjct  313   TVVQIRVVLSFVGESRALQTYSSALKVAQRLGYKSGFAKGMGLGATYFVVFCCYALLLWY  372

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  +TN G        +++   ++GQ A      + A  A   + +II+ +P + 
Sbjct  373   GGYLVRHHFTNGGLAIATMFAVMIGGLALGQSAPSMGAFAKAKVAAGKIFKIIDHKPGMD  432

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              + +  G + E+     +E + V FAYPSR DV +L NFSL +  G  +ALVG+SGSGKS
Sbjct  433   RNSE-AGLELESVTGL-VELKNVDFAYPSRQDVRILNNFSLNVPAGKTIALVGSSGSGKS  490

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEPALFA TI ENI  G P+
Sbjct  491   TVVSLIERFYDPSSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTIKENILLGRPD  550

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEAA+ A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  551   ADQVEIEEAARVANAHSFIVKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  610

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G V+E G+HD+
Sbjct  611   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGTVSEIGAHDE  670

Query  169   LMASELNGIYATLVRAEQEAYAFA  98
             L++   NG+YA L+R ++ A+  A
Sbjct  671   LISKGENGVYAKLIRMQEMAHETA  694



>gb|KGN60047.1| hypothetical protein Csa_3G873270 [Cucumis sativus]
Length=1248

 Score =   357 bits (917),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 224/528 (42%), Positives = 324/528 (61%), Gaps = 4/528 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +  +++ + VG+    I   + Q     L G +LT+R+R  LF +IL  E GWFDFDEN+
Sbjct  717   EVHHVAFMFVGVAIFTIPIYLLQHYFYTLMGERLTARVRLLLFSAILSNEVGWFDFDENN  776

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             TG L S L+ ++   RS L DR S ++  ++       I+F   WRL  +  A  P  +G
Sbjct  777   TGALTSILASNATLVRSALADRISTIVQNVALTVSAFVIAFIFSWRLAAVVVASLPLLIG  836

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             AS    +   G   D   +Y RA+ +A  A++NIRTVA F  +E I   F   L++P + 
Sbjct  837   ASITEQLFLKGFGGDYGQAYNRATAVAHEAIANIRTVAAFGAEEKISSQFAFELNKPNKQ  896

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +  R  + G   G SQ   + +Y L LW+ + L+K  ++N G + K F++L+++S ++ +
Sbjct  897   AFLRGHVAGFGYGISQFFAFCSYALGLWYASTLIKHRHSNFGDIMKSFMVLIITSLAIAE  956

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                L PD    S A+ +V  I++R+ +I  D      +  T+   DIEF  V+F YP+RP
Sbjct  957   TLALTPDIVKGSQALGSVFNILHRKTII--DSNNPSAEMVTNIIGDIEFNNVSFKYPARP  1014

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V  + +L++  G  +A+VG SGSGKST+I ++ RFYDPI G +L++  D++ LNL+ 
Sbjct  1015  DITVFEDLNLRVSAGKSLAVVGQSGSGKSTVIALVMRFYDPISGTILIDGRDIKSLNLRS  1074

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR +  LV QEPALF+ TI ENI +G   AS  E+ +AAK A  H FIS +P  Y+T VG
Sbjct  1075  LRMKIGLVQQEPALFSTTIYENIKYGNQEASEIEVMKAAKAANAHGFISRMPNSYQTHVG  1134

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
               GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE+ VQ+AL ++ +  TTI+V
Sbjct  1135  DRGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDAASERQVQEALDRLMEGRTTILV  1194

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             AHRL+TI++AN IAV+K G V E GSHD L+ +  + IY  LV  + E
Sbjct  1195  AHRLTTIRDANRIAVLKSGRVVEIGSHDSLLKNP-HSIYKQLVNLQHE  1241


 Score =   263 bits (671),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 202/498 (41%), Positives = 290/498 (58%), Gaps = 19/498 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R     SILK++  +FD +     ++   +S D V  +  +GD+    +   
Sbjct  115   GERQTARLRMKYLNSILKKDINFFDTEAKDFNIMF-HISSDMVLVQDAIGDKTGHAMRYF  173

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG  I F+  W+LTLL  A+       G +Y ++IM+   +   ++YA+A   A  
Sbjct  174   SQFIVGFAIGFTSVWKLTLLTLAIVPLVAIAGVAY-TVIMSTLSQKGEAAYAQAGKTAEE  232

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              ++ IRTV ++  +   ++ + ++L    +   R     G  +GF+   ++ A+ L LW+
Sbjct  233   VIAQIRTVYSYVGESKALEKYSESLQNALKLGKRSGFAKGFGVGFTYSLLFCAWALLLWY  292

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ-LAGLAPDTSMASAAIPAVLEIINRRPLI  893
              + LV    TN G  +   + ++ S F++GQ +  LA   ++A   + A     N   +I
Sbjct  293   ASILVLHHETNGGKAFTTIINVIFSGFALGQAMPNLA---AIAKGRVAAA----NIFSMI  345

Query  892   GSDPQRKGRKFE----TSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGAS  725
              +D +   R       +S    IEF  V+FAYPSRP +I     S  I  G  VA+VG S
Sbjct  346   DADYESSSRSNNGVALSSVAGKIEFSEVSFAYPSRPQLI-FDKLSFSISAGRTVAVVGPS  404

Query  724   GSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIA  545
             GSGKST++ M+QRFY+P  G++L++  DLR L LKWLR Q  LV QEPALF  TI  NI 
Sbjct  405   GSGKSTIVSMVQRFYEPSSGKILLDGHDLRTLELKWLRRQMGLVSQEPALFNTTIAANIL  464

Query  544   FGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKS  365
             FG  NA+  EI  AA+ A  H FI  LP+GY T+VG+ G+QLSGGQKQRIAIARA+L+  
Sbjct  465   FGQENATMDEIIAAAEVANAHSFIQELPDGYSTQVGERGIQLSGGQKQRIAIARAVLRNP  524

Query  364   KVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEY  185
             K+LLLDEA+SALD ESE  VQ AL +I    TTI++AHRLSTI+EA+ I V+K G + E 
Sbjct  525   KILLLDEATSALDSESELIVQQALVRIMLNRTTIIIAHRLSTIQEADTIFVLKNGQIVES  584

Query  184   GSHDKLMASELNGIYATL  131
             G+H +LM+   NG YA L
Sbjct  585   GNHSELMSK--NGEYAAL  600



>ref|XP_007162774.1| hypothetical protein PHAVU_001G179300g [Phaseolus vulgaris]
 gb|ESW34768.1| hypothetical protein PHAVU_001G179300g [Phaseolus vulgaris]
Length=1338

 Score =   358 bits (919),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 219/527 (42%), Positives = 335/527 (64%), Gaps = 2/527 (0%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  787   EIEKYCYLLIGLSSTALLFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  846

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  847   SARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPIVVA  906

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F   L  P + 
Sbjct  907   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSETKIVGLFTSNLQAPLKR  966

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  967   CFWKGQISGSGYGVAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1026

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                LAPD      A+ +V E+++RR  I  D Q     F      ++E + V F YP+RP
Sbjct  1027  TLTLAPDFIKGGRAMRSVFELLDRRTEIEPDDQ-DATPFPDRLRGEVELKHVDFVYPTRP  1085

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D+R+ NLK 
Sbjct  1086  DMPVFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKDIRKYNLKS  1145

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR   ++V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP+GY+T VG
Sbjct  1146  LRRHISVVPQEPCLFATTIYENIAYGHESATEAEIIEAATLANAHKFISALPDGYKTFVG  1205

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + GVQLSGGQKQRIA+ARA ++K++++LLDEA+SALD ESE+ VQ+AL + S   TTI+V
Sbjct  1206  ERGVQLSGGQKQRIAVARAFVRKAELMLLDEATSALDAESERSVQEALDRASSGKTTIIV  1265

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLSTI+ A++IAV+ +G VAE GSH +L+ +  +GIY+ +++ ++
Sbjct  1266  AHRLSTIRNAHLIAVIDDGKVAEQGSHSQLLKNHPDGIYSRMIQLQR  1312


 Score =   290 bits (742),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 203/513 (40%), Positives = 311/513 (61%), Gaps = 22/513 (4%)
 Frame = -1

Query  1606  AGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMG  1427
             +G + ++R+R    ++ L Q+  +FD D  ++ V+ + ++ D+V  +  + ++    +  
Sbjct  163   SGERQSTRMRIKYLEAALNQDIQFFDTDVRTSDVVFA-INTDAVMVQDAISEKLGNFIHY  221

Query  1426  LSSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
             +++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A NI  
Sbjct  222   MATFVSGFVVGFTAVWQLALVTLAVVPMIAVIGGIHTTTLAKLSGK-SQEALSQAGNIVE  280

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA------  1091
               V+ IR V  F  +   +Q++  AL        R SQ LG   GF++G   GA      
Sbjct  281   QTVAQIRVVLAFVGESRALQAYSSAL--------RVSQKLGYKTGFAKGMGLGATYFVVF  332

Query  1090  --YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLE  917
               Y L LW+G YLV+   TN G        +++    +GQ A      + A  A   +  
Sbjct  333   CCYALLLWYGGYLVRHHATNGGLAIATMFAVMIGGLGLGQSAPSMAAFTKARVAAAKIFR  392

Query  916   IINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVAL  737
             II+ +P I  + +  G + ET     +E + V F+YPSRP+V +L +FSL +  G  +AL
Sbjct  393   IIDHKPSIDRNSE-SGIELETVTGL-VELKNVDFSYPSRPEVRILNDFSLNVPAGKTIAL  450

Query  736   VGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIG  557
             VG+SGSGKST++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEPALFA TI 
Sbjct  451   VGSSGSGKSTVVSLIERFYDPSSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTIR  510

Query  556   ENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAI  377
             ENI  G P+A+  EIEEAA+ A  H FI  LPEGYET+VG+ G+QLSGGQKQRIAIARA+
Sbjct  511   ENILLGRPDANQVEIEEAARVANAHSFIIKLPEGYETQVGERGLQLSGGQKQRIAIARAM  570

Query  376   LKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGA  197
             LK   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+
Sbjct  571   LKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGS  630

Query  196   VAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             V+E G+HD+L +   NG+YA L++ ++ A+  A
Sbjct  631   VSEIGTHDELFSKGDNGVYAKLIKMQEMAHETA  663



>ref|XP_003520656.1| PREDICTED: ABC transporter B family member 1-like [Glycine max]
Length=1342

 Score =   358 bits (919),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 221/527 (42%), Positives = 338/527 (64%), Gaps = 2/527 (0%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  791   EIEKYCYLLIGLSSTALLFNTLQHFFWDIVGENLTKRVREKMLMAVLKNEMAWFDQEENE  850

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  851   SARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  910

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F   L  P + 
Sbjct  911   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSETKIVGLFTTNLQAPLQR  970

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  971   CFWKGQISGSGYGVAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1030

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                LAPD      A+ +V E+++RR  I  D Q      +  +  ++E + V F+YP+RP
Sbjct  1031  TLTLAPDFIKGGQAMRSVFELLDRRTEIEPDDQDATLVPDRLRG-EVELKHVDFSYPTRP  1089

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D+R+ NLK 
Sbjct  1090  DMPVFRDLSLRARAGKTLALVGPSGCGKSSIIALIQRFYDPTSGRVMIDGKDIRKYNLKS  1149

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR   ++V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFISGLP+GY+T VG
Sbjct  1150  LRRHISVVPQEPCLFATTIYENIAYGHESATEAEIIEAATLANAHKFISGLPDGYKTFVG  1209

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + GVQLSGGQKQRIA+ARA L+K++++LLDEA+SALD ESE+ VQ+AL + S   TTI+V
Sbjct  1210  ERGVQLSGGQKQRIAVARAFLRKAELMLLDEATSALDAESERSVQEALDRASSGKTTIIV  1269

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLST++ AN+IAV+ +G VAE GSH +L+ +  +GIYA +++ ++
Sbjct  1270  AHRLSTVRNANLIAVIDDGKVAEQGSHSQLLKNHPDGIYARMIQLQR  1316


 Score =   279 bits (714),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 193/505 (38%), Positives = 305/505 (60%), Gaps = 6/505 (1%)
 Frame = -1

Query  1606  AGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMG  1427
             +G + ++ +R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  
Sbjct  167   SGERQSTTMRIKYLEAALNQDIQFFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHY  225

Query  1426  LSSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
             +++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A NI  
Sbjct  226   MATFVSGFVVGFTAVWQLALVTLAVVPMIAVIGGIHTATLAKLSGK-SQEALSQAGNIVE  284

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
               V+ IR V  F  +   +QS+  AL   ++   +     G  LG +   ++  Y L LW
Sbjct  285   QTVAQIRVVLAFVGESRALQSYSSALRIAQKIGYKTGFAKGMGLGATYFVVFCCYALLLW  344

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             +G YLV+   TN G        +++    +GQ A      + A  A   +  II+ +P I
Sbjct  345   YGGYLVRHHATNGGLAIATMFAVMIGGLGLGQSAPSMAAFTKARVAAAKIFRIIDHKPNI  404

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
               + +  G + +T     +E + V F+YPSRP+V +L +FSL +  G  +ALVG+SGSGK
Sbjct  405   DRNSE-SGIELDTVTGL-VELKNVDFSYPSRPEVQILNDFSLNVPAGKTIALVGSSGSGK  462

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEPALFA TI ENI  G P
Sbjct  463   STVVSLIERFYDPTSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTIRENILLGRP  522

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
             +A   EIEEAA+ A  H FI  LP+GYET+VG+ G+QLSGGQKQRIAIARA+LK   +LL
Sbjct  523   DADQVEIEEAARVANAHSFIIKLPDGYETQVGERGLQLSGGQKQRIAIARAMLKNPAILL  582

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV++ G+V+E G+HD
Sbjct  583   LDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQLGSVSEIGTHD  642

Query  172   KLMASELNGIYATLVRAEQEAYAFA  98
             +L +   NG+YA L++ ++ A+  A
Sbjct  643   ELFSKGENGVYAKLIKMQEMAHETA  667



>gb|KHN09525.1| ABC transporter B family member 1 [Glycine soja]
Length=1342

 Score =   358 bits (919),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 221/527 (42%), Positives = 338/527 (64%), Gaps = 2/527 (0%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  791   EIEKYCYLLIGLSSTALLFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  850

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  851   SARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  910

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F   L  P + 
Sbjct  911   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSETKIVGLFTTNLQAPLQR  970

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  971   CFWKGQISGSGYGVAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1030

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                LAPD      A+ +V E+++RR  I  D Q      +  +  ++E + V F+YP+RP
Sbjct  1031  TLTLAPDFIKGGQAMRSVFELLDRRTEIEPDDQDATLVPDRLRG-EVELKHVDFSYPTRP  1089

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D+R+ NLK 
Sbjct  1090  DMPVFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKDIRKYNLKS  1149

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR   ++V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFISGLP+GY+T VG
Sbjct  1150  LRRHISVVPQEPCLFATTIYENIAYGHESATEAEIIEAATLANAHKFISGLPDGYKTFVG  1209

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + GVQLSGGQKQRIA+ARA L+K++++LLDEA+SALD ESE+ VQ+AL + S   TTI+V
Sbjct  1210  ERGVQLSGGQKQRIAVARAFLRKAELMLLDEATSALDAESERSVQEALDRASSGKTTIIV  1269

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLST++ AN+IAV+ +G VAE GSH +L+ +  +GIYA +++ ++
Sbjct  1270  AHRLSTVRNANLIAVIDDGKVAEQGSHSQLLKNHPDGIYARMIQLQR  1316


 Score =   279 bits (714),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 193/505 (38%), Positives = 305/505 (60%), Gaps = 6/505 (1%)
 Frame = -1

Query  1606  AGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMG  1427
             +G + ++ +R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  
Sbjct  167   SGERQSTTMRIKYLEAALNQDIQFFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHY  225

Query  1426  LSSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
             +++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A NI  
Sbjct  226   MATFVSGFVVGFTAVWQLALVTLAVVPMIAVIGGIHTATLAKLSGK-SQEALSQAGNIVE  284

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
               V+ IR V  F  +   +QS+  AL   ++   +     G  LG +   ++  Y L LW
Sbjct  285   QTVAQIRVVLAFVGESRALQSYSSALRIAQKIGYKTGFAKGMGLGATYFVVFCCYALLLW  344

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             +G YLV+   TN G        +++    +GQ A      + A  A   +  II+ +P I
Sbjct  345   YGGYLVRHHATNGGLAIATMFAVMIGGLGLGQSAPSMAAFTKARVAAAKIFRIIDHKPNI  404

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
               + +  G + +T     +E + V F+YPSRP+V +L +FSL +  G  +ALVG+SGSGK
Sbjct  405   DRNSE-SGIELDTVTGL-VELKNVDFSYPSRPEVQILNDFSLNVPAGKTIALVGSSGSGK  462

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEPALFA TI ENI  G P
Sbjct  463   STVVSLIERFYDPTSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTIRENILLGRP  522

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
             +A   EIEEAA+ A  H FI  LP+GYET+VG+ G+QLSGGQKQRIAIARA+LK   +LL
Sbjct  523   DADQVEIEEAARVANAHSFIIKLPDGYETQVGERGLQLSGGQKQRIAIARAMLKNPAILL  582

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV++ G+V+E G+HD
Sbjct  583   LDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQLGSVSEIGTHD  642

Query  172   KLMASELNGIYATLVRAEQEAYAFA  98
             +L +   NG+YA L++ ++ A+  A
Sbjct  643   ELFSKGENGVYAKLIKMQEMAHETA  667



>ref|XP_007225446.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
 gb|EMJ26645.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
Length=1244

 Score =   357 bits (915),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 224/531 (42%), Positives = 330/531 (62%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + + ++LI VG+    +   + Q     L G +LT+R+R  +F ++L  E GWFD D
Sbjct  711   IKQEVKKVALIFVGVAVATVPIYLLQHYFYTLMGERLTTRVRLLMFTAMLSNEVGWFDLD  770

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN+TG L S L+ ++   RS L DR S ++  L+  A    I+F+L WR+  +  A  P 
Sbjct  771   ENNTGALTSILAANATLVRSALADRLSTIVQNLALTATAFVIAFTLSWRIAAVVIASLPL  830

Query  1342  tLGASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              +GAS    +   G   D N +Y++A+ +A  A++NIRTVA F  +E I   F   L++P
Sbjct  831   LIGASIAEQLFLKGFGGDYNRAYSKATAVAREAIANIRTVAAFGCEERIAMQFASELNQP  890

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
              + +V R  I G   G SQ   + +Y L LW+ + L+K   +N G + K F++L++++ S
Sbjct  891   NKQAVIRGHISGFCYGLSQFFAFCSYALGLWYASILIKHKDSNFGDIMKSFMVLIITALS  950

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             + +   L PD    S A+  +  I+ R   I  +  +     +     DIEF  V+F YP
Sbjct  951   IAETLALTPDIVKGSQALGPIFRILKRETAINLNAPKSNVVADVKG--DIEFRNVSFWYP  1008

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPD+ +  N +L++  G  +A+VG SGSGKS++I ++ RFYDPI G V+++  D++ LN
Sbjct  1009  ARPDITIFDNLNLRVSAGKSLAVVGPSGSGKSSVIALVMRFYDPISGTVVIDGYDIKSLN  1068

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR + +LV QEPALF+ T+ ENI +G   AS  E+  AAK A    FIS +PEGY+T
Sbjct  1069  LKSLRKKISLVQQEPALFSTTVYENIKYGNEEASDVEVITAAKAANADGFISRMPEGYKT  1128

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
             +VG+ GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD ESEK VQ+AL K+ +  TT
Sbjct  1129  QVGEKGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTESEKLVQEALDKLMEGRTT  1188

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             I+VAHRLSTI++AN IA+++ G V E GSH++L+      +Y  LV  +QE
Sbjct  1189  ILVAHRLSTIRDANRIALLQNGRVVEMGSHEQLIGRP-GSLYKQLVSLQQE  1238


 Score =   280 bits (716),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 208/505 (41%), Positives = 298/505 (59%), Gaps = 31/505 (6%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    +S+LKQ+  +FD +   T ++   +S D++  +  +GD+    L  L
Sbjct  122   GERQTARLRLKYLQSVLKQDINFFDTEARDTNIIF-HISSDAILVQDAIGDKTGHALRYL  180

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG GI F+  WRLTLL  A+       G +Y ++IM+   +   ++YA A  +A  
Sbjct  181   SQFIVGFGIGFTSVWRLTLLTLAVVPLIAIAGGAY-TIIMSTLSEKGEAAYAEAGKVAEE  239

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +S IRTV +F  ++  ++++  +L++  +   +     G  +GF+ G ++ A+ L LW+
Sbjct  240   VISQIRTVYSFGGEDRAIEAYSNSLNKALKLGKKGGFAKGVGVGFTYGLLFCAWALLLWY  299

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                LV+   TN G  +   + ++ S F++GQ A      +   AA   ++++I      G
Sbjct  300   AGILVRHHDTNGGKAFTTIINVIFSGFALGQAAPNLAAIAKGRAAAANIMKMIE----TG  355

Query  889   SD-----------PQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMV  743
             S+           P+  G+         I+F  V F YPSRP+  VL N S  I  G   
Sbjct  356   SNSSKVSDNGIVLPKVSGQ---------IDFCEVGFGYPSRPNR-VLENLSFSIGAGKTF  405

Query  742   ALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGT  563
             A+VG SGSGKST+I MIQRFY+PI G++L++  D+  L LKWLR Q  LV QEPALFA T
Sbjct  406   AVVGPSGSGKSTIISMIQRFYNPISGKILLDGHDVGILQLKWLREQMGLVNQEPALFATT  465

Query  562   IGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIAR  383
             I  NI FG  +A   +I EAAK A  H FI GLP+GY T+ G+ G QLSGGQKQRIAIAR
Sbjct  466   IAGNILFGKEDADMDQIIEAAKAANAHSFIQGLPDGYYTQAGEGGTQLSGGQKQRIAIAR  525

Query  382   AILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKE  203
             A+L+  K+LLLDEA+SALD ESE+ VQ AL KI    TTI+VAHRLSTI++ + I V+K 
Sbjct  526   AVLRNPKILLLDEATSALDAESEQIVQQALDKIMSHRTTIIVAHRLSTIRDVDTIIVLKN  585

Query  202   GAVAEYGSHDKLMASELNGIYATLV  128
             G V E G+H +L++ +  G YA LV
Sbjct  586   GQVVESGNHSELISKK--GEYANLV  608



>ref|XP_004136487.1| PREDICTED: ABC transporter B family member 13-like [Cucumis sativus]
Length=1281

 Score =   357 bits (917),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 224/528 (42%), Positives = 324/528 (61%), Gaps = 4/528 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +  +++ + VG+    I   + Q     L G +LT+R+R  LF +IL  E GWFDFDEN+
Sbjct  750   EVHHVAFMFVGVAIFTIPIYLLQHYFYTLMGERLTARVRLLLFSAILSNEVGWFDFDENN  809

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             TG L S L+ ++   RS L DR S ++  ++       I+F   WRL  +  A  P  +G
Sbjct  810   TGALTSILASNATLVRSALADRISTIVQNVALTVSAFVIAFIFSWRLAAVVVASLPLLIG  869

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             AS    +   G   D   +Y RA+ +A  A++NIRTVA F  +E I   F   L++P + 
Sbjct  870   ASITEQLFLKGFGGDYGQAYNRATAVAHEAIANIRTVAAFGAEEKISSQFAFELNKPNKQ  929

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +  R  + G   G SQ   + +Y L LW+ + L+K  ++N G + K F++L+++S ++ +
Sbjct  930   AFLRGHVAGFGYGISQFFAFCSYALGLWYASTLIKHRHSNFGDIMKSFMVLIITSLAIAE  989

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                L PD    S A+ +V  I++R+ +I  D      +  T+   DIEF  V+F YP+RP
Sbjct  990   TLALTPDIVKGSQALGSVFNILHRKTII--DSNNPSAEMVTNIIGDIEFNNVSFKYPARP  1047

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V  + +L++  G  +A+VG SGSGKST+I ++ RFYDPI G +L++  D++ LNL+ 
Sbjct  1048  DITVFEDLNLRVSAGKSLAVVGQSGSGKSTVIALVMRFYDPISGTILIDGRDIKSLNLRS  1107

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR +  LV QEPALF+ TI ENI +G   AS  E+ +AAK A  H FIS +P  Y+T VG
Sbjct  1108  LRMKIGLVQQEPALFSTTIYENIKYGNQEASEIEVMKAAKAANAHGFISRMPNSYQTHVG  1167

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
               GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SE+ VQ+AL ++ +  TTI+V
Sbjct  1168  DRGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDAASERQVQEALDRLMEGRTTILV  1227

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             AHRL+TI++AN IAV+K G V E GSHD L+ +  + IY  LV  + E
Sbjct  1228  AHRLTTIRDANRIAVLKSGRVVEIGSHDSLLKNP-HSIYKQLVNLQHE  1274


 Score =   263 bits (671),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 202/498 (41%), Positives = 290/498 (58%), Gaps = 19/498 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R     SILK++  +FD +     ++   +S D V  +  +GD+    +   
Sbjct  148   GERQTARLRMKYLNSILKKDINFFDTEAKDFNIMF-HISSDMVLVQDAIGDKTGHAMRYF  206

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S   VG  I F+  W+LTLL  A+       G +Y ++IM+   +   ++YA+A   A  
Sbjct  207   SQFIVGFAIGFTSVWKLTLLTLAIVPLVAIAGVAY-TVIMSTLSQKGEAAYAQAGKTAEE  265

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              ++ IRTV ++  +   ++ + ++L    +   R     G  +GF+   ++ A+ L LW+
Sbjct  266   VIAQIRTVYSYVGESKALEKYSESLQNALKLGKRSGFAKGFGVGFTYSLLFCAWALLLWY  325

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ-LAGLAPDTSMASAAIPAVLEIINRRPLI  893
              + LV    TN G  +   + ++ S F++GQ +  LA   ++A   + A     N   +I
Sbjct  326   ASILVLHHETNGGKAFTTIINVIFSGFALGQAMPNLA---AIAKGRVAAA----NIFSMI  378

Query  892   GSDPQRKGRKFE----TSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGAS  725
              +D +   R       +S    IEF  V+FAYPSRP +I     S  I  G  VA+VG S
Sbjct  379   DADYESSSRSNNGVALSSVAGKIEFSEVSFAYPSRPQLI-FDKLSFSISAGRTVAVVGPS  437

Query  724   GSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIA  545
             GSGKST++ M+QRFY+P  G++L++  DLR L LKWLR Q  LV QEPALF  TI  NI 
Sbjct  438   GSGKSTIVSMVQRFYEPSSGKILLDGHDLRTLELKWLRRQMGLVSQEPALFNTTIAANIL  497

Query  544   FGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKS  365
             FG  NA+  EI  AA+ A  H FI  LP+GY T+VG+ G+QLSGGQKQRIAIARA+L+  
Sbjct  498   FGQENATMDEIIAAAEVANAHSFIQELPDGYSTQVGERGIQLSGGQKQRIAIARAVLRNP  557

Query  364   KVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEY  185
             K+LLLDEA+SALD ESE  VQ AL +I    TTI++AHRLSTI+EA+ I V+K G + E 
Sbjct  558   KILLLDEATSALDSESELIVQQALVRIMLNRTTIIIAHRLSTIQEADTIFVLKNGQIVES  617

Query  184   GSHDKLMASELNGIYATL  131
             G+H +LM+   NG YA L
Sbjct  618   GNHSELMSK--NGEYAAL  633



>emb|CAN71068.1| hypothetical protein VITISV_031708 [Vitis vinifera]
Length=1344

 Score =   358 bits (918),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 230/531 (43%), Positives = 326/531 (61%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ +  ++SLI VG     I   + Q     L G +LT+RIR  +F +IL  E GWFD D
Sbjct  811   IKREVDHISLIFVGAAILTIFIYLLQHYFYTLMGERLTTRIRLLMFSAILSNEIGWFDLD  870

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             ENSTG L S+L+ D+   RS L DR S ++  ++       I+F+L WR+  +  A  P 
Sbjct  871   ENSTGSLTSKLAADATLXRSALADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIASFPL  930

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              +GAS    +   G   D + +YA+A+ +A  A++NIRTVA F  ++ I   F   L++P
Sbjct  931   LIGASITEQLFLKGFGGDYTRAYAQATAVAREAIANIRTVAAFGAEDRISLQFASELNQP  990

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
              + ++ R  I G   G SQ   + +Y L LW+ + L+K   +N G + K F++L++++FS
Sbjct  991   NKQALLRGHISGFGYGVSQLFAFCSYALGLWYASVLIKHNDSNFGDIIKSFMVLIITAFS  1050

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   L PD    S A+ +V  I+ R+  I  D         T    DIEF  V+F YP
Sbjct  1051  VAETLALTPDIVKGSQALGSVFSILQRKTAINRD--XPTSSVVTDIQGDIEFRNVSFRYP  1108

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPD+ + ++ +LKI  G  +A+VG SGSGKST+I ++ RFYDP  G V+++  D++ LN
Sbjct  1109  ARPDLTIFKDLNLKISAGKSLAIVGQSGSGKSTVISLVMRFYDPTSGAVMIDGFDIKGLN  1168

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             L+ LR +  LV QEPALF+ TI ENI +G   AS  EI +AA+ A  H FIS +PEGY+T
Sbjct  1169  LRSLRMKIGLVQQEPALFSTTIYENIRYGNEEASEIEIMKAARAANAHXFISRMPEGYQT  1228

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
             +VG  GVQLSGGQKQR+AIARAILK   +LLLDEA+SALD  SEK VQ+AL  + +  TT
Sbjct  1229  QVGDRGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTASEKLVQEALDTLMEGRTT  1288

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             I++AHRLSTI  A+ IAV++ G V E G H +L+ +    IY  LV  +QE
Sbjct  1289  ILIAHRLSTIHNADSIAVLQHGKVVETGDHRQLI-TRPGSIYKQLVSLQQE  1338


 Score =   286 bits (732),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 213/528 (40%), Positives = 307/528 (58%), Gaps = 11/528 (2%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L  Q    +L LV LG G + +           G + T+R+R    +S+L+Q+  +FD +
Sbjct  177   LSSQVSRHALYLVYLGLGVLASAWIGVAFWMQTGERQTARLRLKYLQSVLRQDINFFDTE  236

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--  1349
                  +    +S D++  +  +GD+    L  LS   VG  I F+  W+LTLL  A+   
Sbjct  237   ARDKNITF-HISNDAILLQDAIGDKIGHGLRYLSQFFVGFAIGFTSVWQLTLLTVAVVPL  295

Query  1348  pftLGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE  1169
                 G +Y ++IM    +   ++YA A  +A  A+S +RTV +F  ++  V+++ ++L +
Sbjct  296   MAIAGGAY-TVIMTTLSEKGEAAYAEAGKVAEEAISQVRTVYSFVGEDRAVETYSRSLQK  354

Query  1168  PKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSF  989
               +   +     G  +GF+ G ++ A+ L LW+ + LV+ G TN G  +   L ++ S F
Sbjct  355   ALKLGKKSGFAKGIGIGFTYGLLFCAWALLLWYASKLVRHGDTNGGKAFTTILNVIFSGF  414

Query  988   SVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSK-PFDIEFEMVTFA  812
             ++GQ A   P+ +  +    A   I+N      +  +R        K    +EF  V FA
Sbjct  415   ALGQAA---PNLAAIAKGRAAAANIVNMIETDSTASKRLDNGIMLPKVAGQLEFCEVCFA  471

Query  811   YPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRE  632
             YPSRP  +V  N S  I  G   A+VG SGSGKST+I M+QRFY+P  G++L++  D++ 
Sbjct  472   YPSRPS-MVFENLSFSIYAGKTFAVVGPSGSGKSTIISMVQRFYEPTSGKILLDGHDIKN  530

Query  631   LNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGY  452
             L LKWLR+Q  LV QEPALFA TI  NI +G  +A   ++ EAAK A  H F+ GLP+GY
Sbjct  531   LRLKWLRAQMGLVSQEPALFATTIAGNILYGKEDADMDQVIEAAKAANAHSFVQGLPDGY  590

Query  451   ETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQA  272
             +T+VG+ G QLSGGQKQRIAIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI    
Sbjct  591   QTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESELIVQKALDKIMLNR  650

Query  271   TTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             TTIVVAHRLSTI++ N I V+K G V E G+H +L++    G YATLV
Sbjct  651   TTIVVAHRLSTIRDVNKIIVLKNGQVVESGTHLELISQ--GGEYATLV  696



>ref|XP_008387548.1| PREDICTED: ABC transporter B family member 1 [Malus domestica]
Length=1354

 Score =   358 bits (918),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 226/535 (42%), Positives = 333/535 (62%), Gaps = 18/535 (3%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  801   QINKYCYLLIGLSSAALIFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  860

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  861   SARVSARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPLVVA  920

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F + L  P R 
Sbjct  921   ATVLQKLFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEGKIVGLFTRNLQIPLRR  980

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI G   G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  981   CFWKGQIAGIGFGIAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1040

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQR-KGRKFETSKPFDIEFEMV  821
                LAPD      A+ +V E+++R+  I  D       P R +G         +IE + V
Sbjct  1041  TLTLAPDFIKGGRAMRSVFELLDRKTEIEPDDPDATVVPDRLRG---------EIELKHV  1091

Query  820   TFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVD  641
              F YPSRPDV + R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D
Sbjct  1092  DFTYPSRPDVPIFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKD  1151

Query  640   LRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLP  461
             +R+ NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP
Sbjct  1152  IRKYNLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAANLANAHKFISALP  1211

Query  460   EGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKIS  281
             EGY+T VG+ GVQLSGGQKQR+AIARA+L+K++V+LLDEA+SALD ESE  +Q+AL +  
Sbjct  1212  EGYKTFVGERGVQLSGGQKQRVAIARALLRKAEVMLLDEATSALDAESESSIQEALERAC  1271

Query  280   KQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
                TTIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1272  SGKTTIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1326


 Score =   273 bits (698),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 190/504 (38%), Positives = 306/504 (61%), Gaps = 6/504 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  178   GERQSTKMRIKYLEAALSQDVQYFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  236

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA + + +  +  K    + ++A +    
Sbjct  237   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAIHTTALGKISGK-SQEALSQAGHTVEQ  295

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V+ IR V ++  +   +Q++  AL   ++   +     G  LG +   ++  Y L LW+
Sbjct  296   TVAQIRVVLSYVGESRALQAYSSALKVSQKLGYKSGFAKGMGLGATYFVVFCCYALLLWY  355

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  +TN G        ++L    +GQ          A  A   + +II+ +P + 
Sbjct  356   GGYLVRHHFTNGGLAISTMFAVMLGGIGLGQSVPSMSAFVKAKVAAAKIFKIIDHKPGMD  415

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              + +  G + E+     +E + V F+YPSR DV +L NFSL +  G  +ALVG+SGSGKS
Sbjct  416   RNSE-AGIELESVTGL-VELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSGSGKS  473

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D+R L LKWLR Q  LV QEPALFA TI ENI  G P+
Sbjct  474   TVVSLIERFYDPSSGQVLLDGHDIRTLKLKWLRQQIGLVSQEPALFATTIKENILLGRPD  533

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEA++ A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  534   ADQVEIEEASRVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  593

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V+E G+HD+
Sbjct  594   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDE  653

Query  169   LMASELNGIYATLVRAEQEAYAFA  98
             L +   NG+YA L+R ++ A+  A
Sbjct  654   LFSKGENGVYAKLIRMQEMAHETA  677



>dbj|BAC41846.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   357 bits (915),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 341/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  723   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  782

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  783   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  842

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  843   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  902

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  903   QKRSLYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  962

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  963   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1020

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYDP+ G+V+++  D+R LN
Sbjct  1021  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLN  1080

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ +AA+ A  H FISGLPEGY+T
Sbjct  1081  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIDAARAANAHGFISGLPEGYKT  1140

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1141  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1200

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++  + E GSH +L+ S   G Y+ L++ +
Sbjct  1201  VVVAHRLSTIRGVDCIGVIQDERIVEQGSHSELV-SRPEGAYSRLLQLQ  1248


 Score =   280 bits (717),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   W+L LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + ++  A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSDAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  +     +IEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGYKLMEIINQRPTIIQDPL-DGKCLDQVHG-NIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ RNF++    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  378   PDVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLK  437

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  438   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  497

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  498   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  557

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  558   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  603



>ref|XP_003554389.1| PREDICTED: ABC transporter B family member 1-like isoform 1 [Glycine 
max]
Length=1339

 Score =   357 bits (916),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 222/531 (42%), Positives = 338/531 (64%), Gaps = 10/531 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  788   EIEKYCYLLIGLSSTALLFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  847

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  848   SARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  907

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F++++ IV  F   L  P + 
Sbjct  908   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEKKIVGLFTTNLQAPLQR  967

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  968   CFWKGQISGSGYGVAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1027

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAY  809
                LAPD      A+ +V ++++RR  I  D Q       T  P     ++E + V F+Y
Sbjct  1028  TLTLAPDFIKGGRAMRSVFDLLDRRTEIEPDDQDA-----TPVPDRLRGEVELKHVDFSY  1082

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPD+ V R+ SL+ K G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D+R+ 
Sbjct  1083  PTRPDMPVFRDLSLRAKAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKDIRKY  1142

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
             NLK LR   ++V QEP LFA TI ENIA+G  + +  EI EAA  A  HKFISGLP+GY+
Sbjct  1143  NLKSLRRHISVVPQEPCLFATTIYENIAYGHESTTEAEIIEAATLANAHKFISGLPDGYK  1202

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQLSGGQKQRIA+ARA ++K++++LLDEA+SALD ESE+ VQ+AL + S   T
Sbjct  1203  TFVGERGVQLSGGQKQRIAVARAFVRKAELMLLDEATSALDAESERSVQEALDRASSGKT  1262

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             TI+VAHRLSTI+ AN+IAV+ +G VAE GSH +L+ +  +GIYA +++ ++
Sbjct  1263  TIIVAHRLSTIRNANLIAVIDDGKVAEQGSHSQLLKNHPDGIYARMIQLQR  1313


 Score =   282 bits (722),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 190/505 (38%), Positives = 307/505 (61%), Gaps = 6/505 (1%)
 Frame = -1

Query  1606  AGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMG  1427
             +G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  
Sbjct  164   SGERQSTKMRIKYLEAALNQDIQFFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHY  222

Query  1426  LSSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
             +++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A NI  
Sbjct  223   MATFVSGFVVGFTAVWQLALVTLAVVPMIAVIGGIHTTTLAKLSGK-SQEALSQAGNIVE  281

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
               ++ IR V  F  +   +Q++  AL   ++   +     G  LG +   ++  Y L LW
Sbjct  282   QTIAQIRVVLAFVGESRALQAYSSALRVAQKIGYKTGFAKGMGLGATYFVVFCCYALLLW  341

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             +G YLV+   TN G        +++    +GQ A      + A  A   +  II+ +P I
Sbjct  342   YGGYLVRHHATNGGLAIATMFAVMIGGLGLGQSAPSMAAFTKARVAAAKIFRIIDHKPSI  401

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
               + +  G + +T     +E + V F+YPSRP+V +L +FSL +  G  +ALVG+SGSGK
Sbjct  402   DQNSE-SGVELDTVTGL-VELKNVDFSYPSRPEVQILNDFSLNVPAGKTIALVGSSGSGK  459

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEPALFA TI ENI  G P
Sbjct  460   STVVSLIERFYDPTSGQVLLDGHDIKTLRLRWLRQQIGLVSQEPALFATTIRENILLGRP  519

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
             +A   EIEEAA+ A  H FI  LP+GYET+VG+ G+QLSGGQKQRIAIARA+LK   +LL
Sbjct  520   DADQVEIEEAARVANAHSFIIKLPDGYETQVGERGLQLSGGQKQRIAIARAMLKNPAILL  579

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD ESEK VQ+AL +     TT+++AHRLSTI++A+++AV+++G+V+E G+HD
Sbjct  580   LDEATSALDSESEKLVQEALDRFMIGRTTLIIAHRLSTIRKADLVAVLQQGSVSEIGTHD  639

Query  172   KLMASELNGIYATLVRAEQEAYAFA  98
             +L +   NG+YA L++ ++ A+  A
Sbjct  640   ELFSKGENGVYAKLIKMQEMAHETA  664



>ref|XP_009334844.1| PREDICTED: ABC transporter B family member 13-like [Pyrus x bretschneideri]
Length=1245

 Score =   356 bits (913),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 228/524 (44%), Positives = 325/524 (62%), Gaps = 4/524 (1%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             ++LI VGL    +   + Q     L G +LT+R+R  +FK+IL  E GWFD +EN TG L
Sbjct  719   IALIFVGLAAVTVPIYLLQHYFYTLMGERLTTRVRLLMFKAILSNEVGWFDLEENDTGSL  778

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYF  1322
              S L+ ++   RS L DR S ++  LS       I+F+  WR+  + +A  P  +GAS  
Sbjct  779   TSTLAANATLVRSALADRLSTIVQNLSLTVTAFVIAFTFSWRMAAVVSASLPLLIGASIT  838

Query  1321  SLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRR  1145
               +   G   D N +Y+RA++IA  A++NI TVA F  +E I   F   L++P + +V R
Sbjct  839   EQLFLKGFGGDYNRAYSRATSIAREAIANIGTVAAFGCEERISLQFSLELNKPNKQAVLR  898

Query  1144  SQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGL  965
               I G   G SQ   + +Y L LW+ + L+K+   N G + K F++L+++S  + +   L
Sbjct  899   GHISGFCYGLSQFFAFCSYALGLWYASILIKDKDLNFGDIMKSFMVLIVTSLCIAETLAL  958

Query  964   APDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
              P+    S A+  +  I+ R   I  D  R       +   DIEF+ V+F YP+RPD+ +
Sbjct  959   TPEIMKGSQALSPIFSILKRETAIHRDDLRS--NVVANVKGDIEFKNVSFWYPARPDITI  1016

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
                 +L++  G  +A+VG SGSGKST+I ++ RFYDPI G VL++  D++ LN K LR +
Sbjct  1017  FDYLNLRVXAGKSLAVVGPSGSGKSTVIALVMRFYDPISGTVLIDGYDIKSLNFKSLRKR  1076

Query  604   TALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              +LV QEPALF+ TI ENI +G+  AS  E+  AAK A  H FIS +PEGY+T+VG+ GV
Sbjct  1077  ISLVQQEPALFSTTIYENIKYGYEEASEVEVVTAAKAANAHGFISQMPEGYKTQVGEKGV  1136

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQR+AIARAILK   +LLLDEA+SALD ESEK VQ+AL K+ +  TTI+VAHRL
Sbjct  1137  QLSGGQKQRVAIARAILKDPSILLLDEATSALDTESEKLVQEALDKLMEGRTTIMVAHRL  1196

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             STI++AN IA+++ G V E GSH++L+      +Y  LV  +Q+
Sbjct  1197  STIRDANRIALLQNGRVVEMGSHEQLIGRP-GSLYKQLVSLQQQ  1239


 Score =   263 bits (672),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 205/511 (40%), Positives = 291/511 (57%), Gaps = 43/511 (8%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    +S+L ++  +FD +   T ++   +S D++  +  +GD+    L  L
Sbjct  120   GERQTARLRMKYLQSVLNKDINFFDTEARDTNIIF-HISSDAILVQDAIGDKTGHALRYL  178

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S    G  I F+  W+LTLL  A+       G +Y ++ M+   +   ++YA A  +A  
Sbjct  179   SQFLTGFAIGFTSVWQLTLLTLAVVPFIAIAGGAY-TITMSTLSEKGEAAYAEAGKVAEE  237

Query  1249  AVSNIRTVATFSTQEHIVQ----SFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTL  1082
              +S IRTV +F  ++  ++    S  KAL   K+T V +    G  +GF+ G ++ A+ L
Sbjct  238   VISQIRTVYSFGGEDRSIEAYSTSLNKALKLGKKTGVAK----GVGVGFTYGLLFCAWAL  293

Query  1081  TLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRR  902
              LW+ + LV+   TN G  +   + ++ S F++GQ A   P+ +  +    A   I    
Sbjct  294   LLWYASILVRHHDTNGGKAFTTIINVIFSGFALGQAA---PNLAAIAKGRAAAGNITT--  348

Query  901   PLIGSD-------------PQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKI  761
              +I SD             P+  G+         I+F  V F YPSR + +V  N S  I
Sbjct  349   -MIDSDSKSCKVSDNGIVLPKVSGQ---------IDFCEVGFNYPSRSN-MVFDNLSFSI  397

Query  760   KGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEP  581
               G   A+VG SGSGKST+I MIQRFY P+ G++L++  +L  L LKWLR Q  LV QEP
Sbjct  398   GAGQTFAVVGPSGSGKSTVISMIQRFYHPVSGKILLDGHELGTLQLKWLREQMGLVSQEP  457

Query  580   ALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQ  401
             ALFA TI  NI  G  +A   +I EAAK A  H FI GLP+GY T+ G+ G QLSGGQKQ
Sbjct  458   ALFATTIAGNILLGKEDADMDQIMEAAKAANAHSFIEGLPDGYNTQAGEGGTQLSGGQKQ  517

Query  400   RIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANV  221
             RIAIARA+L+  K+LLLDEA+SALD ESE  VQ AL KI    TT++VAHRLSTI++ + 
Sbjct  518   RIAIARAVLRNPKILLLDEATSALDAESELVVQQALEKIMSHRTTVIVAHRLSTIQDVDT  577

Query  220   IAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             I V+K G +AE G+H  LM+ +  G YA LV
Sbjct  578   IVVLKNGQLAESGNHSDLMSKK--GEYANLV  606



>ref|XP_011016204.1| PREDICTED: ABC transporter B family member 21-like [Populus euphratica]
Length=1294

 Score =   356 bits (914),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 229/520 (44%), Positives = 322/520 (62%), Gaps = 7/520 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +L+ + LG    V    Q  L  +AG KL  RIR+  F+ ++  E GWFD  E+S+G + 
Sbjct  770   ALMFMTLGLASFVVYPTQTYLFSVAGCKLIQRIRSMCFEKVVHMEVGWFDDPEHSSGAIG  829

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ + R+++GD  S L+  ++SA  GL I+F+  W+L  +   L P      +  
Sbjct  830   ARLSADAATVRALVGDSLSQLVQNIASAVAGLVIAFTACWQLAFVILVLLPLIGLNGFVQ  889

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D    Y  AS +A  AV +IRTVA+F  +E ++Q + +    P RT +R+ 
Sbjct  890   IKFMKGFSADAKKMYEEASQVANDAVGSIRTVASFCAEEKVMQLYRRKCEGPMRTGIRQG  949

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G+  G S   ++  Y  T + GA LV+ G T    V+++F  L +++  + Q +  A
Sbjct  950   MISGTGFGVSFFLLFSVYATTFYVGAQLVRHGKTTFTEVFRVFFALTMAAIGISQSSSFA  1009

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
             PD+S A  A  ++  II+R+  I  DP    GR  +  K  +IE   ++F YPSRPD+ +
Sbjct  1010  PDSSKAKGAAASIFAIIDRKSKI--DPSDESGRTLDNVKG-EIELRHISFKYPSRPDIEI  1066

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
              R+ SL I  G  VALVG SGSGKST+I ++QRFYDP  G + ++ +D++ L LKWLR Q
Sbjct  1067  FRDLSLAIHSGKTVALVGESGSGKSTVISLLQRFYDPDSGHITLDGIDIQSLQLKWLRQQ  1126

Query  604   TALVGQEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
               LV QEP LF  TI  NIA+G   NA+  EI  A++ A  HKFISGL +GY+T VG+ G
Sbjct  1127  MGLVSQEPVLFNETIRANIAYGKEGNATEVEILAASELANAHKFISGLQQGYDTVVGERG  1186

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
              QLSGGQKQR+AIARA++K  K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAHR
Sbjct  1187  TQLSGGQKQRVAIARAMVKSPKILLLDEATSALDAESERVVQDALDRVMVSRTTVVVAHR  1246

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             LSTIK A+VIAVVK G + E G H+ L+  + +G YA+LV
Sbjct  1247  LSTIKNADVIAVVKNGVIVEKGKHEALIHIK-DGFYASLV  1285


 Score =   282 bits (722),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 207/526 (39%), Positives = 308/526 (59%), Gaps = 9/526 (2%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              ++L  V LG G  V    Q     + G +  +RIR    K+ILKQ+  +FD  E +TG 
Sbjct  110   KVALNFVYLGIGSAVASFLQVACWMVTGERQAARIRGTYLKTILKQDVAFFD-KETNTGE  168

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEW--RltllaaaltpftLGA  1331
             +V R+S D+V  +  +G++    +  +S+   G  ++F   W   L +L++       GA
Sbjct  169   VVGRMSGDTVLIQDAMGEKVGKFIQLVSTFIGGFIVAFVKGWLLTLVMLSSIPLLVIAGA  228

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
                 +I  +  +   ++YA+A+ +   A+ +IRTVA+F+ ++  + +++K L+    + V
Sbjct  229   GLAIIIARMASR-GQTAYAKAAIVVEQAIGSIRTVASFTGEKQAISNYKKFLATAYNSGV  287

Query  1150  RRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQL  974
             +     G  LG     ++ +Y L +WFG  ++ E GYT  G V  + + ++  S S+GQ 
Sbjct  288   QEGFTAGLGLGIVMLFIFCSYALAIWFGGKMILEKGYTG-GDVLNVIVAVLTGSMSLGQA  346

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
             +      +   AA   + E INR+P I S   R   K       D+E   V F YP+RPD
Sbjct  347   SPCMTAFAAGQAAAYKMFETINRKPEIDSSDTRG--KILDDISGDVELRDVYFTYPARPD  404

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
               +   FSL I  GT  ALVG SGSGKST+I +I+RFYDP  G VL++  +L+E  LKW+
Sbjct  405   EQIFSGFSLFIPSGTTTALVGQSGSGKSTVISLIERFYDPQAGEVLIDGTNLKEFQLKWI  464

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             R +  LV QEP LFA +I +NIA+G   A+  EI  A + A   KFI  LP+G +T VG+
Sbjct  465   REKIGLVSQEPVLFASSIKDNIAYGKDGATTDEIRAATELANAAKFIDKLPQGIDTMVGE  524

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL +I    TT++VA
Sbjct  525   HGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERIVQEALDRIMVNRTTVIVA  584

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             HRLST++ A++IAV+  G + E GSH +L+  +  G Y+ L+R ++
Sbjct  585   HRLSTVRNADMIAVIYRGKMVEKGSHSELL-KDPEGAYSQLIRLQE  629



>ref|XP_009377013.1| PREDICTED: ABC transporter B family member 1 [Pyrus x bretschneideri]
Length=1353

 Score =   357 bits (916),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 225/535 (42%), Positives = 333/535 (62%), Gaps = 18/535 (3%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  800   QINKYCYLLIGLSSAALIFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  859

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  860   SARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPLVVA  919

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F + L  P R 
Sbjct  920   ATVLQKLFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEGKIVGLFTRNLQIPLRR  979

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI G   G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  980   CFWKGQIAGIGFGIAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1039

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQR-KGRKFETSKPFDIEFEMV  821
                LAPD      A+ +V E+++R+  I  D       P R +G         +IE + V
Sbjct  1040  TLTLAPDFIKGGRAMRSVFELLDRKTEIEPDDPDATVVPDRLRG---------EIELKHV  1090

Query  820   TFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVD  641
              F YP+RPDV + R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D
Sbjct  1091  DFTYPTRPDVPIFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKD  1150

Query  640   LRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLP  461
             +R+ NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP
Sbjct  1151  IRKYNLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAANLANAHKFISALP  1210

Query  460   EGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKIS  281
             EGY+T VG+ GVQLSGGQKQR+AIARA+L+K++V+LLDEA+SALD ESE  +Q+AL +  
Sbjct  1211  EGYKTFVGERGVQLSGGQKQRVAIARALLRKAEVMLLDEATSALDAESESSIQEALERAC  1270

Query  280   KQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
                TTIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1271  SGKTTIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1325


 Score =   269 bits (687),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 190/505 (38%), Positives = 304/505 (60%), Gaps = 8/505 (2%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  177   GERQSTKMRIKYLEAALSQDVQYFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  235

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA + + +  +  K    + ++A +    
Sbjct  236   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAIHTTALGKISGK-SQDALSQAGHTVEQ  294

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V+ IR V ++  +   +Q++  AL   ++   +     G  LG +   ++  Y L LW+
Sbjct  295   TVAQIRVVLSYVGESRALQAYSSALKVAQKLGYKSGFAKGMGLGATYFVVFCCYALLLWY  354

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  +TN G        ++L    +GQ          A  A   + +II+ +P  G
Sbjct  355   GGYLVRHHFTNGGLAISTMFAVMLGGIGLGQSVPSMSAFVKAKVAAAKIFKIIDHKP--G  412

Query  889   SDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
              D     G + E+     +E + V F+YPSR D  +L NFSL +  G  +ALVG+SGSGK
Sbjct  413   MDRYSEAGMELESVTGL-VELKNVDFSYPSRQDDRILNNFSLNVPAGKTIALVGSSGSGK  471

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST++ +I+RFYDP  G+VL++  D++ L LKWLR Q  LV QEPALFA TI ENI  G P
Sbjct  472   STVVSLIERFYDPSSGQVLLDGHDIKTLKLKWLRQQIGLVSQEPALFATTIKENILLGRP  531

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
             +A   EIEEA++ A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+LK   +LL
Sbjct  532   DADQVEIEEASRVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILL  591

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V+E G+HD
Sbjct  592   LDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHD  651

Query  172   KLMASELNGIYATLVRAEQEAYAFA  98
             +L +   NG+YA L+R ++ A+  A
Sbjct  652   ELFSKGENGVYAKLIRMQEMAHETA  676



>gb|KHN02316.1| ABC transporter B family member 1 [Glycine soja]
Length=1300

 Score =   356 bits (914),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 220/527 (42%), Positives = 337/527 (64%), Gaps = 2/527 (0%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  749   EIEKYCYLLIGLSSTALLFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  808

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  809   SARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  868

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F   L  P + 
Sbjct  869   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSETKIVGLFTTNLQAPLQR  928

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  929   CFWKGQISGSGYGVAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  988

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                LAPD      A+ +V E+++RR  I  D Q      +  +  ++E + V F+YP+RP
Sbjct  989   TLTLAPDFIKGGQAMRSVFELLDRRTEIEPDDQDATLVPDRLRG-EVELKHVDFSYPTRP  1047

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D+R+ NLK 
Sbjct  1048  DMPVFRDLSLRARAGKTLALVGPSGCGKSSIIALIQRFYDPTSGRVMIDGKDIRKYNLKS  1107

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR   ++V QEP LFA TI ENIA+G  + +  EI EAA  A  HKFISGLP+GY+T VG
Sbjct  1108  LRRHISVVPQEPCLFATTIYENIAYGHESTTEAEIIEAATLANAHKFISGLPDGYKTFVG  1167

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + GVQLSGGQKQRIA+ARA ++K++++LLDEA+SALD ESE+ VQ+AL + S   TTI+V
Sbjct  1168  ERGVQLSGGQKQRIAVARAFVRKAELMLLDEATSALDAESERSVQEALDRASSGKTTIIV  1227

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLSTI+ AN+IAV+ +G VAE GSH +L+ +  +GIYA +++ ++
Sbjct  1228  AHRLSTIRNANLIAVIDDGKVAEQGSHSQLLKNHPDGIYARMIQLQR  1274


 Score =   274 bits (700),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 178/401 (44%), Positives = 256/401 (64%), Gaps = 18/401 (4%)
 Frame = -1

Query  1276  ARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMY  1097
             ++A NI    ++ IR V  F  +   +Q++  AL        R +Q +G   GF++G   
Sbjct  235   SQAGNIVEQTIAQIRVVLAFVGESRALQAYSSAL--------RVAQKIGYKTGFAKGMGL  286

Query  1096  GA--------YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMAS  941
             GA        Y L LW+G YLV+   TN G        +++    +GQ A      + A 
Sbjct  287   GATYFVVFCCYALLLWYGGYLVRHHATNGGLAIATMFAVMIGGLGLGQSAPSMAAFTKAR  346

Query  940   AAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKI  761
              A   +  II+ +P I  + +  G + +T     +E + V F+YPSRP+V +L +FSL +
Sbjct  347   VAAAKIFRIIDHKPSIDQNSE-SGVELDTVTGL-VELKNVDFSYPSRPEVQILNDFSLNV  404

Query  760   KGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEP  581
               G  +ALVG+SGSGKST++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEP
Sbjct  405   PAGKTIALVGSSGSGKSTVVSLIERFYDPTSGQVLLDGHDIKTLRLRWLRQQIGLVSQEP  464

Query  580   ALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQ  401
             ALFA TI ENI  G P+A   EIEEAA+ A  H FI  LP+GYET+VG+ G+QLSGGQKQ
Sbjct  465   ALFATTIRENILLGRPDADQVEIEEAARVANAHSFIIKLPDGYETQVGERGLQLSGGQKQ  524

Query  400   RIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANV  221
             RIAIARA+LK   +LLLDEA+SALD ESEK VQ+AL +     TT+++AHRLSTI++A++
Sbjct  525   RIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLIIAHRLSTIRKADL  584

Query  220   IAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +AV+++G+V+E G+HD+L +   NG+YA L++ ++ A+  A
Sbjct  585   VAVLQQGSVSEIGTHDELFSKGENGVYAKLIKMQEMAHETA  625



>ref|XP_009376834.1| PREDICTED: ABC transporter B family member 1-like [Pyrus x bretschneideri]
Length=1353

 Score =   357 bits (915),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 225/535 (42%), Positives = 333/535 (62%), Gaps = 18/535 (3%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  800   QINKYCYLLIGLSSAALIFNTLQHFFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  859

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  860   SARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPLVVA  919

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F + L  P R 
Sbjct  920   ATVLQKLFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEGKIVGLFTRNLQIPLRR  979

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI G   G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  980   CFWKGQIAGIGFGIAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1039

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQR-KGRKFETSKPFDIEFEMV  821
                LAPD      A+ +V E+++R+  I  D       P R +G         +IE + V
Sbjct  1040  TLTLAPDFIKGGRAMRSVFELLDRKTEIEPDDPDATVVPDRLRG---------EIELKHV  1090

Query  820   TFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVD  641
              F YP+RPDV + R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D
Sbjct  1091  DFTYPTRPDVPIFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKD  1150

Query  640   LRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLP  461
             +R+ NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP
Sbjct  1151  IRKYNLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAANLANAHKFISALP  1210

Query  460   EGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKIS  281
             EGY+T VG+ GVQLSGGQKQR+AIARA+L+K++V+LLDEA+SALD ESE  +Q+AL +  
Sbjct  1211  EGYKTFVGERGVQLSGGQKQRVAIARALLRKAEVMLLDEATSALDAESESSIQEALERAC  1270

Query  280   KQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
                TTIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1271  SGKTTIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1325


 Score =   269 bits (688),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 188/504 (37%), Positives = 305/504 (61%), Gaps = 6/504 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  177   GERQSTKMRIKYLEAALSQDVQYFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  235

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA + + +  +  K    + ++A +    
Sbjct  236   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAIHTTALGKISGK-SQDALSQAGHTVEQ  294

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V+ IR V ++  +   +Q++  AL   ++   +     G  LG +   ++  Y L LW+
Sbjct  295   TVAQIRVVLSYVGESRALQAYSAALKVAQKLGYKSGFAKGMGLGATYFVVFCCYALLLWY  354

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  +TN G        ++L    +GQ          A  A   + +II+ +P + 
Sbjct  355   GGYLVRHHFTNGGLAISTMFAVMLGGIGLGQSVPSMSAFVKAKVAAAKIFKIIDHKPGMD  414

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              + +  G + E+     +E + V F+YPSR D  +L NFSL +  G  +ALVG+SGSGKS
Sbjct  415   RNSE-AGMELESVTGL-VELKNVDFSYPSRQDDRILNNFSLNVPAGKTIALVGSSGSGKS  472

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D++ L LKWLR Q  LV QEPALFA TI ENI  G P+
Sbjct  473   TVVSLIERFYDPSSGQVLLDGHDIKTLKLKWLRQQIGLVSQEPALFATTIKENILLGRPD  532

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEA++ A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  533   ADQVEIEEASRVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  592

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V+E G+HD+
Sbjct  593   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDE  652

Query  169   LMASELNGIYATLVRAEQEAYAFA  98
             L +   NG+YA L+R ++ A+  A
Sbjct  653   LFSKGENGVYAKLIRMQEMAHETA  676



>gb|AAN28720.2| MDR-like p-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   355 bits (912),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 341/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD D
Sbjct  723   MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDED  782

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P 
Sbjct  783   EHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPL  842

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  I+  F   L  P
Sbjct  843   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVP  902

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+ RSQ  G   G SQ A+YG+  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  903   QKRSLYRSQTSGFLFGLSQLALYGSEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  962

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  +++R+  I  D        ET +  DIEF  V FAYP
Sbjct  963   VAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADA-DPVETIRG-DIEFRHVDFAYP  1020

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V R+F+L+I+ G   ALVGASGSGKS++I MI+RFYD + G+V+++  D+R LN
Sbjct  1021  SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDLLAGKVMIDGKDIRRLN  1080

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA TI +NIA+G   A+ +E+ +AA+ A  H FISGLPEGY+T
Sbjct  1081  LKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIDAARAANAHGFISGLPEGYKT  1140

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1141  PVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTT  1200

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             +VVAHRLSTI+  + I V+++G + E GSH +L+ S   G Y+ L++ +
Sbjct  1201  VVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELV-SRPEGAYSRLLQLQ  1248


 Score =   281 bits (718),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 310/528 (59%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    SL  V LG     +   +      +G +  + +R    +++LKQ+ G+FD D   
Sbjct  82    EVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDAR-  140

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   W+L LL+ A+      
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  200

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + ++  A+    +
Sbjct  201   AGGLYAYTLTGITSK-SRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSDAIQYTLK  259

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  260   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  319

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EIIN+RP I  DP   G+  +     +IEF+ VTF+YPSR
Sbjct  320   QSFSNLGAFSKGKAAGYKLMEIINQRPTIIQDPL-DGKCLDQVHG-NIEFKDVTFSYPSR  377

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ RNF++    G  VA+VG SGSGKST++ +I+RFYDP  G++L++ V+++ L LK
Sbjct  378   PDVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLK  437

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             +LR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP+GY+T+V
Sbjct  438   FLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQV  497

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  498   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVV  557

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRL TI+  + IAV+++G V E G+H++L+A   +G YA+L+R ++
Sbjct  558   VAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK--SGAYASLIRFQE  603



>gb|KGN58980.1| Multidrug resistance protein 1, 2 [Cucumis sativus]
Length=1346

 Score =   356 bits (914),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 217/520 (42%), Positives = 338/520 (65%), Gaps = 2/520 (0%)
 Frame = -1

Query  1672  ILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSR  1493
             +L+GL    ++    Q     + G  LT R+R  +  +ILK E  WFD +EN +  + +R
Sbjct  801   LLIGLSSAALLFNTIQHFFWDIVGENLTKRVREKMLTAILKNEMAWFDQEENESAKIAAR  860

Query  1492  LSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLI  1313
             L++D+ + RS +GDR SV++   S   V     F L+WRL+L+  A+ P  + A+    +
Sbjct  861   LALDANNVRSAIGDRISVIVQNTSLMLVACTAGFVLQWRLSLVLVAVFPVVVAATVLQKM  920

Query  1312  MNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQI  1136
                G   D  +++A+A+ +A  A++N+RTVA F+++E IV+ F   L  P R    + QI
Sbjct  921   FMTGFSGDLEANHAKATQLAGEAIANVRTVAAFNSEEKIVRLFSTNLEIPLRRCFWKGQI  980

Query  1135  LGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPD  956
              GS  G +Q ++Y +Y L LW+ ++LVK G ++     ++F++L++S+    +   LAPD
Sbjct  981   AGSGFGVAQFSLYASYALGLWYASWLVKHGLSDFSKAIRVFMVLMVSANGAAETLTLAPD  1040

Query  955   TSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRN  776
                   A+ +V  +++R+  I  D     +  +  +  ++E + V F+YP+RPD++V R+
Sbjct  1041  FIKGGRAMRSVFALLDRKTEIEPDDPNVTQVPDKLRG-EVELKHVDFSYPTRPDILVFRD  1099

Query  775   FSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTAL  596
              +L+++ G  +ALVG SG GKS++I ++QRFY+P  GRV+++  D+R+ NLK LR   A+
Sbjct  1100  LNLRVRAGKTLALVGPSGCGKSSVISLVQRFYEPTSGRVMIDGKDIRKFNLKSLRKHIAM  1159

Query  595   VGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqls  416
             V QEP LFA +I +NIA+G  +A+  EI EAA  A  HKFISGLPEGY+T VG+ GVQLS
Sbjct  1160  VPQEPCLFAASIYDNIAYGHESATEAEIIEAATLANAHKFISGLPEGYKTFVGERGVQLS  1219

Query  415   ggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTI  236
             GGQKQRIAIARA+++K++++LLDEA+SALD ESE+ VQ+AL +     TTIVVAHRLSTI
Sbjct  1220  GGQKQRIAIARALIRKAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTI  1279

Query  235   KEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             + A+VIAV+ +G V+E GSH  L+ +  +G YA +++ ++
Sbjct  1280  RNAHVIAVIDDGKVSEQGSHSHLLKNYPDGCYAKMIQLQR  1319


 Score =   285 bits (729),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 202/512 (39%), Positives = 306/512 (60%), Gaps = 22/512 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  171   GERQSTKMRIKYLEAALDQDIQYFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  229

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  Y + I  +  K  ++  + A NI   
Sbjct  230   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGGIYTTTIAKLSAKTQDA-LSEAGNIVEQ  288

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA-------  1091
              +  IR V  F  +   +Q +  AL        + SQ +G   GFS+G   GA       
Sbjct  289   TIVQIRVVFAFVGESRALQRYSAAL--------KISQKIGYKSGFSKGIGLGATYFVVFC  340

Query  1090  -YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEI  914
              Y L LW+G YLV+   TN G        +++   ++GQ A      + A  A   +  I
Sbjct  341   CYALLLWYGGYLVRHHATNGGLAIATMFAVMIGGLALGQSAPSMSSFAKAKVAAAKIYRI  400

Query  913   INRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALV  734
             I+ +P +  + +  G + E+     +E + V F YPSRPDV +L NFSL +  G  +ALV
Sbjct  401   IDHKPTLNRNNE-SGLELESVSGL-VELKNVDFTYPSRPDVRILNNFSLAVPAGKTIALV  458

Query  733   GASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGE  554
             G+SGSGKST++ +I+RFYDPI G VL++  D++ L L+WLR Q  LV QEPALFA TI E
Sbjct  459   GSSGSGKSTVVALIERFYDPISGEVLLDGRDIKTLKLRWLRQQIGLVSQEPALFATTIKE  518

Query  553   NIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAIL  374
             NI  G P A   E+EEAA+ A  H FI  LPEGY+T+VG+ G+QLSGGQKQRIAIARA+L
Sbjct  519   NILLGRPEADQLEVEEAARVANAHSFIIKLPEGYDTQVGERGLQLSGGQKQRIAIARAML  578

Query  373   KKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAV  194
             K   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V
Sbjct  579   KNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSV  638

Query  193   AEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +E G+HD+L A   NG+YA L+R ++ A+  A
Sbjct  639   SEMGTHDELFAKGENGVYAKLIRMQEMAHETA  670



>ref|XP_011040312.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
21-like [Populus euphratica]
Length=1152

 Score =   353 bits (907),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 225/500 (45%), Positives = 315/500 (63%), Gaps = 7/500 (1%)
 Frame = -1

Query  1618  LCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSV  1439
             L  +AG KL  RIR+  F+ ++  E GWFD  E+S+G + +RLS D+ + R+++GD  S 
Sbjct  648   LFSVAGCKLIQRIRSMCFEKVVHMEVGWFDDPEHSSGAIGARLSADAATVRALVGDSLSQ  707

Query  1438  LLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLD-NSSYARASN  1262
             L+  ++SAA GL I+F+  W+L  +   L P      +  +    G   D    Y  AS 
Sbjct  708   LVQNIASAAAGLVIAFTACWQLAFVILVLLPLIGLNGFVQIKFMKGFSADAKKMYEEASQ  767

Query  1261  IAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTL  1082
             +A  AV +IRTVA+F  +E ++Q + +    P RT +R+  I G+  G S   ++  Y  
Sbjct  768   VANDAVGSIRTVASFCAEEKVMQLYRRKCEGPMRTGIRQGMISGTGFGVSFFLLFSVYAT  827

Query  1081  TLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRR  902
             T + GA LV+ G T    V+++F  L +++  + Q +  APD+S A  A  ++  II+R+
Sbjct  828   TFYVGAQLVRHGKTTFTEVFRVFFALTMAAIGISQSSSFAPDSSKAKGAAASIFAIIDRK  887

Query  901   PLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGAS  725
               I  DP    GR  +  K  +IE   ++F YPSRPD+ + R+ SL I  G  VALVG S
Sbjct  888   SKI--DPSDESGRTLDNVKG-EIELRHISFKYPSRPDIEIFRDLSLAIHSGKTVALVGES  944

Query  724   GSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIA  545
             GSGKST+I ++QRFYDP  G + ++ +D++ L LKWLR Q  LV QEP LF  TI  NIA
Sbjct  945   GSGKSTVISLLQRFYDPDSGHITLDGIDIQSLQLKWLRQQMGLVSQEPVLFNETIRANIA  1004

Query  544   FGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKK  368
             +G   NA+  EI  A++ A  HKFISGL +GY+T VG+ G QLSGGQKQR+AIARA++K 
Sbjct  1005  YGKEGNATEVEILAASELANAHKFISGLQQGYDTVVGERGTQLSGGQKQRVAIARAMVKS  1064

Query  367   SKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAE  188
              K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAHRLSTIK A+VIAVVK G + E
Sbjct  1065  PKILLLDEATSALDAESERVVQDALDRVMVSRTTVVVAHRLSTIKNADVIAVVKNGVIVE  1124

Query  187   YGSHDKLMASELNGIYATLV  128
              G H+ L+  + +G YA+LV
Sbjct  1125  KGKHETLIHIK-DGFYASLV  1143


 Score =   279 bits (714),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 208/525 (40%), Positives = 308/525 (59%), Gaps = 7/525 (1%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              ++L  V LG G  V    Q     + G +  +RIR    K+ILKQ+  +FD  E +TG 
Sbjct  110   KVALNFVYLGIGSAVAAFLQVACWMVTGERQAARIRGTYLKTILKQDVAFFD-KETNTGE  168

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftLGAS  1328
             +V R+S D+V  +  +G++    +  +S+   G  ++F   W LTL+  +      +  +
Sbjct  169   VVGRMSGDTVLIQDAMGEKVGKFIQLVSTFIGGFIVAFVKGWLLTLVMLSSIPLLVIAGA  228

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
               S++++       ++YA+A+ +   A+ +IRTVA+F+ ++  + +++K L     + V+
Sbjct  229   GLSIMISRMASRGQTAYAKAATVVEQAIGSIRTVASFTGEKQAISNYKKFLVTAYNSGVQ  288

Query  1147  RSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQLA  971
                  G  LG     ++ +Y L +WFG  ++ E GYT  G V  + + ++  S S+GQ +
Sbjct  289   EGFTAGLGLGIVMLFIFCSYALAIWFGGKMILEKGYTG-GDVLNVIVAVLTGSMSLGQAS  347

Query  970   GLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDV  791
                   +   AA   + E INR+P I S   R   K       D+E   V F YP+RPD 
Sbjct  348   PCMSAFAAGQAAAYKMFETINRKPEIDSSDTRG--KILDDISGDVELRDVYFTYPARPDE  405

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
              +   FSL I  GT  ALVG SGSGKST+I +I+RFYDP  G VL++  +L+E  LKW+R
Sbjct  406   QIFSGFSLFIPSGTTTALVGQSGSGKSTVISLIERFYDPQAGEVLIDGTNLKEFQLKWIR  465

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              +  LV QEP LFA +I +NIA+G   A+  EI  AA+ A   KFI  LP+G +T VG+ 
Sbjct  466   EKIGLVSQEPVLFASSIKDNIAYGKDGATTDEIRAAAEVANAAKFIDKLPQGIDTMVGEH  525

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQRIAIARAILK  +VLLLDEA+SALD ESE+ VQ+AL +I    TT++VAH
Sbjct  526   GTQLSGGQKQRIAIARAILKDPRVLLLDEATSALDAESERIVQEALDRIMVTRTTVIVAH  585

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             RLST+  A++IAV+  G + E GSH +L+   + G Y+ L+R ++
Sbjct  586   RLSTVINADIIAVIYRGKIVEKGSHSELLKDPV-GAYSQLIRLQE  629



>ref|XP_007051281.1| ATP binding cassette subfamily B4 isoform 1 [Theobroma cacao]
 gb|EOX95438.1| ATP binding cassette subfamily B4 isoform 1 [Theobroma cacao]
Length=1292

 Score =   355 bits (912),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 234/526 (44%), Positives = 326/526 (62%), Gaps = 7/526 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +LI + LG   ++ +  +     +AG KL  RIR+  F+ ++  E GWFD   +S+G + 
Sbjct  768   ALIFMVLGLASLLALPARTYFFSIAGCKLIQRIRSMCFEKVVHMEVGWFDEPAHSSGSVG  827

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ + R+++GD  + ++  L+SA  GL I+F   W+L  +  AL P      Y  
Sbjct  828   ARLSADAATIRALVGDALAQMVSNLASAVAGLVIAFVASWQLAFIILALIPLIGVNGYVQ  887

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D    Y  AS +A  AV +IRTVA+F  +E ++Q ++K    P +T +R+ 
Sbjct  888   VKFMKGFSADAKMMYEEASQVANDAVGSIRTVASFCAEEKVMQLYKKKCEGPMKTGIRQG  947

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I GS  G S   ++  Y  + + GA LVK G+     V+++F  L +++  + Q +  A
Sbjct  948   LISGSGFGLSFFLLFCVYATSFYAGAQLVKHGHATFSDVFRVFFALTMAAVGISQSSSFA  1007

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
             PD+S A  A  ++  II+R+  I  DP    G   E  K  DIEF  V+F YP RPD+ +
Sbjct  1008  PDSSKAKTAAASIFAIIDRKSKI--DPSDESGTTLENVKG-DIEFRHVSFKYPLRPDIQI  1064

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
             LR+ SL I  G  VALVG SGSGKST+I ++QRFYDP  GR+ ++ V++++L LKWLR Q
Sbjct  1065  LRDLSLSIHAGKTVALVGESGSGKSTVISLLQRFYDPDSGRITLDGVEIQKLQLKWLRQQ  1124

Query  604   TALVGQEPALFAGTIGENIAFGF-PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
               LV QEP LF  TI  NIA+G   NA+  EI  A++ A  HKFIS L +GY+T VG+ G
Sbjct  1125  MGLVSQEPVLFNDTIRANIAYGKGGNATEAEILAASELANAHKFISSLQQGYDTVVGERG  1184

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
             VQ+SGGQKQRIAIARAI+K  K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAHR
Sbjct  1185  VQMSGGQKQRIAIARAIVKSPKILLLDEATSALDAESERVVQDALDRVMVNRTTVVVAHR  1244

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             LSTIK A+VIAVVK G + E G HD L+  + +G YA+LV     A
Sbjct  1245  LSTIKNADVIAVVKNGVIVEKGKHDALINIK-DGFYASLVSLHMSA  1289


 Score =   286 bits (731),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 207/525 (39%), Positives = 309/525 (59%), Gaps = 9/525 (2%)
 Frame = -1

Query  1681  LSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVL  1502
             ++L  V L  G       Q     + G +  +RIR    K+IL+Q+  +FD + N TG +
Sbjct  111   VALKFVYLAVGAAAAAFLQVSCWMVTGERQAARIRGLYLKTILRQDVAFFDVETN-TGEV  169

Query  1501  VSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEW--RltllaaaltpftLGAS  1328
             V R+S D+V  +  +G++    L  +S+   G  I+F   W   L +L++       GA 
Sbjct  170   VGRMSGDTVLIQDAMGEKVGKFLQLISTFFGGFIIAFIKGWLLTLVMLSSIPLLVISGAV  229

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
                LI  +  +   ++YA+A+ +    + +IRTVA+F+ ++  + ++ K L    R+ V 
Sbjct  230   MAILISKMASR-GQTAYAKAATVVEQTIGSIRTVASFTGEKQAISNYNKFLVTAYRSGVH  288

Query  1147  RSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQLA  971
                  G  LG     ++ +Y L +WFG  ++ E GYT  G V  + + ++  S S+GQ +
Sbjct  289   EGAAAGLGLGVVMLIIFCSYALAVWFGGKMILEKGYTG-GQVLNVIIAVLTGSMSLGQAS  347

Query  970   GLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDV  791
                   +   AA   + E I R+P I S   R G+ FE  +  DIE   V F+YP+RPD 
Sbjct  348   PCMSAFAAGQAAAFKMFETIKRKPEIDSYDTR-GKIFEDIRG-DIELRDVNFSYPARPDE  405

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
              +   FSL I  GT  ALVG SGSGKST+I +I+RFYDP  G VL++ ++L++  L+W+R
Sbjct  406   QIFSGFSLAISSGTTSALVGQSGSGKSTVISLIERFYDPQAGEVLIDGINLKDFQLRWIR  465

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              +  LV QEP LF  +I +NIA+G  NA+  EI  AA+ A   KFI  LP+G +T VG+ 
Sbjct  466   GKIGLVSQEPVLFTSSIRDNIAYGKENATTEEIRAAAELANASKFIDKLPQGLDTMVGEH  525

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQR+AIARAILK  ++LLLDEA+SALD ESE+ VQ+AL +I    TT++VAH
Sbjct  526   GTQLSGGQKQRVAIARAILKDPRILLLDEATSALDAESERVVQEALDRIMGNRTTVIVAH  585

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             RLST++ A++IAV+  G + E GSH +L+  +  G Y+ L+R ++
Sbjct  586   RLSTVRNADMIAVIHRGKMVEKGSHSELL-KDPEGAYSQLIRLQE  629



>ref|XP_008439691.1| PREDICTED: ABC transporter B family member 9 [Cucumis melo]
Length=1267

 Score =   355 bits (911),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 235/529 (44%), Positives = 328/529 (62%), Gaps = 8/529 (2%)
 Frame = -1

Query  1699  QLQCQNLSLILVGLGFGCIVTMIG--QQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDF  1526
             QL+ ++    L+ LG GC+       Q    G+AG KL  RIR+  FK I+ Q+  +FD 
Sbjct  733   QLEKESKFWALIYLGLGCLTFFASPTQNYFFGIAGGKLIERIRSLTFKKIVHQQISYFDD  792

Query  1525  DENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltp  1346
               N++G + +RLS D+ + R ++GD  ++++  +++   GL I+F+  W L L+   ++P
Sbjct  793   PANTSGAIGARLSTDAATVRGLVGDALALVVQNIATITAGLVIAFTANWILALVILGVSP  852

Query  1345  ftLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE  1169
               L   Y       G   D    Y  AS +A  AV +IRTVA+F +++ ++  +EK   +
Sbjct  853   LLLVQGYLQTKFTKGFSADAKVMYEEASQVANDAVGSIRTVASFCSEKKVMDLYEKKCED  912

Query  1168  PKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSF  989
             P +  VR   + G+  GFS  A++       + G+ LV  G      V+K+F  L +S+ 
Sbjct  913   PVKNGVRLGLVSGAGFGFSFFALFCTNAFCFYIGSILVNHGMATFPEVFKVFFALTISAM  972

Query  988   SVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAY  809
              V Q + LAPD+S A  +  ++ EI++ +P I S    +G    TS   +IEF+ V+F Y
Sbjct  973   GVSQTSALAPDSSKAKDSAASIFEILDSKPKIDSS-SSEGVTL-TSVIGNIEFDHVSFKY  1030

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPD+ + R+  L+I  G  VALVG SGSGKST+I +I+RFYDP  GR L++ V++ + 
Sbjct  1031  PTRPDIQIFRDLCLRIPSGKTVALVGESGSGKSTVISLIERFYDPDSGRTLLDGVEIHKF  1090

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPN--ASYTEIEEAAKEAYIHKFISGLPEG  455
              L WLR Q  LV QEP LF  TI  NIA+G P   AS  EI  AAK A  H FIS LPEG
Sbjct  1091  KLSWLRQQMGLVSQEPILFNETIRSNIAYGKPENAASEEEIIGAAKAANAHNFISSLPEG  1150

Query  454   YETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQ  275
             YET VG+ GVQLSGGQKQRIAIARAILK  K+LLLDEA+SALD ESE+ VQDAL ++   
Sbjct  1151  YETTVGERGVQLSGGQKQRIAIARAILKNPKILLLDEATSALDAESERVVQDALDRVMVN  1210

Query  274   ATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
              TT+VVAHRL+TI+ A++IAVVK G +AE GSH++LM    +G YA+LV
Sbjct  1211  RTTVVVAHRLTTIRGADIIAVVKNGVIAEKGSHEELMKIS-DGAYASLV  1258


 Score =   268 bits (686),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 198/524 (38%), Positives = 303/524 (58%), Gaps = 5/524 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q   +S+  V LG G  +    Q     + G +  +RIR    K+IL+Q+  +FD  E +
Sbjct  78    QVSKISIDFVYLGIGTGIASFLQVACWMVTGERQAARIRALYLKTILRQDITYFD-TETT  136

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftL  1337
             TG ++ R+S D++  +  +G++    +  +S+   G  ++F   W L ++  +      +
Sbjct  137   TGEVIGRMSGDTILIQDAMGEKVGKFIQLISTFFGGFVVAFVRGWLLAVVLLSCIPAIVI  196

Query  1336  GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
                  SLIM+        +YA A N+    V  IRTVA+F+ ++  ++ + + L    ++
Sbjct  197   AGGTTSLIMSKMSSRGQIAYAEAGNVVEQTVGAIRTVASFTGEKQAIEKYNEKLKIAYKS  256

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +V++    G  LG     ++G Y L +W+G+ L+ +   N G V  +   ++    S+GQ
Sbjct  257   TVQQGLASGLGLGLILLIVFGTYGLAVWYGSKLIIQKGYNGGQVINVIFAIMTGGMSLGQ  316

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
              + +    +   AA   + E I R+P I S     G   E  +  DIE + V F YP+RP
Sbjct  317   TSPVVNAFASGQAAAYKMFETIKRKPKIDS-YDASGIAPEDIQG-DIELKDVHFRYPARP  374

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             DV +   FSL +  GT  ALVG SGSGKST+I +++RFYDP  G VL++ V+L+   L+W
Sbjct  375   DVQIFSGFSLFVPSGTTAALVGHSGSGKSTVISLLERFYDPDSGEVLIDGVNLKHYKLRW  434

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             +R +  LV QEP LF  TI ENI +G  NA+  E+  A + A   KFI  LP+G +T VG
Sbjct  435   IREKIGLVSQEPILFTTTIRENILYGKENATEEELRAATELANAAKFIDKLPKGLDTMVG  494

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + G QLSGGQKQRIAI+RAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT+VV
Sbjct  495   EHGTQLSGGQKQRIAISRAILKNPRILLLDEATSALDSESERIVQEALVRVMANRTTVVV  554

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             AHRL+TI+ ++ IAVV +G + E G+H +L+ +  +G Y+ LVR
Sbjct  555   AHRLTTIRNSDTIAVVHQGKLLEQGTHVELIKNP-DGAYSQLVR  597



>ref|XP_009591470.1| PREDICTED: ABC transporter B family member 19 [Nicotiana tomentosiformis]
Length=1249

 Score =   355 bits (910),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 232/531 (44%), Positives = 341/531 (64%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  720   MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  779

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  780   ENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  839

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ QE I+  F + L  P
Sbjct  840   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVP  899

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQ+ G   G SQ A+Y +  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  900   QMQSLRRSQMSGLLFGISQLALYASEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  959

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   +  DP         S   DIE   V FAYP
Sbjct  960   VAETVSLAPEIVRGGEAVGSVFSILDRSTRV--DPDDTEADPVESIRGDIELRHVDFAYP  1017

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV V ++F+L+I+ G   ALVGASGSGKS++I +I+RFYDP  G+V+++  D+R LN
Sbjct  1018  SRPDVSVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLN  1077

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I ENIA+G   A+  E+ EAA+ A +H F+SGLPEGY+T
Sbjct  1078  LKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVVEAARAANVHTFVSGLPEGYKT  1137

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1138  PVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTT  1197

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + I VV++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1198  VLVAHRLSTIRHVDSIGVVQDGRIVEQGSHSELI-SRPEGAYSRLLQLQHH  1247


 Score =   284 bits (726),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 304/528 (58%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG     +   + G     G +  S +R    +++LKQ+ G+FD D   
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFDTDAR-  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  198   AGGLYAYTLTGLTSK-SRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLK  256

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G ++ G  +      ++   S+G
Sbjct  257   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTAIFSAIVGGMSLG  316

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EII ++P I  D        E +   +IEF+ VTF+YPSR
Sbjct  317   QSFSNLGAFSKGKAAGYKLMEIIKQKPTIVQDLADGKCLSEVNG--NIEFKNVTFSYPSR  374

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ R+F +    G  VA+VG SGSGKST++ +I+RFYDP +G+VL++ VD++ L L+
Sbjct  375   PDVIIFRDFCIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLR  434

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E A   A  H FI+ LP GY T+V
Sbjct  435   WLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQV  494

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  495   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVV  554

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + IAV+++G V E G+H++L+A    G Y++L+R ++
Sbjct  555   VAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA--GAYSSLIRFQE  600



>ref|XP_004134559.1| PREDICTED: ABC transporter B family member 9-like [Cucumis sativus]
 gb|KGN49354.1| hypothetical protein Csa_6G521010 [Cucumis sativus]
Length=1270

 Score =   355 bits (911),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 235/529 (44%), Positives = 329/529 (62%), Gaps = 8/529 (2%)
 Frame = -1

Query  1699  QLQCQNLSLILVGLGFGCIV--TMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDF  1526
             QL+ ++    L+ LG GC+    +  Q    G+AG KL  RIR+  FK I+ Q+  +FD 
Sbjct  736   QLEKESKFWALIYLGLGCLTFFALPTQNYFFGIAGGKLIERIRSLTFKKIVHQQISYFDD  795

Query  1525  DENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltp  1346
               N++G + +RLS D+ + R ++GD  ++++  +++   GL I+F+  W L L+   ++P
Sbjct  796   PANASGAIGARLSTDAATVRGLVGDALALVVQNIATITAGLIIAFTANWILALVIIGVSP  855

Query  1345  ftLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSE  1169
               L   Y       G   D    Y  AS +A  AV +IRTVA+F +++ ++  +EK   +
Sbjct  856   LLLVQGYLQTKFTKGFSADAKIMYEEASQVANDAVGSIRTVASFCSEKKVMDLYEKKCED  915

Query  1168  PKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSF  989
             P +  VR   + G+  GFS  A++       + G+ LV  G      V+K+F  L +S+ 
Sbjct  916   PVKNGVRLGLVSGAGFGFSFFALFCTNAFCFYIGSILVNHGKATFPEVFKVFFALTISAM  975

Query  988   SVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAY  809
              V Q + LAPD+S A  +  ++ EI++ +P I S    +G    TS   +IEF+ V+F Y
Sbjct  976   GVSQTSALAPDSSKAKDSAASIFEILDSKPKIDSS-SSEGVTL-TSVIGNIEFDHVSFKY  1033

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPD+ + R+  L+I  G  VALVG SGSGKST+I +I+RFYDP  GR L++ V++ + 
Sbjct  1034  PTRPDIQIFRDLCLRIPSGKTVALVGESGSGKSTVISLIERFYDPDSGRTLLDGVEIHKF  1093

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPN--ASYTEIEEAAKEAYIHKFISGLPEG  455
              L WLR Q  LV QEP LF  TI  NIA+G P   AS  EI  AAK A  H FIS LPEG
Sbjct  1094  KLSWLRQQMGLVSQEPILFNETIRSNIAYGKPENAASEEEIIGAAKAANAHNFISSLPEG  1153

Query  454   YETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQ  275
             YET VG+ GVQLSGGQKQRIAIARAILK  K+LLLDEA+SALD ESE+ VQDAL ++   
Sbjct  1154  YETSVGERGVQLSGGQKQRIAIARAILKNPKILLLDEATSALDAESERVVQDALDRVMVN  1213

Query  274   ATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
              TT+VVAHRL+TI+ A++IAVVK G +AE GSH++LM    +G YA+LV
Sbjct  1214  RTTVVVAHRLTTIRGADIIAVVKNGVIAEKGSHEELMKIS-DGAYASLV  1261


 Score =   273 bits (697),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 198/526 (38%), Positives = 306/526 (58%), Gaps = 5/526 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q   +S+  V LG G  +    Q     + G +  +RIR    K+IL+Q+  +FD  E +
Sbjct  81    QVSKISIDFVYLGIGTGIASFLQVACWMVTGERQAARIRALYLKTILRQDITYFD-TETT  139

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftL  1337
             TG ++ R+S D++  +  +G++    +  +S+   G  ++F+  W L ++  +      +
Sbjct  140   TGEVIGRMSGDTILIQDAMGEKVGKFIQLMSTFFGGFVVAFARGWLLAVVLLSCIPAVVI  199

Query  1336  GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
                  SLIM+        +YA A N+    V  IRTVA+F+ ++  ++ + + L    ++
Sbjct  200   AGGTTSLIMSKMSSRGQIAYAEAGNVVEQTVGAIRTVASFTGEKQAIEKYNEKLKIAYKS  259

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
             +V++    G  LG      +G Y L +W+G+ L+ +   N G V  +   ++    S+GQ
Sbjct  260   TVQQGLAAGLGLGIILLIAFGTYGLAVWYGSKLIIQKGYNGGQVINVIFAIMTGGMSLGQ  319

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
              + +    +   AA   + E I R+P I S     G   E  +  DIE + + F YP+RP
Sbjct  320   TSPVVNAFASGQAAAYKMFETIKRKPKIDS-YDASGIAPEDIQG-DIELKDIYFRYPARP  377

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             DV +   FSL +  GT  ALVG SGSGKST+I +++RFYDP  G VL++ V+L++  L+W
Sbjct  378   DVQIFSGFSLFVPSGTTAALVGHSGSGKSTVISLLERFYDPDSGEVLIDGVNLKQYKLRW  437

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             +R +  LV QEP LF  TI ENI +G  NA+  E+  A + A   KFI  LP+G +T VG
Sbjct  438   IREKIGLVSQEPILFTTTIRENILYGKDNATEEEVRAAIELANAAKFIDKLPKGLDTMVG  497

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + G QLSGGQKQRIAI+RAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT+VV
Sbjct  498   EHGTQLSGGQKQRIAISRAILKNPRILLLDEATSALDSESERIVQEALVRVMANRTTVVV  557

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             AHRL+TI+ ++ IAVV +G + E G+HD+L+ +  +G Y+ LVR +
Sbjct  558   AHRLTTIRNSDNIAVVHQGKLLEQGTHDELIKNP-DGAYSQLVRLQ  602



>dbj|BAK05967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1266

 Score =   355 bits (911),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 228/529 (43%), Positives = 337/529 (64%), Gaps = 4/529 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G GF  +V  + Q     + G  LT+R+R  +   IL+ + GWFD +
Sbjct  737   MERKTREYVFIYIGTGFYAVVAYLIQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDEE  796

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ +RL+ ++   +S + +R SV+L  ++S  V   + F +EWR+ +L     P 
Sbjct  797   ENNSSLVAARLNTEAADVKSAIAERISVILQNMTSLLVSFIVGFIIEWRVAILILVTFPL  856

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  857   LVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVP  916

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQ+ G   G SQ ++Y +  L LW+GA+LV+   +    V K+F++LV+++ S
Sbjct  917   QMHSLRRSQVSGVLYGLSQLSLYASEALILWYGAHLVRHHVSTFSRVIKVFVVLVITANS  976

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      ++ +V  ++N R  I  D + +G   E  +  +IE   V FAYP
Sbjct  977   VAETVSLAPEIIRGGESVRSVFAVLNSRTRIDPD-EPEGEPVEKVRG-EIELRHVDFAYP  1034

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V + FSL+I+ G   ALVGASGSGKST+I +I+RFYDP+ G+V+++  D+R LN
Sbjct  1035  SRPDVMVFKEFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLN  1094

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEP LFA +I ENI +G    +  E+ EAAK A +H F+S LP+GY T
Sbjct  1095  LKSLRLKIGLVQQEPVLFATSILENIGYGKDGVTEEEVVEAAKVANVHGFVSALPDGYRT  1154

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  VQ+AL +I K  TT
Sbjct  1155  PVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVVQEALGRIMKGRTT  1214

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAE  119
             ++VAHRLSTI+  + IAVV++G V E GSH  L+ S  +G Y+ L++ +
Sbjct  1215  VLVAHRLSTIRCVDSIAVVQDGRVVEQGSHGDLV-SRPDGAYSRLLQLQ  1262


 Score =   280 bits (716),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 203/499 (41%), Positives = 298/499 (60%), Gaps = 4/499 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++L+Q+ G+FD D   TG +V  +S D++  +  +G++    +  L
Sbjct  124   GERQVGALRRRYLEAVLRQDVGFFDTDAR-TGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  182

Query  1423  SSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLDN-SSYARASNIAAGA  1247
             ++   GL + F   WRL LL+ A+ P    A         GP   +  SYA A  IA  A
Sbjct  183   ATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGPTSKSRESYANAGIIAEQA  242

Query  1246  VSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFG  1067
             ++ +RTV ++  +   + S+ +A+    +   +     G  +G + G    ++ L  W+ 
Sbjct  243   IAQVRTVYSYVGETKALNSYSEAIQSTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWYA  302

Query  1066  AYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGS  887
                ++ G T+ G  +      ++   S+GQ        S    A   +LE+I +RP I  
Sbjct  303   GVFIRSGQTDGGKAFTAIFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQRPTIVQ  362

Query  886   DPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKST  707
             D    GR  +     +IEF+ V+F+YPSRPDV+V R+FSL    G   A+VG SGSGKST
Sbjct  363   DST-DGRCLDEVHG-NIEFKEVSFSYPSRPDVMVFRDFSLFFPAGKTAAVVGGSGSGKST  420

Query  706   LIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNA  527
             ++ +I+RFYDP QG+VL++  D++ L LKWLR Q  LV QEPALFA TI +NI +G P+A
Sbjct  421   VVSLIERFYDPNQGQVLLDNADIKSLQLKWLRDQIGLVNQEPALFATTIIDNILYGKPDA  480

Query  526   SYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllld  347
             +  E+E AA  A  H FI+ LP GY T+VG+ G+QLSGGQKQRIAIARA+LK  K+LLLD
Sbjct  481   TMAEVEAAASAANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARAMLKNPKILLLD  540

Query  346   eassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKL  167
             EA+SALD  SE  VQ+AL +I    TT+VVAHRLSTI+  ++IAV+++G V E G+HD+L
Sbjct  541   EATSALDAGSESIVQEALDRIMIGRTTVVVAHRLSTIRSVDMIAVIQQGQVVETGTHDEL  600

Query  166   MASELNGIYATLVRAEQEA  110
             +A   +G YA L+R ++ A
Sbjct  601   LAKGSSGAYAALIRFQEMA  619



>ref|XP_011079475.1| PREDICTED: ABC transporter B family member 4-like [Sesamum indicum]
 ref|XP_011079476.1| PREDICTED: ABC transporter B family member 4-like [Sesamum indicum]
Length=1283

 Score =   355 bits (911),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 235/520 (45%), Positives = 332/520 (64%), Gaps = 7/520 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             + + V LG   ++   G+  L G+AG KL  RIR   F+ ++  E GWFD  E+S+GV+ 
Sbjct  760   AFMFVALGAASLIAYPGRTYLFGVAGNKLIRRIRLMCFERVVNTEVGWFDEPEHSSGVIG  819

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ S R+++GD  + ++  LSSA VGL I+F   W+L L+  A+ P    + Y  
Sbjct  820   ARLSADAASVRALVGDALAQMVQDLSSAVVGLAIAFEASWQLALIILAMIPLIGLSGYVQ  879

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D  + Y  AS +A  AV +IRT+A+F  +E ++  ++     P R  +R+ 
Sbjct  880   IRFIKGFSADAKAMYEEASQVANDAVGSIRTIASFCAEEKVMGMYKNKCEGPMRNGIRQG  939

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              + G   G S G ++  Y  + + GA LV++G      V+++F  L +++ ++ Q + LA
Sbjct  940   VVSGIGFGLSFGLLFLVYATSFYAGARLVEDGKITFTDVFRVFFALTMAAIAISQSSSLA  999

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFETSKPFDIEFEMVTFAYPSRPDVIV  785
             PD+S A +A  ++  I++R+  I  DP    G K E+ K  +IE   V+F YPSRPDV +
Sbjct  1000  PDSSKAKSAAASIFSILDRKSKI--DPSDESGVKLESLKG-EIELRHVSFKYPSRPDVQI  1056

Query  784   LRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQ  605
              R+ SL I+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ +++ +  LKWLR Q
Sbjct  1057  FRDLSLAIRSGKTVALVGESGSGKSTVISLLQRFYDPDSGVITIDGIEIDKFQLKWLRQQ  1116

Query  604   TALVGQEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
               LV QEP LF GTI  NIA+G   NAS  EI  AA+ +  HKFISGL +GY+T VG+ G
Sbjct  1117  MGLVSQEPVLFNGTIRANIAYGKQGNASEAEITAAAELSNAHKFISGLAQGYDTMVGERG  1176

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
             VQLSGGQKQR+AIARAI+K  K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAHR
Sbjct  1177  VQLSGGQKQRVAIARAIIKSPKILLLDEATSALDAESERVVQDALDRVMVNRTTVVVAHR  1236

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             LSTIK A+VIAVVK G + E G HD L+  + +G YA+LV
Sbjct  1237  LSTIKGADVIAVVKNGVIVEKGKHDTLINIK-DGFYASLV  1275


 Score =   286 bits (732),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 203/525 (39%), Positives = 314/525 (60%), Gaps = 7/525 (1%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              ++L  V L  GC V    Q     + G +  +RIR+   ++IL+Q+  +FD  E +TG 
Sbjct  100   KVALKFVYLALGCGVAAFLQVACWMITGERQAARIRSLYLRTILRQDVAFFD-KETNTGE  158

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftLGAS  1328
             ++ R+S D+V  +  +G++    +  L++   G  I+F   W LTL+  +      +   
Sbjct  159   VIGRMSGDTVLIQDAMGEKVGKFIQLLATFVGGFVIAFIKGWLLTLVMLSSIPLLVISGG  218

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
               S +++       ++YA+A+ +    +  IRTVA+F+ ++  V  +EK+L E  ++ V 
Sbjct  219   IMSHVLSKMASRGQNAYAKAAIVVEQTIGAIRTVASFTGEKQAVSDYEKSLVEAYKSGVH  278

Query  1147  RSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQLA  971
                  G   G     ++ +Y L +WFG  ++ E GYT  G V  + + ++  S S+GQ +
Sbjct  279   EGWASGLGFGSVMFILFCSYALAIWFGGKMILEKGYTG-GEVLNVIIAVLTGSMSLGQAS  337

Query  970   GLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDV  791
                   +   AA   + E I+R+P I +   R G+  E  +  DIE   V F+YP+RP+ 
Sbjct  338   PCMTAFAAGQAAAFKMFETISRKPAIDAYDTR-GKILEDIRG-DIELRDVYFSYPARPNE  395

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
              + R FSL I  GT  ALVG SGSGKST+I +I+RFYDP  G VL++ ++L+E  LKW+R
Sbjct  396   QIFRGFSLFIPSGTTAALVGQSGSGKSTVISLIERFYDPELGEVLIDGINLKEFQLKWIR  455

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
             S+  LV QEP LF  +I +NIA+G  +A+  EI  AA+ A   KFI  LP+G +T VG+ 
Sbjct  456   SKLGLVSQEPVLFTASIKDNIAYGKDDATTEEIRMAAELANAAKFIDKLPQGLDTMVGEH  515

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQR+AIARAILK  ++LLLDEA+SALD ESE+ VQ+AL +I    TT++VAH
Sbjct  516   GTQLSGGQKQRVAIARAILKDPRILLLDEATSALDAESERIVQEALDRIMVNRTTVIVAH  575

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             RL+T++ A++IAV+ +G + E G+H +L+  +  G Y+ L+R ++
Sbjct  576   RLTTVRNAHMIAVIHQGKIVEKGTHAELL-QDPEGAYSQLIRLQE  619



>ref|XP_009758464.1| PREDICTED: ABC transporter B family member 19 [Nicotiana sylvestris]
Length=1249

 Score =   355 bits (910),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 232/531 (44%), Positives = 341/531 (64%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +V  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  720   MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  779

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ +L +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  780   ENNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  839

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ QE I+  F + L  P
Sbjct  840   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVP  899

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRSQ+ G   G SQ A+Y +  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  900   QMQSLRRSQMSGLLFGISQLALYASEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  959

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   +  DP         S   DIE   V FAYP
Sbjct  960   VAETVSLAPEIVRGGEAVGSVFSILDRSTRV--DPDDTEADPVESIRGDIELRHVDFAYP  1017

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV V ++F+L+I+ G   ALVGASGSGKS++I +I+RFYDP  G+V+++  D+R LN
Sbjct  1018  SRPDVSVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLN  1077

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I ENIA+G   A+  E+ EAA+ A +H F+SGLPEGY+T
Sbjct  1078  LKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVVEAARAANVHTFVSGLPEGYKT  1137

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1138  PVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTT  1197

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + I VV++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1198  VLVAHRLSTIRHVDSIGVVQDGRIVEQGSHSELI-SRPEGAYSRLLQLQHH  1247


 Score =   284 bits (726),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 204/528 (39%), Positives = 304/528 (58%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG     +   + G     G +  S +R    +++LKQ+ G+FD D   
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFDTDAR-  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  198   AGGLYAYTLTGLTSK-SRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLK  256

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G ++ G  +      ++   S+G
Sbjct  257   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTAIFSAIVGGMSLG  316

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EII ++P I  D        E +   +IEF+ VTF+YPSR
Sbjct  317   QSFSNLGAFSKGKAAGYKLMEIIKQKPTIVQDLADGKCLSEVNG--NIEFKNVTFSYPSR  374

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ R+F +    G  VA+VG SGSGKST++ +I+RFYDP +G+VL++ VD++ L L+
Sbjct  375   PDVIIFRDFCIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLR  434

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E A   A  H FI+ LP GY T+V
Sbjct  435   WLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQV  494

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  495   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVV  554

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + IAV+++G V E G+H++L+A    G Y++L+R ++
Sbjct  555   VAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAK--GGAYSSLIRFQE  600



>ref|XP_004489384.1| PREDICTED: ABC transporter B family member 19-like [Cicer arietinum]
Length=1250

 Score =   355 bits (910),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 228/531 (43%), Positives = 340/531 (64%), Gaps = 4/531 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    I +G G   +   + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  721   MERKTKEYVFIYIGAGIYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  780

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             E+++ ++ +RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  781   EHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPL  840

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+ S IA   VSNIRTVA F+ Q  ++  F   L  P
Sbjct  841   LVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKMLSIFCHELRVP  900

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             +  S+RRS   G   G SQ A+Y +  L LW+GA+LV +G +    V K+F++LV+++ S
Sbjct  901   QSLSLRRSLTSGLLFGLSQLALYASEALILWYGAHLVSKGVSTFSKVIKVFVVLVITANS  960

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      A+ +V  I++R   I  DP     +   S   +IE   V FAYP
Sbjct  961   VAETVSLAPEIIRGGEAVGSVFSILDRSTRI--DPDDPDAEQVESVRGEIELRHVDFAYP  1018

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPDV+V ++FSL+I+ G   ALVGASGSGKS++I +I+RFYDPI G+V+++  D+R+LN
Sbjct  1019  SRPDVMVFKDFSLRIRAGQSQALVGASGSGKSSVIALIERFYDPIVGKVMIDGKDIRKLN  1078

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEPALFA +I ENIA+G   A+  E+ EAA+ A +H F+SGLPEGY+T
Sbjct  1079  LKSLRLKIGLVQQEPALFAASILENIAYGKEGATEAEVIEAARSANVHAFVSGLPEGYKT  1138

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1139  PVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTT  1198

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQE  113
             ++VAHRLSTI+  + I VV++G + E GSH +L+ S   G Y+ L++ +  
Sbjct  1199  VLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELI-SRPEGAYSRLLQLQHH  1248


 Score =   287 bits (734),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 207/528 (39%), Positives = 303/528 (57%), Gaps = 8/528 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG    ++   +       G +  S +R    +++LKQ+ G+FD D   
Sbjct  80    EVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDAR-  138

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  LS+   GL + F   WRL LL+ A+      
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  198

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ +RTV ++  +   + S+  A+    +
Sbjct  199   AGGLYAYTLTGLTSK-SRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLK  257

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  LG + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  258   LGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  317

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S   AA   ++EII ++P I  D        E +   +IEF+ VTF+YPSR
Sbjct  318   QSFSNLGAFSKGKAAGYKLMEIIRQKPTIVEDLLDGKTLAEVNG--NIEFKDVTFSYPSR  375

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDVI+ R FS+    G  VA+VG SGSGKST++ +I+RFYDP +G+VL++ VD++ L LK
Sbjct  376   PDVIIFRKFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLK  435

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E A   A  H FI+ LP GY T+V
Sbjct  436   WLRDQIGLVNQEPALFATTILENILYGKPDATIDEVEAATSAANAHSFITLLPNGYNTQV  495

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQRIAIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  496   GERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMIGRTTVV  555

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             VAHRLSTI+  + IAV+++G V E G+H++L A    G YA+L+R ++
Sbjct  556   VAHRLSTIRNVDTIAVIQQGLVVETGTHEELFAK--GGTYASLIRFQE  601



>gb|KFK44669.1| hypothetical protein AALP_AA1G288400 [Arabis alpina]
Length=1247

 Score =   354 bits (909),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 225/530 (42%), Positives = 327/530 (62%), Gaps = 4/530 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++   + ++++ VG G       + Q     L G +LTSR+R  LF +IL  E GWFD D
Sbjct  718   IKRDVEKVAIVFVGAGILTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLD  777

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN+TG L S L+ D+   RS L DR S ++  LS     L ++F   WR+  +  A  P 
Sbjct  778   ENNTGSLTSILAADATLVRSALADRLSTIVQNLSLTVTALVLAFYYSWRVAAVVTACFPL  837

Query  1342  tLGASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + AS    +   G   D   +Y++A+++A  A+ NIRTVA F  ++ I++ F + LS+P
Sbjct  838   LIAASLTEQLFLKGFGGDYTKAYSKATSVAREAIGNIRTVAAFGAEKQIMEQFTRELSKP  897

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
              + +  R  I G   G SQ   + +Y L LW+ + L+K+  TN     K F++L++++FS
Sbjct  898   TKNAFLRGHISGFGYGLSQFLAFCSYALGLWYVSVLIKQKETNFSDSIKSFMVLIVTAFS  957

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   L PD    + A+ +V  +++R   I   P +      T    DIEF  V+F YP
Sbjct  958   VSETLALTPDIVKGTQALQSVFRVLHRETEI--PPDQANSSLVTQIEGDIEFRNVSFTYP  1015

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +RPD+ + +N +L++  G  +A+VG SGSGKST+I +I RFYDP  G++ ++  D++ LN
Sbjct  1016  ARPDIAIFQNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPDSGKLCIDGQDIKTLN  1075

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             L+ LR + ALV QEPALF+ TI ENI +G  NAS TEI EAAK A  H+FIS + +GY+T
Sbjct  1076  LRSLRKKLALVQQEPALFSTTIHENIKYGNENASETEIIEAAKAANAHEFISRMEDGYKT  1135

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG  GVQLSGGQKQR+AIARA+LK   VLLLDEA+SALD  +EK VQ+AL K+    TT
Sbjct  1136  HVGDKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSAEKLVQEALDKLMNGRTT  1195

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             ++VAHRLSTI++A+ IAV+ +G V E GSH +L+ S  +G Y  +   ++
Sbjct  1196  VLVAHRLSTIRKADTIAVLHKGRVVEKGSHRELV-SIPDGFYKQMTSLQE  1244


 Score =   270 bits (691),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 209/526 (40%), Positives = 295/526 (56%), Gaps = 9/526 (2%)
 Frame = -1

Query  1687  QNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTG  1508
             QN +L LV LG   +V+           G + T+++R    KSIL ++  +FD +   + 
Sbjct  92    QN-ALYLVYLGLANLVSAWIGVACWMQTGERQTAQLRINYLKSILAKDITFFDTEARDSN  150

Query  1507  VLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pftLG  1334
              L+  +S D++  +  +GD+   +L  LS    G  I F   W+LTLL  A+       G
Sbjct  151   -LIFHISSDAILVQDAIGDKTDHVLRYLSQFVAGFVIGFLSVWQLTLLTLAVVPLIAIAG  209

Query  1333  ASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTS  1154
               Y ++IM+   +   ++YA A  +A   +S +RTV  F  +E  V+S+  +L +  +  
Sbjct  210   GGY-AIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVESYSNSLKKALKLG  268

Query  1153  VRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQL  974
              R     G  +G +   ++ A++L LW+ + LV+ G TN    +   L ++ S F++GQ 
Sbjct  269   KRSGLAKGLGVGLTYSLLFCAWSLLLWYASLLVRHGKTNGAKAFTTILNVIYSGFALGQA  328

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
             A      +    A   ++ +I    L  S+    G          IEF  V+FAYPSRP+
Sbjct  329   APSLSAITKGRVAAANIIRMIGNNNLESSERLDNGTTLRNVAG-RIEFHRVSFAYPSRPN  387

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
              +V  + S  I+ G   A VG SGSGKST+I M+QRFY+P  G + ++  D++ L LKWL
Sbjct  388   -MVFEDLSFTIRSGKTYAFVGPSGSGKSTIISMVQRFYEPNSGEIFLDGFDIKRLKLKWL  446

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             R Q  LV QEPALFA TI  NI  G  NA   +I EAAK A    FI  LP GY T+VG+
Sbjct  447   REQMGLVSQEPALFATTIASNILLGKANADMDQIIEAAKSANADSFIKSLPNGYNTQVGE  506

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              G QLSGGQKQRIAIARA+L+  K+LLLDEA+SALD ESEK VQ AL  I  + TTIV+A
Sbjct  507   GGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDNIIGKRTTIVIA  566

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             HRLSTI+  + I V+K G V E GSH +L++    G YA LV  ++
Sbjct  567   HRLSTIRNVHKIIVLKNGQVIETGSHSELISR--GGDYANLVNCQE  610



>ref|XP_009609959.1| PREDICTED: ABC transporter B family member 1 [Nicotiana tomentosiformis]
Length=1342

 Score =   355 bits (912),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 220/531 (41%), Positives = 335/531 (63%), Gaps = 10/531 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+G+    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  793   QIAKYCYLLIGVSSAALIFNTLQHFFWDVVGENLTKRVREKMLDAVLKMEMAWFDQEEND  852

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  853   SSRIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVVA  912

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  AV+N+RTVA F+++  IV  F  +L  P R 
Sbjct  913   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSETKIVNLFNSSLQTPLRR  972

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q  +Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  973   CFWKGQIAGSGYGIAQFLLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1032

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAY  809
                LAPD      A+ +V ++++R+  +  D         T+ P     ++EF+ V F+Y
Sbjct  1033  TLTLAPDFIKGGRAMRSVFDLLDRKTEVEPDDPDA-----TAAPDRLRGEVEFKHVDFSY  1087

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPDV + R+ +L+ + G  +ALVG SG GKS++I +I+RFY+P  GRV+++  D+R+ 
Sbjct  1088  PTRPDVSIFRDLNLRARAGKTLALVGPSGCGKSSVIALIERFYEPSSGRVMIDGKDIRKY  1147

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
             NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKF+S LP+GY+
Sbjct  1148  NLKSLRKHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAATLANAHKFVSALPDGYK  1207

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQLSGGQKQRIAIARA L+K++++LLDEA+SALD ESEK VQ+AL +     T
Sbjct  1208  TFVGERGVQLSGGQKQRIAIARAFLRKAELMLLDEATSALDAESEKCVQEALDRACAGKT  1267

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             TIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +GIYA +++ ++
Sbjct  1268  TIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYADGIYARMIQLQR  1318


 Score =   286 bits (732),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 201/512 (39%), Positives = 313/512 (61%), Gaps = 22/512 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  170   GERQTTKMRIKYLEAALNQDIQYFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  228

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA +   +  +  K    + ++A NI   
Sbjct  229   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAIHTITLAKLSGK-SQEALSKAGNIVEQ  287

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA-------  1091
              V  IRTV  F  +   +Q++  AL        + SQ +G   GFS+G   GA       
Sbjct  288   TVVQIRTVLAFVGESKAMQAYSAAL--------KVSQKIGYKSGFSKGLGLGATYFTVFC  339

Query  1090  -YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEI  914
              Y L LW+G YLV+  YTN G        +++   ++GQ A      + A  A   +  I
Sbjct  340   CYALLLWYGGYLVRHHYTNGGLAIATMFAVMIGGLALGQSAPSMTAFAKARVAASKIFRI  399

Query  913   INRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALV  734
             I+ +P +  +  R G + + S    +E + V F+YPSRP++ +L NF+L +  G  +ALV
Sbjct  400   IDHKPSVDRNA-RTGLELD-SVSGQLELKDVDFSYPSRPEIKILDNFNLIVPAGKTIALV  457

Query  733   GASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGE  554
             G+SGSGKST++ +I+RFYDP  G++L++  D++ L LKWLR Q  LV QEPALFA +I E
Sbjct  458   GSSGSGKSTVVSLIERFYDPTSGQLLLDGNDIKTLKLKWLRQQIGLVSQEPALFATSIKE  517

Query  553   NIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAIL  374
             NI  G P+A+  EIEEAA+ A  H FI  LP+G++T+VG+ GVQLSGGQKQRIAIARA+L
Sbjct  518   NILLGRPDATQIEIEEAARVANAHSFIIKLPDGFDTQVGERGVQLSGGQKQRIAIARAML  577

Query  373   KKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAV  194
             K   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V
Sbjct  578   KNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSV  637

Query  193   AEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +E GSHD+LM+   NG+YA L++ ++ A+  A
Sbjct  638   SEIGSHDELMSKGENGMYAKLIKMQETAHETA  669



>ref|NP_001275319.1| P-glycoprotein [Solanum tuberosum]
 gb|AAD10836.1| P-glycoprotein [Solanum tuberosum]
Length=1313

 Score =   355 bits (911),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 221/531 (42%), Positives = 335/531 (63%), Gaps = 10/531 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+G+    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  764   QIAKYCYLLIGVSSAALIFNTLQHYYWDVVGENLTKRVREKMLAAVLKMEMAWFDQEEND  823

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RLS+D+ + RS +GDR SV++   +   V     F L+WRL L+   + P  + 
Sbjct  824   SSRIAARLSLDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIGVFPVVVA  883

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  AV+N+RTVA F+++  IV  F+ +L  P R 
Sbjct  884   ATVLQKMFMKGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSETKIVNLFDSSLQTPLRR  943

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q  +Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  944   CFWKGQIAGSGYGIAQFLLYSSYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1003

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAY  809
                LAPD      A+ +V E+++R+  +  D         T+ P     ++EF+ V F+Y
Sbjct  1004  TLTLAPDFIKGGRAMRSVFELLDRKTEVEPDDPDA-----TAVPDRLRGEVEFKHVDFSY  1058

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPDV + R+ +L+ + G  +ALVG SG GKS++I +I+RFY+P  GRV+++  D+R+ 
Sbjct  1059  PTRPDVSIFRDLNLRARAGKTLALVGPSGCGKSSVISLIERFYEPSSGRVIIDGKDIRKY  1118

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
             NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP+GY+
Sbjct  1119  NLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEITEAATLANAHKFISALPDGYK  1178

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQLSGGQKQRIAIARA L+K++++LLDEA+SALD ESE+ VQ+AL +     T
Sbjct  1179  TFVGERGVQLSGGQKQRIAIARAFLRKAELMLLDEATSALDAESERCVQEALDRACAGKT  1238

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             TIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +GIYA +++ ++
Sbjct  1239  TIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYSDGIYARMIQLQR  1289


 Score =   283 bits (724),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 200/512 (39%), Positives = 311/512 (61%), Gaps = 22/512 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+++R    ++ L Q+  +FD  E  T  +VS ++ D+V  +  + ++    +  +
Sbjct  141   GERQTTKMRIKYLEAALNQDIQYFD-TEVRTSDVVSAINTDAVVVQDAISEKLGNFIHYM  199

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA Y      +  +    + ++A NI   
Sbjct  200   ATFLSGFVVGFTAVWQLALVTLAVVPLIAVIGAIYTVTSAKLSSQ-SQEALSKAGNIVEQ  258

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA-------  1091
              V  IRTV  F  +   +Q++  AL        R SQ +G   GFS+G   GA       
Sbjct  259   TVVQIRTVLVFVGEAKALQAYTAAL--------RVSQKIGYKSGFSKGLGLGATYFTVFC  310

Query  1090  -YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEI  914
              Y L LW+G YLV+  +TN G        +++   ++GQ A      + A  A   +  I
Sbjct  311   CYALLLWYGGYLVRHHFTNGGLAIATMFAVMIGGLALGQSAPSMTAFAKARVAAAKIFRI  370

Query  913   INRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALV  734
             I+ +P +  +  + G + +T     +E + V F+YPSRP++ +L NF+L +  G  +ALV
Sbjct  371   IDHKPSVDRNA-KTGLELDTVSG-QLELKNVEFSYPSRPEIKILNNFNLVVPAGKTIALV  428

Query  733   GASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGE  554
             G+SGSGKST++ +I+RFYDP  G+++++  D++ L LKWLR Q  LV QEPALFA +I E
Sbjct  429   GSSGSGKSTVVSLIERFYDPTSGQLMLDGNDIKTLKLKWLRQQIGLVSQEPALFATSIKE  488

Query  553   NIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAIL  374
             NI  G P+A+  EIEEAA+ A  H F+  LP+G++T+VG+ G+QLSGGQKQRIAIARA+L
Sbjct  489   NILLGRPDATQIEIEEAARVANAHSFVIKLPDGFDTQVGERGLQLSGGQKQRIAIARAML  548

Query  373   KKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAV  194
             K   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V
Sbjct  549   KNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSV  608

Query  193   AEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +E GSHD+LM+   NG+YA L++ ++ A+  A
Sbjct  609   SEIGSHDELMSKGENGMYAKLIKMQEAAHETA  640



>ref|XP_007144334.1| hypothetical protein PHAVU_007G147400g [Phaseolus vulgaris]
 gb|ESW16328.1| hypothetical protein PHAVU_007G147400g [Phaseolus vulgaris]
Length=1344

 Score =   355 bits (912),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 220/527 (42%), Positives = 335/527 (64%), Gaps = 2/527 (0%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  793   EIEKYCYLLIGLSSAALLFNTLQHSFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEENE  852

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RLS+D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  853   SARIAARLSLDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  912

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F++++ IV  F   L  P R 
Sbjct  913   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEKKIVGLFTSNLETPLRR  972

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  973   CFWKGQISGSGYGIAQFALYASYALGLWYASWLVKHGISDFSKTIQVFMVLMVSANGAAE  1032

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
                LAPD      A+ +V ++++RR  I  D              ++E + V F+YP+RP
Sbjct  1033  TLTLAPDFIKGGRAMRSVFDLLDRRTEIEPDDP-DATPVPDHLRGEVELKHVDFSYPTRP  1091

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             D+ V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV+++  D+R+ NLK 
Sbjct  1092  DMSVFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKDIRKYNLKS  1151

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP+G++T VG
Sbjct  1152  LRRHIAVVPQEPCLFATTIYENIAYGHDSATEAEIIEAATLANAHKFISSLPDGFKTFVG  1211

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + GVQLSGGQKQRIAIARA ++K++++LLDEA+SALD+ESE+ VQ+AL +     TTI+V
Sbjct  1212  ERGVQLSGGQKQRIAIARAFVRKAELMLLDEATSALDVESERSVQEALDRACAGKTTIIV  1271

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRLSTI+ AN+IAV+ +G VAE GSH +L+ +  +GIYA +++ ++
Sbjct  1272  AHRLSTIRNANLIAVMDDGKVAEQGSHSQLLKNHPDGIYARMIQLQR  1318


 Score =   286 bits (733),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 195/501 (39%), Positives = 301/501 (60%), Gaps = 6/501 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++R+R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  170   GERQSTRLRIRYLEAALDQDIQFFDTEVRTSDVVFA-INSDAVMVQDAMSEKLGNFIHYM  228

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  + + +  +  K    S + A NI   
Sbjct  229   ATFVSGFVVGFTAVWQLALVTLAVVPIIAVIGGIHTTTLAKLSSK-SQDSLSLAGNIVEQ  287

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V  IR V  F  +   +Q++  +L   ++   R     G  LG +   ++  Y L LW+
Sbjct  288   TVVQIRVVLAFVGESRALQAYSSSLRTAQKIGYRTGFAKGMGLGATYFVVFCCYALLLWY  347

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  YTN G        +++   ++GQ A      + A  A   +  +I+ +P I 
Sbjct  348   GGYLVRHHYTNGGLAIATMFSVMIGGLALGQSAPSMAAFTKARVAAAKIFRVIDHKPGID  407

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
                +  G + E+     +E   V F+YPSRP+V +L NFSL +  G  +ALVG+SGSGKS
Sbjct  408   RKSE-SGLELESVTGL-VELRNVGFSYPSRPEVTILNNFSLSVPAGKTIALVGSSGSGKS  465

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G V+++  D++ L L+WLR Q  LV QEPALFA TI ENI  G P+
Sbjct  466   TVVSLIERFYDPSSGEVMLDGHDVKTLKLRWLRQQIGLVSQEPALFATTIRENILLGRPD  525

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEAA+ A  H FI  LP+GYET+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  526   ADQVEIEEAARVANAHSFIIKLPQGYETQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  585

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V E G+HD+
Sbjct  586   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVTEIGTHDE  645

Query  169   LMASELNGIYATLVRAEQEAY  107
             L A   NG+YA L+R ++ A+
Sbjct  646   LFAKGENGVYAKLIRMQEMAH  666



>ref|XP_004246624.1| PREDICTED: ABC transporter B family member 1 [Solanum lycopersicum]
Length=1332

 Score =   355 bits (911),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 220/531 (41%), Positives = 335/531 (63%), Gaps = 10/531 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+G+    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  783   QIAKYCYLLIGVSSAALIFNTLQHYYWDVVGENLTKRVREKMLAAVLKMEMAWFDQEEND  842

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RLS+D+ + RS +GDR SV++   +   V     F L+WRL L+   + P  + 
Sbjct  843   SSRIAARLSLDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIGVFPVVVA  902

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  AV+N+RTVA F+++  IV  F+ +L  P R 
Sbjct  903   ATVLQKMFMKGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSETKIVNLFDASLQTPLRR  962

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q  +Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  963   CFWKGQIAGSGYGIAQFLLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1022

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAY  809
                LAPD      A+ +V E+++R+  +  D         T+ P     ++EF+ V F+Y
Sbjct  1023  TLTLAPDFIKGGRAMRSVFELLDRKTEVEPDDPDA-----TAAPDRLRGEVEFKHVDFSY  1077

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPDV + R+ +L+ + G  +ALVG SG GKS++I +I+RFY+P  GRV+++  D+R+ 
Sbjct  1078  PTRPDVSIFRDLNLRARAGKTLALVGPSGCGKSSVIALIERFYEPSSGRVIIDGKDIRKY  1137

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
             NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP+GY+
Sbjct  1138  NLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEITEAATLANAHKFISALPDGYK  1197

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQLSGGQKQRIAIARA L+K++++LLDEA+SALD ESE+ VQ+AL +     T
Sbjct  1198  TFVGERGVQLSGGQKQRIAIARAFLRKAELMLLDEATSALDAESERCVQEALDRACAGKT  1257

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             TI+VAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +GIYA +++ ++
Sbjct  1258  TIIVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYSDGIYARMIQLQR  1308


 Score =   280 bits (716),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 200/512 (39%), Positives = 309/512 (60%), Gaps = 22/512 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+++R    ++ L Q+  +FD  E  T  +VS ++ D+V  +  + ++    +  +
Sbjct  160   GERQTTKMRIKYLEAALNQDIQYFD-TEVRTSDVVSAINTDAVVVQDAISEKLGNFIHYM  218

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA Y      +  +    + ++A N    
Sbjct  219   ATFLSGFVVGFTAVWQLALVTLAVVPLIAVIGAIYTMTSAKLSSQ-SQEALSKAGNTVEQ  277

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA-------  1091
              V  IRTV  F  +   +Q++  AL        R SQ +G   GFS+G   GA       
Sbjct  278   TVVQIRTVLAFVGEAKAMQAYTAAL--------RVSQKIGYKSGFSKGFGLGATYFTVFC  329

Query  1090  -YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEI  914
              Y L LW+G YLV+  +TN G        +++   ++GQ A      + A  A   +  I
Sbjct  330   CYALLLWYGGYLVRHHFTNGGLAIATMFAVMIGGLALGQSAPSMTAFAKARVAAAKIFRI  389

Query  913   INRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALV  734
             I+ +P +  +  + G + +T     +E + V F+YPSRP++ +L NF+L +  G  +ALV
Sbjct  390   IDHKPSVDRNA-KTGLELDTVSG-QLELKNVEFSYPSRPEIKILNNFNLVVPAGKTIALV  447

Query  733   GASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGE  554
             G+SGSGKST++ +I+RFYDP  G+++++  D++ L LKWLR Q  LV QEPALFA +I E
Sbjct  448   GSSGSGKSTVVSLIERFYDPTSGQLMLDGNDIKTLKLKWLRQQIGLVSQEPALFATSIKE  507

Query  553   NIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAIL  374
             NI  G P+A+  EIEEAA+ A  H FI  LP+G++T+VG+ G+QLSGGQKQRIAIARA+L
Sbjct  508   NILLGRPDATQIEIEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAML  567

Query  373   KKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAV  194
             K   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G V
Sbjct  568   KNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGNV  627

Query  193   AEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +E GSHD+LM+   NG+YA L++ ++ A+  A
Sbjct  628   SEIGSHDELMSKGENGMYAKLIKMQEAAHETA  659



>ref|XP_010267196.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
1-like [Nelumbo nucifera]
Length=1349

 Score =   355 bits (911),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 221/520 (43%), Positives = 333/520 (64%), Gaps = 2/520 (0%)
 Frame = -1

Query  1672  ILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSR  1493
             +L+G+    ++    Q     + G  LT R+R  + K++LK E  WFD +EN +  + +R
Sbjct  804   LLIGVSSAVLLFNTLQHFFWDVVGENLTKRVREKMLKAVLKNEIAWFDREENESARIAAR  863

Query  1492  LSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLI  1313
             L++D+ + RS +GDR SV++   +   V     F L+WRL+L+  A+ P  + A+    +
Sbjct  864   LALDANNVRSAIGDRISVIMQNSALMLVACTAGFILQWRLSLVLIAVFPVVVAATVLQKM  923

Query  1312  MNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQI  1136
                G   D  +++A+A+ +A  AV+N+RTVA F+++ +IV  F  +L  P R    + QI
Sbjct  924   FMKGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSEANIVGLFSSSLDSPLRRCFWKGQI  983

Query  1135  LGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPD  956
              GS  G +Q  +Y +Y L LW+ ++LVK G ++     ++F++L++S+    +   LAPD
Sbjct  984   AGSCYGVAQFLLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAETLTLAPD  1043

Query  955   TSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRN  776
                   A+ +V ++++R+  I  D        ++ K  ++EF+ V FAYPSRPDV V ++
Sbjct  1044  FIKGGRAMRSVFDLLDRKTEIEPDDPDFTPAPDSLKG-EVEFKHVDFAYPSRPDVQVFQD  1102

Query  775   FSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTAL  596
              SL+ + G  +ALVG SG GKS++I ++QRFYDP  GRVL++  D+R+ NLK LR   AL
Sbjct  1103  LSLRARAGKTLALVGPSGCGKSSVIALVQRFYDPSSGRVLIDGKDVRKYNLKSLRRHMAL  1162

Query  595   VGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqls  416
             V QEP LFA TI +NIA+G  + +  E+ EAA  A  HKFIS LP+GY T VG+ GVQLS
Sbjct  1163  VPQEPCLFAATIHDNIAYGRDSVTEAEVIEAATLANAHKFISSLPDGYGTWVGERGVQLS  1222

Query  415   ggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTI  236
             GGQ+QRIAIARA ++K++V+LLDEA+SALD ESEK +Q+AL +     TTIVVAHRLSTI
Sbjct  1223  GGQRQRIAIARAFIRKAEVMLLDEATSALDTESEKCIQEALERACSGRTTIVVAHRLSTI  1282

Query  235   KEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             + A+VIAV+ +G VAE GSH  L+    +G YA +++ ++
Sbjct  1283  RNAHVIAVIDDGKVAEQGSHSHLLNHYPDGCYARMIQLQR  1322


 Score =   293 bits (750),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 203/512 (40%), Positives = 313/512 (61%), Gaps = 22/512 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD    ++ V+ + ++ D+V  +  + ++    L  L
Sbjct  174   GERQSTKMRIKYLEAALNQDVQFFDTQVRTSDVVFA-INTDAVLVQDAISEKLGNFLHYL  232

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA + + +  +  K    + ++A NIA  
Sbjct  233   ATFVSGFVVGFTAVWQLALVTLAIVPIIALIGAIHTTTLAKLSSK-SQEALSQAGNIAEQ  291

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA-------  1091
              +  IRTV +F  +   ++++  AL        R +Q LG   GF++G   GA       
Sbjct  292   TIVQIRTVLSFVGESRALEAYSSAL--------RVAQKLGYKSGFAKGIGLGATYFTVFC  343

Query  1090  -YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEI  914
              Y L LW+G YLV+  +TN G        +++   ++GQ A      + A  A   +  I
Sbjct  344   CYALLLWYGGYLVRHHFTNGGLAIATMFSVMIGGLALGQSAPSMTAFTKAKVAAAKIFHI  403

Query  913   INRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALV  734
             I+ +P I  + +  G + E S    +E + V F+YPSRPDV +L NFSL +  G  +ALV
Sbjct  404   IDHKPGIDRNTE-SGLELE-SVSGQVELKNVDFSYPSRPDVCILSNFSLNVPAGKTIALV  461

Query  733   GASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGE  554
             G+SGSGKST++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEPALFA TI E
Sbjct  462   GSSGSGKSTVVSLIERFYDPTSGQVLLDGRDIKTLKLRWLRQQIGLVSQEPALFATTIKE  521

Query  553   NIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAIL  374
             N+  G P+A+  E+EEAA+ A  H FI  LPEGY+T VG+ G+QLSGGQKQRIAIARA+L
Sbjct  522   NMLLGRPDATQVEMEEAARVANAHSFIVKLPEGYDTLVGERGLQLSGGQKQRIAIARAML  581

Query  373   KKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAV  194
             K   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+ 
Sbjct  582   KNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSA  641

Query  193   AEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +E G+HD+L+A   NG+YA L+R ++ A+  A
Sbjct  642   SEIGTHDELIAKGENGVYAKLIRMQEMAHETA  673



>emb|CDP19825.1| unnamed protein product [Coffea canephora]
Length=1265

 Score =   354 bits (909),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 236/519 (45%), Positives = 325/519 (63%), Gaps = 5/519 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             SL+LVGLG   +  +  Q  L G+AG KL  RIR+  F+ ++ QE  WFD   NS+G + 
Sbjct  743   SLMLVGLGALTLAIVPVQNYLFGVAGGKLIQRIRSLSFQKVVHQEISWFDDPANSSGAVG  802

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ + RS++GD  ++++  LS+   GL ISF+  W L  +  A+ PF     +  
Sbjct  803   ARLSTDASTMRSLVGDALALVVQNLSTVVTGLVISFTANWILAFIVVAVLPFIGLQGFLQ  862

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
                + G   D    Y  AS +A  AV +IRTVA+F  +E ++ +++K    P +  V++ 
Sbjct  863   AKFHKGFSGDAKVMYEEASQVANDAVGSIRTVASFCAEEKVMDTYQKKCEGPMKYGVKQG  922

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              + G + G    A Y A     W GA L++ G    G V+K+F  L +++  V Q   L 
Sbjct  923   MVSGFSFGLGSSANYLATAFIFWVGARLIEHGKATFGEVFKVFFALTMAALGVSQTTALT  982

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD + A  A  ++ EI++ +P I S    +G+   T K  DIE + V+F YP+RPD+ + 
Sbjct  983   PDINKAKVAAASIFEILDSKPKIDSSSD-EGQVLATVKG-DIELQHVSFRYPTRPDIQIF  1040

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             ++  L I  G  VALVG SGSGKST+I +I+RFY+P  G + ++ V+L +L + WLR Q 
Sbjct  1041  KDLCLLIPSGKTVALVGESGSGKSTVISLIERFYNPDSGHIYLDGVELWKLKINWLRQQM  1100

Query  601   ALVGQEPALFAGTIGENIAFG-FPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              LVGQEP LF  TI +NIA+G   + +  EI  AAK A  H FISGLP+GY+T VG+ GV
Sbjct  1101  GLVGQEPVLFNETIRDNIAYGKRGDVTEEEIIAAAKAANAHNFISGLPQGYDTSVGERGV  1160

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARAILK  K+LLLDEA+SALD ESE+ VQDAL K+    TT+VVAHRL
Sbjct  1161  QLSGGQKQRIAIARAILKDPKILLLDEATSALDAESERIVQDALDKVMVNRTTVVVAHRL  1220

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLV  128
             STIK A++IAVVK G +AE G HD LM    +G+YA+LV
Sbjct  1221  STIKGADIIAVVKNGVIAEKGGHDTLMNIP-DGVYASLV  1258


 Score =   268 bits (686),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 200/525 (38%), Positives = 305/525 (58%), Gaps = 7/525 (1%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
             ++ L  V L  G  +  I Q     + G +  +RIR    K+IL+Q+  +FD  + +TG 
Sbjct  79    HVCLDYVYLAIGAGIASILQMSCWMVTGERQATRIRGLYLKTILRQDISFFD-TQTTTGE  137

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftLGAS  1328
             ++ R+S D+V  +  +G++    +   S+   G  I F   WRL ++  +      +   
Sbjct  138   VIGRMSGDTVLIQEAMGEKVGKFIQFASTFLGGFVIGFIKGWRLAIVLCSCIPALVVAGG  197

Query  1327  YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVR  1148
               +L M+        +YA A N+    +  IRTVA+F+ ++  ++ ++  L     ++ +
Sbjct  198   AMALFMSKMSSRGQIAYADAGNVLEQTIGAIRTVASFTGEKRAIKKYDDKLQLAYESTNK  257

Query  1147  RSQILGSALGFSQGAMYGAYTLTLWFGAYLV-KEGYTNIGAVYKIFLILVLSSFSVGQLA  971
             +  + G  LG     ++  Y L +++G+ LV  +GY+  G V  + + ++L   S+GQ +
Sbjct  258   QGLVSGLGLGTILLIVFSIYGLAIYYGSRLVLTKGYSG-GDVINVMMAIMLGGMSLGQTS  316

Query  970   GLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDV  791
                   S   AA   + E I R P I +     G   E  K  +I+ + V F YP+RP+V
Sbjct  317   PSLNAFSAGQAAAFKMFETIKRVPQIDA-YDNSGIVLEDLKG-EIDLKDVYFKYPARPEV  374

Query  790   IVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLR  611
              +   F+L +  GT  ALVG SGSGKST+I +++RFYDP  G VL++ V++++L +KWLR
Sbjct  375   QIFSGFTLHVPSGTTAALVGHSGSGKSTVISLLERFYDPEAGEVLVDGVNIKQLQIKWLR  434

Query  610   SQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              +  LV QEP LFA +I ENI +G P A+ +EI  A + A   KFI  LP+G +T VG+ 
Sbjct  435   DKLGLVSQEPILFATSIRENILYGKPGATDSEIRTAIELANAAKFIDKLPKGLDTMVGEH  494

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQDAL K+    TT+VVAH
Sbjct  495   GTQLSGGQKQRIAIARAILKNPRILLLDEATSALDAESERIVQDALDKVMINRTTVVVAH  554

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             RL+TI+ A++IAVV  G + E G+H +L+  + NG Y  LVR ++
Sbjct  555   RLTTIRNADLIAVVHAGKLVEQGTHSELI-KDPNGAYYQLVRMQE  598



>ref|XP_010095132.1| ABC transporter B family member 9 [Morus notabilis]
 gb|EXB58298.1| ABC transporter B family member 9 [Morus notabilis]
Length=1281

 Score =   354 bits (909),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 237/526 (45%), Positives = 327/526 (62%), Gaps = 7/526 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +LI +GLG    V +  Q  L G+AG KL  RIR+  F+ ++ QE  WFD   NS+G + 
Sbjct  759   ALIYMGLGLLNFVVIPVQNFLFGVAGGKLVQRIRSLTFEKVIHQEISWFDDPANSSGAIG  818

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ + RS++GD  ++++  +++   GL ISF+  W L L+  A++P  +   +  
Sbjct  819   ARLSSDASTIRSLVGDALALIVQNIATITSGLIISFTANWILALIILAVSPLMIIQGFLQ  878

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
                  G   D    Y  AS +A  AV +IRTVA+F  ++ +++ ++K    P +T VR  
Sbjct  879   AKFLKGFSADAKVMYEEASQVANDAVGSIRTVASFCAEKKVMEMYQKKCEVPMKTGVRLG  938

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   GFS   +Y       + GA LVK+G    G V+K+F  L L++  V Q   LA
Sbjct  939   LISGGGFGFSFLVLYNVNAFIFYIGAVLVKDGKATFGEVFKVFFALTLAAMGVSQTTALA  998

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD+S A  +  ++ +I++R+P I S    +G    T    DIE + V+F YP+RP+V + 
Sbjct  999   PDSSKAKDSAASIFKILDRKPKIDSSSD-EGVTLPTVTG-DIELQHVSFRYPTRPNVEIF  1056

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+ SL I  G  VALVG SGSGKST+I +I+RFYDP+ G V ++ V++++L L WLR Q 
Sbjct  1057  RDLSLTIPSGKTVALVGESGSGKSTVISLIERFYDPLSGLVTLDGVEIKKLKLNWLRQQM  1116

Query  601   ALVGQEPALFAGTIGENIAFGFP-NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              LV QEP LF  TI  NIA+G     +  EI  A K +  H FIS LP GY+T VG+ G 
Sbjct  1117  GLVSQEPVLFNETIRTNIAYGKQGEVTEEEIIAATKASNAHNFISSLPNGYDTPVGERGT  1176

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQRIAIARAILK  KVLLLDEA+SALD ESE+ VQDAL ++    TT+VVAHRL
Sbjct  1177  QLSGGQKQRIAIARAILKNPKVLLLDEATSALDAESERVVQDALDRVMVDRTTVVVAHRL  1236

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELN-GIYATLVRAEQEA  110
             +TIK A++IAVVK G +AE G HD+LM  ++N G YA+LV   + A
Sbjct  1237  TTIKGADIIAVVKNGVIAEKGKHDELM--KINGGAYASLVALHKSA  1280


 Score =   280 bits (715),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 209/530 (39%), Positives = 303/530 (57%), Gaps = 7/530 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +   +SL  V L  G  +    Q     + G +  +RIR    ++IL+Q+  +FD  E +
Sbjct  91    EVSKVSLDFVYLAIGTSIASFLQVACWMVTGERQATRIRGLYLETILRQDIAFFD-TETT  149

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaa-altpftL  1337
             TG ++ R+S D++  +  +G++    +  +S+   G  I+F   W LTL+    +    L
Sbjct  150   TGEVIGRMSGDTILIQDAMGEKVGKFIQLVSTFLGGFVIAFVKGWLLTLVLLGCIPLIVL  209

Query  1336  GASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
                  + IM+        +YA A N+    V +IRTVA F+ ++  ++ +   L      
Sbjct  210   AGGAMATIMSKMASRGQVAYAEAGNVVEQTVGSIRTVAAFTGEKKAIEKYNSKLVIAYNM  269

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVG  980
               ++    G  LG     ++G Y L +WFG+ L+ E GYT  G V  +   ++    S+G
Sbjct  270   MAKQGLASGLGLGTVLLIVFGTYGLAVWFGSKLIIEKGYTG-GEVINVIFAIMTGGMSLG  328

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q +      +   AA   + E I R+P I +     G   E  +  +IE + V F YP+R
Sbjct  329   QTSPCLNAFASGKAAAYKMFETIKRKPNIDA-YDTNGIVLEDMRG-EIELKNVYFRYPAR  386

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV +   FSL +  GT  ALVG SGSGKST+I +++RFYDP  G VL++ VDL+ L LK
Sbjct  387   PDVQIFAGFSLHVPSGTTTALVGQSGSGKSTVISLLERFYDPDSGEVLIDGVDLKRLQLK  446

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             W+R +  LV QEP LFA TI ENIA+G  NA+  EI+ A + A   KFI  LPEG  T  
Sbjct  447   WIREKIGLVSQEPVLFATTIRENIAYGKENATEEEIKTAIELANAAKFIYKLPEGLNTLA  506

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT+V
Sbjct  507   GEHGTQLSGGQKQRIAIARAILKNPRILLLDEATSALDTESERIVQEALVRVMANRTTVV  566

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             VAHRL+TIK A++IAVV +G + E G+H +L+ S   G Y+ L+R ++ A
Sbjct  567   VAHRLTTIKNADIIAVVHQGKIVEKGTHTELI-SNPEGAYSQLIRLQEGA  615



>gb|AIU41628.1| ABC transporter family protein [Hevea brasiliensis]
Length=1363

 Score =   355 bits (910),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 217/524 (41%), Positives = 335/524 (64%), Gaps = 10/524 (2%)
 Frame = -1

Query  1672  ILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSR  1493
             +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN +  + +R
Sbjct  818   LLIGLSSAALIFNTLQHFFWDIVGENLTKRVREKMLSAVLKNEMAWFDQEENESARIAAR  877

Query  1492  LSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSLI  1313
             L++D+ + RS +GDR SV++   +   V     F L+WRL L+  ++ P  + A+    +
Sbjct  878   LALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLISVFPLVVAATVLQKM  937

Query  1312  MNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQI  1136
                G   D  +++A+A+ +A  A++N+RTVA F+++  IV  F+  L  P R    + QI
Sbjct  938   FMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSESQIVGLFDTNLQIPLRRCFWKGQI  997

Query  1135  LGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPD  956
              GS  G +Q ++Y +Y L LW+ ++LVK G ++     ++F++L++S+    +   LAPD
Sbjct  998   AGSGFGIAQFSLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAETLTLAPD  1057

Query  955   TSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAYPSRPDVI  788
                   A+ +V ++++R+  I  D         T+ P     ++E + V F+YP+RPDV 
Sbjct  1058  FIKGGRAMRSVFDLLDRKTEIEPDDPDA-----TAVPDRLRGEVELKHVDFSYPTRPDVP  1112

Query  787   VLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRS  608
             + R+ +L+ + G  +ALVG SG GKS++I +IQRFY+P  GRV+++  D+R+ NLK LR 
Sbjct  1113  IFRDLNLRARAGKTLALVGPSGCGKSSVIALIQRFYEPSSGRVMIDGKDIRKYNLKSLRK  1172

Query  607   QTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsg  428
               A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFISGLP+GY+T VG+ G
Sbjct  1173  HIAMVPQEPCLFAATIYENIAYGHESATEAEIIEAATLANAHKFISGLPDGYKTFVGERG  1232

Query  427   vqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHR  248
             VQLSGGQKQRIAIARA++++++++LLDEA+SALD ESE+ VQ+AL +     TTIVVAHR
Sbjct  1233  VQLSGGQKQRIAIARALVRRAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHR  1292

Query  247   LSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             LSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1293  LSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1336


 Score =   293 bits (749),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 200/505 (40%), Positives = 306/505 (61%), Gaps = 8/505 (2%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+R+R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    L  +
Sbjct  188   GERQTTRMRIKYLEAALNQDIQYFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFLHYM  246

Query  1423  SSAAVGLGISFSLEWRltllaaaltpftLGASYFSLIMNVGPKLDNSS---YARASNIAA  1253
             ++   G  + F+  W+L L+  A+ P    A   ++  N   KL   S    ++A NI  
Sbjct  247   ATFVSGFVVGFTAVWQLALVTLAVVPLI--AVIAAIHTNTLAKLSGKSQEALSQAGNIVE  304

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
               +  IR V  F  +   +Q +  AL   +R   +     G  LG +   ++  Y L LW
Sbjct  305   QTIVQIRVVLAFVGESRALQGYSSALKVAQRVGYKSGFAKGMGLGATYFVVFCCYALLLW  364

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             +G YLV+  YTN G        +++   ++GQ A      + A  A   +  II+ +P +
Sbjct  365   YGGYLVRHHYTNGGLAIATMFAVMIGGLALGQSAPSMGAFAKAKVAATKIFRIIDHKPAV  424

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
               + +  G + ++     +E + V F+YPSRPDV +L NF+L +  G  +ALVG+SGSGK
Sbjct  425   DRNSE-SGLELDSVTGL-VELKNVDFSYPSRPDVRILNNFTLNVSAGKTIALVGSSGSGK  482

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEPALFA TI ENI  G P
Sbjct  483   STVVSLIERFYDPNSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTIKENILLGRP  542

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
             +A   EIEEAA+ A  H FI  LPEG++T+VG+ G+QLSGGQKQRIAIARA+LK   +LL
Sbjct  543   DADQIEIEEAARVANAHSFIVKLPEGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILL  602

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V E G+HD
Sbjct  603   LDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVTEIGTHD  662

Query  172   KLMASELNGIYATLVRAEQEAYAFA  98
             +L+A   NG+YA L+R ++ A+  A
Sbjct  663   ELIAKGENGVYAKLIRMQEMAHETA  687



>ref|XP_010481062.1| PREDICTED: ABC transporter B family member 11-like isoform X2 
[Camelina sativa]
Length=1287

 Score =   354 bits (908),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 232/527 (44%), Positives = 329/527 (62%), Gaps = 7/527 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             ++I V LG   ++    Q  L  +AG KL  RIR+  F+  +  E GWFD  +NS+G + 
Sbjct  762   AIIFVALGVTSLIVSPTQMYLFAVAGGKLIRRIRSMCFERAVHMEVGWFDEPQNSSGTMG  821

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+   R+++GD  S+ +   +SAA GL I+F+  W L L+   + P      Y  
Sbjct  822   ARLSADAALIRALVGDALSLAVQNAASAASGLIIAFTACWELALIILVMLPLIGINGYVQ  881

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D  S Y  AS +A  AV +IRTVA+F  +E ++Q ++K    P +  +++ 
Sbjct  882   VKFMKGFSADAKSKYEEASQVANDAVGSIRTVASFCAEEKVMQMYKKQCEGPIKDGIKQG  941

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   GFS   ++  Y  + + GA LV++G T    V+++F  L +++  V Q +  A
Sbjct  942   FISGLGFGFSFFILFSVYATSFYAGARLVEDGKTTFNDVFQVFFALTMAAIGVSQSSSFA  1001

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD+S A  A  ++  II+R+  I S  +  G   E  K  DIE   ++F YP+RPD+ + 
Sbjct  1002  PDSSKAKVAAASIFAIIDRKSKIDSSDE-SGTVLENVKG-DIELRHLSFTYPARPDIQIF  1059

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+  L I+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ V+L++L LKWLR Q 
Sbjct  1060  RDLCLTIRAGKTVALVGESGSGKSTVISLLQRFYDPDSGHITLDGVELKKLQLKWLRQQM  1119

Query  601   ALVGQEPALFAGTIGENIAFGF---PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              LVGQEP LF  TI  NIA+G      A+ +EI  AA+ A  HKFIS + +GY+T VG+ 
Sbjct  1120  GLVGQEPVLFNDTIRANIAYGKGSEDTATESEIIAAAELANAHKFISSIQQGYDTVVGER  1179

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G+QLSGGQKQR+AIARAI+K+ K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAH
Sbjct  1180  GIQLSGGQKQRVAIARAIVKEPKILLLDEATSALDAESERVVQDALDRVMVNRTTVVVAH  1239

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             RLSTIK A+VIAVVK G +AE G+H+ L+  +  GIYA+LV+    A
Sbjct  1240  RLSTIKNADVIAVVKNGVIAEKGTHETLIKID-GGIYASLVQLHMTA  1285


 Score =   286 bits (731),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 211/526 (40%), Positives = 317/526 (60%), Gaps = 9/526 (2%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              + L  V LG G +     Q     + G +  SRIR+   K+IL+Q+ G+FD + N TG 
Sbjct  102   KVCLKFVYLGLGTLGAAFLQVACWMITGERQASRIRSTYLKTILRQDIGFFDVETN-TGE  160

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEW--RltllaaaltpftLGA  1331
             +V R+S D+V  +  +G++    +  +S+   G  ++F   W   L +L +       GA
Sbjct  161   VVGRMSGDTVLIQDAMGEKVGKFIQLVSTFVGGFVLAFIKGWLLTLVMLTSIALLAMAGA  220

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
             S  +L +        ++YA+A+ +    + +IRTVA+F+ ++  V S++K ++   ++SV
Sbjct  221   S-MALFVTRASSRGQAAYAKAATVVEQTIGSIRTVASFTGEKQAVNSYKKFITSAYKSSV  279

Query  1150  RRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQL  974
             ++    G  LG      + +Y L +WFG  ++ E GYT  GAV  + +I+V  S S+GQ 
Sbjct  280   QQGFSTGLGLGVMFFVFFSSYALAIWFGGKMIIEKGYTG-GAVINVIIIVVAGSMSLGQT  338

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
             +      +   AA   + E + R+PL  +  +  G   E  +  DIE + V F+YP+RPD
Sbjct  339   SPCVTAFAAGQAAAYKMFETLKRKPLTDA-YEVNGTVLEDIRG-DIELKDVHFSYPARPD  396

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
               +   FSL I  G   ALVG SGSGKST+I +I+RFYDP  G VL++ V+L+E  LKW+
Sbjct  397   EDIFNGFSLFIPSGATAALVGESGSGKSTVISLIERFYDPKAGEVLIDGVNLKEFQLKWI  456

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             RS+  LV QEP LF+ +I ENIA+G  NA+  EI+ A + A   KFI  LP+G +T VG+
Sbjct  457   RSKIGLVSQEPVLFSSSIMENIAYGKDNATLQEIKAATELANAAKFIDKLPQGLDTMVGE  516

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT++VA
Sbjct  517   HGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRVMVNRTTVIVA  576

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             HRLST++ A++IAV+  G + E GSH +L+  +  G Y+ L+R ++
Sbjct  577   HRLSTVRNADMIAVIHRGKMVEKGSHSELL-KDSEGAYSQLIRLQE  621



>ref|XP_002992781.1| hypothetical protein SELMODRAFT_236608 [Selaginella moellendorffii]
 gb|EFJ06167.1| hypothetical protein SELMODRAFT_236608 [Selaginella moellendorffii]
Length=1188

 Score =   352 bits (904),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 226/527 (43%), Positives = 328/527 (62%), Gaps = 5/527 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             L+ +    SLIL G     + + + Q    G  G  LT R+R  +F  IL  E  WFD +
Sbjct  653   LKKEVSKFSLILTGSTICVVFSHMLQHYSFGAMGESLTKRVREMMFLGILNNEISWFDEE  712

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             +N  G++ SRL+ D+   R V+ DR S ++  L+   V   I++ LEWR+ ++  A  P 
Sbjct  713   DNRCGLVASRLASDATMVRVVIADRMSTIVQNLALMFVAFFIAYVLEWRVAVVITATFPL  772

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              L A     +   G   D S +Y+RAS +A+ AV NIRTVA F +++ ++ SF + L  P
Sbjct  773   LLIALVGEQMFLKGFSGDLSKAYSRASTVASEAVGNIRTVAAFCSEKKVIDSFVRELQVP  832

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             KR    R  + G   G SQ  +Y +Y L LW+ + L+K+G T      K F+++++++F 
Sbjct  833   KRKVFLRGHVAGVCYGISQFFLYTSYALGLWYSSVLIKKGVTGFANAIKTFMVIIITAFG  892

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +    APD    S A+ AV EI++R+  I  +P  +  +    K  D++F  V F+YP
Sbjct  893   VAETLATAPDLIKGSQALYAVFEIMDRKGQI--NPNTRAMEISNVKG-DVDFRHVEFSYP  949

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             +R DV++ R+ SL+I+ G  +ALVGASGSGKS+++ +IQRFYDP+ G ++++  ++R LN
Sbjct  950   ARKDVVIFRDLSLRIRAGKSLALVGASGSGKSSVVALIQRFYDPVSGYIMIDGKNIRSLN  1009

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             L+ LR    LV QEPALF+ +I ENI +G   AS  EI +AAK A  H FIS LP GY+T
Sbjct  1010  LQSLRRHIGLVQQEPALFSCSIYENILYGKEGASEAEIVQAAKTANAHGFISSLPNGYQT  1069

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
             +VG+ GVQLSGGQKQR+AIARA+LK   +LLLDEA+SALD  SEK VQ+AL ++ +  TT
Sbjct  1070  QVGERGVQLSGGQKQRVAIARAVLKCPAILLLDEATSALDAHSEKQVQEALDRVMRGRTT  1129

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             ++VAHR S I+ A++IAVV++G V E GS  +L+ S  N  Y  LV+
Sbjct  1130  LIVAHRFSAIRNADIIAVVQDGTVVEQGSPKELL-SNRNSAYFQLVK  1175


 Score =   273 bits (697),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 186/492 (38%), Positives = 296/492 (60%), Gaps = 8/492 (2%)
 Frame = -1

Query  1606  AGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMG  1427
             +G + +++IR    KSIL Q+ G+FD D    G +V+++S D +  +  + ++   L+  
Sbjct  64    SGERQSAKIRIKYLKSILVQDVGFFDTD-MCVGEIVNQISSDILIIQDAISEKAGNLIHF  122

Query  1426  LSSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
             L+    GL   F   W+L L+  A+       G +Y   ++N   K   ++   A  IA 
Sbjct  123   LARFIGGLVAGFVAVWQLALITVAVVPAIALAGGAYAVSLINTAAKSQKAN-EEAGKIAE  181

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
               ++ +RTV +F  +    +++  AL    R   R   + G  +G + G +  A+ L LW
Sbjct  182   QVIAQVRTVYSFGGEARAAKAYSDALQPTLRLGKRAGLVKGLGIGVTYGLVLCAWALLLW  241

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             +   L++ G ++ G  +   L +V+S FS+GQ     P  +   AA   +++++ RRP +
Sbjct  242   YAGVLIRHGMSDAGKAFTTILNIVVSGFSLGQAFSNFPALAEGRAAASNIIQMVKRRPAM  301

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
               +  + GR  E     DIE   + F+YPSRP+ +VL++FSL +  G  +A++G+SGSGK
Sbjct  302   LHN--QGGRLEEVYG--DIELRNICFSYPSRPESLVLKDFSLMVPAGKTIAIIGSSGSGK  357

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST++ +I+RFYDP+ G VL++  +++ L L+WLR Q  LV QEP LFA TI EN+ +   
Sbjct  358   STVVSLIERFYDPLSGDVLLDGTNIKYLELQWLRKQIGLVSQEPILFATTIRENLLYSKE  417

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
             +A+  E+ E +K +  H+FI   PEGYET+VG+ GVQLSGG+KQR+A+ARA+LK  K+LL
Sbjct  418   DATMEELIEVSKASNAHEFIDLFPEGYETQVGERGVQLSGGEKQRVALARAMLKNPKILL  477

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD  S++ VQDAL +     TT+V+AH+LSTI+ A+ IAVV  G + E G+H+
Sbjct  478   LDEATSALDTGSQQLVQDALDRFRVGRTTVVIAHQLSTIRHADSIAVVHHGRIVEMGTHE  537

Query  172   KLMASELNGIYA  137
             +L+A    G ++
Sbjct  538   ELLAKGEKGYWS  549



>ref|XP_008804465.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Phoenix dactylifera]
Length=1275

 Score =   353 bits (907),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 231/532 (43%), Positives = 335/532 (63%), Gaps = 4/532 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    + VG G   +V+ + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  746   MERKTRQYVFMYVGTGLYAVVSYLVQHYFFSIMGENLTTRVRRMMLAAILRNELGWFDEE  805

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++ ++ + L+ D+   +SV+ +R SV+L  ++S      + F +EWR+ LL  A  P 
Sbjct  806   ENNSSLVAAHLATDAADVKSVIAERISVILQNMTSLLTSFIVGFIVEWRVALLIIATFPL  865

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++AR S IA   VSNIRTVA F+ Q+ I+  F   L  P
Sbjct  866   LVLANFAQQLSLKGFAGDMAKAHARTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELEVP  925

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
             ++ S+RRSQ  G   G SQ ++Y +  L LW+GA+LV  G +    V K+F+ILV+++ S
Sbjct  926   QQCSLRRSQTSGLLFGLSQLSLYSSEALILWYGAHLVHSGASTFSKVIKVFVILVITANS  985

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   LAP+      +I +V  I+NR   I  DP     K   S   +IE   V FAYP
Sbjct  986   VAETVSLAPEIIRGGESIRSVFSILNRLTRI--DPDDPEAKPVGSIRGEIELRHVDFAYP  1043

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRPD+ V  +F+L+I  G   ALVGASG GKST+I +I+RFYDP  G+V+++  D+R LN
Sbjct  1044  SRPDIPVFEDFNLRIHAGLSQALVGASGCGKSTVIALIERFYDPTAGKVMIDGEDIRGLN  1103

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             LK LR +  LV QEP LFA +I ENIA+G   A+  E+ EAA+ A +H F+S LP+GY+T
Sbjct  1104  LKSLRLKIGLVQQEPVLFAASIFENIAYGKDGATEDEVLEAARAANVHGFVSALPKGYKT  1163

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQKQRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ +  TT
Sbjct  1164  PVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALEQLMRGRTT  1223

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             ++VAHRLSTI+  + IAVV++G + E GSH +L+A   +G Y  L++ +   
Sbjct  1224  VLVAHRLSTIRGVDSIAVVQDGHIVEQGSHAELVA-RADGAYVRLLQLQHHC  1274


 Score =   286 bits (732),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 204/507 (40%), Positives = 300/507 (59%), Gaps = 20/507 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++LKQ+ G+FD D   TG +V  +S D++S +  + ++F   +  L
Sbjct  133   GERQAGALRRRYLEAVLKQDVGFFDTDAR-TGDIVFSVSTDTLSVQDAISEKFGNFIHYL  191

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA A  +A  
Sbjct  192   STFLAGLVVGFISAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSK-SRESYANAGIVAEQ  250

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             A++ +RTV +F  +   + S+ +A+    +   +     G  +G + G    ++ L  W+
Sbjct  251   AIAQVRTVYSFVGESKALDSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWY  310

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ        S   AA   ++EII ++P I 
Sbjct  311   AGVFIRNGQTDGGKAFTAIFSAIVGGMSLGQAFSNLGAFSKGKAAGYKLMEIIQQKPSII  370

Query  889   SD-------PQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVG  731
              D       P+  G         ++EF+ VTF+YPSRPDVI+ R+FSL    G   A+VG
Sbjct  371   QDLSDGKCLPEVHG---------NLEFKDVTFSYPSRPDVIIFRDFSLSFPAGKTTAVVG  421

Query  730   ASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGEN  551
              SGSGKST++ +I+RFYDP QG++L++ VD++ L LKWLR Q  LV QEPALFA TI EN
Sbjct  422   GSGSGKSTVVVLIERFYDPNQGQILLDNVDIKTLQLKWLREQIGLVSQEPALFATTILEN  481

Query  550   IAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILK  371
             I +G P A+  E+E AA  A  H FIS LP GY T+ G+ GVQLSGGQKQRIAIARA+LK
Sbjct  482   ILYGKPGATIAEVEAAASAANAHNFISLLPNGYNTQAGERGVQLSGGQKQRIAIARAMLK  541

Query  370   KSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVA  191
               K+LLLDEA+SALD  SE  VQ+AL ++    TT+VVAHRLSTI+  ++IAV+++G + 
Sbjct  542   NPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDMIAVIQQGQIV  601

Query  190   EYGSHDKLMASELNGIYATLVRAEQEA  110
             E G+H++L+A   +G YA+L+R ++ A
Sbjct  602   ETGTHEELLAKGTSGAYASLIRFQEMA  628



>ref|XP_006827168.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
 gb|ERM94405.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
Length=1252

 Score =   353 bits (906),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 228/522 (44%), Positives = 332/522 (64%), Gaps = 4/522 (1%)
 Frame = -1

Query  1702  LQLQCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFD  1523
             ++ + +    + +G G   ++  + Q     + G  LT+R+R  +  +IL+ E GWFD +
Sbjct  721   MESKTREFVFMYIGAGLYAVIAYLVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEE  780

Query  1522  ENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpf  1343
             EN++  + SRL+ D+ + +S + +R SV+L  ++S      ++F +EWR++LL  A  P 
Sbjct  781   ENNSSQVASRLATDATTVKSAIAERMSVILQNMTSLLTSFIVAFIIEWRVSLLILATFPL  840

Query  1342  tLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEP  1166
              + A++   +   G   D + ++A+AS +A   VSNIRTVA F+ Q  ++  F + L  P
Sbjct  841   LVFANFAQQLSLKGFAGDTAKAHAKASMVAGEGVSNIRTVAAFNAQSKLLALFRRELRPP  900

Query  1165  KRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFS  986
                ++RRSQI G   G SQ A+Y +  L LW+GA LV+ G +    V K+F++LV+++ S
Sbjct  901   AHRALRRSQIAGLLFGVSQLALYASEALILWYGARLVQHGTSTFSRVIKVFVVLVITANS  960

Query  985   VGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYP  806
             V +   L P+    S A+ +V  I++R   I  DP  K      S   +IEF  V F+YP
Sbjct  961   VAETVSLTPEIIRGSEALSSVFSILDRPTAI--DPDDKDADPIESIRGEIEFRHVDFSYP  1018

Query  805   SRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELN  626
             SRP+V VL+  +L+I+ G  +ALVGASGSGKS+++ +I+RFYDP  GRV ++  D+R LN
Sbjct  1019  SRPEVQVLKALNLRIRAGQSLALVGASGSGKSSILALIERFYDPSAGRVTIDGRDIRRLN  1078

Query  625   LKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYET  446
             L+ LR +  LV QEP LFA TI +NI++G   A+  E+ EAAK A  H FIS LP+GY+T
Sbjct  1079  LRDLRKRIGLVQQEPILFAATIHDNISYGREGATEAEVIEAAKAANAHGFISALPDGYKT  1138

Query  445   kvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATT  266
              VG+ GVQLSGGQ+QRIAIARA+LK   VLLLDEA+SALD ESE  +Q+AL ++ K  TT
Sbjct  1139  AVGERGVQLSGGQRQRIAIARAVLKDPAVLLLDEATSALDAESEHVLQEALERLMKGRTT  1198

Query  265   IVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIY  140
             +VVAHRLSTI+  + I VV++G V E GSH +L AS   G Y
Sbjct  1199  VVVAHRLSTIRGVDSIGVVQDGRVVEQGSHGEL-ASRPEGAY  1239


 Score =   289 bits (739),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 209/530 (39%), Positives = 308/530 (58%), Gaps = 6/530 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             +    +L  V LG     +   +       G +  S +R    +++LKQ+ G+FD D   
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIACWMYTGERQVSALRKKYLEAVLKQDVGFFDTDAR-  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt--pft  1340
             TG +V  +S D++  +  + ++    +  +S+   GL + F   WRL LL+ A+      
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYMSTFLAGLVVGFVSAWRLALLSIAVIPGIAF  197

Query  1339  LGASYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKR  1160
              G  Y   +  +  K    SYA A  IA  A++ IRTV ++  +   + S+ +A+    +
Sbjct  198   AGGLYAYTLTGLTSK-SQQSYASAGIIAEEAIAQIRTVYSYVGESKALGSYSEAIQNTLK  256

Query  1159  TSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVG  980
                +     G  +G + G    ++ L  W+    ++ G T+ G  +      ++   S+G
Sbjct  257   LGYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTAIFSAIVGGMSLG  316

Query  979   QLAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSR  800
             Q        S    A   ++EII ++P I  D Q +G   E  +  +IEF+ VTF+YPSR
Sbjct  317   QSFSNLGAFSKGKVAGYKLMEIIQQKPSIIQD-QAEGNILEQVQG-NIEFKDVTFSYPSR  374

Query  799   PDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLK  620
             PDV++ R+ S+    G  VA+VG SGSGKST++ +I+RFYDP QG VL++ VD+R L L+
Sbjct  375   PDVVIFRSLSILFPAGKTVAVVGGSGSGKSTVVALIERFYDPNQGHVLLDNVDIRTLQLR  434

Query  619   WLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkv  440
             WLR Q  LV QEPALFA TI ENI +G P+A+  E+E AA  A  H FI+ LP GY+T+V
Sbjct  435   WLRDQIGLVNQEPALFATTIRENILYGKPDATNDEVEAAAAAANAHSFIALLPNGYDTQV  494

Query  439   gqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIV  260
             G+ GVQLSGGQKQR+AIARA+LK  K+LLLDEA+SALD  SE  VQ+AL ++    TT+V
Sbjct  495   GERGVQLSGGQKQRVAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVV  554

Query  259   VAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             VAHRLSTI+  + IAV++ G VAE G+HD+L+A   +G YA L+R ++ A
Sbjct  555   VAHRLSTIRNVDTIAVIQNGRVAELGNHDELLAKAPSGAYANLIRFQEIA  604



>ref|XP_006354367.1| PREDICTED: ABC transporter B family member 1 [Solanum tuberosum]
Length=1333

 Score =   354 bits (908),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 221/531 (42%), Positives = 335/531 (63%), Gaps = 10/531 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+G+    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  784   QIAKYCYLLIGVSSAALIFNTLQHYYWDVVGENLTKRVREKMLAAVLKMEMAWFDQEEND  843

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RLS+D+ + RS +GDR SV++   +   V     F L+WRL L+   + P  + 
Sbjct  844   SSRIAARLSLDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIGVFPVVVA  903

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  AV+N+RTVA F+++  IV  F+ +L  P R 
Sbjct  904   ATVLQKMFMKGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSETKIVNLFDSSLQIPLRR  963

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q  +Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  964   CFWKGQIAGSGYGIAQFLLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1023

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAY  809
                LAPD      A+ +V E+++R+  +  D         T+ P     ++EF+ V F+Y
Sbjct  1024  TLTLAPDFIKGGRAMRSVFELLDRKTEVEPDDPDA-----TAVPDRLRGEVEFKHVDFSY  1078

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPDV + R+ +L+ + G  +ALVG SG GKS++I +I+RFY+P  GRV+++  D+R+ 
Sbjct  1079  PTRPDVSIFRDLNLRARAGKTLALVGPSGCGKSSVISLIERFYEPSSGRVIIDGKDIRKY  1138

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
             NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKFIS LP+GY+
Sbjct  1139  NLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEITEAATLANAHKFISALPDGYK  1198

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQLSGGQKQRIAIARA L+K++++LLDEA+SALD ESE+ VQ+AL +     T
Sbjct  1199  TFVGERGVQLSGGQKQRIAIARAFLRKAELMLLDEATSALDAESERCVQEALDRACAGKT  1258

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             TIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +GIYA +++ ++
Sbjct  1259  TIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYSDGIYARMIQLQR  1309


 Score =   283 bits (723),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 200/512 (39%), Positives = 311/512 (61%), Gaps = 22/512 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+++R    ++ L Q+  +FD  E  T  +VS ++ D+V  +  + ++    +  +
Sbjct  161   GERQTTKMRIKYLEAALNQDIQYFD-TEVRTSDVVSAINTDAVVVQEAISEKLGNFIHYM  219

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA Y      +  +    + ++A NI   
Sbjct  220   ATFLSGFVVGFTAVWQLALVTLAVVPLIAVIGAIYTVTSAKLSSQ-SQEALSKAGNIVEQ  278

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA-------  1091
              V  IRTV  F  +   +Q++  AL        R SQ +G   GFS+G   GA       
Sbjct  279   TVVQIRTVLVFVGEAKALQAYTAAL--------RVSQKIGYKSGFSKGLGLGATYFTVFC  330

Query  1090  -YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEI  914
              Y L LW+G YLV+  +TN G        +++   ++GQ A      + A  A   +  I
Sbjct  331   CYALLLWYGGYLVRHHFTNGGLAIATMFAVMIGGLALGQSAPSMTAFAKARVAAAKIFRI  390

Query  913   INRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALV  734
             I+ +P +  +  + G + +T     +E + V F+YPSRP++ +L NF+L +  G  +ALV
Sbjct  391   IDHKPSVDRNA-KTGLELDTVSG-QLELKNVEFSYPSRPEIKILNNFNLVVPAGKTIALV  448

Query  733   GASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGE  554
             G+SGSGKST++ +I+RFYDP  G+++++  D++ L LKWLR Q  LV QEPALFA +I E
Sbjct  449   GSSGSGKSTVVSLIERFYDPTSGQLMLDGNDIKTLKLKWLRQQIGLVSQEPALFATSIKE  508

Query  553   NIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAIL  374
             NI  G P+A+  EIEEAA+ A  H F+  LP+G++T+VG+ G+QLSGGQKQRIAIARA+L
Sbjct  509   NILLGRPDATQIEIEEAARVANAHSFVIKLPDGFDTQVGERGLQLSGGQKQRIAIARAML  568

Query  373   KKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAV  194
             K   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V
Sbjct  569   KNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSV  628

Query  193   AEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +E GSHD+LM+   NG+YA L++ ++ A+  A
Sbjct  629   SEIGSHDELMSKGENGMYAKLIKMQEAAHETA  660



>ref|XP_001784127.1| ATP-binding cassette transporter, subfamily B, member 13, group 
MDR/PGP protein PpABCB13 [Physcomitrella patens]
 gb|EDQ51051.1| ATP-binding cassette transporter, subfamily B, member 13, group 
MDR/PGP protein PpABCB13 [Physcomitrella patens]
Length=1223

 Score =   353 bits (905),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 223/520 (43%), Positives = 322/520 (62%), Gaps = 5/520 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             SL+ + L  G  +    Q    G+ G  L  R+R   F+ +L  E  WFD D N +G + 
Sbjct  701   SLMYLVLAIGIFIVSPIQFYSFGVIGQNLIRRLRRLTFEKVLGNEVAWFDEDNNGSGSIG  760

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+ + + ++ D  S+++  + +   GL I+F   W+L+LL  AL P      YF 
Sbjct  761   ARLSTDAAAVKGMIADTLSIVMQNIGNIICGLTIAFIANWQLSLLVLALVPLLGSQGYFQ  820

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             + M  G   D   +Y  AS +A  A+S++RTV++F  QE +V  +E+   +P ++ +R+ 
Sbjct  821   MKMMQGFSNDAKEAYEDASRVANDAISSVRTVSSFCAQERVVALYEEKCEKPLKSGIRQG  880

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              + G+ L FS   ++  Y L  WFG+ LV++   +   V+K+F  + +S+F V Q A L 
Sbjct  881   YLSGTGLAFSNFVLFACYALAFWFGSKLVQQDKASFEDVFKVFFAITMSAFGVSQGASLT  940

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD S    A+ ++ E+++R+ LI  DP     K       DIE   ++F YPSRP + + 
Sbjct  941   PDLSKTKLAVNSIFELLDRKSLI--DPYNTSGKTLMPLKGDIELRNISFTYPSRPTIPIF  998

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             ++ SL +  G  VALVG SGSGKST+I +++RFYD   G +L++ VD+ +L ++WLR + 
Sbjct  999   KDLSLTVPAGKTVALVGESGSGKSTVISLLERFYDVDSGSILLDGVDITQLQIRWLRQKI  1058

Query  601   ALVGQEPALFAGTIGENIAFGF-PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgv  425
              LV QEP LF  +I  NI +G   + + TEIE AAK +  HKFI GLPEG+ T VG+ GV
Sbjct  1059  GLVSQEPVLFNTSIKANIIYGRDDDVTETEIESAAKASNCHKFIVGLPEGFNTTVGERGV  1118

Query  424   qlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRL  245
             QLSGGQKQR+AIARAI+K  ++LLLDEA+SALD ESE  VQ+AL +I    TTIVVAHRL
Sbjct  1119  QLSGGQKQRVAIARAIVKDPRILLLDEATSALDAESEHVVQEALDRIMVNRTTIVVAHRL  1178

Query  244   STIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             STI+ A+VIAVVK G++ E G HD+LMA + +G Y  LVR
Sbjct  1179  STIRNADVIAVVKNGSIVEQGKHDELMARQ-DGAYHALVR  1217


 Score =   296 bits (758),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 204/499 (41%), Positives = 306/499 (61%), Gaps = 5/499 (1%)
 Frame = -1

Query  1609  LAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLM  1430
             + G +  +RIR+   KSIL+Q+  +FD  E STG ++SR+S D++  ++ +G++    + 
Sbjct  70    ITGERQAARIRSLYLKSILRQDIAFFD-QETSTGEVISRMSGDTILIQNAIGEKVGTFIQ  128

Query  1429  GLSSAAVGLGISFSLEWRltllaaalt-pftLGASYFSLIMNVGPKLDNSSYARASNIAA  1253
              L     G  ++F   W+LTL+  A      L     +++++        +YA A     
Sbjct  129   LLFMFLAGFAVAFVQGWKLTLVMVATIPLLALSGGLMAMMVSKMSGAGQEAYAEAGTTVE  188

Query  1252  GAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLW  1073
               VS++RTV +++ +   V  ++ A+++  +  +  +   G  +GF+   M+ +Y L +W
Sbjct  189   QVVSSVRTVLSYTGEIKSVIEYDHAIAKAAKLGINSALASGFGIGFALFVMFASYALAMW  248

Query  1072  FGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLI  893
             +G+ LV     + G V  +   ++    S+GQ +      +   AA   + E+I R+P+I
Sbjct  249   YGSILVANHELSGGNVLSVIFAVLTGGGSLGQASPCVQAFASGKAAAYKMFEVIKRKPVI  308

Query  892   GSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGK  713
              +     G   +  K  DIE   V F YPSRPDV + +NF+L +  GT VALVG SGSGK
Sbjct  309   DA-YDLSGETLKALKG-DIELRNVYFTYPSRPDVPIFKNFNLSVAAGTTVALVGESGSGK  366

Query  712   STLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFP  533
             ST++ +++RFYDP QG+VL++ VD++ L L+WLR Q  LV QEP LF  +I ENIA+   
Sbjct  367   STVVSLVERFYDPNQGQVLVDGVDIKTLQLRWLRRQVGLVSQEPVLFGTSIKENIAYAKD  426

Query  532   NASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVll  353
             +A+  E++ AA  A    FI+ +P+GYETKVG+ G+QLSGGQKQRIAIARAILK  K+LL
Sbjct  427   DATDEEVQAAASLANAATFINKMPKGYETKVGERGIQLSGGQKQRIAIARAILKDPKILL  486

Query  352   ldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHD  173
             LDEA+SALD ESE  VQ+AL K+    TTIVVAHRL+TI+ AN+IAV++ G V E GSHD
Sbjct  487   LDEATSALDAESECVVQEALEKVMADRTTIVVAHRLTTIRNANLIAVIQRGVVVETGSHD  546

Query  172   KLMASELNGIYATLVRAEQ  116
             +L+ S  +G Y  L+R +Q
Sbjct  547   ELL-SRPDGAYTQLIRLQQ  564



>ref|XP_009789853.1| PREDICTED: ABC transporter B family member 1 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009789854.1| PREDICTED: ABC transporter B family member 1 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009789855.1| PREDICTED: ABC transporter B family member 1 isoform X3 [Nicotiana 
sylvestris]
Length=1337

 Score =   354 bits (908),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 220/531 (41%), Positives = 335/531 (63%), Gaps = 10/531 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+G+    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  788   QIAKYCYLLIGVSSAALIFNTLQHFFWDVVGENLTKRVREKMLDAVLKMEMAWFDQEEND  847

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  848   SSRIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVVA  907

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  AV+N+RTVA F+++  IV  F  +L  P R 
Sbjct  908   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSETKIVNLFNSSLQTPLRR  967

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q  +Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  968   CFWKGQIAGSGYGIAQFLLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1027

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAY  809
                LAPD      A+ +V ++++R+  +  D         T+ P     ++EF+ V F+Y
Sbjct  1028  TLTLAPDFIKGGRAMRSVFDLLDRKTEVEPDDPDA-----TAVPDRLRGEVEFKHVDFSY  1082

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPDV + R+ +L+ + G  +ALVG SG GKS++I +I+RFY+P  GRV+++  D+R+ 
Sbjct  1083  PTRPDVSIFRDLNLRARAGKTLALVGPSGCGKSSVIALIERFYEPSSGRVMIDGKDIRKY  1142

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
             NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  A  HKF+S LP+GY+
Sbjct  1143  NLKSLRKHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAATLANAHKFVSALPDGYK  1202

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQLSGGQKQRIAIARA L+K++++LLDEA+SALD ESEK VQ+AL +     T
Sbjct  1203  TFVGERGVQLSGGQKQRIAIARAFLRKAELMLLDEATSALDAESEKCVQEALDRACAGKT  1262

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             TIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +GIYA +++ ++
Sbjct  1263  TIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYADGIYARMIQLQR  1313


 Score =   283 bits (725),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 201/512 (39%), Positives = 313/512 (61%), Gaps = 22/512 (4%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + T+++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  165   GERQTTKMRIKYLEAALNQDIQYFDTEVRTSDVVFA-INTDAVMVQDAISEKLGNFIHYM  223

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +GA +   +  +  K    + ++A NI   
Sbjct  224   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAIHTITLAKLSGK-SQEALSKAGNIVEQ  282

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGA-------  1091
              V  IRTV  F  +   +Q++  AL        + SQ +G   GFS+G   GA       
Sbjct  283   TVVQIRTVLAFVGESKAMQAYSAAL--------KVSQKIGYKSGFSKGLGLGATYFTVFC  334

Query  1090  -YTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEI  914
              Y L LW+G YLV+  YTN G        +++   ++GQ A      + A  A   +  I
Sbjct  335   CYALLLWYGGYLVRHHYTNGGLAIATMFAVMIGGLALGQSAPSMTAFAKARVAAAKIFRI  394

Query  913   INRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALV  734
             I+ +P +  +  + G + + S    +E + V F+YPSRPD+ +L NF+L +  G  +ALV
Sbjct  395   IDHKPSVDRNA-KTGLELD-SVSGQLELKDVDFSYPSRPDIKILDNFNLIVPAGKTIALV  452

Query  733   GASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGE  554
             G+SGSGKST++ +I+RFYDP  G++L++  D++ L LKWLR Q  LV QEPALFA +I E
Sbjct  453   GSSGSGKSTVVSLIERFYDPTSGQLLLDGNDIKTLKLKWLRQQIGLVSQEPALFATSIKE  512

Query  553   NIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAIL  374
             NI  G P+A+  EIEEAA+ A  H FI  LP+G++T+VG+ GVQLSGGQKQRIAIARA+L
Sbjct  513   NILLGRPDATQIEIEEAARVANAHSFIIKLPDGFDTQVGERGVQLSGGQKQRIAIARAML  572

Query  373   KKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAV  194
             K   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V
Sbjct  573   KNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSV  632

Query  193   AEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +E GSHD+LM+   NG+YA L++ ++ A+  A
Sbjct  633   SEIGSHDELMSKGENGMYAKLIKMQEAAHETA  664



>ref|XP_010457236.1| PREDICTED: ABC transporter B family member 11 isoform X1 [Camelina 
sativa]
Length=1293

 Score =   353 bits (907),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 231/527 (44%), Positives = 331/527 (63%), Gaps = 7/527 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             ++I V LG   ++    Q  L  +AG KL  RIR+  F+  +  E GWFD  +NS+G + 
Sbjct  762   AIIFVALGVTSLIVSPTQMYLFAVAGGKLIRRIRSMCFERAVHMEVGWFDEPQNSSGTMG  821

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+   R+++GD  S+ +  ++SAA GL I+F+  W L L+   + P      Y  
Sbjct  822   ARLSADAALIRALVGDALSLAVQNVASAASGLIIAFTACWELALIILVMLPLIGINGYVQ  881

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D  S Y  AS +A  AV +IRTVA+F  +E ++Q ++K    P +  +++ 
Sbjct  882   VKFMKGFSADAKSKYEEASQVANDAVGSIRTVASFCAEEKVMQMYKKQCEGPIKDGIKQG  941

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   GFS   ++  Y  + + GA LV++G T    V+++F  L +++  V Q +  A
Sbjct  942   FISGLGFGFSFFILFCVYATSFYAGARLVEDGKTTFNDVFQVFFALTMAAIGVSQSSSFA  1001

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD+S A  A  ++  II+R+  I S  +  G   E  K  DIE   ++F YP+RPD+ + 
Sbjct  1002  PDSSKAKVAAASIFAIIDRKSKIDSSDE-SGTVLENVKG-DIELRHLSFTYPARPDIQIF  1059

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+  L I+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ V+L++L LKWLR Q 
Sbjct  1060  RDLCLTIRAGKTVALVGESGSGKSTVISLLQRFYDPDSGHITLDGVELKKLQLKWLRQQM  1119

Query  601   ALVGQEPALFAGTIGENIAFGFPN---ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              LVGQEP LF  TI  NIA+G  +   A+ +EI  AA+ A  HKFIS + +GY+T VG+ 
Sbjct  1120  GLVGQEPVLFNDTIRANIAYGKGSEDAATESEIIAAAELANAHKFISSIQQGYDTVVGER  1179

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G+QLSGGQKQR+AIARAI+K+ K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAH
Sbjct  1180  GIQLSGGQKQRVAIARAIVKEPKILLLDEATSALDAESERVVQDALDRVMVNRTTVVVAH  1239

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             RLSTIK A+VIAVVK G +AE G+H+ L+  +  G+YA+LV+    A
Sbjct  1240  RLSTIKNADVIAVVKNGVIAEKGTHETLIKID-GGVYASLVQLHMTA  1285


 Score =   287 bits (735),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 212/526 (40%), Positives = 318/526 (60%), Gaps = 9/526 (2%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              + L  V LG G +     Q     + G +   RIR+   K+IL+Q+ G+FD + N TG 
Sbjct  102   KVCLKFVYLGLGTLGAAFLQVACWMITGERQAVRIRSAYLKTILRQDIGFFDVETN-TGE  160

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEW--RltllaaaltpftLGA  1331
             +V R+S D+V  +  +G++    +  +S+   G  ++F   W   L +L +       GA
Sbjct  161   VVGRMSGDTVLIQDAMGEKVGKFIQLVSTFVGGFVLAFIKGWLLTLVMLTSIPLLAMAGA  220

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
             S  +LI+        ++YA+A+ +    + +IRTVA+F+ ++  V S++K ++   ++SV
Sbjct  221   S-MALIVTRASSRGQAAYAKAATVVEQTIGSIRTVASFTGEKQAVNSYKKFITSAYKSSV  279

Query  1150  RRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQL  974
             ++    G  LG      + +Y L +WFG  ++ E GYT  G+V  + +I+V  S S+GQ 
Sbjct  280   QQGFSTGLGLGVMFFVFFSSYALAIWFGGKMIIEKGYTG-GSVINVIIIVVAGSMSLGQT  338

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
             +      +   AA   + E I R+PLI +     G+  E  +  DIE + V F+YP+RPD
Sbjct  339   SPCVTAFAAGQAAAYKMFETIKRKPLIDA-YDVNGKVLEDIRG-DIELKDVHFSYPARPD  396

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
               +   FSL I  G   ALVG SGSGKST+I +I+RFYDP  G VL++ V+L+E  LKW+
Sbjct  397   EDIFNGFSLFIPSGATAALVGESGSGKSTVISLIERFYDPKAGEVLIDGVNLKEFQLKWI  456

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             RS+  LV QEP LF+ +I ENIA+G  NA+  EI+ A + A   KFI  LP+G +T VG+
Sbjct  457   RSKIGLVSQEPVLFSSSIMENIAYGKDNATLQEIKAATELANAAKFIDKLPQGLDTMVGE  516

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT++VA
Sbjct  517   HGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRVMVNRTTVIVA  576

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             HRLST++ A++IAV+  G + E GSH +L+  +  G Y+ L+R ++
Sbjct  577   HRLSTVRNADMIAVIHRGRMVEKGSHSELL-KDSEGAYSQLIRLQE  621



>gb|EPS61919.1| hypothetical protein M569_12874 [Genlisea aurea]
Length=1149

 Score =   352 bits (902),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 220/514 (43%), Positives = 335/514 (65%), Gaps = 4/514 (1%)
 Frame = -1

Query  1675  LILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVS  1496
              + +G+G   +V  + Q     + G  LT+R+R+ + +++L+ E GWFD +EN++ ++ +
Sbjct  624   FVYIGIGLYAVVAYLIQHYFFSIMGENLTTRVRSMMLEAVLRNEMGWFDEEENNSSLVSA  683

Query  1495  RLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFSL  1316
             RL+ D+   +S + +R SV+L  ++S      ++F +EWR++LL     P  + A++   
Sbjct  684   RLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLIFGTFPLLVLANFAQQ  743

Query  1315  IMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQ  1139
             +   G   D + ++A+ S IA   VSNIRTVA F+ Q+ ++  F + L  P++ S+RRS 
Sbjct  744   LALKGFAGDTARAHAKTSMIAGEGVSNIRTVAAFNAQKKVLSLFGRELRVPQKRSLRRSN  803

Query  1138  ILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAP  959
               G   G SQ A+Y +  L LW+G  LV  G +    V K+F++LV+++ SV +   LAP
Sbjct  804   ASGFLFGLSQLALYSSEALILWYGCRLVARGLSTFSRVIKVFIVLVITANSVAETVSLAP  863

Query  958   DTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLR  779
             +      +I +V  I++R   I  DP     +   S   +IE   V FAYPSRPDV+V +
Sbjct  864   EIVRGGESIASVFTILDRGTEI--DPDDPEAEAVESVRGEIELRHVDFAYPSRPDVLVFK  921

Query  778   NFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTA  599
             + +L+I+ G   ALVGASGSGKS++I +I+RFYDPI G+V+++  D+R+LNLK LR +  
Sbjct  922   DLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRKLNLKSLRRKIG  981

Query  598   LVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvql  419
              V QEPALFA TI +NIA+G   A+ +E+ EAA+ A +H F+S LPEGY+T VG+ G+QL
Sbjct  982   FVQQEPALFAATIFDNIAYGNDGATESEVIEAARSANVHAFVSSLPEGYKTPVGERGIQL  1041

Query  418   sggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLST  239
             SGGQKQRIAIARA+LK   +LLLDEA+SALD ESE  +Q+AL ++ +  TT++VAHRLST
Sbjct  1042  SGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLST  1101

Query  238   IKEANVIAVVKEGAVAEYGSHDKLMASELNGIYA  137
             I+  + I VV++G +AE GSH +L+  + +G Y+
Sbjct  1102  IRGVDSIGVVQDGRIAEQGSHGELVG-KADGAYS  1134


 Score =   277 bits (708),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 198/500 (40%), Positives = 297/500 (59%), Gaps = 7/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G +    +R    +++LKQ+ G++D D   TG +V  +S D++  +  + ++    +   
Sbjct  4     GERQAGTLRKKYLEAVLKQDVGFYDTDAR-TGDVVFGVSTDTLLVQDAISEKVGNFIHYQ  62

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             S+   GL + F   WRL LL+ A+       G  Y   +  +  K    SYA AS +A  
Sbjct  63    STFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYGYTVSGLASK-SRDSYANASIVAEQ  121

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
             +++ +RTV ++  +   ++S+   + +  +   +     G  LG + G    ++ L  W+
Sbjct  122   SIAQVRTVYSYVGESRALRSYSDLIQDTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWY  181

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
                 ++ G T+ G  +      ++   S+GQ            AA   ++EIIN++P I 
Sbjct  182   AGVFIRNGETDGGKAFTAIFSAIVGGMSLGQSFSNLGAFGKGKAAGYKLMEIINQKPTIV  241

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
              DP   G K  +    +IEF  VTF YPSRPDV+V R+FS+    G  VA+VG SGSGKS
Sbjct  242   DDP--SGAKVLSEVKGNIEFRNVTFGYPSRPDVLVFRDFSITFPAGRTVAVVGGSGSGKS  299

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP QG +L+++V+++ L L+WLR+Q  LV QEPALFA TI ENI +G P+
Sbjct  300   TVVSLIERFYDPNQGEILLDDVNIKTLQLRWLRNQIGLVNQEPALFATTILENILYGKPD  359

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A+  E+E AA  A    FI  LP G++T+VG+ GVQLSGGQKQRIAIARA+LK  +VLLL
Sbjct  360   ATMEEVEAAATAANALSFIGVLPHGFDTQVGERGVQLSGGQKQRIAIARAVLKNPRVLLL  419

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD  SEK VQ+AL  +    TT+VVAHRLSTI   + +AV+++G V E G+H++
Sbjct  420   DEATSALDAGSEKLVQEALDSLMIGRTTVVVAHRLSTITSVDSVAVIQQGQVVETGTHEE  479

Query  169   LMASELNGIYATLVRAEQEA  110
             L+A    G YA+L+R ++ A
Sbjct  480   LLAKP-AGAYASLIRFQEMA  498



>ref|XP_010481058.1| PREDICTED: ABC transporter B family member 11-like isoform X1 
[Camelina sativa]
Length=1287

 Score =   353 bits (906),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 231/527 (44%), Positives = 329/527 (62%), Gaps = 7/527 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             ++I V LG   ++    Q  L  +AG KL  RIR+  F+  +  E GWFD  +NS+G + 
Sbjct  762   AIIFVALGVTSLIVSPTQMYLFAVAGGKLIRRIRSMCFERAVHMEVGWFDEPQNSSGTMG  821

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+   R+++GD  S+ +   +SAA GL I+F+  W L L+   + P      Y  
Sbjct  822   ARLSADAALIRALVGDALSLAVQNAASAASGLIIAFTACWELALIILVMLPLIGINGYVQ  881

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D  S Y  AS +A  AV +IRTVA+F  +E ++Q ++K    P +  +++ 
Sbjct  882   VKFMKGFSADAKSKYEEASQVANDAVGSIRTVASFCAEEKVMQMYKKQCEGPIKDGIKQG  941

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   GFS   ++  Y  + + GA LV++G T    V+++F  L +++  V Q +  A
Sbjct  942   FISGLGFGFSFFILFSVYATSFYAGARLVEDGKTTFNDVFQVFFALTMAAIGVSQSSSFA  1001

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD+S A  A  ++  II+R+  I S  +  G   E  K  DIE   ++F YP+RPD+ + 
Sbjct  1002  PDSSKAKVAAASIFAIIDRKSKIDSSDE-SGTVLENVKG-DIELRHLSFTYPARPDIQIF  1059

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+  L I+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ V+L++L LKWLR Q 
Sbjct  1060  RDLCLTIRAGKTVALVGESGSGKSTVISLLQRFYDPDSGHITLDGVELKKLQLKWLRQQM  1119

Query  601   ALVGQEPALFAGTIGENIAFGF---PNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              LVGQEP LF  TI  NIA+G      A+ +EI  AA+ A  HKFIS + +GY+T VG+ 
Sbjct  1120  GLVGQEPVLFNDTIRANIAYGKGSEDTATESEIIAAAELANAHKFISSIQQGYDTVVGER  1179

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G+QLSGGQKQR+AIARAI+K+ K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAH
Sbjct  1180  GIQLSGGQKQRVAIARAIVKEPKILLLDEATSALDAESERVVQDALDRVMVNRTTVVVAH  1239

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             RLSTIK A+VIAVVK G +AE G+H+ L+  +  G+YA+LV+    A
Sbjct  1240  RLSTIKNADVIAVVKNGVIAEKGTHETLIKID-GGVYASLVQLHMTA  1285


 Score =   286 bits (731),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 211/526 (40%), Positives = 317/526 (60%), Gaps = 9/526 (2%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              + L  V LG G +     Q     + G +  SRIR+   K+IL+Q+ G+FD + N TG 
Sbjct  102   KVCLKFVYLGLGTLGAAFLQVACWMITGERQASRIRSTYLKTILRQDIGFFDVETN-TGE  160

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEW--RltllaaaltpftLGA  1331
             +V R+S D+V  +  +G++    +  +S+   G  ++F   W   L +L +       GA
Sbjct  161   VVGRMSGDTVLIQDAMGEKVGKFIQLVSTFVGGFVLAFIKGWLLTLVMLTSIALLAMAGA  220

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
             S  +L +        ++YA+A+ +    + +IRTVA+F+ ++  V S++K ++   ++SV
Sbjct  221   S-MALFVTRASSRGQAAYAKAATVVEQTIGSIRTVASFTGEKQAVNSYKKFITSAYKSSV  279

Query  1150  RRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQL  974
             ++    G  LG      + +Y L +WFG  ++ E GYT  GAV  + +I+V  S S+GQ 
Sbjct  280   QQGFSTGLGLGVMFFVFFSSYALAIWFGGKMIIEKGYTG-GAVINVIIIVVAGSMSLGQT  338

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
             +      +   AA   + E + R+PL  +  +  G   E  +  DIE + V F+YP+RPD
Sbjct  339   SPCVTAFAAGQAAAYKMFETLKRKPLTDA-YEVNGTVLEDIRG-DIELKDVHFSYPARPD  396

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
               +   FSL I  G   ALVG SGSGKST+I +I+RFYDP  G VL++ V+L+E  LKW+
Sbjct  397   EDIFNGFSLFIPSGATAALVGESGSGKSTVISLIERFYDPKAGEVLIDGVNLKEFQLKWI  456

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             RS+  LV QEP LF+ +I ENIA+G  NA+  EI+ A + A   KFI  LP+G +T VG+
Sbjct  457   RSKIGLVSQEPVLFSSSIMENIAYGKDNATLQEIKAATELANAAKFIDKLPQGLDTMVGE  516

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT++VA
Sbjct  517   HGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRVMVNRTTVIVA  576

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             HRLST++ A++IAV+  G + E GSH +L+  +  G Y+ L+R ++
Sbjct  577   HRLSTVRNADMIAVIHRGKMVEKGSHSELL-KDSEGAYSQLIRLQE  621



>ref|XP_010457237.1| PREDICTED: ABC transporter B family member 11 isoform X2 [Camelina 
sativa]
Length=1287

 Score =   353 bits (906),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 230/522 (44%), Positives = 330/522 (63%), Gaps = 7/522 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             ++I V LG   ++    Q  L  +AG KL  RIR+  F+  +  E GWFD  +NS+G + 
Sbjct  762   AIIFVALGVTSLIVSPTQMYLFAVAGGKLIRRIRSMCFERAVHMEVGWFDEPQNSSGTMG  821

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+   R+++GD  S+ +  ++SAA GL I+F+  W L L+   + P      Y  
Sbjct  822   ARLSADAALIRALVGDALSLAVQNVASAASGLIIAFTACWELALIILVMLPLIGINGYVQ  881

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D  S Y  AS +A  AV +IRTVA+F  +E ++Q ++K    P +  +++ 
Sbjct  882   VKFMKGFSADAKSKYEEASQVANDAVGSIRTVASFCAEEKVMQMYKKQCEGPIKDGIKQG  941

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   GFS   ++  Y  + + GA LV++G T    V+++F  L +++  V Q +  A
Sbjct  942   FISGLGFGFSFFILFCVYATSFYAGARLVEDGKTTFNDVFQVFFALTMAAIGVSQSSSFA  1001

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD+S A  A  ++  II+R+  I S  +  G   E  K  DIE   ++F YP+RPD+ + 
Sbjct  1002  PDSSKAKVAAASIFAIIDRKSKIDSSDE-SGTVLENVKG-DIELRHLSFTYPARPDIQIF  1059

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+  L I+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ V+L++L LKWLR Q 
Sbjct  1060  RDLCLTIRAGKTVALVGESGSGKSTVISLLQRFYDPDSGHITLDGVELKKLQLKWLRQQM  1119

Query  601   ALVGQEPALFAGTIGENIAFGFPN---ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              LVGQEP LF  TI  NIA+G  +   A+ +EI  AA+ A  HKFIS + +GY+T VG+ 
Sbjct  1120  GLVGQEPVLFNDTIRANIAYGKGSEDAATESEIIAAAELANAHKFISSIQQGYDTVVGER  1179

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G+QLSGGQKQR+AIARAI+K+ K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAH
Sbjct  1180  GIQLSGGQKQRVAIARAIVKEPKILLLDEATSALDAESERVVQDALDRVMVNRTTVVVAH  1239

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVR  125
             RLSTIK A+VIAVVK G +AE G+H+ L+  +  G+YA+LV+
Sbjct  1240  RLSTIKNADVIAVVKNGVIAEKGTHETLIKID-GGVYASLVQ  1280


 Score =   287 bits (734),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 212/526 (40%), Positives = 318/526 (60%), Gaps = 9/526 (2%)
 Frame = -1

Query  1684  NLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGV  1505
              + L  V LG G +     Q     + G +   RIR+   K+IL+Q+ G+FD + N TG 
Sbjct  102   KVCLKFVYLGLGTLGAAFLQVACWMITGERQAVRIRSAYLKTILRQDIGFFDVETN-TGE  160

Query  1504  LVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEW--RltllaaaltpftLGA  1331
             +V R+S D+V  +  +G++    +  +S+   G  ++F   W   L +L +       GA
Sbjct  161   VVGRMSGDTVLIQDAMGEKVGKFIQLVSTFVGGFVLAFIKGWLLTLVMLTSIPLLAMAGA  220

Query  1330  SYFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSV  1151
             S  +LI+        ++YA+A+ +    + +IRTVA+F+ ++  V S++K ++   ++SV
Sbjct  221   S-MALIVTRASSRGQAAYAKAATVVEQTIGSIRTVASFTGEKQAVNSYKKFITSAYKSSV  279

Query  1150  RRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQL  974
             ++    G  LG      + +Y L +WFG  ++ E GYT  G+V  + +I+V  S S+GQ 
Sbjct  280   QQGFSTGLGLGVMFFVFFSSYALAIWFGGKMIIEKGYTG-GSVINVIIIVVAGSMSLGQT  338

Query  973   AGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPD  794
             +      +   AA   + E I R+PLI +     G+  E  +  DIE + V F+YP+RPD
Sbjct  339   SPCVTAFAAGQAAAYKMFETIKRKPLIDA-YDVNGKVLEDIRG-DIELKDVHFSYPARPD  396

Query  793   VIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWL  614
               +   FSL I  G   ALVG SGSGKST+I +I+RFYDP  G VL++ V+L+E  LKW+
Sbjct  397   EDIFNGFSLFIPSGATAALVGESGSGKSTVISLIERFYDPKAGEVLIDGVNLKEFQLKWI  456

Query  613   RSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgq  434
             RS+  LV QEP LF+ +I ENIA+G  NA+  EI+ A + A   KFI  LP+G +T VG+
Sbjct  457   RSKIGLVSQEPVLFSSSIMENIAYGKDNATLQEIKAATELANAAKFIDKLPQGLDTMVGE  516

Query  433   sgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVA  254
              G QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT++VA
Sbjct  517   HGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRVMVNRTTVIVA  576

Query  253   HRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             HRLST++ A++IAV+  G + E GSH +L+  +  G Y+ L+R ++
Sbjct  577   HRLSTVRNADMIAVIHRGRMVEKGSHSELL-KDSEGAYSQLIRLQE  621



>ref|XP_001775250.1| ATP-binding cassette transporter, subfamily B, member 14, group 
MDR/PGP protein PpABCB14 [Physcomitrella patens]
 gb|EDQ59986.1| ATP-binding cassette transporter, subfamily B, member 14, group 
MDR/PGP protein PpABCB14 [Physcomitrella patens]
Length=1245

 Score =   353 bits (905),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 222/484 (46%), Positives = 314/484 (65%), Gaps = 7/484 (1%)
 Frame = -1

Query  1567  FKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFS  1388
             F+ +L+ E  WFD D+NS+G + +RLS D+ + RS++ D  S+++  + +   GL I+F 
Sbjct  760   FEKVLRNEVAWFDEDDNSSGSIGTRLSTDAAAVRSMIADTLSLIVQNIGTIVCGLTIAFI  819

Query  1387  LEWRltllaaaltpftLGASYFSLIMNVGPKLDNS-SYARASNIAAGAVSNIRTVATFST  1211
               W L+L+  AL P      YF + M  G   D+  +Y  AS IA  A+S+IRTV++F  
Sbjct  820   YNWELSLVVLALVPLLGSQGYFQMKMMKGFSNDSKVAYEDASRIANDAISSIRTVSSFCA  879

Query  1210  QEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIG  1031
             ++  V  +EK   +P ++ +R   I G+ LGFS   ++ +Y L  WFGA LV +G T   
Sbjct  880   EQKTVALYEKKCEKPLKSGIRLGFISGTGLGFSNFVIFASYALAFWFGAKLVDQGKTKFA  939

Query  1030  AVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIGSDP-QRKGRKFET  854
              V+K+F  + +S+  V Q AGL PD +    A+ +V E+++R+  I  DP  + G   +T
Sbjct  940   NVFKVFFAIAMSAIGVSQSAGLTPDLTKTKLAVNSVFELLDRKSRI--DPYDQTGTTLKT  997

Query  853   SKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDP  674
              K  DIE   ++F YPSRP + + ++ SL +  G  VALVG SGSGKST+I +++RFYD 
Sbjct  998   VKG-DIELRNISFTYPSRPTIPIFKDLSLTVPAGKTVALVGESGSGKSTVISLLERFYDL  1056

Query  673   IQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGF-PNASYTEIEEAAK  497
               G +L++ +D+++L ++WLR Q  LV QEP LF  +I  NI +G   + S TE+  A K
Sbjct  1057  DGGSILLDGIDIKQLQIRWLRQQIGLVSQEPVLFNTSIKANIVYGREDDVSETELVSATK  1116

Query  496   EAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldles  317
              +  +KFI GLPEG+ T VG+ GVQLSGGQKQR+AIARAI+K  K+LLLDEA+SALD ES
Sbjct  1117  ASNCYKFIMGLPEGFNTTVGERGVQLSGGQKQRVAIARAIVKDPKILLLDEATSALDAES  1176

Query  316   EKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYA  137
             E  VQ+AL +I    TTIVVAHRLSTI+ A++IAVVK+GA+ E G HD+LMA E NG Y 
Sbjct  1177  EHVVQEALDRIMVNRTTIVVAHRLSTIRNADLIAVVKDGAIIERGKHDELMARE-NGAYH  1235

Query  136   TLVR  125
              LVR
Sbjct  1236  ALVR  1239


 Score =   281 bits (719),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 206/527 (39%), Positives = 319/527 (61%), Gaps = 5/527 (1%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q   ++L  V LG G  V    +     + G +  +RIR+   K+IL+Q+  +FD  E +
Sbjct  79    QVSKVALKFVYLGIGAAVASYLEISCWMITGERQAARIRSLYLKTILRQDVPFFD-QEAT  137

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             TG ++SR+S D++  +  +G++        ++   G  ++F   W+LTL+  A  P  + 
Sbjct  138   TGEVISRMSGDTMLIQDAIGEKIGKFQQLFATFIAGFVVAFFKGWKLTLVILATLPLLIA  197

Query  1333  AS-YFSLIMNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             +    +++M+        +YA A +     VS+IRTV +++ +   V  +++A+S+ ++ 
Sbjct  198   SGGIMAMVMSRLSGAGQEAYADAGSTVEQVVSSIRTVLSYNGERKSVVEYDRAISKAEKL  257

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
              +  S   G  LG +   M+ +Y L +W+G+ LV     + G V  +   ++    S GQ
Sbjct  258   GINSSIAAGLGLGLALFVMFASYALAMWYGSILVANDGLSGGNVISVVFAVLTGGGSFGQ  317

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRP  797
             ++      +   AA   + ++I R+P I +     G   E  +   +E   V F YPSRP
Sbjct  318   VSPCVQAFAAGKAAAYKMFQVIKRKPAIDA-YDLSGEILENVRG-GVELRNVDFTYPSRP  375

Query  796   DVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKW  617
             DV + +NF+L I  GT VALVG SGSGKST++ +++RFYDP  G+VL++ VD++ L L+W
Sbjct  376   DVPIFKNFNLTIAAGTTVALVGESGSGKSTVVSLVERFYDPSGGQVLVDGVDIKTLQLRW  435

Query  616   LRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvg  437
             LR Q  LV QEP LFA +I ENIA+   +A+  E+++AA  A    FI+ +P+GYET+VG
Sbjct  436   LRQQIGLVSQEPVLFATSIKENIAYAKDSATDEEVQQAAALANAATFINKMPKGYETQVG  495

Query  436   qsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVV  257
             + G+QLSGGQKQRIAIARAILK  ++LLLDEA+SALD ESE  VQ+AL K+    TTIVV
Sbjct  496   ERGIQLSGGQKQRIAIARAILKNPRILLLDEATSALDAESEHIVQEALEKVMVGRTTIVV  555

Query  256   AHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             AHRL+TI+ AN+IAV++ G V E G+HD+L + + +G Y+ L+R +Q
Sbjct  556   AHRLTTIRNANLIAVIQRGVVVETGTHDELQSRQ-DGAYSQLIRLQQ  601



>ref|XP_010101619.1| ABC transporter B family member 1 [Morus notabilis]
 gb|EXB89000.1| ABC transporter B family member 1 [Morus notabilis]
Length=1377

 Score =   354 bits (908),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 220/531 (41%), Positives = 334/531 (63%), Gaps = 10/531 (2%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             Q      +L+GL    ++    Q     + G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  824   QIGKYCYLLIGLSSAALLFNTLQHFFWDIVGENLTKRVREKMLAAVLKNEMAWFDQEENE  883

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  884   SARVAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVA  943

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+ + +A  A++N+RTVA F+++E IV  F   L  P R 
Sbjct  944   ATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNSEEKIVGLFTTNLETPLRR  1003

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  1004  CFWKGQIAGSGFGVAQFALYASYALGLWYASWLVKHGVSDFSKTIRVFMVLMVSANGAAE  1063

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPF----DIEFEMVTFAY  809
                LAPD      A+ +V E+++R+  I  D         T+ P     ++EF+ V F+Y
Sbjct  1064  TLTLAPDFIKGGRAMQSVFELLDRKTEIEPDDPDA-----TAAPDRLRGEVEFKHVDFSY  1118

Query  808   PSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLREL  629
             P+RPDV + R+ +L+ + G  +ALVG SG GKS++I ++QRFYDP  GR++++  D+R+ 
Sbjct  1119  PTRPDVPIFRDLTLRARAGKTLALVGPSGCGKSSVIALVQRFYDPTSGRIMIDGKDIRKY  1178

Query  628   NLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYE  449
             NLK LR   A+V QEP LFA TI ENIA+G   A+  EI EAA  A  HKF+S LP+GY+
Sbjct  1179  NLKSLRKHIAVVPQEPCLFATTIYENIAYGHEFATEAEIIEAATLANAHKFVSSLPDGYK  1238

Query  448   TkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQAT  269
             T VG+ GVQLSGGQKQRIAIARA+++K++++LLDEA+SALD ESE+ VQ+AL +     T
Sbjct  1239  TFVGERGVQLSGGQKQRIAIARALVRKAELMLLDEATSALDAESERSVQEALERACSGKT  1298

Query  268   TIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
             TIVVAHRLSTI+ A+VIAV+ +G VAE GSH  L+ +  +G YA +++ ++
Sbjct  1299  TIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1349


 Score =   276 bits (707),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 196/521 (38%), Positives = 313/521 (60%), Gaps = 24/521 (5%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++R+R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  185   GERQSTRMRIKYLEAALNQDIQYFDTEVRTSDVVFA-INTDAVLVQDAISEKLGNFVHYM  243

Query  1423  SSAAVGLGISFSLEWRltllaaalt--pftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  + + +  +  K    + ++A N+   
Sbjct  244   ATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGGIHTTTLAKLSGK-SQDALSQAGNVVEQ  302

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              V  IR V  F  +   +Q++  AL   +R   +     G  LG +   ++  Y L LW+
Sbjct  303   TVVQIRVVMAFVGESRALQAYSSALRIAQRLGYKSGFAKGMGLGATYFVVFCCYALLLWY  362

Query  1069  GAYLVKEGYTNIG-AVYKIFLILV----------------LSSFSVGQLAGLAPDTSMAS  941
             G YLV+  YTN G A+  +F +++                LSS ++GQ A      + A 
Sbjct  363   GGYLVRHHYTNGGLAIATMFAVMIGGLFRNVVRLNVFLLWLSS-ALGQSAPSMGAFTKAK  421

Query  940   AAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKI  761
              A   +  +I+ +P I  +    G + ++     +E + V F+YP+RP+V +L NF L +
Sbjct  422   VAAAKIFRVIDHKPGIDRNSD-SGLELDSVTGL-VELQNVDFSYPARPEVRILNNFCLSV  479

Query  760   KGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEP  581
               G  +ALVG+SGSGKST++ +I+RFYDP  G+VL++  D++ L L+WLR Q  LV QEP
Sbjct  480   PAGKTIALVGSSGSGKSTVVSLIERFYDPTSGQVLLDGHDIKTLKLRWLRQQIGLVSQEP  539

Query  580   ALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQ  401
             ALFA TI ENI  G P+A   EIEEAA+ A  H FI  LP+G++T+VG+ G+QLSGGQKQ
Sbjct  540   ALFATTIKENILLGRPDADQVEIEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQ  599

Query  400   RIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANV  221
             RIAIARA+LK   +LLLDEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A++
Sbjct  600   RIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADL  659

Query  220   IAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEAYAFA  98
             +AV+++G+V+E G+HD+L+A   NG+YA L+R ++ A+  A
Sbjct  660   VAVLQQGSVSEIGTHDELIAKGENGMYAKLIRMQEMAHETA  700



>gb|KEH42187.1| ABC transporter B family protein [Medicago truncatula]
Length=1321

 Score =   353 bits (906),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 223/535 (42%), Positives = 334/535 (62%), Gaps = 18/535 (3%)
 Frame = -1

Query  1693  QCQNLSLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENS  1514
             + +    +L+GL    +V    Q       G  LT R+R  +  ++LK E  WFD +EN 
Sbjct  770   EIEKYCYLLIGLSSAALVFNTLQHFFWDTVGENLTKRVREKMLSAVLKNEMAWFDREENE  829

Query  1513  TGVLVSRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLG  1334
             +  + +RL++D+ + RS +GDR SV++   +   V     F L+WRL L+  A+ P  + 
Sbjct  830   SARIAARLALDANNVRSAIGDRISVIVQNTALLLVACTAGFVLQWRLALVLVAVFPVVVA  889

Query  1333  ASYFSLIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRT  1157
             A+    +   G   D  +++A+A+ +A  A++N+RTVA F++++ IV  F   L  P R 
Sbjct  890   ATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSEKKIVGLFASNLETPLRR  949

Query  1156  SVRRSQILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQ  977
                + QI GS  G +Q A+Y +Y L LW+ ++LVK G ++     ++F++L++S+    +
Sbjct  950   CFWKGQISGSGYGIAQFALYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAAE  1009

Query  976   LAGLAPDTSMASAAIPAVLEIINRRPLIGSD-------PQR-KGRKFETSKPFDIEFEMV  821
                LAPD      A+ +V ++++RR  I  D       P R +G         ++E + V
Sbjct  1010  TLTLAPDFIKGGRAMKSVFDLLDRRTEIEPDDPDAVIVPDRLRG---------EVELKHV  1060

Query  820   TFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVD  641
              F+YPSRPD+ V R+ SL+ + G  +ALVG SG GKS++I +IQRFYDP  GRV ++  D
Sbjct  1061  DFSYPSRPDMPVFRDLSLRARAGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVTIDGKD  1120

Query  640   LRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLP  461
             +R+ NLK LR   A+V QEP LFA TI ENIA+G  +A+  EI EAA  +  HKFIS LP
Sbjct  1121  IRKYNLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEIIEAATLSNAHKFISSLP  1180

Query  460   EGYETkvgqsgvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKIS  281
             +GY+T VG+ GVQLSGGQKQRIAIARA ++K++++LLDEA+SALD ESE+ VQ+AL +  
Sbjct  1181  DGYKTFVGERGVQLSGGQKQRIAIARAFVRKAELMLLDEATSALDAESERSVQEALERAC  1240

Query  280   KQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQ  116
                TTI+VAHRLSTI+ AN+IAV+ +G V E GSH  L+ +  +GIYA +++ ++
Sbjct  1241  SGKTTIIVAHRLSTIRNANLIAVIDDGTVEEQGSHSHLLKNHPDGIYARMIQLQR  1295


 Score =   283 bits (724),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 194/500 (39%), Positives = 302/500 (60%), Gaps = 6/500 (1%)
 Frame = -1

Query  1603  GTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRLSIDSVSFRSVLGDRFSVLLMGL  1424
             G + ++++R    ++ L Q+  +FD +  ++ V+ + ++ D+V  +  + ++    +  +
Sbjct  146   GERQSTKMRIKYLEAALDQDIQFFDTEVRTSDVVFA-INSDAVMVQDAISEKLGNFVHYM  204

Query  1423  SSAAVGLGISFSLEWRltllaaal--tpftLGASYFSLIMNVGPKLDNSSYARASNIAAG  1250
             ++   G  + F+  W+L L+  A+      +G  +   +  +  K    + ++A NI   
Sbjct  205   ATFVSGFAVGFTAVWQLALVTLAVVPMIAVIGGIHTITLGKLSGK-SQEALSQAGNIVEQ  263

Query  1249  AVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQILGSALGFSQGAMYGAYTLTLWF  1070
              +  IR V  F  +   +Q +  AL   ++   R     G  LG +   ++  Y L LW+
Sbjct  264   TIVQIRVVLAFVGETKALQGYSSALRVAQKIGYRTGFAKGIGLGATYFVVFCCYALLLWY  323

Query  1069  GAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLAPDTSMASAAIPAVLEIINRRPLIG  890
             G YLV+  YTN G        +++   ++GQ A      + A  A   +  +I+ +P I 
Sbjct  324   GGYLVRHDYTNGGLAISTMFAVMIGGLALGQSAPSMIAFTKARVAAAKIFGVIDHKPCID  383

Query  889   SDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRNFSLKIKGGTMVALVGASGSGKS  710
                +  G + ET     +E + V F+YPSRP+V +L +FSL +  G  +ALVG+SGSGKS
Sbjct  384   KKSE-SGLELETVTGL-VELKNVDFSYPSRPEVQILHDFSLSVPSGKTIALVGSSGSGKS  441

Query  709   TLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTALVGQEPALFAGTIGENIAFGFPN  530
             T++ +I+RFYDP  G+VL++  D++ L LKWLR Q  LV QEPALFA TI ENI  G P+
Sbjct  442   TIVSLIERFYDPSSGQVLLDGHDVKTLKLKWLRQQIGLVSQEPALFATTIRENILLGRPD  501

Query  529   ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqlsggqkQRIAIARAILKKSKVlll  350
             A   EIEEAA+ A  H FI  LP+GYET+VG+ G+QLSGGQKQRIAIARA+LK   +LLL
Sbjct  502   ADQVEIEEAARVANAHSFIIKLPDGYETQVGERGLQLSGGQKQRIAIARAMLKNPAILLL  561

Query  349   deassaldlesEKHVQDALRKISKQATTIVVAHRLSTIKEANVIAVVKEGAVAEYGSHDK  170
             DEA+SALD ESEK VQ+AL +     TT+V+AHRLSTI++A+++AV+++G+V+E G+HD+
Sbjct  562   DEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDE  621

Query  169   LMASELNGIYATLVRAEQEA  110
             L A   NG+YA L++ ++ A
Sbjct  622   LFAKGENGVYAKLIKMQEMA  641



>emb|CDY51307.1| BnaCnng20520D [Brassica napus]
Length=1264

 Score =   353 bits (905),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 232/527 (44%), Positives = 328/527 (62%), Gaps = 7/527 (1%)
 Frame = -1

Query  1678  SLILVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLV  1499
             +LI V LG    +    Q  L  +AG KL  RIR+  F+  +  E GWFD  +NS+G L 
Sbjct  739   ALIFVALGVVSFIISPTQMYLFAVAGGKLIRRIRSMCFEKAVHMEVGWFDEPQNSSGTLG  798

Query  1498  SRLSIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaaltpftLGASYFS  1319
             +RLS D+   R+++GD  S+ +   +SAA GL I+F+  W L L+   + P      Y  
Sbjct  799   ARLSADAALIRALVGDALSLAVQNAASAASGLIIAFTACWELALIILVMLPLIGINGYIQ  858

Query  1318  LIMNVGPKLD-NSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRS  1142
             +    G   D  S Y  AS +A  AV +IRTVA+F  +E ++Q ++K    P +  +++ 
Sbjct  859   VKFMKGFTADAKSKYEDASQVANDAVGSIRTVASFCAEEKVMQMYKKQCEGPIKDGIKQG  918

Query  1141  QILGSALGFSQGAMYGAYTLTLWFGAYLVKEGYTNIGAVYKIFLILVLSSFSVGQLAGLA  962
              I G   GFS   ++  Y  + + GA LV+ G T    V+++F  L +++  + Q +  A
Sbjct  919   FISGLGFGFSFFILFCVYAASFYAGARLVEAGRTTFNDVFQVFFALTMAAIGISQSSSFA  978

Query  961   PDTSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVL  782
             PD+S A  A  ++  II+R+  I S  +  G   E  K  DIE   ++F YP+RPD+ + 
Sbjct  979   PDSSKAKVAAASIFGIIDRKSKIDSSDE-SGTVLENVKG-DIELRHISFTYPARPDIQIF  1036

Query  781   RNFSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQT  602
             R+  L I+ G  VALVG SGSGKST+I ++QRFYDP  G + ++ V+L+++ LKWLR Q 
Sbjct  1037  RDLCLTIRAGKTVALVGESGSGKSTVISLLQRFYDPDSGHITLDGVELKKMQLKWLRQQM  1096

Query  601   ALVGQEPALFAGTIGENIAFGFPN---ASYTEIEEAAKEAYIHKFISGLPEGYETkvgqs  431
              LVGQEP LF  TI  NIA+G  +   A+ +EI  AA+ A  HKFIS + +GY+T VG+ 
Sbjct  1097  GLVGQEPVLFNDTIRANIAYGKGSEEAATESEITAAAELANAHKFISSIQQGYDTVVGER  1156

Query  430   gvqlsggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAH  251
             G+QLSGGQKQR+AIARAI+K+ K+LLLDEA+SALD ESE+ VQDAL ++    TT+VVAH
Sbjct  1157  GIQLSGGQKQRVAIARAIVKEPKILLLDEATSALDAESERVVQDALDRVMVNRTTVVVAH  1216

Query  250   RLSTIKEANVIAVVKEGAVAEYGSHDKLMASELNGIYATLVRAEQEA  110
             RLSTIK A+VIAVVK G +AE G+H+ L+  E  G+YA+LV+    A
Sbjct  1217  RLSTIKNADVIAVVKNGVIAEKGTHETLIKME-GGVYASLVQLHMTA  1262


 Score =   296 bits (759),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 205/520 (39%), Positives = 319/520 (61%), Gaps = 7/520 (1%)
 Frame = -1

Query  1669  LVGLGFGCIVTMIGQQGLCGLAGTKLTSRIRNFLFKSILKQEPGWFDFDENSTGVLVSRL  1490
              V LG G +     Q     + G +  +RIRN   K+IL+Q+ G+FD + N TG +V R+
Sbjct  104   FVYLGLGTLGAAFLQVACWMITGERQAARIRNMYLKTILRQDIGFFDVETN-TGEVVGRM  162

Query  1489  SIDSVSFRSVLGDRFSVLLMGLSSAAVGLGISFSLEWRltllaaalt-pftLGASYFSLI  1313
             S D+V  +  +G++    +  +++   G  ++F+  W LTL+         +  +  ++I
Sbjct  163   SGDTVLIQEAMGEKVGKFIQLIATFIGGFALAFAKGWLLTLVMLTSIPLLAMAGAAMAII  222

Query  1312  MNVGPKLDNSSYARASNIAAGAVSNIRTVATFSTQEHIVQSFEKALSEPKRTSVRRSQIL  1133
             +        ++YA+A+ +    + +IRTVA+F+ ++  +  ++K ++   ++S+++    
Sbjct  223   VTKASSQGQAAYAKAATVVEQTIGSIRTVASFTGEKEAINKYKKFITSAYKSSIQQGFST  282

Query  1132  GSALGFSQGAMYGAYTLTLWFGAYLVKE-GYTNIGAVYKIFLILVLSSFSVGQLAGLAPD  956
             G  LG     ++ +Y L +WFG  ++ E GYT  GAV  + +I+V  + S+GQ +     
Sbjct  283   GLGLGIMLFVLFSSYALAIWFGGKMILEKGYTG-GAVINVLIIVVAGAMSLGQTSPCVTA  341

Query  955   TSMASAAIPAVLEIINRRPLIGSDPQRKGRKFETSKPFDIEFEMVTFAYPSRPDVIVLRN  776
              S   +A   + E I R+PLI +    KG+  +  +  DIE + V F+YP+RPD  +   
Sbjct  342   FSAGQSAAYKMFETIERKPLIDA-YDLKGKILKDIRG-DIELKDVHFSYPARPDEDIFDG  399

Query  775   FSLKIKGGTMVALVGASGSGKSTLIWMIQRFYDPIQGRVLMEEVDLRELNLKWLRSQTAL  596
             FSL I  G   ALVG SGSGKST+I +I+RFYDP  G+VL++ V+L+E  LKW+RS+  L
Sbjct  400   FSLFIPSGATAALVGESGSGKSTVISLIERFYDPKAGQVLIDGVNLKEFQLKWIRSKIGL  459

Query  595   VGQEPALFAGTIGENIAFGFPNASYTEIEEAAKEAYIHKFISGLPEGYETkvgqsgvqls  416
             V QEP LF+ +I ENIA+G  NA+  EI+ A + A   KFI  LP+G +T VG+ G QLS
Sbjct  460   VSQEPVLFSSSIMENIAYGKDNATIQEIKAATELANAAKFIDKLPQGLDTMVGEHGTQLS  519

Query  415   ggqkQRIAIARAILKKSKVllldeassaldlesEKHVQDALRKISKQATTIVVAHRLSTI  236
             GGQKQRIAIARAILK  ++LLLDEA+SALD ESE+ VQ+AL ++    TT++VAHRLST+
Sbjct  520   GGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRVMVNRTTVIVAHRLSTV  579

Query  235   KEANVIAVVKEGAVAEYGSHDKLMASELNG