BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1432_g1_i1 len=1106 path=[1:0-1105]

Length=1106
                                                                      Score     E

emb|CDP18718.1|  unnamed protein product                                119   3e-27   
ref|XP_011098078.1|  PREDICTED: protodermal factor 1-like               114   1e-25   
ref|XP_011082933.1|  PREDICTED: protodermal factor 1-like               114   2e-25   
ref|XP_009798270.1|  PREDICTED: protodermal factor 1-like               112   1e-24   
ref|XP_009598266.1|  PREDICTED: protodermal factor 1-like               112   2e-24   
ref|XP_004251814.1|  PREDICTED: protodermal factor 1-like               112   3e-24   
gb|EYU29573.1|  hypothetical protein MIMGU_mgv1a010287mg                110   4e-24   
ref|XP_006350016.1|  PREDICTED: leucine-rich repeat extensin-like...    112   1e-23   
gb|EPS67338.1|  hypothetical protein M569_07441                         105   2e-23   
ref|XP_002283883.1|  PREDICTED: protodermal factor 1                    107   3e-23   Vitis vinifera
gb|EPS57238.1|  hypothetical protein M569_17582                         103   1e-22   
ref|XP_004248209.2|  PREDICTED: protodermal factor 1-like               106   3e-22   
gb|KDP42653.1|  hypothetical protein JCGZ_00157                         104   4e-22   
ref|XP_009597208.1|  PREDICTED: protodermal factor 1-like               102   1e-21   
ref|XP_009620538.1|  PREDICTED: protodermal factor 1                    103   3e-21   
ref|XP_010035900.1|  PREDICTED: protodermal factor 1-like               102   3e-21   
ref|XP_006360063.1|  PREDICTED: protodermal factor 1-like               102   4e-21   
ref|XP_009800987.1|  PREDICTED: protodermal factor 1                    102   5e-21   
ref|XP_009771855.1|  PREDICTED: protodermal factor 1-like               100   7e-21   
ref|XP_004169671.1|  PREDICTED: uncharacterized LOC101217126          97.4    5e-20   
ref|XP_004143175.1|  PREDICTED: uncharacterized protein LOC101217126  97.1    6e-20   
ref|XP_008456355.1|  PREDICTED: protodermal factor 1-like             97.1    6e-20   
gb|EYU31571.1|  hypothetical protein MIMGU_mgv1a013646mg              95.9    1e-19   
ref|XP_002307539.2|  hypothetical protein POPTR_0005s22280g           96.7    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011044808.1|  PREDICTED: protodermal factor 1-like             95.9    2e-19   
ref|XP_002520383.1|  copper ion binding protein, putative             96.3    2e-19   Ricinus communis
ref|XP_006386286.1|  hypothetical protein POPTR_0002s06160g           95.9    4e-19   
ref|NP_001044120.1|  Os01g0726700                                     98.6    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55322.1|  hypothetical protein OsJ_03322                        98.6    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011026338.1|  PREDICTED: protodermal factor 1-like             94.7    6e-19   
ref|XP_004171602.1|  PREDICTED: uncharacterized protein LOC101225955  91.7    1e-18   
ref|XP_007141385.1|  hypothetical protein PHAVU_008G190900g           95.1    1e-18   
ref|XP_010273406.1|  PREDICTED: protodermal factor 1                  94.0    1e-18   
ref|XP_004303856.1|  PREDICTED: protodermal factor 1-like             94.0    1e-18   
ref|XP_007217461.1|  hypothetical protein PRUPE_ppa027080mg           93.2    2e-18   
gb|EEC71412.1|  hypothetical protein OsI_03588                        96.3    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_008229397.1|  PREDICTED: protodermal factor 1                  93.6    2e-18   
ref|XP_007141386.1|  hypothetical protein PHAVU_008G190900g           94.0    7e-18   
gb|EPS67965.1|  protodermal factor 1.3                                90.5    1e-17   
ref|XP_009395219.1|  PREDICTED: protodermal factor 1-like             90.1    2e-17   
ref|XP_009415185.1|  PREDICTED: protodermal factor 1-like             88.6    2e-17   
ref|XP_008380226.1|  PREDICTED: protodermal factor 1-like             90.5    2e-17   
ref|XP_008342372.1|  PREDICTED: protodermal factor 1                  90.1    3e-17   
ref|XP_009377653.1|  PREDICTED: protodermal factor 1-like             90.1    3e-17   
ref|XP_004243231.1|  PREDICTED: protodermal factor 1                  89.4    4e-17   
ref|XP_008449530.1|  PREDICTED: protodermal factor 1-like isoform...  90.5    4e-17   
ref|XP_006437196.1|  hypothetical protein CICLE_v10032169mg           89.4    7e-17   
ref|XP_010525366.1|  PREDICTED: protodermal factor 1                  89.0    7e-17   
ref|XP_008449524.1|  PREDICTED: protodermal factor 1-like isoform X5  90.5    8e-17   
ref|XP_008449526.1|  PREDICTED: protodermal factor 1-like isoform X7  90.5    8e-17   
ref|XP_008449523.1|  PREDICTED: protodermal factor 1-like isoform X4  90.5    8e-17   
ref|XP_008449525.1|  PREDICTED: protodermal factor 1-like isoform X6  90.5    8e-17   
ref|XP_008449528.1|  PREDICTED: protodermal factor 1-like isoform X9  90.5    8e-17   
ref|XP_008449527.1|  PREDICTED: protodermal factor 1-like isoform X8  90.5    8e-17   
ref|XP_008449522.1|  PREDICTED: protodermal factor 1-like isoform X3  90.5    8e-17   
ref|XP_008449520.1|  PREDICTED: protodermal factor 1-like isoform X2  90.5    9e-17   
ref|XP_006437197.1|  hypothetical protein CICLE_v10032169mg           89.0    9e-17   
ref|XP_008449519.1|  PREDICTED: protodermal factor 1-like isoform X1  90.5    9e-17   
ref|XP_006348944.1|  PREDICTED: protodermal factor 1-like             88.2    1e-16   
ref|XP_009356648.1|  PREDICTED: protodermal factor 1-like             88.2    1e-16   
ref|XP_010102174.1|  hypothetical protein L484_021408                 87.8    1e-16   
ref|XP_006575665.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    2e-16   
gb|KGN47994.1|  hypothetical protein Csa_6G423360                     90.1    2e-16   
ref|XP_004140248.1|  PREDICTED: uncharacterized protein LOC101219879  89.7    2e-16   
ref|XP_003518516.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    3e-16   
ref|XP_007146358.1|  hypothetical protein PHAVU_006G033900g           86.3    4e-16   
ref|XP_007146359.1|  hypothetical protein PHAVU_006G033900g           86.3    6e-16   
ref|XP_010506127.1|  PREDICTED: protodermal factor 1-like             87.0    7e-16   
ref|XP_003567069.2|  PREDICTED: protodermal factor 1-like             87.8    9e-16   
ref|XP_010272672.1|  PREDICTED: protodermal factor 1-like             85.1    1e-15   
ref|XP_010508517.1|  PREDICTED: protodermal factor 1                  87.4    1e-15   
gb|AEA50959.1|  protodermal factor 1.2                                85.1    2e-15   
ref|XP_007048835.1|  Protodermal factor 1.3, putative                 85.9    2e-15   
gb|KHG14479.1|  hypothetical protein F383_09534                       85.5    2e-15   
gb|AEA50962.1|  protodermal factor 1.3                                85.1    2e-15   
gb|AEA50960.1|  protodermal factor 1.3                                85.1    3e-15   
ref|XP_006294534.1|  hypothetical protein CARUB_v10023570mg           85.1    3e-15   
ref|XP_010517829.1|  PREDICTED: protodermal factor 1-like             85.1    3e-15   
ref|XP_006411555.1|  hypothetical protein EUTSA_v10016927mg           84.7    3e-15   
ref|NP_181812.1|  protodermal factor 1                                84.3    4e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50826.1|  BnaC04g52630D                                        85.5    5e-15   
ref|XP_009407017.1|  PREDICTED: protodermal factor 1-like             83.6    5e-15   
emb|CDX79858.1|  BnaA05g02980D                                        85.5    5e-15   
ref|XP_009142865.1|  PREDICTED: protodermal factor 1                  85.1    6e-15   
gb|ABL86674.1|  PDF                                                   83.6    6e-15   Gossypium barbadense [Egyptian cotton]
ref|XP_006646282.1|  PREDICTED: extensin-like                         85.9    7e-15   
gb|KFK37128.1|  protodermal factor                                    83.6    7e-15   
ref|XP_010924678.1|  PREDICTED: protodermal factor 1-like             82.4    1e-14   
gb|AEA50961.1|  protodermal factor 1.1                                82.0    2e-14   
ref|XP_004513725.1|  PREDICTED: protodermal factor 1-like             82.0    2e-14   
ref|XP_004491347.1|  PREDICTED: extensin-like                         84.0    2e-14   
ref|XP_003602116.1|  hypothetical protein MTR_3g089570                81.6    2e-14   
gb|AFK43320.1|  unknown                                               81.6    3e-14   
emb|CDY14858.1|  BnaC04g48550D                                        81.6    3e-14   
ref|XP_009142091.1|  PREDICTED: protodermal factor 1-like             81.6    3e-14   
emb|CDY47992.1|  BnaA04g24700D                                        81.6    3e-14   
ref|XP_006859008.1|  hypothetical protein AMTR_s00068p00158450        81.3    3e-14   
ref|XP_003532098.1|  PREDICTED: protodermal factor 1-like isoform 1   81.3    3e-14   
ref|XP_006601837.1|  PREDICTED: uncharacterized protein LOC100810...  80.9    4e-14   
gb|ACU19260.1|  unknown                                               80.9    4e-14   Glycine max [soybeans]
ref|XP_003532099.1|  PREDICTED: protodermal factor 1-like isoform 2   80.9    4e-14   
ref|NP_001240242.1|  uncharacterized protein LOC100810866 precursor   80.9    4e-14   
ref|NP_001148678.1|  meiosis 5 precursor                              77.4    3e-13   Zea mays [maize]
dbj|BAJ92021.1|  predicted protein                                    80.5    4e-13   
ref|XP_009392539.1|  PREDICTED: protodermal factor 1-like             77.0    4e-13   
gb|EMS52214.1|  hypothetical protein TRIUR3_33602                     80.1    5e-13   
emb|CDM84206.1|  unnamed protein product                              79.7    6e-13   
gb|AFW71223.1|  meiosis 5                                             76.3    7e-13   
ref|XP_008792281.1|  PREDICTED: protodermal factor 1-like             76.6    1e-12   
ref|XP_008791849.1|  PREDICTED: protodermal factor 1                  78.2    2e-12   
ref|NP_001151862.1|  DNA-directed RNA polymerase II largest subun...  78.2    2e-12   Zea mays [maize]
ref|XP_009381201.1|  PREDICTED: protodermal factor 1-like             75.9    2e-12   
ref|XP_008673135.1|  PREDICTED: uncharacterized protein LOC100382...  78.2    2e-12   
ref|XP_010915432.1|  PREDICTED: leucine-rich repeat extensin-like...  77.8    3e-12   
ref|XP_002451823.1|  hypothetical protein SORBIDRAFT_04g008270        74.3    4e-12   Sorghum bicolor [broomcorn]
ref|XP_004951386.1|  PREDICTED: protodermal factor 1-like             73.2    1e-11   
gb|ADE77644.1|  unknown                                               73.9    3e-11   
ref|XP_002456277.1|  hypothetical protein SORBIDRAFT_03g033390        74.3    4e-11   Sorghum bicolor [broomcorn]
gb|EMT14417.1|  hypothetical protein F775_04470                       72.0    7e-11   
ref|NP_001150889.1|  LOC100284522 precursor                           70.1    9e-11   Zea mays [maize]
ref|XP_004969811.1|  PREDICTED: sialidase-like                        73.2    9e-11   
ref|XP_004965593.1|  PREDICTED: keratin-3, type I cytoskeletal 51...  69.3    2e-10   
ref|XP_009409605.1|  PREDICTED: protodermal factor 1-like             67.4    3e-10   
ref|XP_010667972.1|  PREDICTED: protodermal factor 1                  70.1    5e-10   
ref|XP_002438553.1|  hypothetical protein SORBIDRAFT_10g021810        68.2    5e-10   Sorghum bicolor [broomcorn]
gb|AFW86949.1|  meiosis 5                                             67.4    7e-10   
ref|NP_001148016.1|  meiosis 5 precursor                              67.0    9e-10   Zea mays [maize]
gb|AFW86950.1|  hypothetical protein ZEAMMB73_132004                  67.0    9e-10   
gb|ACG27615.1|  meiosis 5                                             67.0    1e-09   Zea mays [maize]
ref|XP_003571819.1|  PREDICTED: protodermal factor 1-like             67.8    1e-09   
gb|AFW86951.1|  meiosis 5                                             67.0    1e-09   
ref|NP_001168480.1|  uncharacterized protein LOC100382257 precursor   66.6    1e-09   Zea mays [maize]
gb|ACG28466.1|  meiosis 5                                             66.6    1e-09   Zea mays [maize]
gb|AAT71304.1|  proline- and threonine-rich protein                   67.0    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AFW76536.1|  hypothetical protein ZEAMMB73_750604                  65.9    1e-09   
ref|NP_001172867.1|  Os02g0230300                                     67.0    1e-09   
ref|NP_001183948.1|  uncharacterized protein LOC100502555 precursor   66.6    2e-09   
emb|CDM81708.1|  unnamed protein product                              67.0    2e-09   
ref|NP_001148184.1|  meiosis 5 precursor                              66.6    2e-09   Zea mays [maize]
ref|XP_006576119.1|  PREDICTED: protodermal factor 1-like             65.9    2e-09   
gb|KHN38375.1|  hypothetical protein glysoja_004040                   65.9    2e-09   
ref|XP_006647097.1|  PREDICTED: protodermal factor 1-like             66.6    2e-09   
gb|AFW86948.1|  hypothetical protein ZEAMMB73_132004                  66.2    2e-09   
gb|AEJ07953.1|  meiosis 5-like protein                                67.8    4e-09   
gb|EAY85105.1|  hypothetical protein OsI_06457                        65.9    4e-09   Oryza sativa Indica Group [Indian rice]
dbj|BAJ91952.1|  predicted protein                                    65.9    4e-09   
ref|NP_001057844.1|  Os06g0553200                                     65.1    5e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01309.1|  hypothetical protein OsI_23340                        65.1    6e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002436628.1|  hypothetical protein SORBIDRAFT_10g006190        67.0    6e-09   Sorghum bicolor [broomcorn]
gb|AAV58857.1|  meiosis 5                                             66.6    7e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006656154.1|  PREDICTED: protodermal factor 1-like             63.2    2e-08   
dbj|BAJ89562.1|  predicted protein                                    62.0    5e-08   
gb|EMT07136.1|  hypothetical protein F775_31687                       61.2    1e-07   
ref|XP_003563769.1|  PREDICTED: protodermal factor 1-like             60.8    1e-07   
ref|XP_010053227.1|  PREDICTED: protodermal factor 1                  62.4    2e-07   
dbj|BAJ86629.1|  predicted protein                                    61.2    4e-07   
emb|CDM82145.1|  unnamed protein product                              61.2    4e-07   
gb|EMT03246.1|  hypothetical protein F775_31546                       60.8    5e-07   
ref|NP_001042324.2|  Os01g0201600                                     60.8    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968555.1|  PREDICTED: keratin, type I cytoskeletal 9-like   58.9    3e-06   
gb|AFV13467.1|  meiosis 5-like protein                                56.6    2e-05   
ref|XP_002457165.1|  hypothetical protein SORBIDRAFT_03g002540        56.2    2e-05   Sorghum bicolor [broomcorn]
ref|XP_003565471.1|  PREDICTED: protodermal factor 1-like             55.1    4e-05   
ref|NP_001150305.1|  meiosis 5 precursor                              55.1    4e-05   Zea mays [maize]



>emb|CDP18718.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 84/101 (83%), Gaps = 3/101 (3%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQA  949
             P  PP+GFDPNSPPF+C+YW++HP LIWGL+G+WGTVG   G  S+P   FG+N+++LQA
Sbjct  170   PPAPPYGFDPNSPPFSCNYWRTHPTLIWGLLGWWGTVGQTLGATSIPG--FGSNMSVLQA  227

Query  950   LSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LSNTR DG+G LYREGTAS LNSM++ + FPYTTQ VRD+F
Sbjct  228   LSNTRTDGFGALYREGTASFLNSMVH-RNFPYTTQQVRDTF  267


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query  269  MRMERSSKHGSLLLWATMAALLSQNLVVIPAIAAAAFNDQKNYYSPDPN  415
            M  +RS    SLLLWAT+A LLSQNL+V  AI+AA   DQKNYY PDPN
Sbjct  1    MERKRSKLQASLLLWATVAVLLSQNLLVS-AISAATVEDQKNYYPPDPN  48



>ref|XP_011098078.1| PREDICTED: protodermal factor 1-like [Sesamum indicum]
Length=270

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 3/99 (3%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
             +PPF FDPNSPPFTC YW++HP LIWGL G+W T+G  FGV S+P    G ++NLLQALS
Sbjct  146   SPPFPFDPNSPPFTCTYWRNHPTLIWGLFGWWATIGNAFGVTSLPG--TGAHMNLLQALS  203

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NTR DG GELYREGTA+LLNSM + K FPYTT HVRDSF
Sbjct  204   NTRADGVGELYREGTAALLNSMTHPK-FPYTTTHVRDSF  241


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = +2

Query  275  MERS-SKHGSLLLWATMAALLSQNLVVIPAIAAAAFNDQKN-YYSPDPN  415
            MER  SK  S+LLWA +AAL SQNL V+P ++A  F DQKN +Y+P P+
Sbjct  1    MERKRSKPASVLLWAAVAALFSQNL-VMPVVSAIGFEDQKNFFYTPVPS  48



>ref|XP_011082933.1| PREDICTED: protodermal factor 1-like [Sesamum indicum]
Length=291

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 3/99 (3%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
             +PPF FDPNSPPFTC YW++HP LIWGL G+WGT+G  FG+ SVP   F  N+NLLQALS
Sbjct  167   SPPFPFDPNSPPFTCIYWRNHPTLIWGLFGWWGTLGSAFGLTSVPG--FSPNMNLLQALS  224

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NTR DG G+LYREGTA+LLNSM +T RFPYTT  VRDSF
Sbjct  225   NTRTDGLGDLYREGTAALLNSMAHT-RFPYTTSQVRDSF  262



>ref|XP_009798270.1| PREDICTED: protodermal factor 1-like [Nicotiana sylvestris]
Length=348

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 3/96 (3%)
 Frame = +2

Query  785   FGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTR  964
             F  DPNSPPFTCDYW++HP LIWG++G+WG+VG  FGV+SVPA   G N+NLLQALSNTR
Sbjct  227   FPIDPNSPPFTCDYWRTHPTLIWGILGWWGSVGNAFGVSSVPA--LGANMNLLQALSNTR  284

Query  965   NDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              DG GELYREGTASLLNSM+ ++RF YTT  VR+SF
Sbjct  285   PDGLGELYREGTASLLNSMV-SRRFTYTTDQVRNSF  319



>ref|XP_009598266.1| PREDICTED: protodermal factor 1-like [Nicotiana tomentosiformis]
Length=325

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 3/96 (3%)
 Frame = +2

Query  785   FGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTR  964
             F  DPNSPPFTCDYW++HP LIWG++G+WG+VG  FGVASVPA   G N+NLLQALSNTR
Sbjct  204   FPIDPNSPPFTCDYWRTHPTLIWGILGWWGSVGNAFGVASVPA--LGANMNLLQALSNTR  261

Query  965   NDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              DG GELYREGTASLLNSM+ ++RF YTT  V++SF
Sbjct  262   PDGLGELYREGTASLLNSMV-SRRFTYTTNQVKNSF  296



>ref|XP_004251814.1| PREDICTED: protodermal factor 1-like [Solanum lycopersicum]
Length=407

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = +2

Query  767   EPSTPP----FGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNL  934
             +P TP     F  DPNSPPFTC+YW++HP LIWGL G+ GTVG  FGVASVP   FG+N+
Sbjct  280   DPGTPSAPGVFPIDPNSPPFTCNYWRTHPTLIWGLFGWLGTVGNSFGVASVPG--FGSNM  337

Query  935   NLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NLLQALSN+R D YG+LYREGTASLLNSM+ +K F YTT  VRDSF
Sbjct  338   NLLQALSNSRTDAYGDLYREGTASLLNSMV-SKSFTYTTNQVRDSF  382



>gb|EYU29573.1| hypothetical protein MIMGU_mgv1a010287mg [Erythranthe guttata]
Length=317

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +2

Query  761   GLEPSTPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNL  940
             G+   +P F FDPNSPPF+C+YW++HP L+WGL+G+WGTVG  FGV +   G  G+N+NL
Sbjct  190   GITIPSPAFPFDPNSPPFSCNYWRNHPTLVWGLIGWWGTVGNAFGVPTSSPG-LGSNMNL  248

Query  941   LQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             +QALSNTR+DG+GELYR+GTA+LLNSM ++  FPYTT  VRDSF
Sbjct  249   IQALSNTRSDGFGELYRQGTAALLNSMAHSTSFPYTTTQVRDSF  292



>ref|XP_006350016.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like [Solanum 
tuberosum]
Length=656

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 7/106 (7%)
 Frame = +2

Query  767   EPSTPP----FGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNL  934
             +P TP     F  DPNSPPFTC+YW++HP LIWGL G+WGTVG  FGVASVP   FG+N+
Sbjct  529   DPGTPSAPGVFPIDPNSPPFTCNYWRTHPTLIWGLFGWWGTVGNSFGVASVPG--FGSNM  586

Query  935   NLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NLLQALSN+RND YG+LYREGTASLLNSM+ +K F YT+  VRDSF
Sbjct  587   NLLQALSNSRNDAYGDLYREGTASLLNSMV-SKSFTYTSNQVRDSF  631



>gb|EPS67338.1| hypothetical protein M569_07441, partial [Genlisea aurea]
Length=173

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 3/99 (3%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
             TP FGFDPNSPPFTC++W+++P ++W L+G+ GT+G  FG+++ P   FG   N LQALS
Sbjct  54    TPRFGFDPNSPPFTCNFWRTNPAMVWRLLGYLGTLGNAFGISTFPG--FGPRTNALQALS  111

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NTRNDGYGELYREGTA+LLN+M +T RFP+T   VR+ F
Sbjct  112   NTRNDGYGELYREGTAALLNAMTHT-RFPFTATEVRNGF  149



>ref|XP_002283883.1| PREDICTED: protodermal factor 1 [Vitis vinifera]
Length=281

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 84/105 (80%), Gaps = 4/105 (4%)
 Frame = +2

Query  761   GLEPSTPPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLN  937
             G+   TPPF  DPNSP   TC+YW +HPG IWGL+G+WGT+GG FGVASVP   FG N++
Sbjct  151   GISIPTPPFLPDPNSPFTGTCNYWSTHPGAIWGLLGWWGTLGGAFGVASVPG--FGANIS  208

Query  938   LLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             L QALSNTR DG GELYREGTASLLNSM+N KRFP+TT+ VRD F
Sbjct  209   LQQALSNTRTDGLGELYREGTASLLNSMVN-KRFPFTTKQVRDRF  252



>gb|EPS57238.1| hypothetical protein M569_17582, partial [Genlisea aurea]
Length=189

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +2

Query  785   FGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvf-gvASVPAGEFGTNLNLLQALSNT  961
             FGFDP+SPPFTC +W++HP L+WGL+G W    G   G++SVP   FG++ N+LQALSNT
Sbjct  70    FGFDPHSPPFTCIFWRNHPTLVWGLLGGWWGTLGNAFGISSVPG--FGSHANVLQALSNT  127

Query  962   RNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             R DGYGELYREGTA+LLN++  T+ FPY+   VRD F
Sbjct  128   REDGYGELYREGTAALLNAVARTRFFPYSANEVRDGF  164



>ref|XP_004248209.2| PREDICTED: protodermal factor 1-like [Solanum lycopersicum]
Length=415

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 3/98 (3%)
 Frame = +2

Query  779   PPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSN  958
             PP  FDPNSPPF+ DYW+++P LIW L G+W T+G  FGVA  PA   G+N NLLQAL+N
Sbjct  292   PPPLFDPNSPPFSIDYWRTNPALIWALCGWWATIGSAFGVA--PAPGLGSNFNLLQALTN  349

Query  959   TRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             TR+DG GELYREGTASLLNSM+N K+FPYTT+ VR++F
Sbjct  350   TRSDGVGELYREGTASLLNSMVN-KKFPYTTKQVRENF  386



>gb|KDP42653.1| hypothetical protein JCGZ_00157 [Jatropha curcas]
Length=293

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 85/99 (86%), Gaps = 4/99 (4%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
             +PPF  DPNSP +TC+YWK+HPGL+WGL+G+WGTVG  FGV S+P+  FGT++N+ QAL+
Sbjct  170   SPPFTPDPNSP-YTCNYWKNHPGLVWGLLGWWGTVGNAFGVTSLPS--FGTSMNVQQALA  226

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NTR DGYG LYREGTA+LLNSM++ K FP+TT+ VR+SF
Sbjct  227   NTRADGYGSLYREGTAALLNSMVSNK-FPFTTRQVRESF  264



>ref|XP_009597208.1| PREDICTED: protodermal factor 1-like [Nicotiana tomentosiformis]
Length=268

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (80%), Gaps = 4/104 (4%)
 Frame = +2

Query  764   LEPSTPPFGFDPN-SPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNL  940
             ++P TP     P  SPPFTCDYW++HPGLIWGL G+WGTVGG FGVA+ P    G+N+NL
Sbjct  139   VDPGTPSTPAIPTPSPPFTCDYWRTHPGLIWGLFGWWGTVGGAFGVATAPG--LGSNMNL  196

Query  941   LQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LQALSNT  DG+G+LYREGTASLLNSM+ +KRF YTT  V+++F
Sbjct  197   LQALSNTHTDGFGQLYREGTASLLNSMV-SKRFSYTTTQVKNNF  239


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  269  MRMERSSKHGSLLLWATMAALLSQNLVVIPAIAAAAFNDQKNYYSPDPNI  418
            M  ++ SK  SL+LWA  AALLSQNLV IP ++ A+F +QKN+Y PDP I
Sbjct  1    MMEKQRSKQSSLILWAAFAALLSQNLV-IPVMSTASFEEQKNFYIPDPTI  49



>ref|XP_009620538.1| PREDICTED: protodermal factor 1 [Nicotiana tomentosiformis]
Length=389

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = +2

Query  779   PPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSN  958
             PP  FDPNSPPF  DYW+++P LIWGL G+W TVG  FGVAS P   FG NLNLLQALSN
Sbjct  266   PPPLFDPNSPPFPLDYWRTNPALIWGLFGWWATVGSAFGVASTPG--FGGNLNLLQALSN  323

Query  959   TRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              R DG G+LYREGTASLLNSM+ +K F Y+T+ VRDSF
Sbjct  324   PRADGVGDLYREGTASLLNSMV-SKNFAYSTKQVRDSF  360



>ref|XP_010035900.1| PREDICTED: protodermal factor 1-like [Eucalyptus grandis]
 gb|KCW47405.1| hypothetical protein EUGRSUZ_K01198 [Eucalyptus grandis]
Length=318

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 83/101 (82%), Gaps = 7/101 (7%)
 Frame = +2

Query  776   TPPFGFDPNSPPFT--CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQA  949
             TPPF  DPNS PFT  C++W++HPG+IWGL+G+WGTVGG FG  S+P   F +NLNL+QA
Sbjct  194   TPPF--DPNSNPFTGTCNFWRTHPGVIWGLLGWWGTVGGTFGATSMPG--FPSNLNLMQA  249

Query  950   LSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LSNTR DG G+LYREGTASLLNSM+N  RFPYTTQ V++ F
Sbjct  250   LSNTRTDGLGQLYREGTASLLNSMVN-ARFPYTTQQVKERF  289



>ref|XP_006360063.1| PREDICTED: protodermal factor 1-like, partial [Solanum tuberosum]
Length=347

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = +2

Query  779   PPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSN  958
             PP  F PNSPPF+ DYW+++P LIWGL G+W TVG  FGVA+ P    G+N NLLQALSN
Sbjct  224   PPPLFYPNSPPFSIDYWRTNPALIWGLFGWWATVGSAFGVAASPG--LGSNFNLLQALSN  281

Query  959   TRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             TR+DG GELYREGTASLLNSM+N K++PYTT+ VR+ F
Sbjct  282   TRSDGVGELYREGTASLLNSMVN-KKYPYTTKQVREKF  318



>ref|XP_009800987.1| PREDICTED: protodermal factor 1 [Nicotiana sylvestris]
Length=394

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = +2

Query  779   PPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSN  958
             PP  FDPNSPPF  DYW+++P LIWGL G+W TVG  FGVA  P   FG NLNLLQALSN
Sbjct  271   PPPLFDPNSPPFPLDYWRTNPALIWGLFGWWATVGSAFGVAGAPG--FGGNLNLLQALSN  328

Query  959   TRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              R DG GELYREGTASLLNSM  +K F Y+T+ VRDSF
Sbjct  329   PRADGVGELYREGTASLLNSM-GSKNFAYSTKQVRDSF  365


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  275  MERSSKHGSLLLWATMAALLSQNLVVIPAIAAAAFNDQKNYYSPDPNI  418
            ++  +   SL+LWA +AALLSQNL+ IP ++ A F +QK  +SPDPNI
Sbjct  2    VKEKNMQTSLILWAAVAALLSQNLL-IPVMSTATFEEQKTDHSPDPNI  48



>ref|XP_009771855.1| PREDICTED: protodermal factor 1-like [Nicotiana sylvestris]
Length=268

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 82/104 (79%), Gaps = 4/104 (4%)
 Frame = +2

Query  764   LEPSTPPFGFDPN-SPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNL  940
             ++P TP     P  SPPFTCDYW++HPGLIWGL G+WGTVGG FGVA+ P    G ++NL
Sbjct  139   VDPGTPSTPAIPTPSPPFTCDYWRTHPGLIWGLFGWWGTVGGAFGVATAPG--LGAHMNL  196

Query  941   LQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LQALSNT  DG+G+LYREGTASLLNSM+ +KRF YTT  V+++F
Sbjct  197   LQALSNTHTDGFGQLYREGTASLLNSMV-SKRFAYTTTQVKNNF  239


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  269  MRMERSSKHGSLLLWATMAALLSQNLVVIPAIAAAAFNDQKNYYSPDPNI  418
            M  ++ SK  SL+LWA  AALLSQNLV IP ++ A+F +QKN+Y PDP I
Sbjct  1    MMEKQRSKQSSLILWAAFAALLSQNLV-IPVMSTASFEEQKNFYIPDPTI  49



>ref|XP_004169671.1| PREDICTED: uncharacterized LOC101217126 [Cucumis sativus]
Length=241

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 3/87 (3%)
 Frame = +2

Query  812   FTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYR  991
             FTC YW +HPGLIWG++G+WGT+G  FG  +VP   FGTNLNLLQALSNTRNDGYG L R
Sbjct  129   FTCTYWLNHPGLIWGVLGWWGTLGNAFGATNVPG--FGTNLNLLQALSNTRNDGYGALLR  186

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EGTAS LNS L + RFPYTT+ VR SF
Sbjct  187   EGTASYLNS-LASNRFPYTTKQVRTSF  212



>ref|XP_004143175.1| PREDICTED: uncharacterized protein LOC101217126 [Cucumis sativus]
 gb|KGN47037.1| hypothetical protein Csa_6G178950 [Cucumis sativus]
Length=241

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 3/87 (3%)
 Frame = +2

Query  812   FTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYR  991
             FTC YW +HPGLIWG++G+WGT+G  FG  +VP   FGTNLNLLQALSNTRNDGYG L R
Sbjct  129   FTCTYWLNHPGLIWGVLGWWGTLGNAFGATNVPG--FGTNLNLLQALSNTRNDGYGALLR  186

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EGTAS LNS L + RFPYTT+ VR SF
Sbjct  187   EGTASYLNS-LASNRFPYTTKQVRTSF  212



>ref|XP_008456355.1| PREDICTED: protodermal factor 1-like [Cucumis melo]
Length=237

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 3/87 (3%)
 Frame = +2

Query  812   FTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYR  991
             FTC+YW +HPGLIWG++G+WGT+G  FG  +VP   FGTNLNLLQALSNTRNDGYG L R
Sbjct  125   FTCNYWLNHPGLIWGVLGWWGTLGNAFGATNVPG--FGTNLNLLQALSNTRNDGYGALLR  182

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EGTAS LNS L + RFPYTT+ VR SF
Sbjct  183   EGTASYLNS-LASNRFPYTTKQVRTSF  208



>gb|EYU31571.1| hypothetical protein MIMGU_mgv1a013646mg [Erythranthe guttata]
Length=214

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = +2

Query  761   GLEPSTPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNL  940
             G+   +PPF FDPNSPPF C YWK+HP ++WGLVG+WGTVG  FGV     G FG +LN 
Sbjct  88    GITIPSPPFAFDPNSPPFNCTYWKNHPTIVWGLVGWWGTVGNAFGVTGTIPG-FGAHLNP  146

Query  941   LQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             L+AL+NTR DG+GEL R+GTA+LLN + +TK FP T   VR SF
Sbjct  147   LEALTNTRTDGFGELCRQGTAALLNCLAHTK-FPLTAAQVRSSF  189



>ref|XP_002307539.2| hypothetical protein POPTR_0005s22280g [Populus trichocarpa]
 gb|EEE94535.2| hypothetical protein POPTR_0005s22280g [Populus trichocarpa]
Length=291

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 78/93 (84%), Gaps = 4/93 (4%)
 Frame = +2

Query  794   DPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDG  973
             DPNSP F+C+YW++HP LIWG++G+WGT+G  FGV S+P   FGT++ + QALSNTR DG
Sbjct  174   DPNSP-FSCNYWRTHPALIWGVLGWWGTMGNAFGVGSLPG--FGTSMTVQQALSNTRTDG  230

Query  974   YGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             YG LYREGTASLLNSM+ + RFP+TT+ VR++F
Sbjct  231   YGTLYREGTASLLNSMV-SNRFPFTTRQVRENF  262



>ref|XP_011044808.1| PREDICTED: protodermal factor 1-like [Populus euphratica]
Length=259

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +2

Query  794   DPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDG  973
             DPNSP F+C+YW++HP LIWG++G+WGT+G  FGV S+P   FGT++ + QALSNTR DG
Sbjct  142   DPNSP-FSCNYWRTHPALIWGVLGWWGTMGNAFGVGSLPG--FGTSMTVQQALSNTRTDG  198

Query  974   YGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             YG LYREGTASLLNSM+ + RFP+TT  VR++F
Sbjct  199   YGTLYREGTASLLNSMV-SNRFPFTTTQVRENF  230



>ref|XP_002520383.1| copper ion binding protein, putative [Ricinus communis]
 gb|EEF41999.1| copper ion binding protein, putative [Ricinus communis]
Length=284

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = +2

Query  785   FGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTR  964
             F  DPNSP F+C+YW++HP +IWGL+G+WGTVG  FG  SVP    G +++L QALSNTR
Sbjct  164   FSPDPNSP-FSCNYWRTHPAIIWGLLGWWGTVGSAFGTTSVPG--LGASMSLQQALSNTR  220

Query  965   NDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              DGYG LYREGTASLLNSM++ K FP+TT+ VR+SF
Sbjct  221   TDGYGTLYREGTASLLNSMVSNK-FPFTTRQVRESF  255


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  269  MRMERSSKHGSLLLWATMAALLSQNLVVIPAIAAAAFNDQKNYYSPDPN  415
            M  E+  +H S+L+W   A L+SQ+ +V P +A   + DQKNYYSPDP+
Sbjct  1    MGKEKCKQHASVLMWVFAAGLISQSFLV-PVMATTTYEDQKNYYSPDPH  48



>ref|XP_006386286.1| hypothetical protein POPTR_0002s06160g [Populus trichocarpa]
 gb|ERP64083.1| hypothetical protein POPTR_0002s06160g [Populus trichocarpa]
Length=308

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +2

Query  794   DPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDG  973
             DPNSP F+C+YW++HP LIWG++G+WGT+G  FGV  +P   FGT++ L QALSNTR DG
Sbjct  191   DPNSP-FSCNYWRTHPALIWGVLGWWGTMGNAFGVTRLPG--FGTSMTLQQALSNTRTDG  247

Query  974   YGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             YG LYREGTASLLNSM+ + RFP+TT+ VR++F
Sbjct  248   YGTLYREGTASLLNSMV-SNRFPFTTRQVRENF  279



>ref|NP_001044120.1| Os01g0726700 [Oryza sativa Japonica Group]
 dbj|BAF06034.1| Os01g0726700 [Oryza sativa Japonica Group]
Length=662

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = +2

Query  773   STPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQAL  952
             ST P  FDPN+ PF C YW SHPG+IWGL GFW  +  +FG  +  A  FG +L + +AL
Sbjct  537   STTPMPFDPNTAPFPCSYWLSHPGVIWGLFGFWCPMARLFGPTA--AAPFGHDLTVPEAL  594

Query  953   SNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             +NTR DG GELYREGTASLLNSM+N+ RFP+TTQ V+D+F
Sbjct  595   ANTRADGVGELYREGTASLLNSMVNS-RFPFTTQQVKDAF  633



>gb|EEE55322.1| hypothetical protein OsJ_03322 [Oryza sativa Japonica Group]
Length=650

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = +2

Query  773   STPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQAL  952
             ST P  FDPN+ PF C YW SHPG+IWGL GFW  +  +FG  +  A  FG +L + +AL
Sbjct  525   STTPMPFDPNTAPFPCSYWLSHPGVIWGLFGFWCPMARLFGPTA--AAPFGHDLTVPEAL  582

Query  953   SNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             +NTR DG GELYREGTASLLNSM+N+ RFP+TTQ V+D+F
Sbjct  583   ANTRADGVGELYREGTASLLNSMVNS-RFPFTTQQVKDAF  621



>ref|XP_011026338.1| PREDICTED: protodermal factor 1-like [Populus euphratica]
Length=260

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 4/93 (4%)
 Frame = +2

Query  794   DPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDG  973
             DPNSP F+C+YW++HP LIWG++G+WGT+G  FGV S+P   FGT++ L QALSNTR DG
Sbjct  143   DPNSP-FSCNYWRTHPALIWGVMGWWGTMGNAFGVTSLPG--FGTSMTLQQALSNTRTDG  199

Query  974   YGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             YG LYREGTASLLNSM+ + RF +TT+ VR++F
Sbjct  200   YGTLYREGTASLLNSMV-SNRFSFTTRQVRENF  231



>ref|XP_004171602.1| PREDICTED: uncharacterized protein LOC101225955, partial [Cucumis 
sativus]
Length=158

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  25    YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  82

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  83    TLSLPQALSNTRTDGLGSLYREGAAAFLNSMVN-NRYPFTTNQVRESF  129



>ref|XP_007141385.1| hypothetical protein PHAVU_008G190900g [Phaseolus vulgaris]
 gb|ESW13379.1| hypothetical protein PHAVU_008G190900g [Phaseolus vulgaris]
Length=347

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQA  949
             PSTPP+   P     TC+YW +HPG+IWGL+G+WGT+G VFGV++VP+  FG +L+L QA
Sbjct  221   PSTPPYLPSPTPFTGTCNYWSTHPGIIWGLLGWWGTLGHVFGVSNVPS--FGASLSLPQA  278

Query  950   LSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LSNTR DG G LYREGTAS LNS++N  RFPYTTQ VRDSF
Sbjct  279   LSNTRTDGLGALYREGTASFLNSLVN-NRFPYTTQQVRDSF  318



>ref|XP_010273406.1| PREDICTED: protodermal factor 1 [Nelumbo nucifera]
Length=272

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 6/103 (6%)
 Frame = +2

Query  770   PSTPPFGFDPNSP-PF-TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLL  943
             PSTP   FDPN+P PF TC YW SHPGLIWGL G+WGTV G+FG A  P   F  +L L 
Sbjct  145   PSTP--SFDPNTPSPFGTCSYWGSHPGLIWGLFGWWGTVAGIFGAACTPM-IFSPSLTLH  201

Query  944   QALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             QAL+NTR DG+G LYREGTASLLNSM+N + FP+TTQ ++D F
Sbjct  202   QALTNTRTDGFGALYREGTASLLNSMVN-RGFPFTTQQIKDRF  243



>ref|XP_004303856.1| PREDICTED: protodermal factor 1-like [Fragaria vesca subsp. vesca]
Length=296

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 4/94 (4%)
 Frame = +2

Query  794   DPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTN-LNLLQALSNTRND  970
             +PNSPPFTC YW++HP +IWGLVG+W T+G  FG+ S+P   FG++ +NL QALSNTR D
Sbjct  177   NPNSPPFTCTYWRNHPTVIWGLVGWWATMGHTFGLTSLPG--FGSSTMNLQQALSNTRTD  234

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             G GELYREGTA+LLNSM++  RF +TT  VRDSF
Sbjct  235   GVGELYREGTAALLNSMVD-NRFHFTTTQVRDSF  267



>ref|XP_007217461.1| hypothetical protein PRUPE_ppa027080mg, partial [Prunus persica]
 gb|EMJ18660.1| hypothetical protein PRUPE_ppa027080mg, partial [Prunus persica]
Length=255

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 4/100 (4%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTN-LNLLQAL  952
             TPPF  DPNSPPFTC YW++HP +IWGL+G+WGT+G  FGV S+P   FG++ ++L QAL
Sbjct  130   TPPFLPDPNSPPFTCIYWRNHPTVIWGLLGWWGTLGHAFGVTSLPG--FGSSTMSLQQAL  187

Query  953   SNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             SNT  DG GELYR+GTA+LLNSM++  RF +TT+ VRDSF
Sbjct  188   SNTHTDGLGELYRQGTAALLNSMVD-NRFHFTTKQVRDSF  226



>gb|EEC71412.1| hypothetical protein OsI_03588 [Oryza sativa Indica Group]
Length=625

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = +2

Query  791   FDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRND  970
             FDPN+ PF C YW SHPG+IWGL GFW  +  +FG  +  A  FG +L + +AL+NTR D
Sbjct  506   FDPNTAPFPCSYWLSHPGVIWGLFGFWCPMARLFGPTA--AAPFGHDLTVPEALANTRAD  563

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             G GELYREGTASLLNSM+N+ RFP+TTQ V+D+F
Sbjct  564   GVGELYREGTASLLNSMVNS-RFPFTTQQVKDAF  596



>ref|XP_008229397.1| PREDICTED: protodermal factor 1 [Prunus mume]
Length=301

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 4/100 (4%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTN-LNLLQAL  952
             TPPF  DPNSPPFTC YW++HP +IWGL+G+WGT+G  FGV S+P   FG++ ++L QAL
Sbjct  176   TPPFLPDPNSPPFTCIYWRNHPTVIWGLLGWWGTLGHAFGVNSLPG--FGSSTMSLQQAL  233

Query  953   SNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             SNT  DG GELYR+GTA+LLNSM++  RF +TT+ VRDSF
Sbjct  234   SNTHTDGLGELYRQGTAALLNSMVD-NRFHFTTKQVRDSF  272



>ref|XP_007141386.1| hypothetical protein PHAVU_008G190900g [Phaseolus vulgaris]
 gb|ESW13380.1| hypothetical protein PHAVU_008G190900g [Phaseolus vulgaris]
Length=439

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 82/103 (80%), Gaps = 7/103 (7%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFT--CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLL  943
             PSTPP+   P   PFT  C+YW +HPG+IWGL+G+WGT+G VFGV++VP+  FG +L+L 
Sbjct  313   PSTPPYLPSPT--PFTGTCNYWSTHPGIIWGLLGWWGTLGHVFGVSNVPS--FGASLSLP  368

Query  944   QALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             QALSNTR DG G LYREGTAS LNS++N  RFPYTTQ VRDSF
Sbjct  369   QALSNTRTDGLGALYREGTASFLNSLVN-NRFPYTTQQVRDSF  410



>gb|EPS67965.1| protodermal factor 1.3 [Genlisea aurea]
Length=250

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQA  949
             PS PP G +PNSPPF   +W+++P L+W LVG+WG   G     S   G FG++ N+LQA
Sbjct  126   PSPPPLGLNPNSPPFPFVFWRNNPQLVWRLVGWWGGTLGNAFGISQFPG-FGSHANVLQA  184

Query  950   LSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LSN RNDGYGELYREGTA LLN+M  T R+ Y+   VRD+F
Sbjct  185   LSNDRNDGYGELYREGTAGLLNAMART-RYAYSVNEVRDNF  224



>ref|XP_009395219.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=253

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQA  949
             P+TP   FDPN+ PFTCDYW++H   IWGL+G+WGTV  +FG  +  A  FG +L+L +A
Sbjct  129   PATPLLPFDPNTFPFTCDYWRTHSAAIWGLIGYWGTVSQLFGPPA--AAAFGRSLSLPEA  186

Query  950   LSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             L+NTR DG G LYREGTASLLNS+ N K F ++TQ VRD+F
Sbjct  187   LANTRADGIGALYREGTASLLNSLAN-KSFVFSTQQVRDAF  226



>ref|XP_009415185.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=174

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
              PP   +PNS PF+CDYW++HP  I  L+G+W T+G  FG+ +V A  FG + +LL+ALS
Sbjct  51    VPPAPTNPNSSPFSCDYWRAHPEAILALLGYWCTLGEFFGLPAVSA--FGRDPSLLEALS  108

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NTR+DG G LYREGTASLLNS++N + F  TTQ VR+ F
Sbjct  109   NTRSDGIGALYREGTASLLNSLVN-RNFALTTQKVREEF  146



>ref|XP_008380226.1| PREDICTED: protodermal factor 1-like [Malus domestica]
Length=282

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 3/94 (3%)
 Frame = +2

Query  794   DPNS-PPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRND  970
             DPNS PPFTC+YW+SHP LIWGL+G+WG +G  FGV+S+P    GT ++L QALSNTR D
Sbjct  162   DPNSLPPFTCNYWRSHPTLIWGLLGWWGNLGHSFGVSSLPGIGSGT-MSLPQALSNTRTD  220

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             G GELYR+GTA+LLN+M++  RF +TT  VRDSF
Sbjct  221   GLGELYRQGTAALLNAMVD-NRFHFTTNQVRDSF  253



>ref|XP_008342372.1| PREDICTED: protodermal factor 1 [Malus domestica]
Length=294

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = +2

Query  776   TPPFGFDPNS-PPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQAL  952
             +PPF   PNS PPFTC+YW SHP LIWGL+G+WGT+G  FGV+S+P    GT ++L QAL
Sbjct  168   SPPFLPGPNSLPPFTCNYWGSHPTLIWGLLGWWGTLGNSFGVSSLPGIGSGT-MSLPQAL  226

Query  953   SNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             SNTR DG GELYR+GTA+LLN+M++  RF +TT  VRDSF
Sbjct  227   SNTRTDGLGELYRQGTAALLNAMVD-NRFHFTTNQVRDSF  265



>ref|XP_009377653.1| PREDICTED: protodermal factor 1-like [Pyrus x bretschneideri]
Length=294

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = +2

Query  776   TPPFGFDPNS-PPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQAL  952
             +PPF   PNS PPFTC+YW SHP LIWGL+G+WGT+G  FGV+S+P    GT ++L QAL
Sbjct  168   SPPFLPGPNSLPPFTCNYWGSHPTLIWGLLGWWGTLGNSFGVSSLPGIGSGT-MSLPQAL  226

Query  953   SNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             SNTR DG GELYR+GTA+LLN+M++  RF +TT  VRDSF
Sbjct  227   SNTRTDGLGELYRQGTAALLNAMVD-NRFHFTTNQVRDSF  265



>ref|XP_004243231.1| PREDICTED: protodermal factor 1 [Solanum lycopersicum]
Length=258

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +2

Query  818   CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYREG  997
             CDYW++HPGLIWGL G+WG VG  FGVAS P    G+N+NLLQALSN   DG+G+LYREG
Sbjct  148   CDYWRTHPGLIWGLFGWWGNVGSAFGVASAPG--LGSNMNLLQALSNQHTDGFGQLYREG  205

Query  998   TASLLNSMLNTKRFPYTTQHVRDSF  1072
             TASLLNSM+ +KRF Y+T  V+++F
Sbjct  206   TASLLNSMV-SKRFSYSTTQVKNNF  229



>ref|XP_008449530.1| PREDICTED: protodermal factor 1-like isoform X11 [Cucumis melo]
Length=342

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  209   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  266

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  267   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  313



>ref|XP_006437196.1| hypothetical protein CICLE_v10032169mg [Citrus clementina]
 ref|XP_006484837.1| PREDICTED: protodermal factor 1-like [Citrus sinensis]
 gb|ESR50436.1| hypothetical protein CICLE_v10032169mg [Citrus clementina]
Length=294

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +2

Query  791   FDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRN  967
             FDPNSP P TC YW SHPGLIWGL+G+WGT+GG+    SVP   FG++ +LLQALSNT  
Sbjct  175   FDPNSPVPGTCTYWSSHPGLIWGLLGWWGTLGGIGV-PSVPG--FGSSTSLLQALSNTHT  231

Query  968   DGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             DG+G LYREGTAS LNS+  + RFP+TT  VR+SF
Sbjct  232   DGFGALYREGTASWLNSVA-SHRFPFTTNQVRNSF  265



>ref|XP_010525366.1| PREDICTED: protodermal factor 1 [Tarenaya hassleriana]
Length=292

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 6/106 (6%)
 Frame = +2

Query  764   LEPSTPPFGFDPNS-PPFT--CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNL  934
             ++P TP   F P   PP T  CDYW++HP LIWGL+G+WGTVGGVFG  + P   F +N+
Sbjct  161   IDPGTPGTPFYPAPLPPITGTCDYWRNHPTLIWGLLGWWGTVGGVFGGTTAPG--FSSNM  218

Query  935   NLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NLLQALSN   DGYG LYREGTAS LNSM+N  RFP+TT  VRD+F
Sbjct  219   NLLQALSNAHTDGYGALYREGTASWLNSMVN-NRFPFTTTQVRDNF  263



>ref|XP_008449524.1| PREDICTED: protodermal factor 1-like isoform X5 [Cucumis melo]
Length=391

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  258   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  315

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  316   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  362



>ref|XP_008449526.1| PREDICTED: protodermal factor 1-like isoform X7 [Cucumis melo]
Length=390

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  257   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  314

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  315   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  361



>ref|XP_008449523.1| PREDICTED: protodermal factor 1-like isoform X4 [Cucumis melo]
Length=395

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  262   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  319

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  320   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  366



>ref|XP_008449525.1| PREDICTED: protodermal factor 1-like isoform X6 [Cucumis melo]
Length=390

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  257   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  314

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  315   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  361



>ref|XP_008449528.1| PREDICTED: protodermal factor 1-like isoform X9 [Cucumis melo]
 ref|XP_008449529.1| PREDICTED: protodermal factor 1-like isoform X10 [Cucumis melo]
Length=387

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  254   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  311

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  312   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  358



>ref|XP_008449527.1| PREDICTED: protodermal factor 1-like isoform X8 [Cucumis melo]
Length=388

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  255   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  312

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  313   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  359



>ref|XP_008449522.1| PREDICTED: protodermal factor 1-like isoform X3 [Cucumis melo]
Length=395

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  262   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  319

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  320   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  366



>ref|XP_008449520.1| PREDICTED: protodermal factor 1-like isoform X2 [Cucumis melo]
Length=400

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  267   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  324

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  325   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  371



>ref|XP_006437197.1| hypothetical protein CICLE_v10032169mg [Citrus clementina]
 gb|ESR50437.1| hypothetical protein CICLE_v10032169mg [Citrus clementina]
 gb|KDO60926.1| hypothetical protein CISIN_1g021427mg [Citrus sinensis]
Length=312

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +2

Query  791   FDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRN  967
             FDPNSP P TC YW SHPGLIWGL+G+WGT+GG+    SVP   FG++ +LLQALSNT  
Sbjct  193   FDPNSPVPGTCTYWSSHPGLIWGLLGWWGTLGGIGV-PSVPG--FGSSTSLLQALSNTHT  249

Query  968   DGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             DG+G LYREGTAS LNS+  + RFP+TT  VR+SF
Sbjct  250   DGFGALYREGTASWLNSVA-SHRFPFTTNQVRNSF  283



>ref|XP_008449519.1| PREDICTED: protodermal factor 1-like isoform X1 [Cucumis melo]
Length=405

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  272   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  329

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  330   TLSLPQALSNTRTDGLGALYREGAAAFLNSMVN-NRYPFTTNQVRESF  376



>ref|XP_006348944.1| PREDICTED: protodermal factor 1-like [Solanum tuberosum]
Length=253

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 3/85 (4%)
 Frame = +2

Query  818   CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYREG  997
             CDYW++HPGLIWGL G+WGTVGG FGVAS P    G+N+NLLQALSN   DG G+LYREG
Sbjct  143   CDYWRTHPGLIWGLFGWWGTVGGAFGVASAPG--LGSNMNLLQALSNQHTDGLGQLYREG  200

Query  998   TASLLNSMLNTKRFPYTTQHVRDSF  1072
             TASLLNSM+ +KRF Y+T  V+++F
Sbjct  201   TASLLNSMV-SKRFSYSTTQVKNNF  224



>ref|XP_009356648.1| PREDICTED: protodermal factor 1-like [Pyrus x bretschneideri]
Length=284

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = +2

Query  794   DPNS-PPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRND  970
             DPNS PPFTC+YW+SHP LIWGL+G+WG +G  FGV+S+P    G  ++L QALSNTR D
Sbjct  164   DPNSLPPFTCNYWRSHPTLIWGLLGWWGNLGHSFGVSSLPGIGSGI-MSLPQALSNTRTD  222

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             G GELYR+GTA+LLN+M++  RF +TT  VRDSF
Sbjct  223   GLGELYRQGTAALLNAMVD-NRFHFTTNQVRDSF  255



>ref|XP_010102174.1| hypothetical protein L484_021408 [Morus notabilis]
 gb|EXB92424.1| hypothetical protein L484_021408 [Morus notabilis]
Length=272

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 3/91 (3%)
 Frame = +2

Query  800   NSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYG  979
             NSPPFTC YW++HP LI+G++G+WGT+G  FGV +VP    G+N++L  ALSNTR DGYG
Sbjct  159   NSPPFTCTYWRNHPQLIFGVLGWWGTLGNAFGVPTVPG--LGSNISLKDALSNTRTDGYG  216

Query  980   ELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EL R+ TASLLNSM++  RF +TT+ VR++F
Sbjct  217   ELCRQATASLLNSMID-NRFAFTTKQVRENF  246


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = +2

Query  275  MERSS-KHGSLLLWATMAALLSQNLVVIPAIAAAAFNDQKNYYSPDPNI  418
            MER S +  SLLLW+ +AAL+SQNL++   + +A+F DQKNYY+PDP++
Sbjct  1    MERKSIRMSSLLLWSLVAALVSQNLLI--PVMSASFEDQKNYYTPDPHV  47



>ref|XP_006575665.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like isoform 
X2 [Glycine max]
 gb|KHN38310.1| Sialidase [Glycine soja]
Length=519

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 7/103 (7%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFT--CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLL  943
             PSTPP+   P   PFT  C+YW +HPG+IWGL+G+WGT+G  FGV+S+P   FG + +L 
Sbjct  393   PSTPPYLPSPT--PFTGTCNYWNTHPGIIWGLLGWWGTLGHAFGVSSIPG--FGASRSLP  448

Query  944   QALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             QALSNTR DG G LYREGTAS LNS++N  RFPYTTQ VRD F
Sbjct  449   QALSNTRTDGLGALYREGTASFLNSLVN-NRFPYTTQQVRDRF  490



>gb|KGN47994.1| hypothetical protein Csa_6G423360 [Cucumis sativus]
Length=520

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  387   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  444

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  445   TLSLPQALSNTRTDGLGSLYREGAAAFLNSMVN-NRYPFTTNQVRESF  491



>ref|XP_004140248.1| PREDICTED: uncharacterized protein LOC101219879 [Cucumis sativus]
Length=468

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  758   FGLEPST--PPFGFDPNSP-PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGT  928
             +G  P+T  PPF  DPNSP   TC+YW++HPG+IWGL+G+WGT+G  FG+ + P   FG 
Sbjct  335   YGTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWGTMGSAFGITNAPG--FGA  392

Query  929   NLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              L+L QALSNTR DG G LYREG A+ LNSM+N  R+P+TT  VR+SF
Sbjct  393   TLSLPQALSNTRTDGLGSLYREGAAAFLNSMVN-NRYPFTTNQVRESF  439



>ref|XP_003518516.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like isoform 
X1 [Glycine max]
Length=571

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 7/103 (7%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFT--CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLL  943
             PSTPP+   P   PFT  C+YW +HPG+IWGL+G+WGT+G  FGV+S+P   FG + +L 
Sbjct  445   PSTPPYLPSPT--PFTGTCNYWNTHPGIIWGLLGWWGTLGHAFGVSSIPG--FGASRSLP  500

Query  944   QALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             QALSNTR DG G LYREGTAS LNS++N  RFPYTTQ VRD F
Sbjct  501   QALSNTRTDGLGALYREGTASFLNSLVN-NRFPYTTQQVRDRF  542



>ref|XP_007146358.1| hypothetical protein PHAVU_006G033900g [Phaseolus vulgaris]
 gb|ESW18352.1| hypothetical protein PHAVU_006G033900g [Phaseolus vulgaris]
Length=262

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HP +IWG++G+WGT+G  FGV+SVP   F   L+L QALSNTR+DG G LYRE
Sbjct  151   TCNYWRNHPAIIWGILGWWGTLGSAFGVSSVPG--FSPGLSLPQALSNTRSDGIGALYRE  208

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N+K FPYTT  VRD F
Sbjct  209   GTASFLNSMVNSK-FPYTTNQVRDRF  233



>ref|XP_007146359.1| hypothetical protein PHAVU_006G033900g [Phaseolus vulgaris]
 gb|ESW18353.1| hypothetical protein PHAVU_006G033900g [Phaseolus vulgaris]
Length=268

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HP +IWG++G+WGT+G  FGV+SVP   F   L+L QALSNTR+DG G LYRE
Sbjct  157   TCNYWRNHPAIIWGILGWWGTLGSAFGVSSVPG--FSPGLSLPQALSNTRSDGIGALYRE  214

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N+K FPYTT  VRD F
Sbjct  215   GTASFLNSMVNSK-FPYTTNQVRDRF  239



>ref|XP_010506127.1| PREDICTED: protodermal factor 1-like [Camelina sativa]
Length=340

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 69/110 (63%), Gaps = 10/110 (9%)
 Frame = +2

Query  764   LEPSTPPFGFDPNS-PPFT--CDYWKSHP----GLIwglvgfwgtvggvfgvASVPAGEF  922
             ++P TP   F P   PP T  CDYW++HP    GL+       G  G V   +S+P   F
Sbjct  205   IDPGTPGTPFVPAPFPPITGTCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTSSSIPG--F  262

Query  923   GTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
               ++NLLQALSNTR+D  G LYREGTAS LNSM+NT RFP+TT  VRD F
Sbjct  263   DPHMNLLQALSNTRSDSIGALYREGTASWLNSMVNT-RFPFTTPQVRDHF  311



>ref|XP_003567069.2| PREDICTED: protodermal factor 1-like [Brachypodium distachyon]
Length=453

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 75/118 (64%), Gaps = 20/118 (17%)
 Frame = +2

Query  770   PSTPPFG-------------FDPNSPPFTC---DYWKSHPGLIwglvgfwgtvggv-fgv  898
             PSTPPF              FDPN+PPF+     YW SHPG+IWGL GFW  +  +    
Sbjct  310   PSTPPFSPLVPTPPTNTPAPFDPNTPPFSTGPYSYWMSHPGVIWGLFGFWCPLVRLFGPS  369

Query  899   ASVPAGEFGTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             A+VP   FG +L + +AL+NTR DG G LYREGTASLLNSM++   FP+TTQ V+D F
Sbjct  370   AAVP---FGHDLTVPEALANTRADGVGALYREGTASLLNSMVSAGGFPFTTQQVKDGF  424



>ref|XP_010272672.1| PREDICTED: protodermal factor 1-like [Nelumbo nucifera]
Length=241

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 6/86 (7%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW +HP LIWGL G+WGTV G+FG  +     FGT+L L QAL+NTR DGY  LYRE
Sbjct  133   TCNYWATHPQLIWGLFGWWGTVAGIFGTPT-----FGTSLTLPQALTNTRTDGYSALYRE  187

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTASLLNSM+N KRFP+TTQ V+D F
Sbjct  188   GTASLLNSMVN-KRFPFTTQQVKDHF  212



>ref|XP_010508517.1| PREDICTED: protodermal factor 1 [Camelina sativa]
Length=462

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 69/110 (63%), Gaps = 10/110 (9%)
 Frame = +2

Query  764   LEPSTPPFGFDPNS-PPFT--CDYWKSHP----GLIwglvgfwgtvggvfgvASVPAGEF  922
             ++P TP   F P   PP T  CDYW++HP    GL+       G  G V   +S+P   F
Sbjct  327   IDPGTPGTPFVPAPFPPITGTCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTSSSIPG--F  384

Query  923   GTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
               ++NLLQALSNTR+D  G LYREGTAS LNSM+NT RFP+TT  VRD F
Sbjct  385   DPHMNLLQALSNTRSDSIGALYREGTASWLNSMVNT-RFPFTTSQVRDHF  433



>gb|AEA50959.1| protodermal factor 1.2 [Gossypium barbadense]
Length=294

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TCD+W+SHP LIWGL+G+WGTVG  FGV +VP    GT+++L QALSNTR DG G LYRE
Sbjct  183   TCDFWRSHPTLIWGLLGWWGTVGNAFGVTNVPG--LGTSMSLPQALSNTRTDGLGALYRE  240

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N  RFP++T+ VR++F
Sbjct  241   GTASFLNSMVN-NRFPFSTKQVRETF  265



>ref|XP_007048835.1| Protodermal factor 1.3, putative [Theobroma cacao]
 gb|EOX92992.1| Protodermal factor 1.3, putative [Theobroma cacao]
Length=346

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 70/86 (81%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC++W+SHP LIWG++G+WGT+G  FGV S+P   FGT ++L QALSNT  DG+G LYRE
Sbjct  235   TCNFWRSHPALIWGVLGWWGTLGSAFGVTSIPG--FGTTMSLPQALSNTHTDGFGALYRE  292

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTASLLNSM+N  RF ++T+ VR+SF
Sbjct  293   GTASLLNSMVN-NRFSFSTKQVRESF  317



>gb|KHG14479.1| hypothetical protein F383_09534 [Gossypium arboreum]
Length=317

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TCD+W+SHP LIWGL+G+WGTVG  FGV +VP    GT+++L QALSNTR DG G LYRE
Sbjct  206   TCDFWRSHPTLIWGLLGWWGTVGNAFGVTNVPG--LGTSMSLPQALSNTRTDGLGALYRE  263

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N  RFP++T+ VR++F
Sbjct  264   GTASFLNSMVN-NRFPFSTKQVRETF  288



>gb|AEA50962.1| protodermal factor 1.3 [Gossypium hirsutum]
Length=309

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TCD+W+SHP LIWGL+G+WGTVG  FGV +VP    GT+++L QALSNTR DG G LYRE
Sbjct  198   TCDFWRSHPTLIWGLLGWWGTVGNAFGVTNVPG--LGTSMSLPQALSNTRTDGLGALYRE  255

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N  RFP++T+ VR++F
Sbjct  256   GTASFLNSMVN-NRFPFSTKQVRETF  280



>gb|AEA50960.1| protodermal factor 1.3 [Gossypium barbadense]
Length=325

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TCD+W+SHP LIWGL+G+WGTVG  FGV +VP    GT+++L QALSNTR DG G LYRE
Sbjct  214   TCDFWRSHPTLIWGLLGWWGTVGNAFGVTNVPG--LGTSMSLPQALSNTRTDGLGALYRE  271

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N  RFP++T+ VR++F
Sbjct  272   GTASFLNSMVN-NRFPFSTKQVRETF  296



>ref|XP_006294534.1| hypothetical protein CARUB_v10023570mg, partial [Capsella rubella]
 gb|EOA27432.1| hypothetical protein CARUB_v10023570mg, partial [Capsella rubella]
Length=340

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = +2

Query  764   LEPSTPPFGFDPNS-PPFT--CDYWKSHP----GLIwglvgfwgtvggvfgvASVPAGEF  922
             ++P TP   F P   PP T  CDYW++HP    GL+       G  G V   +S+P   F
Sbjct  205   IDPGTPGTPFLPAPFPPITGTCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTSSSIPG--F  262

Query  923   GTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
               ++NLLQALSN+R D  G LYREGTAS LNSM+NT RFP+TT  VRD F
Sbjct  263   DPHMNLLQALSNSRTDAIGALYREGTASWLNSMVNT-RFPFTTPQVRDHF  311



>ref|XP_010517829.1| PREDICTED: protodermal factor 1-like [Camelina sativa]
Length=341

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 69/110 (63%), Gaps = 10/110 (9%)
 Frame = +2

Query  764   LEPSTPPFGFDPNS-PPFT--CDYWKSHP----GLIwglvgfwgtvggvfgvASVPAGEF  922
             ++P TP   F P   PP T  CDYW++HP    GL+       G  G V   +S+P   F
Sbjct  206   IDPGTPGTPFVPAPFPPITGTCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTSSSIPG--F  263

Query  923   GTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
               ++NLLQALSNTR+D  G LYREGTAS LNS++NT RFP+TT  VRD F
Sbjct  264   DPHMNLLQALSNTRSDSIGALYREGTASWLNSVVNT-RFPFTTPQVRDHF  312



>ref|XP_006411555.1| hypothetical protein EUTSA_v10016927mg [Eutrema salsugineum]
 gb|ESQ53008.1| hypothetical protein EUTSA_v10016927mg [Eutrema salsugineum]
Length=325

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAG--EFGTNLNLLQALSNTRNDGYGELY  988
             TCDYW++HP LIWGL+G+WGTVGG FG  S P+    F  ++NLLQALSNTR D  G LY
Sbjct  210   TCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTPSSIPGFDPHMNLLQALSNTRTDAIGALY  269

Query  989   REGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             REGTAS LNSM+N  RFP+TT  VRD F
Sbjct  270   REGTASWLNSMVN-HRFPFTTPQVRDHF  296



>ref|NP_181812.1| protodermal factor 1 [Arabidopsis thaliana]
 sp|Q9S728.1|PDF1_ARATH RecName: Full=Protodermal factor 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD33868.1|AF141375_1 protodermal factor 1 [Arabidopsis thaliana]
 gb|AAD33869.1|AF141376_1 protodermal factor 1 [Arabidopsis thaliana]
 gb|AAD21725.1| En/Spm-like transposon protein [Arabidopsis thaliana]
 gb|AAM65640.1| En/Spm-like transposon protein [Arabidopsis thaliana]
 gb|ABD59119.1| At2g42840 [Arabidopsis thaliana]
 gb|AEC10176.1| protodermal factor 1 [Arabidopsis thaliana]
Length=306

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 3/88 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAG--EFGTNLNLLQALSNTRNDGYGELY  988
             TCDYW++HP LIWGL+G+WGTVGG FG  S+P+    F  ++NLLQALSNTR+D  G LY
Sbjct  191   TCDYWRNHPTLIWGLLGWWGTVGGAFGTVSIPSSIPGFDPHMNLLQALSNTRSDPIGALY  250

Query  989   REGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             REGTAS LNSM+N K FP+TT  VRD F
Sbjct  251   REGTASWLNSMVNHK-FPFTTPQVRDHF  277



>emb|CDY50826.1| BnaC04g52630D [Brassica napus]
Length=391

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 3/88 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAG--EFGTNLNLLQALSNTRNDGYGELY  988
             TCDYW++HP LIWGL+G+WGTVGG FG  S+P+    F  ++NLLQALSNTR D  G LY
Sbjct  276   TCDYWRNHPTLIWGLLGWWGTVGGAFGAVSIPSSIPGFDPHMNLLQALSNTRTDAIGSLY  335

Query  989   REGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             REGTAS LNSM+N  +FP+TT  VRD F
Sbjct  336   REGTASWLNSMVN-NQFPFTTSQVRDQF  362



>ref|XP_009407017.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=281

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 72/101 (71%), Gaps = 5/101 (5%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEF-GTNLNLLQ  946
             P   P   DPN+PPF+CDYW++HP  IW L+GFW  +  +F    +PA  F G+N +L++
Sbjct  156   PPATPMDPDPNTPPFSCDYWRTHPTAIWALLGFWCPLSQIF---GMPAASFFGSNPSLVE  212

Query  947   ALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDS  1069
             A+S+ R+DG G LYREGTAS LNS+++ + F +TTQ VRD+
Sbjct  213   AMSDARSDGIGALYREGTASFLNSLVD-RDFFFTTQQVRDA  252



>emb|CDX79858.1| BnaA05g02980D [Brassica napus]
Length=410

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 3/88 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAG--EFGTNLNLLQALSNTRNDGYGELY  988
             TCDYW++HP LIWGL+G+WGTVGG FG  S+P+    F  ++NLLQALSNTR D  G LY
Sbjct  295   TCDYWRNHPTLIWGLLGWWGTVGGAFGAVSIPSSIPGFDPHMNLLQALSNTRTDAIGSLY  354

Query  989   REGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             REGTAS LNSM+N  +FP+TT  VRD F
Sbjct  355   REGTASWLNSMVN-NQFPFTTSQVRDQF  381



>ref|XP_009142865.1| PREDICTED: protodermal factor 1 [Brassica rapa]
Length=410

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 3/88 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAG--EFGTNLNLLQALSNTRNDGYGELY  988
             TCDYW++HP LIWGL+G+WGTVGG FG  S+P+    F  ++NLLQALSNTR D  G LY
Sbjct  295   TCDYWRNHPTLIWGLLGWWGTVGGAFGAVSIPSSIPGFDPHMNLLQALSNTRTDAIGSLY  354

Query  989   REGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             REGTAS LNSM+N  +FP+TT  VRD F
Sbjct  355   REGTASWLNSMVN-NQFPFTTSQVRDQF  381



>gb|ABL86674.1| PDF [Gossypium barbadense]
 gb|AEA50958.1| protodermal factor 1.1 [Gossypium barbadense]
Length=294

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 69/86 (80%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TCD+W+SHP LIWGL+G+WGTVG  FGV + P    GT+++L QALSNTR DG G LYRE
Sbjct  183   TCDFWRSHPTLIWGLLGWWGTVGNAFGVTNAPG--LGTSMSLPQALSNTRTDGLGALYRE  240

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N  RFP++T+ VR++F
Sbjct  241   GTASFLNSMVN-NRFPFSTKQVRETF  265



>ref|XP_006646282.1| PREDICTED: extensin-like [Oryza brachyantha]
Length=767

 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = +2

Query  791   FDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRND  970
             FDPN+ PF C YW SHP +IWGL GFW  +  +FG  +  A  FG +L + +AL+N R D
Sbjct  648   FDPNTAPFPCTYWLSHPNVIWGLFGFWCPLVRLFGPTA--AAPFGHDLTVTEALANKRTD  705

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             G GELYREGTASLLNSM+N+K F ++TQ V+D+F
Sbjct  706   GVGELYREGTASLLNSMVNSK-FAFSTQQVKDAF  738



>gb|KFK37128.1| protodermal factor [Arabis alpina]
Length=312

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +2

Query  815   TCDYWKSHP----GLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGE  982
             TCDYW++HP    GL+       G  G V   + +P   F  ++NLLQALSNTR D  G 
Sbjct  197   TCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTSSIIPG--FDPHMNLLQALSNTRTDAIGS  254

Query  983   LYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LYREGTAS LNSM+NT RFP+TT  VRD F
Sbjct  255   LYREGTASWLNSMVNT-RFPFTTPQVRDHF  283



>ref|XP_010924678.1| PREDICTED: protodermal factor 1-like [Elaeis guineensis]
Length=264

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TCDYW++HP  I+GL G+W  +G +FG+ +  A   G+NL+L +AL+NTR+DG+G L RE
Sbjct  154   TCDYWRTHPAAIFGLFGYWCNIGQLFGLPATSA--LGSNLSLPEALANTRSDGFGALLRE  211

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTASLLNSM+N +RFP TTQ VRD+F
Sbjct  212   GTASLLNSMVN-QRFPLTTQQVRDAF  236



>gb|AEA50961.1| protodermal factor 1.1 [Gossypium hirsutum]
Length=294

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TCD+W+ HP LIWGL+G+WGTVG  FGV + P    GT+++L QALSNTR DG G LYRE
Sbjct  183   TCDFWRGHPTLIWGLLGWWGTVGNAFGVTNAPG--LGTSMSLPQALSNTRTDGLGALYRE  240

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N  RFP++T+ VR++F
Sbjct  241   GTASFLNSMVN-NRFPFSTKQVRETF  265



>ref|XP_004513725.1| PREDICTED: protodermal factor 1-like [Cicer arietinum]
Length=284

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvA-SVPAGEFGTNLNLLQALSNTRNDGYGELYR  991
             TC+YW+SHPG+IWG++G+WGT G  FG+  SVP   F   L L QALSNTR DG GELYR
Sbjct  172   TCNYWRSHPGIIWGILGWWGTTGNAFGITNSVPG--FSPGLTLPQALSNTRTDGLGELYR  229

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EGTAS LNS++N K FPYTT  VR+ F
Sbjct  230   EGTASFLNSLVNHK-FPYTTDQVRERF  255



>ref|XP_004491347.1| PREDICTED: extensin-like [Cicer arietinum]
Length=504

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW +HP +IWGL+G+WGT+G  F V S+P   FG++L+L QALSNTR DG G LYRE
Sbjct  393   TCNYWNTHPQIIWGLLGWWGTLGNAFHVPSLPG--FGSSLSLPQALSNTRTDGLGALYRE  450

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             G AS LNS++N  RFPYTTQ VRD F
Sbjct  451   GAASFLNSLVN-NRFPYTTQQVRDRF  475



>ref|XP_003602116.1| hypothetical protein MTR_3g089570 [Medicago truncatula]
 ref|XP_003636551.1| hypothetical protein MTR_045s0046 [Medicago truncatula]
 gb|AES72367.1| pollen Ole e I family allergen [Medicago truncatula]
Length=272

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HPG+IWG++G+WG +G  FGV ++P   F   L L QALSNTR DG G LYRE
Sbjct  161   TCNYWRTHPGIIWGILGWWGNMGNAFGVTNIPG--FSPGLTLPQALSNTRTDGLGALYRE  218

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNS++N K FPYTT  V+D F
Sbjct  219   GTASFLNSLVNNK-FPYTTDQVKDRF  243



>gb|AFK43320.1| unknown [Medicago truncatula]
Length=272

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HPG+IWG++G+WG +G  FGV ++P   F   L L QALSNTR DG G LYRE
Sbjct  161   TCNYWRTHPGIIWGILGWWGNMGNAFGVTNIPG--FSPGLTLPQALSNTRTDGLGALYRE  218

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNS++N K FPYTT  V+D F
Sbjct  219   GTASFLNSLVNNK-FPYTTDQVKDRF  243



>emb|CDY14858.1| BnaC04g48550D [Brassica napus]
Length=287

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = +2

Query  815   TCDYWKSHP----GLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGE  982
             TCDYW++HP    GL+       G  G V   +S+P   F  ++NLLQALSNTR D  G 
Sbjct  172   TCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTSSSIPG--FDPHMNLLQALSNTRTDAIGA  229

Query  983   LYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LYREGTAS LNSM+N K FP TT  VRD F
Sbjct  230   LYREGTASWLNSMVNNK-FPLTTPQVRDHF  258



>ref|XP_009142091.1| PREDICTED: protodermal factor 1-like [Brassica rapa]
Length=278

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = +2

Query  815   TCDYWKSHP----GLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGE  982
             TCDYW++HP    GL+       G  G V   +S+P   F  ++NLLQALSNTR D  G 
Sbjct  163   TCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTSSSIPG--FDPHMNLLQALSNTRTDAIGA  220

Query  983   LYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LYREGTAS LNSM+N K FP TT  VRD F
Sbjct  221   LYREGTASWLNSMVNNK-FPLTTPQVRDHF  249



>emb|CDY47992.1| BnaA04g24700D [Brassica napus]
Length=287

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = +2

Query  815   TCDYWKSHP----GLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGE  982
             TCDYW++HP    GL+       G  G V   +S+P   F  ++NLLQALSNTR D  G 
Sbjct  172   TCDYWRNHPTLIWGLLGWWGTVGGAFGTVSTSSSIPG--FDPHMNLLQALSNTRTDAIGA  229

Query  983   LYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             LYREGTAS LNSM+N K FP TT  VRD F
Sbjct  230   LYREGTASWLNSMVNNK-FPLTTPQVRDHF  258



>ref|XP_006859008.1| hypothetical protein AMTR_s00068p00158450 [Amborella trichopoda]
 gb|ERN20475.1| hypothetical protein AMTR_s00068p00158450 [Amborella trichopoda]
Length=267

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 73/106 (69%), Gaps = 8/106 (8%)
 Frame = +2

Query  773   STP--PFGFDPNSP-PF---TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNL  934
             STP  P+  DPN+  PF   TCD+W++HP  +WG+ G++ TV G FG   +P G FG  L
Sbjct  135   STPGTPYIPDPNTRFPFIGGTCDFWRTHPAAVWGMFGYFVTVAGAFGCIGIPGG-FGQGL  193

Query  935   NLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NL QAL+N R DG+G LYREGTASLLNSM+N K F +T   V+ SF
Sbjct  194   NLHQALNNNRKDGFGSLYREGTASLLNSMVN-KNFAFTPDQVKSSF  238



>ref|XP_003532098.1| PREDICTED: protodermal factor 1-like isoform 1 [Glycine max]
 gb|KHM99623.1| hypothetical protein glysoja_006466 [Glycine soja]
Length=266

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HP +IWG++G+WGT+G  FGV       F   L+L QALSNTR DG G LYRE
Sbjct  153   TCNYWRNHPAIIWGILGWWGTLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  212

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N K FPYTT  VRD F
Sbjct  213   GTASFLNSMVNNK-FPYTTNQVRDRF  237



>ref|XP_006601837.1| PREDICTED: uncharacterized protein LOC100810866 isoform X1 [Glycine 
max]
Length=264

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HP +IWG++G+WGT+G  FGV       F   L+L QALSNTR DG G LYRE
Sbjct  151   TCNYWRNHPAIIWGILGWWGTLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  210

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N K FPYTT  VRD F
Sbjct  211   GTASFLNSMVNNK-FPYTTNQVRDRF  235



>gb|ACU19260.1| unknown [Glycine max]
Length=264

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HP +IWG++G+WGT+G  FGV       F   L+L QALSNTR DG G LYRE
Sbjct  151   TCNYWRNHPAIIWGILGWWGTLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  210

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N K FPYTT  VRD F
Sbjct  211   GTASFLNSMVNNK-FPYTTNQVRDRF  235



>ref|XP_003532099.1| PREDICTED: protodermal factor 1-like isoform 2 [Glycine max]
Length=272

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HP +IWG++G+WGT+G  FGV       F   L+L QALSNTR DG G LYRE
Sbjct  159   TCNYWRNHPAIIWGILGWWGTLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  218

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N K FPYTT  VRD F
Sbjct  219   GTASFLNSMVNNK-FPYTTNQVRDRF  243



>ref|NP_001240242.1| uncharacterized protein LOC100810866 precursor [Glycine max]
 gb|ACU23938.1| unknown [Glycine max]
 gb|KHN18102.1| hypothetical protein glysoja_020875 [Glycine soja]
Length=270

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             TC+YW++HP +IWG++G+WGT+G  FGV       F   L+L QALSNTR DG G LYRE
Sbjct  157   TCNYWRNHPAIIWGILGWWGTLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  216

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTAS LNSM+N K FPYTT  VRD F
Sbjct  217   GTASFLNSMVNNK-FPYTTNQVRDRF  241



>ref|NP_001148678.1| meiosis 5 precursor [Zea mays]
 gb|ACG32503.1| meiosis 5 [Zea mays]
Length=201

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 9/110 (8%)
 Frame = +2

Query  758   FGLEPSTPPFGFDPNSPPF----TCDYWKSHPGLIwglvgfwgtvggvfgvA-SVPAGEF  922
             +G  PSTP  G  P  P      +CDYWKSHP +I  +VG  G +G  FG A S+  G+ 
Sbjct  71    YGTTPSTPAHGV-PEIPKHGFVGSCDYWKSHPDMIIAVVGSLGNIGKTFGAACSLLVGKK  129

Query  923   GTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
               NL+  +ALSNTR DG G L REG+A+ LNS++N K+FP+TTQ V+D  
Sbjct  130   LENLH--EALSNTRTDGVGALLREGSAAFLNSIVN-KKFPFTTQQVKDCI  176



>dbj|BAJ92021.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 8/98 (8%)
 Frame = +2

Query  791   FDPNSPPFTCD---YWKSHPGLIwglvgfwgtvggv-fgvASVPAGEFGTNLNLLQALSN  958
             FDPN+PPF+     YW SHPG+IWGL G+W  +  +    A+VP   FG +L + +AL+N
Sbjct  457   FDPNTPPFSTGPYGYWMSHPGVIWGLFGYWCPLVRLFGPSAAVP---FGHDLTVPEALAN  513

Query  959   TRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             TR DG G LYREGTASLLNSM+N++ FP TT  V+D+F
Sbjct  514   TRADGVGALYREGTASLLNSMVNSE-FPLTTTQVKDAF  550



>ref|XP_009392539.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=205

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query  794   DPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDG  973
             D N  PFTCDYW++HP  I  L GFW T+G + G  +  A   G N ++L+ALSNTR DG
Sbjct  87    DSNPSPFTCDYWRTHPEAILALFGFWCTLGQLLGTPAAYA--LGRNPSVLEALSNTRADG  144

Query  974   YGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              G LYREGTAS LNS++ ++ F +T + VRD+F
Sbjct  145   IGALYREGTASFLNSLV-SRSFVFTARQVRDAF  176



>gb|EMS52214.1| hypothetical protein TRIUR3_33602 [Triticum urartu]
Length=529

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 70/98 (71%), Gaps = 8/98 (8%)
 Frame = +2

Query  791   FDPNSPPFTCD---YWKSHPGLIwglvgfwgtvggv-fgvASVPAGEFGTNLNLLQALSN  958
             FDPN+PPF+     YW SHPG+IWGL G+W  +  +    A+VP   FG +L + +AL+N
Sbjct  407   FDPNTPPFSTGPYGYWMSHPGVIWGLFGYWCPLVRLFGPSAAVP---FGHDLTVPEALAN  463

Query  959   TRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             TR DG G LYREGTASLLNSM+++  FP+TT  V+D+F
Sbjct  464   TRADGVGALYREGTASLLNSMVSSG-FPFTTAQVKDAF  500



>emb|CDM84206.1| unnamed protein product [Triticum aestivum]
Length=586

 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 8/98 (8%)
 Frame = +2

Query  791   FDPNSPPFTCD---YWKSHPGLIwglvgf-wgtvggvfgvASVPAGEFGTNLNLLQALSN  958
             FDPN+PPF+     YW SHPG+IWGL G+    V      A+VP   FG +L + +AL+N
Sbjct  464   FDPNTPPFSTGPYGYWMSHPGVIWGLFGYWCPLVRLFGPSAAVP---FGHDLTVPEALAN  520

Query  959   TRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             TR DG G LYREGTASLLNSM+++  FP+TT  V+D+F
Sbjct  521   TRADGVGALYREGTASLLNSMVSSG-FPFTTAQVKDAF  557



>gb|AFW71223.1| meiosis 5 [Zea mays]
Length=201

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = +2

Query  758   FGLEPSTPPFGFDPNSPPF----TCDYWKSHPGLIwglvgfwgtvggvfgvA-SVPAGEF  922
             +G  PSTP  G  P  P      +CDYWKSHP +I  +VG  G +G  FG A S+  G+ 
Sbjct  71    YGTTPSTPAHGV-PEIPKHGFVGSCDYWKSHPDMIIAVVGSLGNIGKTFGAACSLLVGKK  129

Query  923   GTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
               NL+   ALSNTR DG G L REG+A+ LNS++N K+FP+TTQ V+D  
Sbjct  130   LENLH--DALSNTRTDGVGALLREGSAAFLNSIVN-KKFPFTTQQVKDCI  176



>ref|XP_008792281.1| PREDICTED: protodermal factor 1-like [Phoenix dactylifera]
Length=258

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 60/93 (65%), Gaps = 21/93 (23%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEF---------GTNLNLLQALSNTRN  967
             TCD+W++HP  IWGL G+W           VP G+F         G NL+L +AL+NTR 
Sbjct  148   TCDFWRTHPAAIWGLFGYW-----------VPVGQFFGLPSTSMFGRNLSLPEALANTRK  196

Query  968   DGYGELYREGTASLLNSMLNTKRFPYTTQHVRD  1066
             DG+G L REGTASLLNSM+N +RFP TTQ V D
Sbjct  197   DGFGALLREGTASLLNSMVN-RRFPLTTQQVTD  228



>ref|XP_008791849.1| PREDICTED: protodermal factor 1 [Phoenix dactylifera]
Length=485

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 6/96 (6%)
 Frame = +2

Query  794   DPNSPP---FTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTR  964
             DPNS P    TC+YW++HP  I  ++G+ G +  +FG A   A  FG +L+L +AL+NTR
Sbjct  366   DPNSHPSFTGTCNYWRTHPEAILTVLGYLGNISQLFGAACGLA--FGRDLSLPEALANTR  423

Query  965   NDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              DG G LYREGTASLLNS+ + +RFP+TTQ V D+F
Sbjct  424   ADGIGALYREGTASLLNSLAD-RRFPFTTQQVTDAF  458



>ref|NP_001151862.1| DNA-directed RNA polymerase II largest subunit precursor [Zea 
mays]
 gb|ACG44652.1| DNA-directed RNA polymerase II largest subunit [Zea mays]
Length=566

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 5/86 (6%)
 Frame = +2

Query  818   CDYWKSHPGLIwglvgfwgtvggv-fgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             C YW  HPG+IWGL GFW  +  +    A+VP   FG +L + +AL+NTR DG G LYRE
Sbjct  454   CTYWMMHPGVIWGLFGFWCPLVRLFGPSAAVP---FGHDLTVPEALANTREDGVGALYRE  510

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTASLLNSM+N  RFP+TTQ V+D+F
Sbjct  511   GTASLLNSMVN-NRFPFTTQEVKDAF  535



>ref|XP_009381201.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=257

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 65/96 (68%), Gaps = 6/96 (6%)
 Frame = +2

Query  794   DPNSPPF---TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTR  964
             DP+ PPF   TC +W SHP  I  ++G  GT+G +FG     A  FG+N +L  AL+NTR
Sbjct  138   DPHIPPFFTGTCRFWGSHPDAIAAIIGSLGTIGDLFGHGC--AAIFGSNPSLTDALTNTR  195

Query  965   NDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              DGYG L REGTA+ LNSM N+ R+P+TT+ V+ +F
Sbjct  196   TDGYGALIREGTAAFLNSMANS-RYPFTTRQVKTAF  230



>ref|XP_008673135.1| PREDICTED: uncharacterized protein LOC100382457 isoform X1 [Zea 
mays]
Length=564

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 5/86 (6%)
 Frame = +2

Query  818   CDYWKSHPGLIwglvgfwgtvggv-fgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             C YW  HPG+IWGL GFW  +  +    A+VP   FG +L + +AL+NTR DG G LYRE
Sbjct  452   CTYWMMHPGVIWGLFGFWCPLVRLFGPSAAVP---FGHDLTVPEALANTREDGMGALYRE  508

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTASLLNSM+N  RFP+TTQ V+D+F
Sbjct  509   GTASLLNSMVN-NRFPFTTQEVKDAF  533



>ref|XP_010915432.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Elaeis 
guineensis]
Length=517

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +2

Query  794   DPNSPPF---TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTR  964
             +PNS P+   TC+YW++HP  I  ++G+ G +  +FG A   A  FG +L+L +AL+NTR
Sbjct  398   NPNSHPYFTGTCNYWRTHPEAIMAILGYLGNISQLFGPAYGLA--FGRDLSLPEALANTR  455

Query  965   NDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NDG G LYREGTASLLNS +++ RFP+TTQ V+++F
Sbjct  456   NDGIGALYREGTASLLNSFVDS-RFPFTTQQVKNAF  490



>ref|XP_002451823.1| hypothetical protein SORBIDRAFT_04g008270 [Sorghum bicolor]
 gb|EES04799.1| hypothetical protein SORBIDRAFT_04g008270 [Sorghum bicolor]
Length=213

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPF----TCDYWKSHPGLIwglvgfwgtvggvfgvA-SVPAGEFGTNL  934
             PSTP +G  P  P      +CDYWKSHP +I  + G  G +G  FG A S+  G+   NL
Sbjct  87    PSTPAYGV-PEIPKHGFVGSCDYWKSHPDMIIAVAGSLGNIGKTFGAACSLIVGKKLENL  145

Query  935   NLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             +   ALSNTR DG G L REG A+ LNS++N K+FP+TTQ V+D  
Sbjct  146   H--DALSNTRTDGVGSLLREGAAAYLNSIVN-KKFPFTTQQVKDCI  188



>ref|XP_004951386.1| PREDICTED: protodermal factor 1-like [Setaria italica]
Length=202

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 63/102 (62%), Gaps = 9/102 (9%)
 Frame = +2

Query  770   PSTPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvA-SVPAGEFGTNLNLLQ  946
             P  P  GF  +     CDYWKSHP +I  +VG  G +G  FG A S+  G+   NL+   
Sbjct  84    PEIPKHGFTGS-----CDYWKSHPDMIVAVVGSLGNIGKTFGTACSLIVGKKLENLH--D  136

Query  947   ALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             ALSNTR DG G L REG A+ LNS++N K+FP+TTQ V+D  
Sbjct  137   ALSNTRTDGVGALIREGAAAYLNSIVN-KKFPFTTQQVKDCI  177



>gb|ADE77644.1| unknown [Picea sitchensis]
Length=349

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = +2

Query  773   STPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQAL  952
             S+PP   DP S   TCD+W +HP  +  ++ F+ ++  +FG  S P   FG ++ L +AL
Sbjct  226   SSPPVVGDPGSSTGTCDFWGTHPDSLPSILSFFSSISDLFGSGSSPI--FGGDMTLQEAL  283

Query  953   SNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             +NTR DGYG L REG+ASLLNS +N ++F ++ Q V+  F
Sbjct  284   TNTRRDGYGSLLREGSASLLNSFVN-EKFVFSPQEVKQKF  322



>ref|XP_002456277.1| hypothetical protein SORBIDRAFT_03g033390 [Sorghum bicolor]
 gb|EES01397.1| hypothetical protein SORBIDRAFT_03g033390 [Sorghum bicolor]
Length=525

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 5/86 (6%)
 Frame = +2

Query  818   CDYWKSHPGLIwglvgfwgtvggvfg-vASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             C YW  HPG++WGL GFW  +  +FG  A+VP   FG +L + +AL+NTR DG G L+RE
Sbjct  414   CTYWIMHPGVVWGLFGFWCPLVRLFGPSAAVP---FGHDLTVPEALANTRQDGVGALFRE  470

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTASLLNSM+N+  FP+TTQ V+D+F
Sbjct  471   GTASLLNSMVNSG-FPFTTQEVKDAF  495



>gb|EMT14417.1| hypothetical protein F775_04470 [Aegilops tauschii]
Length=277

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +2

Query  809   PFTCDYWKSHPGLIwglvgfwgtvggv-fgvASVPAGEFGTNLNLLQALSNTRNDGYGEL  985
             P+   YW SHPG+IWGL G+W  +  +    A+VP   FG +L + +AL+NTR DG G L
Sbjct  164   PYYACYWMSHPGVIWGLFGYWCPLVRLFGPSAAVP---FGYDLTVPEALANTRADGVGAL  220

Query  986   YREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             YREGTASLLNSM+++  FP+TT  V+D+F
Sbjct  221   YREGTASLLNSMVSSG-FPFTTAQVKDAF  248



>ref|NP_001150889.1| LOC100284522 precursor [Zea mays]
 gb|ACG40802.1| meiosis 5 [Zea mays]
Length=183

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   VG  G+V G  G A   +  FG  L  LQ AL N R DGYG+L R
Sbjct  72    TCDYWKSHPDAIVSCVGSLGSVLGSLGDAC--SAFFGGKLQTLQDALCNARADGYGDLLR  129

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS+    ++ YTTQ V+D  
Sbjct  130   EGAAAYLNSVAAAGKYAYTTQQVKDCI  156



>ref|XP_004969811.1| PREDICTED: sialidase-like [Setaria italica]
Length=617

 Score = 73.2 bits (178),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 5/86 (6%)
 Frame = +2

Query  818   CDYWKSHPGLIwglvgfwgtvggv-fgvASVPAGEFGTNLNLLQALSNTRNDGYGELYRE  994
             C YW +HPG++WGL GFW  +  +    A+VP   FG +L + +AL+NTR DG G L+RE
Sbjct  508   CTYWMTHPGVVWGLFGFWCPLVRLFGPSAAVP---FGHDLTVPEALANTRQDGVGALFRE  564

Query  995   GTASLLNSMLNTKRFPYTTQHVRDSF  1072
             GTASLLNSM++  RF +TTQ V+D+F
Sbjct  565   GTASLLNSMVD-NRFAFTTQEVKDAF  589



>ref|XP_004965593.1| PREDICTED: keratin-3, type I cytoskeletal 51 kDa-like [Setaria 
italica]
Length=197

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  87    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  144

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  K++ Y+TQ V+D  
Sbjct  145   EGAAAYLNS-IAAKKYAYSTQQVKDCI  170



>ref|XP_009409605.1| PREDICTED: protodermal factor 1-like, partial [Musa acuminata 
subsp. malaccensis]
Length=109

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +2

Query  824   YWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYREGTA  1003
             YW SHP  I  ++G  GTVG +FG     A  FG+N  L  AL+NTR DGYG L+REGTA
Sbjct  5     YWGSHPDAIVAVIGSLGTVGDLFGYGC--AAIFGSNPTLHDALTNTRTDGYGALFREGTA  62

Query  1004  SLLNSMLNTKRFPYTTQHVRDSF  1072
             +LLNSM ++K +P+TT+ V+ SF
Sbjct  63    ALLNSMTDSK-YPFTTKQVKFSF  84



>ref|XP_010667972.1| PREDICTED: protodermal factor 1 [Beta vulgaris subsp. vulgaris]
Length=339

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +2

Query  818   CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYREG  997
             C YW SHPGLI+G++G+W TVGG+FGV ++P     T+L   + L+N RNDGYG LYREG
Sbjct  224   CTYWGSHPGLIFGVLGWWATVGGIFGVTTLPGLNSATSLE--EMLNNPRNDGYGSLYREG  281

Query  998   TASLLNSMLNTKRFPYTTQHVRDSF  1072
             TAS LNSM  TK F  +T+ V+D+F
Sbjct  282   TASFLNSMA-TKEFSLSTKQVKDAF  305



>ref|XP_002438553.1| hypothetical protein SORBIDRAFT_10g021810 [Sorghum bicolor]
 gb|EER89920.1| hypothetical protein SORBIDRAFT_10g021810 [Sorghum bicolor]
Length=199

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 4/92 (4%)
 Frame = +2

Query  803   SPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYG  979
             S   TCDYWKSHP  I   +G  G++ G      V +  FG+ +  LQ AL NTR+D YG
Sbjct  84    SGTGTCDYWKSHPDAIISCIGSLGSILGSL--GDVCSAFFGSKVQTLQDALCNTRSDCYG  141

Query  980   ELYREGTASLLNSMLNTK-RFPYTTQHVRDSF  1072
             +L REG A+ LNS+   K +F Y+TQ V+D  
Sbjct  142   DLLREGAAAYLNSVAAKKQQFAYSTQQVKDCI  173



>gb|AFW86949.1| meiosis 5 [Zea mays]
Length=174

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  65    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  122

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  +++ Y+TQ V+D  
Sbjct  123   EGAAAYLNS-IAAEKYAYSTQQVQDCI  148



>ref|NP_001148016.1| meiosis 5 precursor [Zea mays]
 gb|ACG29415.1| meiosis 5 [Zea mays]
Length=169

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  60    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  117

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  +++ Y+TQ V+D  
Sbjct  118   EGAAAYLNS-IAAEKYAYSTQQVQDCI  143



>gb|AFW86950.1| hypothetical protein ZEAMMB73_132004 [Zea mays]
Length=178

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +2

Query  803   SPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYG  979
             S   TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG
Sbjct  65    SGTGTCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYG  122

Query  980   ELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             +L REG A+ LNS +  +++ Y+TQ V+D  
Sbjct  123   DLLREGAAAYLNS-IAAEKYAYSTQQVQDCI  152



>gb|ACG27615.1| meiosis 5 [Zea mays]
Length=168

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  58    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  115

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  +++ Y+TQ V+D  
Sbjct  116   EGAAAYLNS-IAAEKYAYSTQQVQDCI  141



>ref|XP_003571819.1| PREDICTED: protodermal factor 1-like [Brachypodium distachyon]
Length=220

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHP-GLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYR  991
             +CDYWK HP  ++  +              S+  G+   NL+   ALSNTR DG G L R
Sbjct  112   SCDYWKKHPDAIVAAIGSVGNIGKTFGVACSLIVGKKIENLH--DALSNTRTDGIGALIR  169

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS++N K FP+TTQ V+D  
Sbjct  170   EGAAAYLNSIVNHK-FPFTTQQVKDCI  195



>gb|AFW86951.1| meiosis 5 [Zea mays]
Length=182

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +2

Query  803   SPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYG  979
             S   TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG
Sbjct  69    SGTGTCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYG  126

Query  980   ELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             +L REG A+ LNS +  +++ Y+TQ V+D  
Sbjct  127   DLLREGAAAYLNS-IAAEKYAYSTQQVQDCI  156



>ref|NP_001168480.1| uncharacterized protein LOC100382257 precursor [Zea mays]
 gb|ACN28368.1| unknown [Zea mays]
Length=176

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  67    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  124

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  +++ Y+TQ V+D  
Sbjct  125   EGAAAYLNS-IAAEKYAYSTQQVQDCI  150



>gb|ACG28466.1| meiosis 5 [Zea mays]
Length=174

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  64    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  121

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  +++ Y+TQ V+D  
Sbjct  122   EGAAAYLNS-IAAEKYAYSTQQVQDCI  147



>gb|AAT71304.1| proline- and threonine-rich protein [Oryza sativa]
Length=219

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 66/120 (55%), Gaps = 19/120 (16%)
 Frame = +2

Query  758   FGLEPSTPPFGFDPNSPPF--------------TCDYWKSHPGLIwglvgfwgtvggvfg  895
             +G  P TP +G  P+SP                +CDYWK+HP +I   +G  G +G    
Sbjct  79    YGTTP-TPSYGTTPSSPSTPDVPEVPTKHDFCGSCDYWKNHPDVIISAIGSLGDIGMTLD  137

Query  896   vA-SVPAGEFGTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
              A S+  G+   NL+   ALSNT  DG G L REG A+ LNS++N K+FP+TTQ V+D  
Sbjct  138   TACSLITGKKLENLH--DALSNTGTDGTGALLREGAAAYLNSIVN-KKFPFTTQQVKDCI  194



>gb|AFW76536.1| hypothetical protein ZEAMMB73_750604 [Zea mays]
Length=144

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 53/93 (57%), Gaps = 5/93 (5%)
 Frame = +2

Query  803   SPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYG  979
             S   TCDYWKSHP  I   VG  G+V G  G A   +  FG  L  LQ AL N R DGYG
Sbjct  27    SGTGTCDYWKSHPDAIVSCVGSLGSVLGSLGDAC--SAFFGGKLQTLQDALCNARADGYG  84

Query  980   ELYREGTASLLNSMLNTK--RFPYTTQHVRDSF  1072
             +L REG A+ LNS+      ++ YTTQ V+D  
Sbjct  85    DLLREGAAAYLNSVAAAAAGKYAYTTQQVKDCI  117



>ref|NP_001172867.1| Os02g0230300 [Oryza sativa Japonica Group]
 dbj|BAD26174.1| putative protodermal factor [Oryza sativa Japonica Group]
 gb|EAZ22325.1| hypothetical protein OsJ_05979 [Oryza sativa Japonica Group]
 dbj|BAH91596.1| Os02g0230300 [Oryza sativa Japonica Group]
Length=219

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 64/111 (58%), Gaps = 9/111 (8%)
 Frame = +2

Query  758   FGLEPSTPPFGFDPNSPP-----FTCDYWKSHPGLIwglvgfwgtvggvfgvA-SVPAGE  919
             +G  PSTP     P  P       +CDYWK+HP +I   +G  G +G   G A S+  G+
Sbjct  87    YGTTPSTPSTPDVPEVPTKHDFCGSCDYWKNHPDVIISAIGSLGDIGKTLGTACSLITGK  146

Query  920   FGTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
                NL+   ALSNT  DG G L REG A+ LNS++N K+FP+TTQ V+D  
Sbjct  147   KLENLH--DALSNTGTDGTGALLREGAAAYLNSIVN-KKFPFTTQQVKDCI  194



>ref|NP_001183948.1| uncharacterized protein LOC100502555 precursor [Zea mays]
 ref|XP_008658578.1| PREDICTED: meiosis 5 isoform X1 [Zea mays]
 gb|ACF85547.1| unknown [Zea mays]
 gb|AFW86952.1| meiosis 5 [Zea mays]
Length=196

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  87    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  144

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  +++ Y+TQ V+D  
Sbjct  145   EGAAAYLNS-IAAEKYAYSTQQVQDCI  170



>emb|CDM81708.1| unnamed protein product [Triticum aestivum]
Length=230

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNL-NLLQALSNTRNDGYGELYR  991
             +CDYWK+HP  I   +G  G +G  FG A    G  G  L N+  ALSNTR DG G L R
Sbjct  122   SCDYWKNHPDAIVAAIGSLGNIGKTFGAACSMIG--GKKLGNMHDALSNTRTDGIGALIR  179

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS++N K+FP+TTQ V++  
Sbjct  180   EGAAAYLNSIVN-KKFPFTTQQVKNCI  205



>ref|NP_001148184.1| meiosis 5 precursor [Zea mays]
 gb|ACG30086.1| meiosis 5 [Zea mays]
 gb|ACG43595.1| meiosis 5 [Zea mays]
Length=194

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  84    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  141

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  +++ Y+TQ V+D  
Sbjct  142   EGAAAYLNS-IAAEKYAYSTQQVQDCI  167



>ref|XP_006576119.1| PREDICTED: protodermal factor 1-like [Glycine max]
 gb|KHN38376.1| hypothetical protein glysoja_004041 [Glycine soja]
Length=154

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +2

Query  809   PFTCD--YWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGE  982
             PFT    YW S+PG I  ++G+ GT+G  FGV S    +  +N++L+ ALSNT +DG G 
Sbjct  40    PFTGTSYYWSSNPGRIKEVLGWVGTIGSAFGVGS-SNNKIPSNVSLVHALSNTTSDGLGA  98

Query  983   LYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             L REGTAS LNS++N K FPYTT  VRD+F
Sbjct  99    LCREGTASFLNSLVNNK-FPYTTPQVRDTF  127



>gb|KHN38375.1| hypothetical protein glysoja_004040 [Glycine soja]
Length=149

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +2

Query  809   PFTCD--YWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGE  982
             PFT    YW S+PG I  ++G+ GT+G  FGV S    +  +N++L+ ALSNT +DG G 
Sbjct  40    PFTGTSYYWSSNPGRIKEVLGWVGTIGSAFGVGS-SNNKIPSNVSLVHALSNTTSDGLGA  98

Query  983   LYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             L REGTAS LNS++N K FPYTT  VRD+F
Sbjct  99    LCREGTASFLNSLVNNK-FPYTTPQVRDTF  127



>ref|XP_006647097.1| PREDICTED: protodermal factor 1-like [Oryza brachyantha]
Length=208

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNL-NLLQALSNTRNDGYGELYR  991
             +CDYWKSHP +I   +G  G +G   G A       G  L NL  ALSNTR+DG G L R
Sbjct  98    SCDYWKSHPDVIIAAIGSLGDIGKTLGDACNLI--VGKKLENLHDALSNTRSDGTGALLR  155

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS++N K FP++TQ V+D  
Sbjct  156   EGAAAYLNSIVNNK-FPFSTQQVKDCI  181



>gb|AFW86948.1| hypothetical protein ZEAMMB73_132004, partial [Zea mays]
Length=186

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             TCDYWKSHP  I   +G  G++ G F    V +  FG+ L  LQ AL NTR D YG+L R
Sbjct  77    TCDYWKSHPDAIISCIGSLGSILGSF--GDVCSAFFGSKLQTLQDALCNTRTDCYGDLLR  134

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS +  +++ Y+TQ V+D  
Sbjct  135   EGAAAYLNS-IAAEKYAYSTQQVQDCI  160



>gb|AEJ07953.1| meiosis 5-like protein [Sorghum propinquum]
Length=354

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 57/98 (58%), Gaps = 6/98 (6%)
 Frame = +2

Query  782   PFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASV--PAGEFG-TNLNLLQAL  952
             P  FD  S P +CDYW+SHP  IW  +G          +      AG  G +++++  AL
Sbjct  231   PHSFD--SLPGSCDYWRSHPMEIWSAIGGRFPSTSPSSMGHFFGAAGSIGGSDVSIQDAL  288

Query  953   SNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRD  1066
             +NTR+DG G L REG A+LLNSM     FPYTT+ VRD
Sbjct  289   ANTRSDGTGALLREGAAALLNSMTRAG-FPYTTEQVRD  325



>gb|EAY85105.1| hypothetical protein OsI_06457 [Oryza sativa Indica Group]
Length=219

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 9/111 (8%)
 Frame = +2

Query  758   FGLEPSTPPFGFDPNSPPF-----TCDYWKSHPGLIwglvgfwgtvggvfgvA-SVPAGE  919
             +G  PSTP     P  P       +CDYWK+HP +I   +G  G +G   G A S+  G+
Sbjct  87    YGTTPSTPSTPDVPEVPTKHDFCGSCDYWKNHPDVIISAIGSLGDIGKTLGTACSLITGK  146

Query  920   FGTNLNLLQALSNTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
                NL+   ALSNT  DG G L REG A+ LNS++N K+FP++TQ V+D  
Sbjct  147   KLENLH--DALSNTGTDGTGALLREGAAAYLNSIVN-KKFPFSTQQVKDCI  194



>dbj|BAJ91952.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNL-NLLQALSNTRNDGYGELYR  991
             +CD+WK+HP  I   +G  G +G  FG A    G  G  L N+  ALSNTR DG G L R
Sbjct  114   SCDFWKNHPDAIIAAIGSLGNIGKTFGAACSMIG--GKKLGNMHDALSNTRTDGIGALIR  171

Query  992   EGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             EG A+ LNS++N K FP+TTQ V+D  
Sbjct  172   EGAAAYLNSIVNNK-FPFTTQQVKDCI  197



>ref|NP_001057844.1| Os06g0553200 [Oryza sativa Japonica Group]
 dbj|BAD53672.1| protodermal factor-like [Oryza sativa Japonica Group]
 dbj|BAF19758.1| Os06g0553200 [Oryza sativa Japonica Group]
 gb|EAZ37324.1| hypothetical protein OsJ_21665 [Oryza sativa Japonica Group]
 gb|ACA50498.1| protodermal factor-like protein [Oryza sativa Japonica Group]
 dbj|BAG87602.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96757.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96852.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00603.1| unnamed protein product [Oryza sativa Japonica Group]
Length=186

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             +CD+WKSHP  I   +G  G++ G F    V +G FG+ L  LQ AL +TR D YG+L R
Sbjct  73    SCDFWKSHPEKIISCIGSLGSIVGSF--GDVCSGFFGSKLQTLQDALCSTRKDCYGDLLR  130

Query  992   EGTASLLNSMLNTK--RFPYTTQHVRDSF  1072
             EG A+ +NS+   K  +F YTTQ V+   
Sbjct  131   EGAAAYINSVAAKKQAKFAYTTQQVKSCI  159



>gb|EAZ01309.1| hypothetical protein OsI_23340 [Oryza sativa Indica Group]
Length=189

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             +CD+WKSHP  I   +G  G++ G F    V +G FG+ L  LQ AL +TR D YG+L R
Sbjct  76    SCDFWKSHPEKIISCIGSLGSIVGSF--GDVCSGFFGSKLQTLQDALCSTRKDCYGDLLR  133

Query  992   EGTASLLNSMLNTK--RFPYTTQHVRDSF  1072
             EG A+ +NS+   K  +F YTTQ V+   
Sbjct  134   EGAAAYINSVAAKKQAKFAYTTQQVKSCI  162



>ref|XP_002436628.1| hypothetical protein SORBIDRAFT_10g006190 [Sorghum bicolor]
 gb|EER87995.1| hypothetical protein SORBIDRAFT_10g006190 [Sorghum bicolor]
Length=344

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 4/89 (4%)
 Frame = +2

Query  809   PFTCDYWKSHPGLIwglvgfwgtvggvfgvA---SVPAGEFGTNLNLLQALSNTRNDGYG  979
             P +CDYW+SHP  IW  +G          +           G+++++  AL+NTR+DG G
Sbjct  228   PGSCDYWRSHPMEIWSAIGGRFPSTSPSSMGHFFGAAGSNGGSDVSIQDALANTRSDGTG  287

Query  980   ELYREGTASLLNSMLNTKRFPYTTQHVRD  1066
              L REG A+LLNSM     FPYTT+ VRD
Sbjct  288   ALLREGAAALLNSMTRAG-FPYTTEQVRD  315



>gb|AAV58857.1| meiosis 5 [Triticum aestivum]
Length=325

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
             TP    DPNS   TCDYW++HP  IW  +G W +    F  A+  A   G ++++  AL+
Sbjct  201   TPLIPVDPNSL-GTCDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGPSMSIQDALA  259

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVRDSF  1072
             NTR DG G L REGTA+LLNSM     F YTTQ VRD+F
Sbjct  260   NTRTDGAGALLREGTAALLNSMTR-PGFAYTTQQVRDAF  297



>ref|XP_006656154.1| PREDICTED: protodermal factor 1-like [Oryza brachyantha]
Length=181

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYR  991
             +CD+WKS+P  I   +G  G++ G F    V +  FG  L  LQ AL NTR D YG+L R
Sbjct  70    SCDFWKSNPDKIISCIGSLGSIVGSF--GDVCSSFFGGKLQTLQDALCNTRKDCYGDLLR  127

Query  992   EGTASLLNSMLNTK-RFPYTTQHVRDSF  1072
             EG A+ +NSM   K +F YTT  V+D  
Sbjct  128   EGAAAYINSMAAKKAKFAYTTHQVKDCI  155



>dbj|BAJ89562.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=197

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
             TP    DPNS   TCDYW++HP  IW  +G W +    F  A+  A   G ++++  AL+
Sbjct  73    TPLIPVDPNSL-GTCDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGPSVSIQDALA  131

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVR  1063
             NTR DG G L REGTA+LLNSM     F YTTQ VR
Sbjct  132   NTRTDGAGALLREGTAALLNSMTR-PGFAYTTQQVR  166



>gb|EMT07136.1| hypothetical protein F775_31687 [Aegilops tauschii]
Length=201

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  821   DYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNL-NLLQALSNTRNDGYGELYREG  997
             +YWK+HP  I   +G  G +G  FG A    G  G  L N+  ALSNTR DG G L REG
Sbjct  95    NYWKNHPDAIVAAIGSLGNIGKTFGAACSMIG--GKKLGNMHDALSNTRTDGIGALIREG  152

Query  998   TASLLNSMLNTKRFPYTTQHVRDSF  1072
              A+ LNS++N K+FP+TTQ V+D  
Sbjct  153   AAAYLNSIVN-KKFPFTTQQVKDCI  176



>ref|XP_003563769.1| PREDICTED: protodermal factor 1-like [Brachypodium distachyon]
Length=192

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +2

Query  818   CDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQ-ALSNTRNDGYGELYRE  994
             CDYWKSHP  I   VG  G++ G F    V +  +GT +  L+ AL +TR D YG+L RE
Sbjct  82    CDYWKSHPDKIISCVGSLGSIVGSF--GDVCSSFYGTKIQTLKDALCSTRTDCYGDLLRE  139

Query  995   GTASLLNSMLNTK-RFPYTTQHVRDSF  1072
             G A+ +NS+   K  F YTT  V+D  
Sbjct  140   GAAAYINSIAAKKAHFAYTTHQVKDCI  166



>ref|XP_010053227.1| PREDICTED: protodermal factor 1 [Eucalyptus grandis]
 gb|KCW89701.1| hypothetical protein EUGRSUZ_A01963 [Eucalyptus grandis]
Length=311

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 2/84 (2%)
 Frame = +2

Query  821   DYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELYREGT  1000
             +Y+ S+PG+I GLVGF   +G  F   + P   F    NL+QAL NT  DG G LYREGT
Sbjct  200   NYYLSNPGVIIGLVGFVMPMGPAFR-VTTPVPGFPAAQNLIQALGNTSADGLGALYREGT  258

Query  1001  ASLLNSMLNTKRFPYTTQHVRDSF  1072
             A+LLNS + + RFP+TT  VR SF
Sbjct  259   AALLNS-IASNRFPFTTAQVRQSF  281



>dbj|BAJ86629.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
             TP    DPNS   TCDYW++HP  IW  +G W +    F  A+  A   G ++++  AL+
Sbjct  224   TPLIPVDPNSL-GTCDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGPSVSIQDALA  282

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVR  1063
             NTR DG G L REGTA+LLNSM     F YTTQ VR
Sbjct  283   NTRTDGAGALLREGTAALLNSMTR-PGFAYTTQQVR  317



>emb|CDM82145.1| unnamed protein product [Triticum aestivum]
Length=324

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +2

Query  791   FDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRND  970
              DPNS   TCDYW++HP  IW  +G W +    F  A+  A   G ++++  AL+NTR D
Sbjct  205   VDPNSL-GTCDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGPSMSIQDALANTRTD  263

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVR  1063
             G G L REGTA+LLNSM     F YTTQ VR
Sbjct  264   GAGALLREGTAALLNSMTR-PGFAYTTQQVR  293



>gb|EMT03246.1| hypothetical protein F775_31546 [Aegilops tauschii]
Length=322

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  776   TPPFGFDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALS  955
             TP    DPNS   TCDYW++HP  IW  +G W +    F  A+  A   G ++++  AL+
Sbjct  199   TPLIPVDPNSL-GTCDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGPSMSIQDALA  257

Query  956   NTRNDGYGELYREGTASLLNSMLNTKRFPYTTQHVR  1063
             NTR DG G L REGTA+LLNSM     F YTTQ VR
Sbjct  258   NTRTDGAGALLREGTAALLNSMTR-PGFAYTTQQVR  292



>ref|NP_001042324.2| Os01g0201600 [Oryza sativa Japonica Group]
 dbj|BAD73169.1| VsaA -like [Oryza sativa Japonica Group]
 dbj|BAD73213.1| VsaA -like [Oryza sativa Japonica Group]
 gb|EAZ10929.1| hypothetical protein OsJ_00770 [Oryza sativa Japonica Group]
 dbj|BAG93523.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04238.2| Os01g0201600 [Oryza sativa Japonica Group]
Length=301

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = +2

Query  809   PFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRNDGYGELY  988
             P TCDYW+SHP  +            V       +G  GT +++  AL+NTR DG GEL 
Sbjct  189   PGTCDYWRSHP--MEMWSALGRWPSSVGHFFGSGSGGAGTGMSIQDALANTRGDGAGELM  246

Query  989   REGTASLLNSMLNTKRFPYTTQHVR  1063
             REG A+LLNSM  +  FPYT + VR
Sbjct  247   REGAAALLNSMTRSG-FPYTAEQVR  270



>ref|XP_004968555.1| PREDICTED: keratin, type I cytoskeletal 9-like [Setaria italica]
Length=369

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 49/91 (54%), Gaps = 7/91 (8%)
 Frame = +2

Query  809   PFTCDYWKSHPGLIwglvgfwgtvggvf------gvASVPAGEFGTNLNLLQALSNTRND  970
             P +CDYW+SHP  IW  +G               G+          +L++  AL+NTR+D
Sbjct  250   PGSCDYWRSHPMEIWSALGGRFPSSMGHFFGGAGGLGGAGGLGGAADLSIQDALANTRSD  309

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVR  1063
             G G L REG A+LLNSM     FPYTT+ VR
Sbjct  310   GAGALLREGAAALLNSMTRAG-FPYTTEQVR  339



>gb|AFV13467.1| meiosis 5-like protein, partial [Coix lacryma-jobi]
Length=359

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = +2

Query  809   PFTCDYWKSHPGLIwglvgfwgtvggvfgvASV----PAGEFGTN--LNLLQALSNTRND  970
             P +C+YW+SHP  IW  +G           +       AG  G    +++  AL++TR+D
Sbjct  248   PGSCNYWRSHPMEIWSAIGGRFPSTSSSSSSMGHFFGAAGSVGGPDVMSIQDALASTRSD  307

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVRD  1066
             G G L REG A+LLNSM     FPYTT  VRD
Sbjct  308   GTGALLREGAAALLNSMTRAG-FPYTTDQVRD  338



>ref|XP_002457165.1| hypothetical protein SORBIDRAFT_03g002540 [Sorghum bicolor]
 gb|EES02285.1| hypothetical protein SORBIDRAFT_03g002540 [Sorghum bicolor]
Length=332

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 45/91 (49%), Gaps = 8/91 (9%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgvASV-------PAGEFGTNLNLLQALSNTRNDG  973
             TCDYW+SHP  IW  +G                      +      +++  AL NTR DG
Sbjct  214   TCDYWRSHPMEIWSAIGGRFPSTSSSMGTMSHFFGAAAGSVGGANMMSIQDALGNTRADG  273

Query  974   YGELYREGTASLLNSMLNTKRFPYTTQHVRD  1066
              G L REG A+LLNSM     FPYTT+ VRD
Sbjct  274   TGALLREGAAALLNSMTRAG-FPYTTEQVRD  303



>ref|XP_003565471.1| PREDICTED: protodermal factor 1-like [Brachypodium distachyon]
Length=318

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 46/91 (51%), Gaps = 4/91 (4%)
 Frame = +2

Query  791   FDPNSPPFTCDYWKSHPGLIwglvgfwgtvggvfgvASVPAGEFGTNLNLLQALSNTRND  970
              DPNSP  TC+YW+SHP  IW  +G                    + +++  AL NT ND
Sbjct  200   VDPNSP-GTCEYWRSHPMQIWSALGGSWPSSVGHFFGGGSGLG--SGVSIQDALGNTGND  256

Query  971   GYGELYREGTASLLNSMLNTKRFPYTTQHVR  1063
                 L RE TA+LLNSM     FPYTT  VR
Sbjct  257   SSSALLREATAALLNSMTRAG-FPYTTSQVR  286



>ref|NP_001150305.1| meiosis 5 precursor [Zea mays]
 gb|ACG38591.1| meiosis 5 [Zea mays]
Length=325

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 45/87 (52%), Gaps = 5/87 (6%)
 Frame = +2

Query  815   TCDYWKSHPGLIwglvgfwgtvggvfgv----ASVPAGEFGTNLNLLQALSNTRNDGYGE  982
             TCDYW+SHP  IW  VG               A+         +++  A+ NTR DG G 
Sbjct  210   TCDYWRSHPMEIWSAVGGRFPSTSSSMGHFFGAAAGNVGGADVMSIQDAVGNTRADGTGA  269

Query  983   LYREGTASLLNSMLNTKRFPYTTQHVR  1063
             L REG A+LLNSM     FPYTT+ VR
Sbjct  270   LLREGAAALLNSMTRAG-FPYTTEQVR  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2629592296512