BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14322_g1_i1 len=904 path=[1:0-903]

Length=904
                                                                      Score     E

ref|XP_010689616.1|  PREDICTED: auxin transporter-like protein 3        361   1e-118   
emb|CDP15820.1|  unnamed protein product                                358   1e-118   
ref|XP_011097813.1|  PREDICTED: auxin transporter-like protein 3        361   2e-118   
ref|XP_003523460.1|  PREDICTED: auxin transporter-like protein 3-...    360   3e-118   
ref|XP_003526613.1|  PREDICTED: auxin transporter-like protein 3-...    358   2e-117   
gb|KHN09180.1|  Auxin transporter-like protein 3                        358   2e-117   
ref|XP_002513768.1|  amino acid transporter, putative                   356   2e-117   Ricinus communis
ref|XP_004500588.1|  PREDICTED: auxin transporter-like protein 3-...    357   3e-117   
ref|XP_007018988.1|  hypothetical protein TCM_035054                    357   3e-117   
ref|XP_007137377.1|  hypothetical protein PHAVU_009G122200g             356   9e-117   
ref|XP_009598314.1|  PREDICTED: auxin transporter-like protein 3        355   3e-116   
gb|AFK43565.1|  unknown                                                 354   5e-116   
gb|ABN81351.1|  auxin influx transport protein                          354   5e-116   Casuarina glauca
gb|ABN81352.1|  auxin influx transport protein                          354   5e-116   Casuarina glauca
ref|XP_011001431.1|  PREDICTED: auxin transporter-like protein 3        354   7e-116   
gb|KHG23901.1|  Auxin transporter-like protein 3                        353   9e-116   
ref|XP_010274353.1|  PREDICTED: auxin transporter-like protein 3        352   3e-115   
emb|CAN68381.1|  hypothetical protein VITISV_018907                     351   5e-115   Vitis vinifera
ref|XP_002285836.1|  PREDICTED: auxin transporter-like protein 3        352   5e-115   Vitis vinifera
gb|EYU22931.1|  hypothetical protein MIMGU_mgv1a005784mg                352   5e-115   
ref|XP_007222959.1|  hypothetical protein PRUPE_ppa005323mg             352   5e-115   
ref|XP_010063356.1|  PREDICTED: auxin transporter-like protein 3        351   7e-115   
ref|XP_008233901.1|  PREDICTED: auxin transporter-like protein 3        351   8e-115   
ref|XP_006434137.1|  hypothetical protein CICLE_v10001072mg             351   1e-114   
ref|NP_001234682.1|  LAX3 protein                                       351   1e-114   
ref|XP_010521237.1|  PREDICTED: auxin transporter-like protein 3        351   1e-114   
emb|CCF23026.1|  auxin influx carrier protein                           351   1e-114   
gb|KDO80738.1|  hypothetical protein CISIN_1g012371mg                   351   1e-114   
ref|XP_006472728.1|  PREDICTED: auxin transporter-like protein 3-...    350   1e-114   
ref|XP_011027592.1|  PREDICTED: auxin transporter-like protein 3        350   1e-114   
ref|XP_006366935.1|  PREDICTED: auxin transporter-like protein 3-...    350   2e-114   
emb|CAJ84440.1|  auxin influx carrier                                   349   5e-114   Lupinus albus
gb|KCW70571.1|  hypothetical protein EUGRSUZ_F03758                     351   5e-114   
ref|XP_002302253.1|  amino acid permease family protein                 348   1e-113   Populus trichocarpa [western balsam poplar]
ref|XP_010091352.1|  hypothetical protein L484_020154                   348   1e-113   
ref|XP_008465793.1|  PREDICTED: auxin transporter-like protein 3        348   1e-113   
ref|XP_008781479.1|  PREDICTED: auxin transporter-like protein 3        347   2e-113   
ref|XP_002306615.1|  amino acid permease family protein                 347   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_003601086.1|  Auxin influx carrier                               347   3e-113   
ref|XP_010930892.1|  PREDICTED: auxin transporter-like protein 3        347   3e-113   
gb|AIS71914.1|  LAX3 protein                                            347   3e-113   
gb|ABK94652.1|  unknown                                                 346   6e-113   Populus trichocarpa [western balsam poplar]
ref|XP_009341668.1|  PREDICTED: auxin transporter-like protein 3        346   6e-113   
ref|XP_009366978.1|  PREDICTED: auxin transporter-like protein 3        346   8e-113   
ref|XP_004140386.1|  PREDICTED: auxin transporter-like protein 3-...    346   8e-113   
ref|XP_010534639.1|  PREDICTED: auxin transporter-like protein 3        345   2e-112   
ref|XP_004290835.1|  PREDICTED: auxin transporter-like protein 3-...    345   2e-112   
ref|XP_010272856.1|  PREDICTED: auxin transporter-like protein 3        345   3e-112   
ref|XP_004173513.1|  PREDICTED: LOW QUALITY PROTEIN: auxin transp...    344   4e-112   
gb|KDP32765.1|  hypothetical protein JCGZ_12057                         344   5e-112   
ref|XP_008338785.1|  PREDICTED: auxin transporter-like protein 3        343   8e-112   
ref|NP_177892.1|  auxin influx carrier LAX3                             343   9e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79229.1|  BnaC06g20740D                                          343   9e-112   
ref|XP_008378489.1|  PREDICTED: auxin transporter-like protein 3        343   1e-111   
ref|XP_006390066.1|  hypothetical protein EUTSA_v10018493mg             343   1e-111   
ref|XP_006300460.1|  hypothetical protein CARUB_v10020229mg             343   2e-111   
ref|XP_010428852.1|  PREDICTED: auxin transporter-like protein 3        342   2e-111   
ref|XP_010471965.1|  PREDICTED: auxin transporter-like protein 3        342   3e-111   
ref|XP_011012812.1|  PREDICTED: auxin transporter-like protein 3        342   3e-111   
ref|XP_010416725.1|  PREDICTED: auxin transporter-like protein 3 ...    342   5e-111   
dbj|BAI94502.1|  auxin influx carrier protein                           341   7e-111   
gb|KFK42165.1|  hypothetical protein AALP_AA2G219600                    341   8e-111   
emb|CDX68048.1|  BnaA07g20880D                                          341   1e-110   
ref|XP_009104609.1|  PREDICTED: auxin transporter-like protein 3        341   1e-110   
ref|XP_009128243.1|  PREDICTED: auxin transporter-like protein 3        340   3e-110   
emb|CDY44521.1|  BnaCnng11320D                                          338   1e-109   
ref|XP_002450367.1|  hypothetical protein SORBIDRAFT_05g004250          338   3e-109   Sorghum bicolor [broomcorn]
ref|XP_009406113.1|  PREDICTED: auxin transporter-like protein 3        336   8e-109   
ref|XP_004978789.1|  PREDICTED: putative auxin transporter-like p...    331   5e-107   
ref|XP_004978791.1|  PREDICTED: putative auxin transporter-like p...    331   5e-107   
ref|XP_004978792.1|  PREDICTED: putative auxin transporter-like p...    331   5e-107   
gb|AFW65371.1|  hypothetical protein ZEAMMB73_861395                    328   8e-107   
ref|XP_004978790.1|  PREDICTED: putative auxin transporter-like p...    330   1e-106   
ref|XP_004978788.1|  PREDICTED: putative auxin transporter-like p...    331   1e-106   
ref|XP_008679620.1|  PREDICTED: auxin transporter-like protein 3        329   8e-106   
ref|XP_010690397.1|  PREDICTED: auxin transporter-like protein 2        325   5e-104   
ref|XP_004983392.1|  PREDICTED: auxin transporter-like protein 3-...    326   6e-104   
ref|XP_007137359.1|  hypothetical protein PHAVU_009G120700g             324   7e-104   
ref|XP_002277417.1|  PREDICTED: auxin transporter-like protein 2        324   7e-104   Vitis vinifera
ref|XP_006847065.1|  hypothetical protein AMTR_s00017p00205360          323   1e-103   
ref|XP_010271557.1|  PREDICTED: auxin transporter-like protein 2        323   1e-103   
ref|XP_006577903.1|  PREDICTED: auxin transporter-like protein 5-...    322   2e-103   
gb|KHN20003.1|  Auxin transporter-like protein 5                        321   2e-103   
ref|XP_003523499.1|  PREDICTED: auxin transporter-like protein 5-...    322   3e-103   
ref|XP_004144920.1|  PREDICTED: auxin transporter-like protein 5-...    319   4e-103   
gb|KHN33683.1|  Auxin transporter-like protein 5                        322   4e-103   
ref|XP_003573729.1|  PREDICTED: auxin transporter-like protein 3        323   4e-103   
ref|NP_001105117.1|  auxin import carrier1                              323   5e-103   Zea mays [maize]
ref|XP_004289854.1|  PREDICTED: auxin transporter-like protein 2-...    322   5e-103   
ref|XP_006662765.1|  PREDICTED: putative auxin transporter-like p...    322   5e-103   
ref|XP_003527602.1|  PREDICTED: auxin transporter-like protein 5-...    322   5e-103   
gb|ACG35887.1|  auxin transporter-like protein 3                        323   6e-103   Zea mays [maize]
gb|EMT20447.1|  hypothetical protein F775_12101                         322   8e-103   
ref|XP_008648314.1|  PREDICTED: auxin import carrier1 isoform X1        323   9e-103   
gb|KGN43238.1|  hypothetical protein Csa_7G010800                       321   1e-102   
ref|XP_009400351.1|  PREDICTED: auxin transporter-like protein 3        322   1e-102   
ref|XP_006851916.1|  hypothetical protein AMTR_s00041p00165970          320   2e-102   
ref|XP_008235992.1|  PREDICTED: auxin transporter-like protein 2        320   2e-102   
dbj|BAK03484.1|  predicted protein                                      321   2e-102   
ref|XP_009615217.1|  PREDICTED: auxin transporter-like protein 2        320   2e-102   
ref|XP_008447968.1|  PREDICTED: auxin transporter-like protein 2        320   3e-102   
ref|XP_006366614.1|  PREDICTED: auxin transporter-like protein 2-...    320   4e-102   
ref|XP_004165789.1|  PREDICTED: LOW QUALITY PROTEIN: auxin transp...    317   4e-102   
ref|XP_008457668.1|  PREDICTED: auxin transporter-like protein 2 ...    320   4e-102   
ref|XP_004147069.1|  PREDICTED: auxin transporter-like protein 5-...    317   5e-102   
ref|XP_009798935.1|  PREDICTED: auxin transporter-like protein 2        319   5e-102   
ref|NP_001233924.1|  LAX5 protein                                       319   7e-102   
ref|XP_002312973.1|  auxin influx carrier family protein                318   9e-102   Populus trichocarpa [western balsam poplar]
gb|AAK58522.1|AF263100_1  putative AUX1-like permease                   318   9e-102   Populus tremula x Populus tremuloides
ref|XP_002467350.1|  hypothetical protein SORBIDRAFT_01g026240          320   1e-101   Sorghum bicolor [broomcorn]
dbj|BAJ33981.1|  unnamed protein product                                313   1e-101   
ref|XP_007200986.1|  hypothetical protein PRUPE_ppa004865mg             318   1e-101   
ref|XP_010090315.1|  hypothetical protein L484_024980                   318   2e-101   
gb|EPS72387.1|  auxin influx carrier component                          317   2e-101   
ref|XP_008372897.1|  PREDICTED: auxin transporter-like protein 2        317   3e-101   
gb|KHN05411.1|  Auxin transporter-like protein 5                        317   3e-101   
ref|XP_010553089.1|  PREDICTED: auxin transporter-like protein 1        317   3e-101   
ref|XP_009377677.1|  PREDICTED: auxin transporter-like protein 2        317   3e-101   
ref|XP_003540652.1|  PREDICTED: auxin transporter-like protein 5-...    317   3e-101   
gb|KGN61915.1|  hypothetical protein Csa_2G264590                       317   4e-101   
ref|XP_008349394.1|  PREDICTED: auxin transporter-like protein 2        317   4e-101   
ref|XP_009413688.1|  PREDICTED: auxin transporter-like protein 2        318   4e-101   
ref|XP_011046499.1|  PREDICTED: auxin transporter-like protein 5        317   4e-101   
ref|XP_009340237.1|  PREDICTED: auxin transporter-like protein 2        317   4e-101   
ref|XP_006422638.1|  hypothetical protein CICLE_v10028271mg             317   4e-101   
ref|XP_006486767.1|  PREDICTED: auxin transporter-like protein 5-...    317   5e-101   
ref|XP_011088581.1|  PREDICTED: auxin transporter-like protein 5        317   5e-101   
ref|XP_011092887.1|  PREDICTED: auxin transporter-like protein 2        317   6e-101   
ref|XP_004505775.1|  PREDICTED: auxin transporter-like protein 5-...    316   6e-101   
ref|XP_010934176.1|  PREDICTED: auxin transporter-like protein 2        317   6e-101   
gb|KDP29622.1|  hypothetical protein JCGZ_18784                         316   6e-101   
ref|XP_009621128.1|  PREDICTED: auxin transporter-like protein 2        316   8e-101   
dbj|BAK07453.1|  predicted protein                                      317   8e-101   
ref|XP_008781006.1|  PREDICTED: auxin transporter-like protein 2        317   9e-101   
emb|CCF23027.1|  auxin influx carrier protein                           316   9e-101   
ref|XP_003537799.1|  PREDICTED: auxin transporter-like protein 5-...    316   1e-100   
gb|KHN39891.1|  Auxin transporter-like protein 5                        315   1e-100   
emb|CCF23028.1|  auxin influx carrier protein                           316   1e-100   
ref|XP_010268655.1|  PREDICTED: auxin transporter-like protein 2        316   1e-100   
ref|NP_001049534.1|  Os03g0244600                                       317   1e-100   Oryza sativa Japonica Group [Japonica rice]
emb|CDY71765.1|  BnaCnng74340D                                          311   2e-100   
ref|XP_007133922.1|  hypothetical protein PHAVU_010G003600g             315   2e-100   
ref|XP_003557091.2|  PREDICTED: auxin transporter-like protein 2-...    306   2e-100   
ref|XP_004173289.1|  PREDICTED: LOW QUALITY PROTEIN: auxin transp...    312   2e-100   
ref|XP_006404544.1|  hypothetical protein EUTSA_v10000149mg             315   3e-100   
ref|XP_002468184.1|  hypothetical protein SORBIDRAFT_01g041270          315   5e-100   Sorghum bicolor [broomcorn]
ref|NP_001064161.1|  Os10g0147400                                       316   5e-100   Oryza sativa Japonica Group [Japonica rice]
gb|EAY77705.1|  hypothetical protein OsI_32746                          316   6e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_010526556.1|  PREDICTED: auxin transporter-like protein 2        313   6e-100   
ref|XP_002532696.1|  amino acid transporter, putative                   314   6e-100   Ricinus communis
sp|Q8L883.1|LAX5_MEDTR  RecName: Full=Auxin transporter-like prot...    313   7e-100   Medicago truncatula
ref|XP_007041889.1|  hypothetical protein TCM_006657                    314   7e-100   
ref|XP_010416846.1|  PREDICTED: LOW QUALITY PROTEIN: auxin transp...    313   8e-100   
ref|XP_010529889.1|  PREDICTED: auxin transporter protein 1             313   8e-100   
dbj|BAD82312.1|  putative AUX1-like permease                            306   9e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010472082.1|  PREDICTED: auxin transporter-like protein 2 ...    313   1e-99    
ref|XP_010256603.1|  PREDICTED: auxin transporter-like protein 2        313   1e-99    
ref|XP_003561828.1|  PREDICTED: auxin transporter-like protein 3        314   1e-99    
ref|XP_010428998.1|  PREDICTED: auxin transporter-like protein 2        313   1e-99    
gb|KFK37063.1|  hypothetical protein AALP_AA4G208000                    313   1e-99    
emb|CDX83191.1|  BnaA03g23150D                                          313   1e-99    
ref|XP_010920178.1|  PREDICTED: auxin transporter-like protein 2        314   1e-99    
ref|XP_009770462.1|  PREDICTED: auxin transporter-like protein 2        313   1e-99    
ref|XP_006662180.1|  PREDICTED: auxin transporter-like protein 3-...    314   1e-99    
gb|KCW49470.1|  hypothetical protein EUGRSUZ_K02992                     313   2e-99    
ref|XP_010262806.1|  PREDICTED: auxin transporter-like protein 2        312   2e-99    
gb|KCW64113.1|  hypothetical protein EUGRSUZ_G01769                     312   2e-99    
ref|XP_003520808.1|  PREDICTED: auxin transporter-like protein 2-...    312   2e-99    
ref|XP_010923085.1|  PREDICTED: auxin transporter-like protein 2        312   2e-99    
ref|XP_006848158.1|  hypothetical protein AMTR_s00029p00231910          312   2e-99    
ref|XP_010037718.1|  PREDICTED: auxin transporter-like protein 4        312   2e-99    
ref|XP_008788387.1|  PREDICTED: auxin transporter-like protein 2        313   3e-99    
dbj|BAF49450.1|  putative AUX1-like permease                            313   3e-99    Oryza sativa Indica Group [Indian rice]
gb|EPS66996.1|  auxin influx transport protein                          311   3e-99    
ref|XP_006294110.1|  hypothetical protein CARUB_v10023108mg             312   3e-99    
ref|XP_008785385.1|  PREDICTED: auxin transporter-like protein 4        312   3e-99    
gb|EYU37934.1|  hypothetical protein MIMGU_mgv1a005137mg                312   3e-99    
ref|XP_006649726.1|  PREDICTED: auxin transporter-like protein 3-...    313   3e-99    
ref|XP_002878531.1|  hypothetical protein ARALYDRAFT_900513             311   3e-99    
ref|NP_179701.1|  like AUXIN RESISTANT 2                                311   4e-99    Arabidopsis thaliana [mouse-ear cress]
emb|CBI37897.3|  unnamed protein product                                311   4e-99    
ref|XP_004985027.1|  PREDICTED: auxin transporter-like protein 3-...    313   4e-99    
ref|XP_002456658.1|  hypothetical protein SORBIDRAFT_03g040320          311   4e-99    Sorghum bicolor [broomcorn]
ref|XP_010066266.1|  PREDICTED: LOW QUALITY PROTEIN: auxin transp...    311   5e-99    
ref|XP_002268925.1|  PREDICTED: auxin transporter-like protein 2        310   7e-99    Vitis vinifera
ref|XP_002306175.1|  hypothetical protein POPTR_0004s17860g             311   8e-99    Populus trichocarpa [western balsam poplar]
gb|KHG20422.1|  Auxin transporter-like protein 4                        310   8e-99    
ref|XP_006359671.1|  PREDICTED: auxin transporter-like protein 5-...    311   9e-99    
ref|NP_001234675.1|  LAX2 protein                                       311   9e-99    
ref|XP_009117443.1|  PREDICTED: auxin transporter-like protein 2        310   1e-98    
ref|XP_010030821.1|  PREDICTED: auxin transporter-like protein 4        311   1e-98    
ref|NP_001065850.1|  Os11g0169200                                       310   1e-98    Oryza sativa Japonica Group [Japonica rice]
gb|EAY80094.1|  hypothetical protein OsI_35263                          310   1e-98    Oryza sativa Indica Group [Indian rice]
gb|KHG12121.1|  Auxin transporter-like protein 2                        310   1e-98    
gb|EMT10762.1|  hypothetical protein F775_16607                         310   1e-98    
ref|XP_010553246.1|  PREDICTED: auxin transporter protein 1-like        310   1e-98    
emb|CDX93326.1|  BnaC04g45700D                                          310   1e-98    
ref|XP_009141723.1|  PREDICTED: auxin transporter protein 1-like        310   1e-98    
ref|NP_001234688.1|  LAX4 protein                                       310   1e-98    
emb|CDY18404.1|  BnaA04g21830D                                          310   1e-98    
emb|CDX81996.1|  BnaC08g36050D                                          310   1e-98    
ref|XP_010528794.1|  PREDICTED: auxin transporter protein 1-like        310   2e-98    
ref|NP_974719.1|  auxin transporter-like protein 1                      307   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122846.1|  PREDICTED: auxin transporter-like protein 1 ...    307   2e-98    
ref|XP_009134011.1|  PREDICTED: auxin transporter-like protein 2        310   2e-98    
gb|KFK24627.1|  hypothetical protein AALP_AA8G003900                    311   2e-98    
ref|XP_002316226.1|  putative AUX1-like permease family protein         309   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_009133231.1|  PREDICTED: auxin transporter protein 1-like        310   3e-98    
gb|KHG06629.1|  Auxin transporter-like protein 2                        309   3e-98    
dbj|BAH47613.1|  auxin influx carrier protein                           309   3e-98    Zinnia violacea [garden zinnia]
ref|XP_008442451.1|  PREDICTED: auxin transporter-like protein 2        309   3e-98    
ref|XP_004970626.1|  PREDICTED: auxin transporter-like protein 1-...    309   4e-98    
ref|XP_011035981.1|  PREDICTED: auxin transporter-like protein 2        308   4e-98    
emb|CCF23025.1|  auxin influx carrier protein                           309   4e-98    
ref|XP_009122845.1|  PREDICTED: auxin transporter-like protein 1 ...    307   4e-98    
gb|KHM99981.1|  Auxin transporter-like protein 2                        309   4e-98    
ref|XP_002322969.2|  auxin resistant 1 family protein                   308   5e-98    Populus trichocarpa [western balsam poplar]
ref|XP_009619160.1|  PREDICTED: auxin transporter-like protein 4        309   5e-98    
ref|XP_009407542.1|  PREDICTED: auxin transporter-like protein 1        308   6e-98    
gb|ABK24607.1|  unknown                                                 309   6e-98    Picea sitchensis
ref|XP_004169795.1|  PREDICTED: LOW QUALITY PROTEIN: auxin transp...    300   6e-98    
gb|AII98157.1|  auxin influx transport protein                          308   6e-98    
ref|XP_002873019.1|  hypothetical protein ARALYDRAFT_486953             308   6e-98    
ref|NP_001150441.1|  LOC100284071                                       310   7e-98    Zea mays [maize]
ref|XP_011001993.1|  PREDICTED: auxin transporter-like protein 2        308   7e-98    
emb|CDY07751.1|  BnaA03g17600D                                          310   7e-98    
ref|XP_011094989.1|  PREDICTED: auxin transporter-like protein 2        308   7e-98    
tpg|DAA44356.1|  TPA: auxin transporter-like protein 3                  309   7e-98    
ref|NP_001233919.1|  LAX1 protein                                       308   8e-98    
ref|XP_010095085.1|  hypothetical protein L484_026394                   308   9e-98    
ref|XP_004492419.1|  PREDICTED: auxin transporter-like protein 2-...    308   1e-97    
ref|XP_006398638.1|  hypothetical protein EUTSA_v10013364mg             308   1e-97    
gb|AAG17171.1|AF190880_1  putative AUX1-like permease                   308   1e-97    Populus tremula x Populus tremuloides
emb|CDY40307.1|  BnaA10g27610D                                          308   1e-97    
ref|XP_004137726.1|  PREDICTED: auxin transporter-like protein 2-...    308   1e-97    
dbj|BAC98948.1|  AUX1-like auxin influx carrier protein                 308   1e-97    Pisum sativum [garden pea]
ref|XP_009402291.1|  PREDICTED: auxin transporter-like protein 1 ...    299   1e-97    
ref|XP_002526879.1|  amino acid transporter, putative                   307   1e-97    Ricinus communis
ref|NP_195744.1|  auxin transporter-like protein 1                      308   1e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AAR18696.1|  auxin transporter protein 1                             298   1e-97    Populus tomentosa [Chinese white poplar]
ref|XP_009122843.1|  PREDICTED: auxin transporter-like protein 1 ...    308   2e-97    
ref|XP_007141783.1|  hypothetical protein PHAVU_008G225300g             307   2e-97    
ref|XP_009787603.1|  PREDICTED: auxin transporter-like protein 2        298   2e-97    
ref|XP_009402290.1|  PREDICTED: auxin transporter-like protein 1 ...    300   2e-97    
ref|XP_004490968.1|  PREDICTED: auxin transporter-like protein 1-...    307   2e-97    
ref|XP_004490969.1|  PREDICTED: auxin transporter-like protein 1-...    307   2e-97    
ref|XP_010505424.1|  PREDICTED: auxin transporter protein 1-like        307   2e-97    
ref|XP_006293379.1|  hypothetical protein CARUB_v10023103mg             307   2e-97    
ref|XP_010509224.1|  PREDICTED: auxin transporter protein 1 isofo...    307   2e-97    
dbj|BAJ88422.1|  predicted protein                                      307   2e-97    
gb|KDP24475.1|  hypothetical protein JCGZ_25039                         307   2e-97    
ref|XP_011019137.1|  PREDICTED: auxin transporter-like protein 2        307   2e-97    
ref|XP_010689866.1|  PREDICTED: auxin transporter-like protein 2        307   2e-97    
ref|XP_009612241.1|  PREDICTED: auxin transporter-like protein 4        307   2e-97    
sp|Q8L884.1|LAX4_MEDTR  RecName: Full=Auxin transporter-like prot...    307   2e-97    Medicago truncatula
ref|NP_001151566.1|  auxin transporter-like protein 1                   307   3e-97    Zea mays [maize]
ref|XP_011076716.1|  PREDICTED: auxin transporter-like protein 2        306   3e-97    
ref|XP_010517097.1|  PREDICTED: auxin transporter protein 1-like        307   3e-97    
ref|XP_009416206.1|  PREDICTED: auxin transporter-like protein 1        307   3e-97    
ref|XP_004171931.1|  PREDICTED: auxin transporter-like protein 2-...    306   3e-97    
ref|NP_001044846.1|  Os01g0856500                                       306   4e-97    Oryza sativa Japonica Group [Japonica rice]
gb|EYU41872.1|  hypothetical protein MIMGU_mgv1a005485mg                306   4e-97    
gb|EAY76542.1|  hypothetical protein OsI_04484                          306   5e-97    Oryza sativa Indica Group [Indian rice]
gb|KDP44804.1|  hypothetical protein JCGZ_01304                         306   5e-97    
gb|ABQ95667.1|  auxin influx carrier                                    302   5e-97    
ref|XP_002309128.1|  auxin resistant 1 family protein                   306   5e-97    Populus trichocarpa [western balsam poplar]
ref|XP_009412578.1|  PREDICTED: auxin transporter-like protein 4        306   5e-97    
gb|EMT08246.1|  hypothetical protein F775_16049                         309   5e-97    
ref|XP_009781043.1|  PREDICTED: auxin transporter-like protein 4        306   5e-97    
ref|XP_006366358.1|  PREDICTED: auxin transporter-like protein 2-...    306   6e-97    
ref|XP_007131693.1|  hypothetical protein PHAVU_011G034000g             306   6e-97    
ref|XP_004147917.1|  PREDICTED: auxin transporter protein 1-like        300   6e-97    
ref|XP_006411014.1|  hypothetical protein EUTSA_v10016566mg             306   7e-97    
ref|XP_009787627.1|  PREDICTED: auxin transporter-like protein 4        306   7e-97    
gb|AAF21982.1|AF115543_1  AUX1-like protein                             305   7e-97    Populus tremula x Populus tremuloides
ref|XP_009610286.1|  PREDICTED: auxin transporter-like protein 2        305   7e-97    
ref|XP_008673001.1|  PREDICTED: auxin transporter-like protein 1 ...    306   7e-97    
ref|XP_010678106.1|  PREDICTED: auxin transporter-like protein 4        306   8e-97    
ref|XP_007009047.1|  hypothetical protein TCM_042567                    305   8e-97    
ref|XP_011077572.1|  PREDICTED: auxin transporter-like protein 2        305   1e-96    
gb|ABQ95665.1|  auxin influx carrier                                    301   1e-96    
gb|EYU40423.1|  hypothetical protein MIMGU_mgv1a005408mg                305   1e-96    
emb|CDY10489.1|  BnaCnng03900D                                          302   1e-96    
emb|CDP06500.1|  unnamed protein product                                305   1e-96    
ref|XP_007140373.1|  hypothetical protein PHAVU_008G106300g             305   1e-96    
ref|XP_007026762.1|  Transmembrane amino acid transporter family ...    305   1e-96    
ref|NP_565882.1|  auxin transporter protein 1                           305   1e-96    
ref|XP_009384850.1|  PREDICTED: auxin transporter-like protein 1        305   1e-96    
ref|XP_009402296.1|  PREDICTED: auxin transporter-like protein 1        305   2e-96    
ref|XP_002879728.1|  hypothetical protein ARALYDRAFT_482819             305   2e-96    
gb|AEQ61904.1|  auxin influx transport protein                          305   2e-96    
ref|XP_008465848.1|  PREDICTED: auxin transporter-like protein 4        304   3e-96    
ref|XP_009143423.1|  PREDICTED: auxin transporter protein 1             305   3e-96    
emb|CDX91429.1|  BnaC04g07210D                                          305   3e-96    
emb|CDX74908.1|  BnaA05g06540D                                          304   3e-96    
emb|CDY14488.1|  BnaC03g21070D                                          306   3e-96    
gb|KHG06031.1|  Auxin transporter-like protein 2                        303   3e-96    
ref|XP_008360782.1|  PREDICTED: auxin transporter-like protein 2        304   3e-96    
ref|XP_011047431.1|  PREDICTED: auxin transporter-like protein 2 ...    304   4e-96    
gb|ABQ95666.1|  auxin influx carrier                                    300   4e-96    
ref|XP_002531347.1|  amino acid transporter, putative                   304   4e-96    
gb|EPS67876.1|  auxin influx transport protein                          303   4e-96    
emb|CAN81358.1|  hypothetical protein VITISV_040407                     303   4e-96    
ref|XP_009350839.1|  PREDICTED: auxin transporter-like protein 2        303   4e-96    
gb|ACZ67478.1|  auxin resistant 1 protein                               304   5e-96    
ref|XP_010109636.1|  hypothetical protein L484_015591                   303   6e-96    
ref|XP_006645042.1|  PREDICTED: auxin transporter-like protein 1-...    303   6e-96    
gb|ABN81349.1|  auxin influx transport protein                          303   6e-96    
ref|XP_008373818.1|  PREDICTED: auxin transporter-like protein 2        301   6e-96    
ref|NP_001289206.1|  auxin transporter-like protein 2                   303   7e-96    
ref|XP_009370198.1|  PREDICTED: auxin transporter-like protein 2        303   8e-96    
emb|CDO96935.1|  unnamed protein product                                303   9e-96    
ref|XP_009358863.1|  PREDICTED: auxin transporter-like protein 2        303   1e-95    
gb|KHG04765.1|  Auxin transporter-like protein 2                        302   1e-95    
ref|XP_010534572.1|  PREDICTED: auxin transporter-like protein 1        301   1e-95    
ref|XP_003552458.1|  PREDICTED: auxin transporter-like protein 1-...    302   1e-95    
ref|XP_008388199.1|  PREDICTED: auxin transporter-like protein 2        302   1e-95    
ref|XP_002311208.1|  putative AUX1-like permease family protein         302   1e-95    
ref|XP_007163526.1|  hypothetical protein PHAVU_001G241500g             302   1e-95    
ref|XP_009344618.1|  PREDICTED: auxin transporter-like protein 1        302   2e-95    
ref|XP_008441444.1|  PREDICTED: auxin transporter-like protein 1        301   2e-95    
ref|XP_007217944.1|  hypothetical protein PRUPE_ppa005057mg             301   2e-95    
ref|XP_006349465.1|  PREDICTED: auxin transporter-like protein 2-...    302   3e-95    
gb|KEH28281.1|  auxin influx transporter                                301   3e-95    
ref|XP_003616599.1|  Auxin influx protein                               301   3e-95    
ref|XP_002279219.1|  PREDICTED: auxin transporter-like protein 2        301   3e-95    
ref|XP_004307625.1|  PREDICTED: auxin transporter-like protein 2-...    301   3e-95    
ref|XP_006287618.1|  hypothetical protein CARUB_v10000830mg             301   3e-95    
ref|XP_003564646.1|  PREDICTED: auxin transporter-like protein 1        301   3e-95    
ref|XP_003623228.1|  Auxin transporter-like protein                     301   3e-95    
ref|XP_010490591.1|  PREDICTED: auxin transporter-like protein 1        301   3e-95    
ref|XP_010452009.1|  PREDICTED: auxin transporter-like protein 1        301   3e-95    
ref|XP_010423925.1|  PREDICTED: auxin transporter-like protein 1        301   3e-95    
emb|CAN72381.1|  hypothetical protein VITISV_038019                     301   4e-95    
ref|XP_008233733.1|  PREDICTED: auxin transporter-like protein 1        301   4e-95    
ref|XP_008463226.1|  PREDICTED: auxin transporter-like protein 1        301   4e-95    
ref|XP_008388198.1|  PREDICTED: auxin transporter-like protein 2        301   4e-95    
ref|XP_006590304.1|  PREDICTED: uncharacterized protein LOC100792...    301   5e-95    
gb|KHN36389.1|  Auxin transporter-like protein 1                        301   5e-95    
ref|XP_004961913.1|  PREDICTED: auxin transporter-like protein 2-...    301   5e-95    
gb|EYU41875.1|  hypothetical protein MIMGU_mgv1a005679mg                301   5e-95    
ref|XP_011042692.1|  PREDICTED: auxin transporter-like protein 1        300   5e-95    
gb|ACN31453.1|  unknown                                                 298   5e-95    
gb|AAW57318.1|  auxin influx protein                                    301   6e-95    
ref|XP_004138429.1|  PREDICTED: auxin transporter-like protein 1-...    300   6e-95    
dbj|BAH47612.1|  auxin influx carrier protein                           300   7e-95    
ref|XP_008392938.1|  PREDICTED: auxin transporter-like protein 1        300   7e-95    
gb|EPS65374.1|  auxin influx transport protein                          300   7e-95    
ref|XP_006480987.1|  PREDICTED: auxin transporter-like protein 2-...    301   7e-95    
gb|EMS49038.1|  hypothetical protein TRIUR3_02444                       301   7e-95    
ref|XP_006435701.1|  hypothetical protein CICLE_v10031413mg             300   7e-95    
ref|XP_004149252.1|  PREDICTED: auxin transporter-like protein 1-...    300   8e-95    
ref|XP_004167058.1|  PREDICTED: auxin transporter-like protein 4-...    300   8e-95    
ref|XP_007205126.1|  hypothetical protein PRUPE_ppa004949mg             300   8e-95    
ref|XP_004302648.1|  PREDICTED: auxin transporter-like protein 2-...    300   1e-94    
ref|XP_006429325.1|  hypothetical protein CICLE_v10011596mg             300   1e-94    
ref|XP_006575533.1|  PREDICTED: auxin transporter-like protein 1-...    300   1e-94    
ref|XP_006583631.1|  PREDICTED: auxin transporter-like protein 2-...    300   1e-94    
gb|ABS17592.1|  auxin influx transport protein                          298   1e-94    
ref|XP_003519387.1|  PREDICTED: auxin transporter-like protein 1-...    300   2e-94    
gb|KHN48553.1|  Auxin transporter-like protein 1                        300   2e-94    
ref|XP_006602646.1|  PREDICTED: auxin transporter-like protein 2-...    300   2e-94    
gb|KHN34733.1|  Auxin transporter-like protein 1                        299   3e-94    
ref|NP_001055693.1|  Os05g0447200                                       299   3e-94    
dbj|BAF49451.1|  putative AUX1-like permease                            299   3e-94    
ref|XP_003544105.1|  PREDICTED: auxin transporter-like protein 1-...    299   3e-94    
gb|EYU26651.1|  hypothetical protein MIMGU_mgv1a0066981mg               293   4e-94    
ref|XP_002441191.1|  hypothetical protein SORBIDRAFT_09g021990          299   5e-94    
dbj|BAG99356.1|  unnamed protein product                                299   6e-94    
emb|CAI05895.1|  putative auxin influx carrier protein                  298   6e-94    
ref|XP_009416187.1|  PREDICTED: auxin transporter-like protein 2        298   8e-94    
gb|AAQ08857.1|  auxin influx carrier-like protein 3                     297   1e-93    
dbj|BAJ92392.1|  predicted protein                                      293   1e-93    
gb|KDO53257.1|  hypothetical protein CISIN_1g011392mg                   297   1e-93    
ref|XP_010909234.1|  PREDICTED: auxin transporter-like protein 2        297   1e-93    
ref|XP_009384847.1|  PREDICTED: auxin transporter-like protein 2        297   1e-93    
emb|CDP14046.1|  unnamed protein product                                297   2e-93    
ref|XP_008795448.1|  PREDICTED: auxin transporter-like protein 2        297   2e-93    
emb|CDM85075.1|  unnamed protein product                                296   3e-93    
gb|AAQ08856.1|  auxin influx carrier-like protein 2                     300   5e-93    
gb|AAQ08855.1|  auxin influx carrier-like protein 1                     295   5e-93    
gb|EYU28490.1|  hypothetical protein MIMGU_mgv1a005429mg                296   5e-93    
ref|XP_003522093.1|  PREDICTED: auxin transporter-like protein 4-...    295   1e-92    
gb|AFW78109.1|  hypothetical protein ZEAMMB73_015656                    299   2e-92    
dbj|BAK00784.1|  predicted protein                                      294   3e-92    
gb|KHG25803.1|  Auxin transporter-like protein 5                        294   3e-92    
ref|XP_009133398.1|  PREDICTED: auxin transporter-like protein 1        291   1e-91    
emb|CDY69548.1|  BnaAnng30780D                                          291   1e-91    
ref|XP_009407552.1|  PREDICTED: auxin transporter-like protein 2        291   2e-91    
emb|CDP17858.1|  unnamed protein product                                291   3e-91    
ref|XP_002862319.1|  predicted protein                                  281   3e-91    
ref|XP_010508931.1|  PREDICTED: auxin transporter-like protein 2 ...    290   4e-91    
ref|XP_010067513.1|  PREDICTED: auxin transporter-like protein 2        291   6e-91    
gb|EMS50823.1|  hypothetical protein TRIUR3_23837                       292   6e-91    
ref|XP_010534573.1|  PREDICTED: auxin transporter-like protein 4        292   8e-91    
ref|XP_002879837.1|  auxin influx transport protein                     289   9e-91    
ref|XP_006294205.1|  hypothetical protein CARUB_v10023201mg             288   2e-90    
dbj|BAC41318.1|  AUX1-like auxin transport protein                      289   2e-90    
ref|XP_010505704.1|  PREDICTED: auxin transporter-like protein 1        288   2e-90    
ref|XP_006411246.1|  hypothetical protein EUTSA_v10016637mg             288   2e-90    
ref|XP_010517391.1|  PREDICTED: auxin transporter-like protein 1        288   2e-90    
ref|XP_002889156.1|  hypothetical protein ARALYDRAFT_476933             286   1e-89    
ref|XP_001767152.1|  predicted protein                                  280   2e-87    
ref|XP_002980500.1|  hypothetical protein SELMODRAFT_112710             281   2e-87    
ref|XP_002962587.1|  hypothetical protein SELMODRAFT_165624             281   2e-87    
ref|XP_008457669.1|  PREDICTED: auxin transporter-like protein 2 ...    278   5e-87    
ref|XP_001776801.1|  predicted protein                                  277   6e-86    
gb|EMT26923.1|  hypothetical protein F775_10388                         276   6e-86    
ref|XP_006654484.1|  PREDICTED: auxin transporter-like protein 2-...    275   6e-85    
emb|CAB55758.1|  putative AUX1-like permease                            275   9e-85    
gb|ABF46821.1|  putative auxin permease protein 1                       271   3e-84    
emb|CAJ84439.1|  auxin influx carrier                                   271   6e-84    
emb|CAN76469.1|  hypothetical protein VITISV_030043                     281   1e-83    
ref|NP_001242574.1|  uncharacterized protein LOC100792491               269   4e-83    
ref|XP_002977230.1|  hypothetical protein SELMODRAFT_176094             269   6e-83    
ref|XP_002965384.1|  hypothetical protein SELMODRAFT_439204             267   3e-82    
gb|ACJ85343.1|  unknown                                                 263   5e-82    
gb|AFK43091.1|  unknown                                                 263   7e-82    
ref|XP_011047433.1|  PREDICTED: auxin transporter-like protein 2 ...    256   2e-78    
gb|KDO69050.1|  hypothetical protein CISIN_1g0119661mg                  253   2e-77    
gb|EEE63904.1|  hypothetical protein OsJ_18729                          254   2e-77    
ref|XP_001776955.1|  predicted protein                                  254   5e-77    
gb|KEH28866.1|  auxin influx transporter                                252   6e-77    
ref|XP_006429324.1|  hypothetical protein CICLE_v10011596mg             252   3e-76    
gb|KDO53258.1|  hypothetical protein CISIN_1g011392mg                   249   1e-75    
gb|EAZ17569.1|  hypothetical protein OsJ_33105                          247   2e-74    
gb|EAY98240.1|  hypothetical protein OsI_20150                          251   2e-74    
ref|XP_002962429.1|  hypothetical protein SELMODRAFT_78094              243   1e-72    
ref|XP_002989384.1|  hypothetical protein SELMODRAFT_184534             243   1e-72    
ref|XP_002962430.1|  hypothetical protein SELMODRAFT_141124             239   2e-72    
ref|XP_001780458.1|  predicted protein                                  240   9e-72    
ref|XP_002964346.1|  hypothetical protein SELMODRAFT_81490              221   3e-64    
ref|XP_008370141.1|  PREDICTED: auxin transporter-like protein 2        218   6e-64    
emb|CDY68713.1|  BnaAnng28100D                                          211   3e-63    
ref|XP_002967689.1|  hypothetical protein SELMODRAFT_88304              218   7e-62    
gb|AFK41005.1|  unknown                                                 204   1e-61    
ref|XP_002973949.1|  hypothetical protein SELMODRAFT_100516             212   5e-61    
ref|XP_002969114.1|  hypothetical protein SELMODRAFT_90513              212   6e-61    
gb|KHN49099.1|  Auxin transporter-like protein 4                        210   1e-60    
gb|EEE58683.1|  hypothetical protein OsJ_10112                          207   1e-58    
ref|XP_001768181.1|  predicted protein                                  204   1e-57    
gb|KHG08092.1|  Auxin transporter-like protein 2                        200   1e-57    
ref|XP_002978000.1|  hypothetical protein SELMODRAFT_108264             203   2e-57    
ref|XP_002966748.1|  hypothetical protein SELMODRAFT_85340              201   9e-57    
ref|XP_002991388.1|  hypothetical protein SELMODRAFT_133400             199   5e-56    
ref|XP_002988255.1|  hypothetical protein SELMODRAFT_127494             198   1e-55    
ref|XP_002965755.1|  hypothetical protein SELMODRAFT_84463              196   3e-55    
ref|XP_002962334.1|  hypothetical protein SELMODRAFT_79164              194   1e-54    
ref|XP_002965754.1|  hypothetical protein SELMODRAFT_84093              191   8e-54    
ref|XP_002975842.1|  hypothetical protein SELMODRAFT_175182             192   1e-53    
ref|XP_001765158.1|  predicted protein                                  191   7e-53    
ref|XP_002975838.1|  hypothetical protein SELMODRAFT_104259             188   5e-52    
ref|XP_002965759.1|  hypothetical protein SELMODRAFT_84370              186   3e-51    
gb|ABR16158.1|  unknown                                                 176   2e-47    
ref|XP_002968972.1|  hypothetical protein SELMODRAFT_90516              172   4e-46    
ref|XP_001762708.1|  predicted protein                                  170   2e-45    
gb|AAR18699.1|  auxin influx carrier protein                            155   2e-43    
ref|XP_002990020.1|  hypothetical protein SELMODRAFT_130820             160   1e-41    
ref|XP_002988655.1|  hypothetical protein SELMODRAFT_184022             147   8e-37    
ref|XP_002986405.1|  hypothetical protein SELMODRAFT_123993             143   2e-35    
ref|XP_002988665.1|  hypothetical protein SELMODRAFT_128635             142   3e-35    
ref|XP_005644927.1|  hypothetical protein COCSUDRAFT_30594              139   5e-34    
ref|XP_002975482.1|  hypothetical protein SELMODRAFT_103602             131   1e-32    
ref|XP_002962998.1|  hypothetical protein SELMODRAFT_438269             132   2e-31    
ref|XP_005643892.1|  hypothetical protein COCSUDRAFT_19779              129   1e-30    
ref|XP_002978721.1|  hypothetical protein SELMODRAFT_443996             127   5e-30    
gb|ACU18315.1|  unknown                                                 119   6e-30    
ref|XP_002963141.1|  hypothetical protein SELMODRAFT_78325              120   2e-27    
ref|XP_002980180.1|  hypothetical protein SELMODRAFT_178114             119   3e-27    
ref|XP_003516350.1|  PREDICTED: auxin transporter-like protein 4-...    114   1e-25    
gb|KCW88119.1|  hypothetical protein EUGRSUZ_A00514                     114   1e-25    
ref|XP_005646900.1|  hypothetical protein COCSUDRAFT_47845              113   6e-25    
ref|XP_006379625.1|  hypothetical protein POPTR_0008s06630g             108   1e-23    
gb|KDO53259.1|  hypothetical protein CISIN_1g011392mg                   108   1e-23    
gb|EJK69867.1|  hypothetical protein THAOC_08836                        109   5e-23    
ref|XP_002962738.1|  hypothetical protein SELMODRAFT_79053              106   1e-22    
ref|XP_005847790.1|  hypothetical protein CHLNCDRAFT_133952             102   2e-21    
ref|NP_001281101.1|  uncharacterized protein LOC100217279             94.4    4e-18    
ref|XP_005649132.1|  hypothetical protein COCSUDRAFT_40946            91.3    2e-17    
ref|XP_005649624.1|  hypothetical protein COCSUDRAFT_65085            90.9    3e-17    
ref|XP_008354529.1|  PREDICTED: TMV resistance protein N-like         86.3    2e-15    
gb|AFP50456.1|  LAX4                                                  78.2    4e-15    
gb|AFP50162.1|  auxine transporter-like protein 2                     80.5    2e-14    
gb|AFP50168.1|  auxine transporter-like protein 2                     80.5    2e-14    
gb|AFP50164.1|  auxine transporter-like protein 2                     80.5    2e-14    
gb|AFP50171.1|  auxine transporter-like protein 2                     80.1    3e-14    
gb|AFP50157.1|  auxine transporter-like protein 2                     80.1    3e-14    
gb|AFP50166.1|  auxine transporter-like protein 2                     80.1    3e-14    
tpg|DAA56766.1|  TPA: hypothetical protein ZEAMMB73_201637            81.3    5e-14    
gb|AFP50449.1|  auxine transporter-like 4                             77.0    8e-14    
gb|AFP50451.1|  auxine transporter-like protein 4                     78.6    1e-13    
gb|ACF83268.1|  unknown                                               79.7    2e-13    
gb|AFP50447.1|  auxine transporter-like protein 4                     77.8    2e-13    
gb|AFP50454.1|  auxine transporter-like protein 4                     77.8    2e-13    
gb|AFP50453.1|  auxine transporter-like protein 4                     77.4    3e-13    
ref|NP_001132266.2|  uncharacterized protein LOC100193702             79.0    3e-13    
gb|AFW78110.1|  hypothetical protein ZEAMMB73_015656                  78.6    6e-13    
gb|AFP50457.1|  auxine transporter-like protein 4                     76.6    6e-13    
ref|XP_002962596.1|  hypothetical protein SELMODRAFT_404487           77.0    8e-13    
gb|EMT32139.1|  hypothetical protein F775_18243                       75.1    4e-12    



>ref|XP_010689616.1| PREDICTED: auxin transporter-like protein 3 [Beta vulgaris subsp. 
vulgaris]
Length=470

 Score =   361 bits (927),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWA+GDMLLDHSNALSLLPRT FRDTA++LM
Sbjct  255  MWKPQKFKMIYLLATLYVLTLTLPSASAVYWAYGDMLLDHSNALSLLPRTAFRDTAIILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIG+H TKS+ KR++ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKFIGIHETKSIMKRSIARLPVVIPIWFLAIIFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPAMAHMITFASP+ARENAVE+PPS +GGWAG Y MNIF+V WVF+V
Sbjct  375  AVGSLLVSFTVYIIPAMAHMITFASPSARENAVERPPSFVGGWAGMYSMNIFLVVWVFVV  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASM+NF++Q+NTFGLFAKCYQCP HKA
Sbjct  435  GFGLGGWASMMNFIQQVNTFGLFAKCYQCPPHKA  468



>emb|CDP15820.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL ATIYVLTLTLPSASAVYWAFGDMLL+HSNALSLLPRTGFRD AVVLM
Sbjct  184  MWKPQKFKLIYLGATIYVLTLTLPSASAVYWAFGDMLLNHSNALSLLPRTGFRDAAVVLM  243

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKSLFKRALARLPVV+PIWFLAIIFPFFGPINS
Sbjct  244  LIHQFITFGFACTPLYFVWEKFIGVHETKSLFKRALARLPVVVPIWFLAIIFPFFGPINS  303

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PP  +GGWAG Y MNIFVV WVF+V
Sbjct  304  TVGSLLVSFTVYIIPALAHMVTFASASARENAVERPPKFLGGWAGLYSMNIFVVVWVFVV  363

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASMVNFVRQI+TFGLF KC+QCP  KA
Sbjct  364  GFGFGGWASMVNFVRQIDTFGLFTKCFQCPPRKA  397



>ref|XP_011097813.1| PREDICTED: auxin transporter-like protein 3 [Sesamum indicum]
Length=470

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+ATIYVLTLTLPSASAVYWAFGD+LL+ SNAL+LLPRTGFRDTAV+LM
Sbjct  257  MWKPQKFKLIYLMATIYVLTLTLPSASAVYWAFGDLLLNRSNALALLPRTGFRDTAVILM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKSLFKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFACTPLYFVWEKFIGVHKTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPAMAHMITFAS +ARENAVE+ P  +GGW G Y MNIFVVAWVFIV
Sbjct  377  TVGSLLVSFTVYIIPAMAHMITFASASARENAVERAPRIVGGWTGLYVMNIFVVAWVFIV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFV QINTFGLFAKCYQCPKHK
Sbjct  437  GFGFGGWASMVNFVHQINTFGLFAKCYQCPKHK  469



>ref|XP_003523460.1| PREDICTED: auxin transporter-like protein 3-like [Glycine max]
 gb|KHN47048.1| Auxin transporter-like protein 3 [Glycine soja]
Length=465

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGD LL HSNALSLLPR+GFRDTAV+LM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPRSGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKSLFKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGVHETKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS  ARENAVE+PPS +GGW G Y MN+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMVTFASAPARENAVERPPSKLGGWVGLYSMNVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASM+NF+ QI+TFGLFAKCYQCP HKA
Sbjct  432  GFGLGGWASMINFIHQIDTFGLFAKCYQCPPHKA  465



>ref|XP_003526613.1| PREDICTED: auxin transporter-like protein 3-like [Glycine max]
Length=465

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGD LL HSNALSLLP+TGFRDTAV+LM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKTGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKSLFKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGVHETKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS  ARENAVE+PPS +GGW G Y MN+FVV WV ++
Sbjct  372  TVGSLLVSFTVYIIPALAHMVTFASAPARENAVERPPSKLGGWVGLYSMNVFVVVWVLVI  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASM+NF+ QI+TFGLF KCYQCP HKA
Sbjct  432  GFGLGGWASMINFIHQIDTFGLFVKCYQCPPHKA  465



>gb|KHN09180.1| Auxin transporter-like protein 3 [Glycine soja]
Length=465

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGD LL HSNALSLLP+TGFRDTAV+LM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKTGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKSLFKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGVHETKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS  ARENAVE+PPS +GGW G Y MN+FVV WV ++
Sbjct  372  TVGSLLVSFTVYIIPALAHMVTFASAPARENAVERPPSKLGGWVGLYSMNVFVVVWVLVI  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASM+NF+ QI+TFGLF KCYQCP HKA
Sbjct  432  GFGLGGWASMINFIHQIDTFGLFVKCYQCPPHKA  465



>ref|XP_002513768.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF48351.1| amino acid transporter, putative [Ricinus communis]
Length=412

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD+LL HSNALSLLP+TGFRDTAVVLM
Sbjct  199  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDLLLTHSNALSLLPKTGFRDTAVVLM  258

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH+TKSLFKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  259  LIHQFITFGFACTPLYFVWEKFIRVHDTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  318

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHMITF+S +ARENAVE+PPS +GGW G +CMN+FVV WVF+V
Sbjct  319  TVGSLLVSFTVYIIPSLAHMITFSSASARENAVERPPSFLGGWVGMFCMNLFVVVWVFVV  378

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWAS++NF+ QIN+FGLF KCYQCP HKA
Sbjct  379  GFGFGGWASLLNFIHQINSFGLFTKCYQCPPHKA  412



>ref|XP_004500588.1| PREDICTED: auxin transporter-like protein 3-like [Cicer arietinum]
Length=465

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSA AVYWAFGDMLL HSNALSLLP+TGFRDTAV+LM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSAVAVYWAFGDMLLTHSNALSLLPKTGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+GVH TKSLFKRAL RLPVV+PIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFVGVHETKSLFKRALVRLPVVVPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFASP++RENAVE+PPS +GGW G Y MN+FV  WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMVTFASPSSRENAVERPPSFLGGWVGLYSMNVFVAVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASM+NF+ QI+TFGLFAKCYQCP HKA
Sbjct  432  GFGLGGWASMLNFIHQIDTFGLFAKCYQCPPHKA  465



>ref|XP_007018988.1| hypothetical protein TCM_035054 [Theobroma cacao]
 gb|EOY16213.1| hypothetical protein TCM_035054 [Theobroma cacao]
Length=465

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGD+LL H+NALSLLPRTGFRDTA++LM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSASAVYWAFGDLLLTHANALSLLPRTGFRDTAIILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKSLFKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGVHETKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHMITFA  AARENAVE+PPS +GGWAG Y MN FVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPSLAHMITFAPAAARENAVERPPSFLGGWAGMYSMNAFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF++QI+TFGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIQQIDTFGLFTKCYQCPPHKA  465



>ref|XP_007137377.1| hypothetical protein PHAVU_009G122200g [Phaseolus vulgaris]
 gb|ESW09371.1| hypothetical protein PHAVU_009G122200g [Phaseolus vulgaris]
Length=465

 Score =   356 bits (914),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSA+AVYWAFGD LL HSNALSLLP+TGFRDTAV+LM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSAAAVYWAFGDQLLTHSNALSLLPKTGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKSLFKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGVHETKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS  ARENAVE+PPS +GGW G Y MN+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMMTFASAPARENAVERPPSRLGGWVGLYSMNVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASM+NF+ QI+TFGLF KCYQCP HKA
Sbjct  432  GFGLGGWASMINFIHQIDTFGLFTKCYQCPPHKA  465



>ref|XP_009598314.1| PREDICTED: auxin transporter-like protein 3 [Nicotiana tomentosiformis]
 ref|XP_009772391.1| PREDICTED: auxin transporter-like protein 3 [Nicotiana sylvestris]
Length=468

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+ATIYVLTLTLPSASAVYWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  255  MWKPQKFKLIYLMATIYVLTLTLPSASAVYWAFGDALLTHSNALALLPRTRFRDAAVVLM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH+TKSLFKRA+ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKFIRVHDTKSLFKRAMARLPVVIPIWFLAIVFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFASP+ARENAVEQPPS +G W G YC NIFVVAWVFIV
Sbjct  375  TVGSLLVSFTVYIIPALAHMVTFASPSARENAVEQPPSFLGRWVGLYCTNIFVVAWVFIV  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASMVNFV QINTFGLF KCYQCP HKA
Sbjct  435  GFGFGGWASMVNFVHQINTFGLFTKCYQCPPHKA  468



>gb|AFK43565.1| unknown [Lotus japonicus]
Length=465

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSA+AVYWAFGDMLL HSNALSLLP+T FRD+AVVLM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSAAAVYWAFGDMLLTHSNALSLLPKTRFRDSAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+GVH TKSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFLGVHETKSLLKRALTRLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS  ARENAVE+PPS +GGW G Y MN+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMVTFASAPARENAVERPPSIVGGWVGLYSMNVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASMVNF+RQ+NTFGLFAKCYQCP HKA
Sbjct  432  GFGLGGWASMVNFIRQVNTFGLFAKCYQCPPHKA  465



>gb|ABN81351.1| auxin influx transport protein [Casuarina glauca]
Length=465

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGDMLL HSNALSLLPR+GFRDTAVVLM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSASAVYWAFGDMLLTHSNALSLLPRSGFRDTAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI +H+TKS+FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIRIHDTKSVFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PPS +GGW G Y +N FVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAHMLTFASASARENAVERPPSFLGGWTGSYSVNSFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQ++TFGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQVDTFGLFTKCYQCPPHKA  465



>gb|ABN81352.1| auxin influx transport protein [Casuarina glauca]
Length=465

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGDMLL HSNALSLLPR+GFRDTAVVLM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSASAVYWAFGDMLLTHSNALSLLPRSGFRDTAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI +H+TKS+FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIRIHDTKSVFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PPS +GGW G Y +N FVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAHMLTFASASARENAVERPPSFLGGWTGSYSVNSFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQ++TFGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQVDTFGLFTKCYQCPPHKA  465



>ref|XP_011001431.1| PREDICTED: auxin transporter-like protein 3 [Populus euphratica]
Length=465

 Score =   354 bits (908),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNALSLLPR G+RDTAVVLM
Sbjct  252  MWKPQKFKLIYLIATLYVLTLTLPSASAVYWAFGDFLLTHSNALSLLPRNGYRDTAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIG+H TKS+FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGIHYTKSVFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHM+TF+S +ARENAVE+PP  +GGWAG YC+N FVV WVF+V
Sbjct  372  TVGSLLVSFTVYIIPSLAHMVTFSSASARENAVERPPPFLGGWAGSYCVNFFVVVWVFVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQI++FGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQIDSFGLFTKCYQCPPHKA  465



>gb|KHG23901.1| Auxin transporter-like protein 3 [Gossypium arboreum]
Length=452

 Score =   353 bits (906),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 203/214 (95%), Gaps = 1/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGD+LL HSNALSLLPR+GFRDTAV+LM
Sbjct  240  MWKPQKFKMIYLIATLYVLTLTLPSASAVYWAFGDLLLTHSNALSLLPRSGFRDTAVILM  299

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKS+FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  300  LIHQFITFGFACTPLYFVWEKFIGVHETKSVFKRALARLPVVIPIWFLAIIFPFFGPINS  359

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHMITFA  AARENAVE+PPS +GGWAG Y +NIFVV WV IV
Sbjct  360  TVGSLLVSFTVYIIPSLAHMITFAPSAARENAVERPPSFLGGWAGMYSINIFVVVWVLIV  419

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF++QINTFGLF KCYQCP HKA
Sbjct  420  GFGFGGWASMLNFIQQINTFGLFTKCYQCP-HKA  452



>ref|XP_010274353.1| PREDICTED: auxin transporter-like protein 3 [Nelumbo nucifera]
Length=464

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSA +VYWAFGDMLL+HSNA SLLPR+GFRDTAV+LM
Sbjct  251  MWKPQKFKLIYLMATLYVLTLTLPSAISVYWAFGDMLLNHSNAFSLLPRSGFRDTAVILM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+G+HNTKSLFKRAL+RLPVVIPIWFLAIIFPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYFVWEKFLGMHNTKSLFKRALSRLPVVIPIWFLAIIFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVG+LLVSFTVYIIPA+AHMITFA  +ARENAVE+PPS +GGWAG YCMNIF+VAWV ++
Sbjct  371  TVGALLVSFTVYIIPALAHMITFAPASARENAVERPPSFIGGWAGLYCMNIFIVAWVLVI  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NFV QI+TFG+F KCYQCP  KA
Sbjct  431  GFGFGGWASMINFVHQIDTFGVFTKCYQCPPRKA  464



>emb|CAN68381.1| hypothetical protein VITISV_018907 [Vitis vinifera]
Length=437

 Score =   351 bits (900),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQ+FKLIYL AT+YVLTLTLPSASAVYWAFGDMLL+HSNA SLLPR+G+RDTAV+LM
Sbjct  225  MWKPQRFKLIYLTATLYVLTLTLPSASAVYWAFGDMLLNHSNAFSLLPRSGYRDTAVILM  284

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+GVH+TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  285  LIHQFITFGFACTPLYFVWEKFVGVHDTKSVCKRALARLPVVIPIWFLAIIFPFFGPINS  344

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHMITF+SP++RENAVE+PPS +GGWAG Y MN FVV W+ +V
Sbjct  345  TVGSLLVSFTVYIIPALAHMITFSSPSSRENAVERPPSFLGGWAGVYSMNAFVVGWILVV  404

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASM+NF++QINTFGLF KCYQCP+
Sbjct  405  GFGFGGWASMLNFIQQINTFGLFTKCYQCPR  435



>ref|XP_002285836.1| PREDICTED: auxin transporter-like protein 3 [Vitis vinifera]
 emb|CBI19062.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQ+FKLIYL AT+YVLTLTLPSASAVYWAFGDMLL+HSNA SLLPR+G+RDTAV+LM
Sbjct  252  MWKPQRFKLIYLTATLYVLTLTLPSASAVYWAFGDMLLNHSNAFSLLPRSGYRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+GVH+TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFVGVHDTKSVCKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHMITF+SP++RENAVE+PPS +GGWAG Y MN FVV W+ +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMITFSSPSSRENAVERPPSFLGGWAGVYSMNAFVVGWILVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASM+NF++QINTFGLF KCYQCP+
Sbjct  432  GFGFGGWASMLNFIQQINTFGLFTKCYQCPR  462



>gb|EYU22931.1| hypothetical protein MIMGU_mgv1a005784mg [Erythranthe guttata]
Length=470

 Score =   352 bits (903),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+ATIYVLTLTLPSASAVYWAFGD+LL+ SNAL+LLPRTGFRD AVVLM
Sbjct  257  MWKPQKFKLIYLIATIYVLTLTLPSASAVYWAFGDLLLNRSNALALLPRTGFRDAAVVLM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+GVH TKSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFACTPLYFVWEKFLGVHETKSLLKRALTRLPVVIPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPAMAHMITFAS +ARENAVE+ P  +GGW G Y MNIFVV WVFIV
Sbjct  377  TVGSLLVSFTVYIIPAMAHMITFASASARENAVERAPKIVGGWVGLYSMNIFVVVWVFIV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFV QI+TFG+F KCYQCPKHK
Sbjct  437  GFGFGGWASMVNFVHQIDTFGVFTKCYQCPKHK  469



>ref|XP_007222959.1| hypothetical protein PRUPE_ppa005323mg [Prunus persica]
 gb|EMJ24158.1| hypothetical protein PRUPE_ppa005323mg [Prunus persica]
Length=467

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNAL+LLPRTGFRDTAVVLM
Sbjct  254  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDNLLTHSNALALLPRTGFRDTAVVLM  313

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI +H TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  314  LIHQFITFGFACTPLYFVWEKFIQMHETKSMLKRALARLPVVIPIWFLAIIFPFFGPINS  373

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PPS +GGWAG Y +N FVV WV IV
Sbjct  374  TVGSLLVSFTVYIIPALAHMVTFASASARENAVERPPSLLGGWAGSYAINSFVVVWVLIV  433

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQ++TFGLF KCYQCP HKA
Sbjct  434  GFGFGGWASMLNFIRQVDTFGLFTKCYQCPPHKA  467



>ref|XP_010063356.1| PREDICTED: auxin transporter-like protein 3 [Eucalyptus grandis]
Length=465

 Score =   351 bits (901),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD+LL H+NALSLLPRT FRD AV+LM
Sbjct  252  MWKPQKFKLIYLIATLYVLTLTLPSASAVYWAFGDLLLTHANALSLLPRTRFRDAAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK + VHNTKS+FKRA+ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKLLRVHNTKSMFKRAMARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPAMAHM+TF+SP+ARENAV++PPS +GGWAG + +N+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPAMAHMVTFSSPSARENAVDRPPSFLGGWAGSFSLNMFVVGWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQINTFGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQINTFGLFTKCYQCPPHKA  465



>ref|XP_008233901.1| PREDICTED: auxin transporter-like protein 3 [Prunus mume]
Length=464

 Score =   351 bits (901),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNAL+LLPRTGFRDTAVVLM
Sbjct  251  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDNLLTHSNALALLPRTGFRDTAVVLM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI +H TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYFVWEKFIQMHETKSMLKRALARLPVVIPIWFLAIIFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PPS +GGWAG Y +N FVV WV IV
Sbjct  371  TVGSLLVSFTVYIIPALAHMVTFASASARENAVERPPSLLGGWAGSYAINSFVVVWVLIV  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQ++TFGLF KCYQCP HKA
Sbjct  431  GFGFGGWASMLNFIRQVDTFGLFTKCYQCPPHKA  464



>ref|XP_006434137.1| hypothetical protein CICLE_v10001072mg [Citrus clementina]
 gb|ESR47377.1| hypothetical protein CICLE_v10001072mg [Citrus clementina]
Length=465

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSASAVYWAFGDMLL HSNA SLLPRTGFRDTAV+LM
Sbjct  252  MWKPQKFKSIYLLATLYVLTLTLPSASAVYWAFGDMLLTHSNAFSLLPRTGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVHNTKS FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGVHNTKSTFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHMITFA  AARENAVE+PP  +GGWAG Y +NIFVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMITFAPAAARENAVERPPKCLGGWAGLYSLNIFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF++Q++ FGLF KCYQCP HK
Sbjct  432  GFGFGGWASMLNFIQQVDAFGLFTKCYQCPPHK  464



>ref|NP_001234682.1| LAX3 protein [Solanum lycopersicum]
 gb|AEI69670.1| LAX3 protein [Solanum lycopersicum]
Length=468

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNAL+LLP+T FRD+AV+LM
Sbjct  255  MWKPQKFKTIYLIATIYVLTLTLPSASAVYWAFGDALLTHSNALALLPKTKFRDSAVILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH TKSLFKRA+ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKFIRVHETKSLFKRAMARLPVVIPIWFLAIIFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            +VGSLLVSFTVYIIPA+AHM+TFASP+ARENAVEQPPS +G W G YC NIFVVAWVFIV
Sbjct  375  SVGSLLVSFTVYIIPALAHMLTFASPSARENAVEQPPSFLGRWVGLYCTNIFVVAWVFIV  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASMVNFV QINTFGLF KCYQCP HKA
Sbjct  435  GFGFGGWASMVNFVHQINTFGLFTKCYQCPPHKA  468



>ref|XP_010521237.1| PREDICTED: auxin transporter-like protein 3 [Tarenaya hassleriana]
Length=469

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGD+LL HSNALSLLPRTGFRDTAV+LM
Sbjct  257  MWKPQKFKMIYLLATVYVLTLTLPSASAVYWAFGDLLLTHSNALSLLPRTGFRDTAVILM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H TKS+FKRAL+RLPVV+PIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFACTPLYFVWEKLIGIHETKSMFKRALSRLPVVVPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPAMAHMITFA   ARENAVE+PP  +GGW G YC+N FVV WVF+V
Sbjct  377  TVGSLLVSFTVYIIPAMAHMITFAPSPARENAVEKPPKVVGGWVGTYCLNAFVVVWVFVV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWAS+VNFVRQI+TFGLF KCYQCP+
Sbjct  437  GFGFGGWASIVNFVRQIDTFGLFTKCYQCPR  467



>emb|CCF23026.1| auxin influx carrier protein [Mangifera indica]
 gb|AFG18186.1| auxin influx carrier component [Mangifera indica]
Length=465

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGDMLL H+NA SLLPRTGFRD+AV+LM
Sbjct  252  MWKPQKFKVIYLMATLYVLTLTLPSASAVYWAFGDMLLTHANAFSLLPRTGFRDSAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG HNTKS+FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKLIGAHNTKSIFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFA  AARENAVE+PP  +GGWAG Y MN FVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAHMVTFAPAAARENAVERPPKCLGGWAGLYSMNSFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF++Q++TFGLF KCYQCP HK 
Sbjct  432  GFGFGGWASMLNFIQQVDTFGLFTKCYQCPPHKG  465



>gb|KDO80738.1| hypothetical protein CISIN_1g012371mg [Citrus sinensis]
Length=465

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSASAVYWAFGDMLL HSNA SLLPRTGFRDTAV+LM
Sbjct  252  MWKPQKFKSIYLLATLYVLTLTLPSASAVYWAFGDMLLTHSNAFSLLPRTGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVHNTKS FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGVHNTKSTFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHMITFA  AARENAVE+PP  +GGWAG Y +NIFVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMITFAPAAARENAVERPPKCLGGWAGLYSLNIFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF++Q++ FGLF KCYQCP HK
Sbjct  432  GFGFGGWASMLNFIQQVDKFGLFTKCYQCPPHK  464



>ref|XP_006472728.1| PREDICTED: auxin transporter-like protein 3-like [Citrus sinensis]
Length=465

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSASAVYWAFGDMLL HSNA SLLPRTGFRDTAV+LM
Sbjct  252  MWKPQKFKSIYLLATLYVLTLTLPSASAVYWAFGDMLLTHSNAFSLLPRTGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVHNTKS FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGVHNTKSTFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHMITFA  AARENAVE+PP  +GGWAG Y +NIFVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMITFAPAAARENAVERPPKCLGGWAGLYSLNIFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF++Q++ FGLF KCYQCP HK
Sbjct  432  GFGFGGWASMLNFIQQVDKFGLFTKCYQCPPHK  464



>ref|XP_011027592.1| PREDICTED: auxin transporter-like protein 3 [Populus euphratica]
Length=465

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD+LL HSNALSLLP+ G+RDTAV+LM
Sbjct  252  MWRPQKFKLIYLIATLYVLTLTLPSASAVYWAFGDLLLTHSNALSLLPKNGYRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH+TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIRVHDTKSVLKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHMITF+S +ARENAVE+PP  +GGW G YC+NIFV+ WVF+V
Sbjct  372  TVGSLLVSFTVYIIPSLAHMITFSSASARENAVERPPPFLGGWVGLYCVNIFVMVWVFVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQI++FGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQIDSFGLFTKCYQCPPHKA  465



>ref|XP_006366935.1| PREDICTED: auxin transporter-like protein 3-like [Solanum tuberosum]
Length=468

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNAL+LLP+T FRD+AV+LM
Sbjct  255  MWKPQKFKTIYLIATIYVLTLTLPSASAVYWAFGDALLTHSNALALLPKTKFRDSAVILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH TKSLFKRA+ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKFIRVHETKSLFKRAMARLPVVIPIWFLAIVFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            +VGSLLVSFTVYIIPA+AHM+TFASP+ARENAVEQPPS +G W G YC NIFVV WVFIV
Sbjct  375  SVGSLLVSFTVYIIPALAHMLTFASPSARENAVEQPPSFLGRWVGLYCTNIFVVVWVFIV  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASMVNFV QINTFGLF KCYQCP HKA
Sbjct  435  GFGFGGWASMVNFVHQINTFGLFTKCYQCPPHKA  468



>emb|CAJ84440.1| auxin influx carrier [Lupinus albus]
Length=465

 Score =   349 bits (896),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGDMLL HSNALSLLPRTGFRD AV+LM
Sbjct  252  MWKPQKFKMIYLIATLYVLTLTLPSASAVYWAFGDMLLTHSNALSLLPRTGFRDIAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+GVH TKSL KRAL RLPVV+PIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFVGVHETKSLLKRALVRLPVVVPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFAS  ARENAV++PPS +GGW G Y MN+FVV WV +V
Sbjct  372  AVGSLLVSFTVYIIPALAHMVTFASAPARENAVKRPPSILGGWIGSYSMNVFVVLWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWAS++NF+ QINTFGLFAKCYQCP HKA
Sbjct  432  GFGLGGWASILNFIHQINTFGLFAKCYQCPTHKA  465



>gb|KCW70571.1| hypothetical protein EUGRSUZ_F03758 [Eucalyptus grandis]
Length=529

 Score =   351 bits (901),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD+LL H+NALSLLPRT FRD AV+LM
Sbjct  316  MWKPQKFKLIYLIATLYVLTLTLPSASAVYWAFGDLLLTHANALSLLPRTRFRDAAVILM  375

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK + VHNTKS+FKRA+ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  376  LIHQFITFGFACTPLYFVWEKLLRVHNTKSMFKRAMARLPVVIPIWFLAIIFPFFGPINS  435

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPAMAHM+TF+SP+ARENAV++PPS +GGWAG + +N+FVV WV +V
Sbjct  436  TVGSLLVSFTVYIIPAMAHMVTFSSPSARENAVDRPPSFLGGWAGSFSLNMFVVGWVLVV  495

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQINTFGLF KCYQCP HKA
Sbjct  496  GFGFGGWASMLNFIRQINTFGLFTKCYQCPPHKA  529



>ref|XP_002302253.1| amino acid permease family protein [Populus trichocarpa]
 gb|EEE81526.1| amino acid permease family protein [Populus trichocarpa]
Length=465

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD+LL HSNALSLLP+ G+RDTA++LM
Sbjct  252  MWKPQKFKLIYLIATLYVLTLTLPSASAVYWAFGDLLLTHSNALSLLPKNGYRDTAIILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH+TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIRVHDTKSVLKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHMITF+S +ARENAVE+PP  +GGW G YC+NIFV+ WVFIV
Sbjct  372  TVGSLLVSFTVYIIPSLAHMITFSSASARENAVERPPPFLGGWVGLYCVNIFVMVWVFIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQI++FGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQIDSFGLFTKCYQCPPHKA  465



>ref|XP_010091352.1| hypothetical protein L484_020154 [Morus notabilis]
 gb|EXB44342.1| hypothetical protein L484_020154 [Morus notabilis]
Length=482

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYLVAT+YVLTLTLPSASAVYWAFGD+LL HSNAL+LLPRT FRDTAVVLM
Sbjct  269  MWKPQKFKSIYLVATLYVLTLTLPSASAVYWAFGDLLLTHSNALALLPRTHFRDTAVVLM  328

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  329  LIHQFITFGFACTPLYFVWEKFISVHETKSVLKRALARLPVVIPIWFLAIIFPFFGPINS  388

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS AARENAVE+PPS +GGW G Y +NIFVVAWVFIV
Sbjct  389  TVGSLLVSFTVYIIPALAHMVTFASAAARENAVERPPSFLGGWTGSYSVNIFVVAWVFIV  448

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NFV+QI+TFGLF KCYQCP HKA
Sbjct  449  GFGFGGWASMLNFVQQIDTFGLFTKCYQCPPHKA  482



>ref|XP_008465793.1| PREDICTED: auxin transporter-like protein 3 [Cucumis melo]
Length=466

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNA +LLPR GFRDTAV+LM
Sbjct  253  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDDLLTHSNAFALLPRNGFRDTAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH TKSL KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKFIGVHETKSLIKRALARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFASP+ARENAVE+ PS +GGWAG Y +NIFVV WV +V
Sbjct  373  TVGSLLVSFTVYIIPALAHMVTFASPSARENAVERAPSLLGGWAGLYSVNIFVVGWVLVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF+ Q++TFGLF KCYQCP HK
Sbjct  433  GFGFGGWASMLNFIHQVDTFGLFTKCYQCPPHK  465



>ref|XP_008781479.1| PREDICTED: auxin transporter-like protein 3 [Phoenix dactylifera]
Length=463

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 200/213 (94%), Gaps = 1/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYLVAT+YVLTLTLPSA+++YWAFGDMLLDHSNA SLLPR+GFRD+AV+LM
Sbjct  251  MWKPQKFKLIYLVATLYVLTLTLPSAASMYWAFGDMLLDHSNAFSLLPRSGFRDSAVILM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H TKS+FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYFVWEKLIGIHETKSMFKRALARLPVVIPIWFLAIIFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPAMAHMITFA  +ARENAVE+PPS +GGWAG Y +N FVV WV +V
Sbjct  371  TVGSLLVSFTVYIIPAMAHMITFAPASARENAVERPPSLLGGWAGLYSLNCFVVVWVLVV  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
            GFGFGGWASM+NF++Q++TFGLF KCYQC PKH
Sbjct  431  GFGFGGWASMLNFIQQVDTFGLFTKCYQCPPKH  463



>ref|XP_002306615.1| amino acid permease family protein [Populus trichocarpa]
 gb|ABK95732.1| unknown [Populus trichocarpa]
 gb|EEE93611.1| amino acid permease family protein [Populus trichocarpa]
Length=464

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 201/214 (94%), Gaps = 1/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD+LL HSNALSLLPR G+RDTAVVLM
Sbjct  252  MWKPQKFKLIYLIATLYVLTLTLPSASAVYWAFGDLLLTHSNALSLLPRNGYRDTAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIG+H TKS+FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIGIHYTKSVFKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIP++AHM+TF+S +ARENAVE+PP  +GGW G YC+N FVV WVF+V
Sbjct  372  AVGSLLVSFTVYIIPSLAHMVTFSSASARENAVERPPPFLGGWVGSYCVNFFVVVWVFVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQI++FGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQIDSFGLFTKCYQCP-HKA  464



>ref|XP_003601086.1| Auxin influx carrier [Medicago truncatula]
 sp|Q9FEL6.1|LAX3_MEDTR RecName: Full=Auxin transporter-like protein 3; AltName: Full=AUX1-like 
protein 3; AltName: Full=MtLAX3 [Medicago truncatula]
 emb|CAC12997.1| putative AUX1-like permease [Medicago truncatula]
 gb|AAM55303.1| auxin influx carrier protein [Medicago truncatula]
 gb|AES71337.1| auxin influx transporter [Medicago truncatula]
 gb|AFK49590.1| unknown [Medicago truncatula]
Length=465

 Score =   347 bits (891),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YV+TLTLPSA+AVYWAFGD LL HSNALSLLPRTGFRDTAV+LM
Sbjct  252  MWKPQKFKMIYLIATLYVMTLTLPSAAAVYWAFGDNLLTHSNALSLLPRTGFRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+GVH TKSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFLGVHETKSLLKRALVRLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS  ARENAVE+PPS +GGW G Y +N+FV  WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMVTFASAPARENAVERPPSFLGGWVGLYSVNVFVAVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASM+NFV QI TFGLFAKC+QCP HKA
Sbjct  432  GFGLGGWASMLNFVHQIKTFGLFAKCFQCPPHKA  465



>ref|XP_010930892.1| PREDICTED: auxin transporter-like protein 3 [Elaeis guineensis]
Length=463

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSA+++YWAFGDMLLDHSNA SLLPR+GFRDTAV+LM
Sbjct  251  MWKPQKFKLIYLMATLYVLTLTLPSAASMYWAFGDMLLDHSNAFSLLPRSGFRDTAVILM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H TKS+FKRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYFVWEKLIGIHETKSMFKRALARLPVVIPIWFLAIIFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPAMAHMITFA  AARENAVE+PPS +GGWAG Y +N FVV WV +V
Sbjct  371  TVGSLLVSFTVYIIPAMAHMITFAPAAARENAVERPPSFLGGWAGLYSVNCFVVVWVLVV  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NF++Q++TFGLF KCYQCP
Sbjct  431  GFGFGGWASMLNFIQQVDTFGLFTKCYQCP  460



>gb|AIS71914.1| LAX3 protein [Nicotiana tabacum]
Length=468

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+  +RD AV+LM
Sbjct  255  MWKPQKFKYIYLIATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKNAWRDAAVILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH+TKSLFKRA+ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKFIRVHDTKSLFKRAMARLPVVIPIWFLAIVFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFASP+ARENAVEQPPS +G W G YC NIFVVAWVFIV
Sbjct  375  TVGSLLVSFTVYIIPALAHMVTFASPSARENAVEQPPSFLGRWVGLYCTNIFVVAWVFIV  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASMVNFV QINTFGLF KCYQCP HKA
Sbjct  435  GFGFGGWASMVNFVHQINTFGLFTKCYQCPPHKA  468



>gb|ABK94652.1| unknown [Populus trichocarpa]
Length=465

 Score =   346 bits (888),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD+LL HSNALSLLP+ G+RDTA +LM
Sbjct  252  MWKPQKFKLIYLIATLYVLTLTLPSASAVYWAFGDLLLTHSNALSLLPKNGYRDTAKILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH+TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIRVHDTKSVLKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHMITF+S +ARENAVE+PP  +GGW G YC+NIFV+ WVFIV
Sbjct  372  TVGSLLVSFTVYIIPSLAHMITFSSASARENAVERPPPFLGGWVGLYCVNIFVMVWVFIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQI++FGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQIDSFGLFTKCYQCPPHKA  465



>ref|XP_009341668.1| PREDICTED: auxin transporter-like protein 3 [Pyrus x bretschneideri]
Length=465

 Score =   346 bits (888),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNAL++LP+T FRDTAVVLM
Sbjct  252  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDNLLTHSNALAMLPKTRFRDTAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI +H TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIQMHETKSMVKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PPS +GGWAG Y MNIFVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAHMVTFASASARENAVEKPPSFLGGWAGSYTMNIFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+ Q+NTFGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFINQVNTFGLFTKCYQCPPHKA  465



>ref|XP_009366978.1| PREDICTED: auxin transporter-like protein 3 [Pyrus x bretschneideri]
Length=466

 Score =   346 bits (888),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNAL++LP+T FRDTAVVLM
Sbjct  253  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDNLLTHSNALAMLPKTRFRDTAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI +H TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKFIQMHETKSMVKRALARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PPS +GGWAG Y MNIFVV WV IV
Sbjct  373  TVGSLLVSFTVYIIPALAHMVTFASASARENAVEKPPSFLGGWAGSYTMNIFVVVWVLIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+ Q+NTFGLF KCYQCP HKA
Sbjct  433  GFGFGGWASMLNFINQVNTFGLFTKCYQCPPHKA  466



>ref|XP_004140386.1| PREDICTED: auxin transporter-like protein 3-like [Cucumis sativus]
 gb|KGN50963.1| hypothetical protein Csa_5G374730 [Cucumis sativus]
Length=466

 Score =   346 bits (888),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNA +LLPR GFRDTAV+LM
Sbjct  253  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDDLLTHSNAFALLPRNGFRDTAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH T SL KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKFIGVHETNSLIKRALARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFASP+ARENAVE+ PS +GGWAG Y +NIFVV WV +V
Sbjct  373  TVGSLLVSFTVYIIPALAHMVTFASPSARENAVERAPSLLGGWAGLYSVNIFVVGWVLVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF+ Q++TFGLF KCYQCP HK
Sbjct  433  GFGFGGWASMLNFIHQVDTFGLFTKCYQCPPHK  465



>ref|XP_010534639.1| PREDICTED: auxin transporter-like protein 3 [Tarenaya hassleriana]
Length=471

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFKLIYL+ATIYV TLTLPSASAVYWAFGD+LL HSNALSLLPRTGFRDTAV+LM
Sbjct  258  MWKPKKFKLIYLLATIYVWTLTLPSASAVYWAFGDLLLTHSNALSLLPRTGFRDTAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+GVH TKSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKFLGVHETKSLLKRAFARLPVVIPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPAMAHMITFA  +ARENAVE+PP  +GGW G YCMN+FVV WVF+V
Sbjct  378  AVGSLLVSFTVYIIPAMAHMITFAPASARENAVERPPKKVGGWIGAYCMNVFVVVWVFVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWAS++NFVRQI+TFG+F KCYQCP  K
Sbjct  438  GFGFGGWASLLNFVRQIDTFGVFTKCYQCPPPK  470



>ref|XP_004290835.1| PREDICTED: auxin transporter-like protein 3-like [Fragaria vesca 
subsp. vesca]
Length=466

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK+IYL+AT+YVLTLTLPSASAVYWAFGD LL HSNAL+LLPRT FRDTAVVLM
Sbjct  253  MWKPQKFKMIYLMATLYVLTLTLPSASAVYWAFGDALLTHSNALALLPRTRFRDTAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKF+ +H TKS+ KRA+ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKFLRIHETKSMLKRAIARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFASP ARENAVE+PPS +GGW G Y MNIFVV WV IV
Sbjct  373  TVGSLLVSFTVYIIPALAHMVTFASPQARENAVERPPSFLGGWPGSYTMNIFVVVWVAIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+ Q++TFGLF KCYQCP HKA
Sbjct  433  GFGFGGWASMLNFIHQVDTFGLFTKCYQCPPHKA  466



>ref|XP_010272856.1| PREDICTED: auxin transporter-like protein 3 [Nelumbo nucifera]
Length=464

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKL+YL+AT+YVLTLTLPSA +VYWAFGDMLL+HSNA SLLP++GFRD AV+LM
Sbjct  251  MWKPQKFKLLYLIATLYVLTLTLPSAISVYWAFGDMLLNHSNAFSLLPKSGFRDIAVILM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+FKRAL+RLPVVIPIWFLAIIFPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYFVWEKLIGMHSTKSIFKRALSRLPVVIPIWFLAIIFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHMITFA  +ARENAVE+PPS +GGWAG YC+NIFVV WV ++
Sbjct  371  TVGSLLVSFTVYIIPSLAHMITFAPASARENAVERPPSFLGGWAGLYCLNIFVVVWVLVI  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+ Q++TFGLF KCYQCP  KA
Sbjct  431  GFGFGGWASMINFIHQVDTFGLFTKCYQCPSRKA  464



>ref|XP_004173513.1| PREDICTED: LOW QUALITY PROTEIN: auxin transporter-like protein 
3-like [Cucumis sativus]
Length=466

 Score =   344 bits (883),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYW FGD LL HSNA +LLPR GFRDTAV+LM
Sbjct  253  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWXFGDDLLTHSNAFALLPRNGFRDTAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFIGVH T SL KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKFIGVHETNSLIKRALARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFASP+ARENAVE+ PS +GGWAG Y +NIFVV WV +V
Sbjct  373  TVGSLLVSFTVYIIPALAHMVTFASPSARENAVERAPSLLGGWAGLYSVNIFVVGWVLVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF+ Q++TFGLF KCYQCP HK
Sbjct  433  GFGFGGWASMLNFIHQVDTFGLFTKCYQCPPHK  465



>gb|KDP32765.1| hypothetical protein JCGZ_12057 [Jatropha curcas]
Length=465

 Score =   344 bits (883),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD+LL H+NALSLLPR G+RD AV+LM
Sbjct  252  MWKPQKFKLIYLLATLYVLTLTLPSASAVYWAFGDLLLTHANALSLLPRNGYRDAAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH TKSLFKRALARLPVV+PIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIRVHETKSLFKRALARLPVVVPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ITF++ +ARENAVE+PPS +GGW G +C+N+FVV WVFIV
Sbjct  372  TVGSLLVSFTVYIIPALAHIITFSTASARENAVERPPSFLGGWVGLFCVNLFVVVWVFIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWAS++NF+ QI++FGLF KCYQCP HKA
Sbjct  432  GFGFGGWASLLNFIHQIDSFGLFTKCYQCPPHKA  465



>ref|XP_008338785.1| PREDICTED: auxin transporter-like protein 3 [Malus domestica]
Length=466

 Score =   343 bits (881),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNAL++LP+T FRDTAVVLM
Sbjct  253  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDNLLTHSNALAMLPKTRFRDTAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK I +H TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKXIQMHETKSMVKRALARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PPS +GGWAG Y MNIFVV WV IV
Sbjct  373  TVGSLLVSFTVYIIPALAHMVTFASASARENAVEKPPSFLGGWAGSYTMNIFVVVWVLIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+ Q+NTFGLF KCYQCP HKA
Sbjct  433  GFGFGGWASMLNFINQVNTFGLFTKCYQCPPHKA  466



>ref|NP_177892.1| auxin influx carrier LAX3 [Arabidopsis thaliana]
 sp|Q9CA25.1|LAX3_ARATH RecName: Full=Auxin transporter-like protein 3; AltName: Full=AUX1-like 
protein 3 [Arabidopsis thaliana]
 gb|AAG51630.1|AC012193_12 putative AUX1-like permease; 10674-8589 [Arabidopsis thaliana]
 gb|AAL06925.1| At1g77690/T32E8_2 [Arabidopsis thaliana]
 gb|AAN02284.1| putative AUX1-like permease [Arabidopsis thaliana]
 gb|AAP37659.1| At1g77690/T32E8_2 [Arabidopsis thaliana]
 gb|AEE36010.1| auxin influx carrier LAX3 [Arabidopsis thaliana]
Length=470

 Score =   343 bits (881),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP+TGFRDTAV+LM
Sbjct  257  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDKLLTHSNALSLLPKTGFRDTAVILM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  377  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVVGGWMGTYCINIFVVVWVFVV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP HK
Sbjct  437  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPHK  469



>emb|CDX79229.1| BnaC06g20740D [Brassica napus]
Length=471

 Score =   343 bits (881),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  258  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  378  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVVGGWMGTYCINIFVVVWVFVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQINTFGLF KCYQCP HK
Sbjct  438  GFGFGGWASMVNFVRQINTFGLFTKCYQCPPHK  470



>ref|XP_008378489.1| PREDICTED: auxin transporter-like protein 3 [Malus domestica]
Length=466

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGD LL HSNAL++LP+T FRDTAVVLM
Sbjct  253  MWKPQKFKLIYLMATLYVLTLTLPSASAVYWAFGDNLLTHSNALAMLPKTRFRDTAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI +H TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKFIQMHETKSMVKRALARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TFAS +ARENAVE+PPS +GGWAG Y MNIFVVAWV IV
Sbjct  373  TVGSLLVSFTVYIIPALAHMVTFASASARENAVEKPPSFLGGWAGSYTMNIFVVAWVLIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+ Q+NTFGLF KCYQCP  KA
Sbjct  433  GFGFGGWASMLNFINQVNTFGLFTKCYQCPPRKA  466



>ref|XP_006390066.1| hypothetical protein EUTSA_v10018493mg [Eutrema salsugineum]
 gb|ESQ27352.1| hypothetical protein EUTSA_v10018493mg [Eutrema salsugineum]
Length=469

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  256  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  316  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  376  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVVGGWMGTYCINIFVVVWVFVV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP HK
Sbjct  436  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPHK  468



>ref|XP_006300460.1| hypothetical protein CARUB_v10020229mg [Capsella rubella]
 gb|EOA33358.1| hypothetical protein CARUB_v10020229mg [Capsella rubella]
Length=470

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  257  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  377  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVVGGWMGTYCINIFVVVWVFVV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP HK
Sbjct  437  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPHK  469



>ref|XP_010428852.1| PREDICTED: auxin transporter-like protein 3 [Camelina sativa]
Length=470

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  257  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  377  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRMVGGWMGTYCINIFVVVWVFVV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP HK
Sbjct  437  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPHK  469



>ref|XP_010471965.1| PREDICTED: auxin transporter-like protein 3 [Camelina sativa]
Length=470

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  257  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  377  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRMVGGWMGTYCINIFVVVWVFVV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP HK
Sbjct  437  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPHK  469



>ref|XP_011012812.1| PREDICTED: auxin transporter-like protein 3 [Populus euphratica]
Length=465

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFKLIYL+AT+YVLT TLPSASA YWAFG +LL HSNALSLLP+ G+RDTAV+LM
Sbjct  252  MWRPQKFKLIYLIATLYVLTSTLPSASAGYWAFGGLLLTHSNALSLLPKNGYRDTAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEKFI VH+TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKFIRVHDTKSVLKRALARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHMITF+S +ARENAVE+PP  +GGW G YC+NIFV+ WVF+V
Sbjct  372  TVGSLLVSFTVYIIPSLAHMITFSSASARENAVERPPPFLGGWVGLYCVNIFVMVWVFVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM+NF+RQI++FGLF KCYQCP HKA
Sbjct  432  GFGFGGWASMLNFIRQIDSFGLFTKCYQCPPHKA  465



>ref|XP_010416725.1| PREDICTED: auxin transporter-like protein 3 isoform X1 [Camelina 
sativa]
 ref|XP_010416726.1| PREDICTED: auxin transporter-like protein 3 isoform X2 [Camelina 
sativa]
Length=470

 Score =   342 bits (876),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  257  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  377  AVGSLLVSFTVYIIPAVAHMLTFAPAPSRENAVERPPRMVGGWIGTYCINIFVVVWVFVV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP HK
Sbjct  437  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPHK  469



>dbj|BAI94502.1| auxin influx carrier protein [Dianthus caryophyllus]
Length=466

 Score =   341 bits (875),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRT FRD AV+LM
Sbjct  252  MWKPQKFKLIYLIATVYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTPFRDVAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IGVH TKS+ KR++AR+PVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKLIGVHETKSVIKRSIARIPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVY+IP++AHM+TFAS ++RE+AVE+PPS +GGWAG Y MN+FVV WV +V
Sbjct  372  AVGALLVSFTVYVIPSLAHMLTFASSSSREHAVERPPSFIGGWAGMYGMNVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFG GGWASM NFV QINTFGLFAKCYQCPK  A
Sbjct  432  GFGLGGWASMRNFVLQINTFGLFAKCYQCPKKPA  465



>gb|KFK42165.1| hypothetical protein AALP_AA2G219600 [Arabis alpina]
Length=473

 Score =   341 bits (875),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSL+P+TGFRDTAV+LM
Sbjct  260  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLMPKTGFRDTAVILM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  320  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVFIV
Sbjct  380  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVVGGWIGTYCINIFVVVWVFIV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP HK
Sbjct  440  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPHK  472



>emb|CDX68048.1| BnaA07g20880D [Brassica napus]
Length=471

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  258  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPIN 
Sbjct  318  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINL  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  378  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVVGGWMGTYCINIFVVVWVFVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQINTFGLF KCYQCP HK
Sbjct  438  GFGFGGWASMVNFVRQINTFGLFTKCYQCPPHK  470



>ref|XP_009104609.1| PREDICTED: auxin transporter-like protein 3 [Brassica rapa]
Length=471

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  258  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW   YC+NIFVV WVF+V
Sbjct  378  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVVGGWMETYCINIFVVVWVFVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQINTFGLF KCYQCP HK
Sbjct  438  GFGFGGWASMVNFVRQINTFGLFTKCYQCPPHK  470



>ref|XP_009128243.1| PREDICTED: auxin transporter-like protein 3 [Brassica rapa]
 emb|CDY38327.1| BnaA02g18200D [Brassica napus]
Length=472

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  259  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVLPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  379  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVLGGWMGTYCINIFVVVWVFVV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP  K
Sbjct  439  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPRK  471



>emb|CDY44521.1| BnaCnng11320D [Brassica napus]
Length=472

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSA+AVYWAFGD LL HSNALSLLP++GFRDTAV+LM
Sbjct  259  MWKPQKFKAIYLLATIYVLTLTLPSATAVYWAFGDQLLTHSNALSLLPKSGFRDTAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IGVH TKS+FKRA+ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFASTPLYFVWEKLIGVHETKSMFKRAMARLPVVLPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TFA   +RENAVE+PP  +GGW G YC+NIFVV WVF+V
Sbjct  379  AVGSLLVSFTVYIIPALAHMLTFAPAPSRENAVERPPRVLGGWMGTYCINIFVVVWVFVV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASMVNFVRQI+TFGLF KCYQCP  K
Sbjct  439  GFGFGGWASMVNFVRQIDTFGLFTKCYQCPPRK  471



>ref|XP_002450367.1| hypothetical protein SORBIDRAFT_05g004250 [Sorghum bicolor]
 gb|EES09355.1| hypothetical protein SORBIDRAFT_05g004250 [Sorghum bicolor]
Length=487

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 193/213 (91%), Gaps = 1/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYLVAT+YVLTLTLPSASAVYWAFGDMLLDHSNA SLLPR+GFRD AV+LM
Sbjct  275  MWKPQKFKLIYLVATLYVLTLTLPSASAVYWAFGDMLLDHSNAFSLLPRSGFRDAAVILM  334

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IGVH T S+  RA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  335  LIHQFITFGFACTPLYFVWEKLIGVHETGSVALRAAARLPVVVPIWFLAIIFPFFGPINS  394

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TFA PAARENAVE+PP  +GGWAG Y  N FVVAWV +V
Sbjct  395  TVGSLLVSFTVYIIPALAHMATFAPPAARENAVERPPRGVGGWAGMYAANCFVVAWVLVV  454

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
            GFGFGGWAS VNFVRQ++TFGLF +CYQC PKH
Sbjct  455  GFGFGGWASTVNFVRQVDTFGLFTRCYQCPPKH  487



>ref|XP_009406113.1| PREDICTED: auxin transporter-like protein 3 [Musa acuminata subsp. 
malaccensis]
Length=463

 Score =   336 bits (861),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKL+YL AT+YVLTLTLPSA+A+YWAFGDMLLDHSNA SLLPR+GFR+ AVV+M
Sbjct  251  MWKPQKFKLVYLFATLYVLTLTLPSAAAMYWAFGDMLLDHSNAFSLLPRSGFRNAAVVVM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYFVWEKAIGMHKTKSVCKRALARLPVVIPIWFLAIIFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPAMAHM+TFA  +ARENAVE+P S +GGW G YCMN FVV WV +V
Sbjct  371  TVGSLLVSFTVYIIPAMAHMMTFAPASARENAVERPASFLGGWVGHYCMNAFVVVWVLVV  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NFV Q++TFGLF KCYQCP
Sbjct  431  GFGFGGWASMLNFVHQVDTFGLFTKCYQCP  460



>ref|XP_004978789.1| PREDICTED: putative auxin transporter-like protein 4-like isoform 
X2 [Setaria italica]
Length=471

 Score =   331 bits (849),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL AT+YVLTLT+PSASAVYWAFGD LLDHSNA+SLLPR+GFRD AVVLM
Sbjct  259  MWKPQKFKLIYLAATLYVLTLTIPSASAVYWAFGDTLLDHSNAISLLPRSGFRDAAVVLM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK +GVH ++SL  RA ARLP+V+PIWFLAIIFPFFGPINS
Sbjct  319  LVHQFITFGFACTPLYFVWEKLVGVHESRSLALRAAARLPIVLPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM  FA  AARENAVE+PP  +GGWAG Y  N FVVAWV +V
Sbjct  379  TVGSLLVSFTVYIIPALAHMAVFAPAAARENAVERPPRGVGGWAGMYAANCFVVAWVLVV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
            GFGFGGWAS VNFVRQI+TFGLF KCYQC PKH
Sbjct  439  GFGFGGWASTVNFVRQIDTFGLFTKCYQCPPKH  471



>ref|XP_004978791.1| PREDICTED: putative auxin transporter-like protein 4-like isoform 
X4 [Setaria italica]
Length=458

 Score =   331 bits (848),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL AT+YVLTLT+PSASAVYWAFGD LLDHSNA+SLLPR+GFRD AVVLM
Sbjct  246  MWKPQKFKLIYLAATLYVLTLTIPSASAVYWAFGDTLLDHSNAISLLPRSGFRDAAVVLM  305

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK +GVH ++SL  RA ARLP+V+PIWFLAIIFPFFGPINS
Sbjct  306  LVHQFITFGFACTPLYFVWEKLVGVHESRSLALRAAARLPIVLPIWFLAIIFPFFGPINS  365

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM  FA  AARENAVE+PP  +GGWAG Y  N FVVAWV +V
Sbjct  366  TVGSLLVSFTVYIIPALAHMAVFAPAAARENAVERPPRGVGGWAGMYAANCFVVAWVLVV  425

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
            GFGFGGWAS VNFVRQI+TFGLF KCYQC PKH
Sbjct  426  GFGFGGWASTVNFVRQIDTFGLFTKCYQCPPKH  458



>ref|XP_004978792.1| PREDICTED: putative auxin transporter-like protein 4-like isoform 
X5 [Setaria italica]
Length=457

 Score =   331 bits (848),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL AT+YVLTLT+PSASAVYWAFGD LLDHSNA+SLLPR+GFRD AVVLM
Sbjct  245  MWKPQKFKLIYLAATLYVLTLTIPSASAVYWAFGDTLLDHSNAISLLPRSGFRDAAVVLM  304

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK +GVH ++SL  RA ARLP+V+PIWFLAIIFPFFGPINS
Sbjct  305  LVHQFITFGFACTPLYFVWEKLVGVHESRSLALRAAARLPIVLPIWFLAIIFPFFGPINS  364

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM  FA  AARENAVE+PP  +GGWAG Y  N FVVAWV +V
Sbjct  365  TVGSLLVSFTVYIIPALAHMAVFAPAAARENAVERPPRGVGGWAGMYAANCFVVAWVLVV  424

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
            GFGFGGWAS VNFVRQI+TFGLF KCYQC PKH
Sbjct  425  GFGFGGWASTVNFVRQIDTFGLFTKCYQCPPKH  457



>gb|AFW65371.1| hypothetical protein ZEAMMB73_861395 [Zea mays]
Length=397

 Score =   328 bits (842),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP KFKLIYLVAT+YVLTLTLPSASAVYWAFGDMLLDHSNA +LLPR+GFRD AV+ M
Sbjct  185  MWKPHKFKLIYLVATLYVLTLTLPSASAVYWAFGDMLLDHSNAFALLPRSGFRDAAVIFM  244

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IGVH T S+  RA ARLP+V PIWFLA++FPFFGPINS
Sbjct  245  LIHQFITFGFACTPLYFVWEKLIGVHETGSVALRAAARLPIVAPIWFLAVVFPFFGPINS  304

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF  PAARENAVE+PP  +GGWAG Y  N FVVAWV +V
Sbjct  305  TVGSLLVSFTVYIIPALAHMATFLPPAARENAVERPPRGLGGWAGMYAANFFVVAWVLVV  364

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS VNFVRQ+NTFGLF +CYQCP
Sbjct  365  GFGFGGWASTVNFVRQVNTFGLFTRCYQCP  394



>ref|XP_004978790.1| PREDICTED: putative auxin transporter-like protein 4-like isoform 
X3 [Setaria italica]
Length=470

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL AT+YVLTLT+PSASAVYWAFGD LLDHSNA+SLLPR+GFRD AVVLM
Sbjct  258  MWKPQKFKLIYLAATLYVLTLTIPSASAVYWAFGDTLLDHSNAISLLPRSGFRDAAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK +GVH ++SL  RA ARLP+V+PIWFLAIIFPFFGPINS
Sbjct  318  LVHQFITFGFACTPLYFVWEKLVGVHESRSLALRAAARLPIVLPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM  FA  AARENAVE+PP  +GGWAG Y  N FVVAWV +V
Sbjct  378  TVGSLLVSFTVYIIPALAHMAVFAPAAARENAVERPPRGVGGWAGMYAANCFVVAWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
            GFGFGGWAS VNFVRQI+TFGLF KCYQC PKH
Sbjct  438  GFGFGGWASTVNFVRQIDTFGLFTKCYQCPPKH  470



>ref|XP_004978788.1| PREDICTED: putative auxin transporter-like protein 4-like isoform 
X1 [Setaria italica]
Length=482

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL AT+YVLTLT+PSASAVYWAFGD LLDHSNA+SLLPR+GFRD AVVLM
Sbjct  270  MWKPQKFKLIYLAATLYVLTLTIPSASAVYWAFGDTLLDHSNAISLLPRSGFRDAAVVLM  329

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK +GVH ++SL  RA ARLP+V+PIWFLAIIFPFFGPINS
Sbjct  330  LVHQFITFGFACTPLYFVWEKLVGVHESRSLALRAAARLPIVLPIWFLAIIFPFFGPINS  389

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM  FA  AARENAVE+PP  +GGWAG Y  N FVVAWV +V
Sbjct  390  TVGSLLVSFTVYIIPALAHMAVFAPAAARENAVERPPRGVGGWAGMYAANCFVVAWVLVV  449

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
            GFGFGGWAS VNFVRQI+TFGLF KCYQC PKH
Sbjct  450  GFGFGGWASTVNFVRQIDTFGLFTKCYQCPPKH  482



>ref|XP_008679620.1| PREDICTED: auxin transporter-like protein 3 [Zea mays]
 gb|AFW65370.1| hypothetical protein ZEAMMB73_861395 [Zea mays]
Length=485

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP KFKLIYLVAT+YVLTLTLPSASAVYWAFGDMLLDHSNA +LLPR+GFRD AV+ M
Sbjct  273  MWKPHKFKLIYLVATLYVLTLTLPSASAVYWAFGDMLLDHSNAFALLPRSGFRDAAVIFM  332

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IGVH T S+  RA ARLP+V PIWFLA++FPFFGPINS
Sbjct  333  LIHQFITFGFACTPLYFVWEKLIGVHETGSVALRAAARLPIVAPIWFLAVVFPFFGPINS  392

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF  PAARENAVE+PP  +GGWAG Y  N FVVAWV +V
Sbjct  393  TVGSLLVSFTVYIIPALAHMATFLPPAARENAVERPPRGLGGWAGMYAANFFVVAWVLVV  452

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS VNFVRQ+NTFGLF +CYQCP
Sbjct  453  GFGFGGWASTVNFVRQVNTFGLFTRCYQCP  482



>ref|XP_010690397.1| PREDICTED: auxin transporter-like protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGDMLLDHSNA SLLPR+ +RD AV+LM
Sbjct  259  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDMLLDHSNAFSLLPRSPYRDMAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ KS+ KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKAIGLHDCKSMCKRAAARLPVVVPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM TF S AARE+AVEQPP  +G WAG + +NIFVV WV IV
Sbjct  379  AVGSLLVSFTVYIIPALAHMFTFRSAAARESAVEQPPKFVGRWAGSFAINIFVVIWVLIV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWASM+NFV QI+TFGLF KCYQCP  K A
Sbjct  439  GFGFGGWASMINFVHQIDTFGLFTKCYQCPSPKVA  473



>ref|XP_004983392.1| PREDICTED: auxin transporter-like protein 3-like [Setaria italica]
Length=541

 Score =   326 bits (835),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA+A YWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  267  MWRPQKFKSIYLLATVYVLTLTLPSAAAAYWAFGDALLTHSNALALLPRTAFRDAAVVLM  326

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  327  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  386

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TF SP +RENAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  387  AVGSLLVSFTVYIIPALAHMVTFRSPQSRENAVERPPRFAGGWTGAYVINSFVVAWVLVV  446

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKH  636
            GFGFGGWAS+ NFV+Q+NTFGLFAKCYQCP H
Sbjct  447  GFGFGGWASITNFVQQVNTFGLFAKCYQCPPH  478



>ref|XP_007137359.1| hypothetical protein PHAVU_009G120700g [Phaseolus vulgaris]
 gb|ESW09353.1| hypothetical protein PHAVU_009G120700g [Phaseolus vulgaris]
Length=481

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+A++YVLTLTLPSA+AVYWAFGDMLLDHSNA SLLPR+ FRD AV+LM
Sbjct  252  MWKPKKFKSIYLLASLYVLTLTLPSAAAVYWAFGDMLLDHSNAFSLLPRSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLY VWEK IG+H  +SL KRALARLPVVIPIWFLAI+FPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYLVWEKAIGIHECRSLCKRALARLPVVIPIWFLAIVFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF SPAAR+NAVEQPP  +G WAG Y +N+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSPAARQNAVEQPPKLVGRWAGAYTINVFVVVWVVVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASMVNFV QI+TFG F KCYQCP 
Sbjct  432  GFGFGGWASMVNFVHQIDTFGFFTKCYQCPS  462



>ref|XP_002277417.1| PREDICTED: auxin transporter-like protein 2 [Vitis vinifera]
Length=489

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGD LL HSNA +LLPR+ FRD AVVLM
Sbjct  252  MWKPQKFKAIYLLATVYVLTLTLPSAAAVYWAFGDALLSHSNAFALLPRSHFRDMAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G WAG Y +NIFVV WVF+V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPKYLGRWAGAYTINIFVVVWVFVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NFV QI+TFGLF KCYQCP
Sbjct  432  GFGFGGWASMINFVHQIDTFGLFTKCYQCP  461



>ref|XP_006847065.1| hypothetical protein AMTR_s00017p00205360 [Amborella trichopoda]
 gb|ERN08646.1| hypothetical protein AMTR_s00017p00205360 [Amborella trichopoda]
Length=478

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRDTAV+LM
Sbjct  251  MWKPQKFKSIYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDTAVILM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLY VWEK IG+H TKS+ +RALARLPVVIPIWFLAI+FPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYLVWEKAIGMHETKSVLRRALARLPVVIPIWFLAIMFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TF + ++RENAVE+PP  +GGW G Y +N+FVV WVFIV
Sbjct  371  TVGSLLVSFTVYIIPAVAHMLTFRTASSRENAVERPPRFVGGWTGTYSINMFVVGWVFIV  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF+RQ+++FGLF KCYQCP  K
Sbjct  431  GFGFGGWASMLNFIRQVDSFGLFTKCYQCPPPK  463



>ref|XP_010271557.1| PREDICTED: auxin transporter-like protein 2 [Nelumbo nucifera]
Length=494

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA AVYWAFGDMLL+HSNA +LLPR+ FRD AVVLM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSAVAVYWAFGDMLLNHSNAFALLPRSAFRDMAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKVIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TF S AARENAVEQPP+ +G WAG Y +NIFVV WVF+V
Sbjct  372  AVGSLLVSFTVYIIPALAHMLTFRSAAARENAVEQPPNFVGRWAGMYSINIFVVVWVFVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  460



>ref|XP_006577903.1| PREDICTED: auxin transporter-like protein 5-like isoform X2 [Glycine 
max]
Length=462

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV+TLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRD AV+LM
Sbjct  238  MWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILM  297

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLY VWEK IG+H  +SL KRALARLPVVIPIWFLAI+FPFFGPINS
Sbjct  298  LIHQFITFGFASTPLYLVWEKAIGIHECRSLCKRALARLPVVIPIWFLAIVFPFFGPINS  357

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF SPAAR NAVEQPP S+G W G Y MN+FVV WV +V
Sbjct  358  TVGSLLVSFTVYIIPALAHMFTFKSPAARRNAVEQPPRSVGRWVGAYTMNVFVVVWVLVV  417

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASMVNF+ QI+TFG F KCYQCP
Sbjct  418  GFGFGGWASMVNFIHQIDTFGFFTKCYQCP  447



>gb|KHN20003.1| Auxin transporter-like protein 5 [Glycine soja]
Length=437

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV+TLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRD AV+LM
Sbjct  208  MWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILM  267

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLY VWEK IG+H  +SL KRALARLPVVIPIWFLAI+FPFFGPINS
Sbjct  268  LIHQFITFGFACTPLYLVWEKAIGIHECRSLCKRALARLPVVIPIWFLAIVFPFFGPINS  327

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF SP+AR+NAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  328  TVGSLLVSFTVYIIPALAHMFTFKSPSARQNAVEQPPRLVGRWVGAYTINLFVVVWVLVV  387

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASMVNF+ QI+TFG F KCYQCP
Sbjct  388  GFGFGGWASMVNFIHQIDTFGFFTKCYQCP  417



>ref|XP_003523499.1| PREDICTED: auxin transporter-like protein 5-like isoform X1 [Glycine 
max]
Length=476

 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV+TLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLY VWEK IG+H  +SL KRALARLPVVIPIWFLAI+FPFFGPINS
Sbjct  312  LIHQFITFGFASTPLYLVWEKAIGIHECRSLCKRALARLPVVIPIWFLAIVFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF SPAAR NAVEQPP S+G W G Y MN+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMFTFKSPAARRNAVEQPPRSVGRWVGAYTMNVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASMVNF+ QI+TFG F KCYQCP
Sbjct  432  GFGFGGWASMVNFIHQIDTFGFFTKCYQCP  461



>ref|XP_004144920.1| PREDICTED: auxin transporter-like protein 5-like [Cucumis sativus]
Length=407

 Score =   319 bits (818),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYLVAT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLP++  RD AV+LM
Sbjct  169  MWKPQKFKAIYLVATVYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPKSPLRDMAVILM  228

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  229  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  288

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF SPA+RENAVEQPP   G W G Y +N FVV WV +V
Sbjct  289  TVGSLLVSFTVYIIPALAHMFTFRSPASRENAVEQPPKFTGRWVGAYVINAFVVVWVLVV  348

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP    A
Sbjct  349  GFGFGGWASVTNFVHQIDTFGLFTKCYQCPPQTPA  383



>gb|KHN33683.1| Auxin transporter-like protein 5 [Glycine soja]
Length=476

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV+TLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLY VWEK IG+H  +SL KRALARLPVVIPIWFLAI+FPFFGPINS
Sbjct  312  LIHQFITFGFASTPLYLVWEKAIGIHECRSLCKRALARLPVVIPIWFLAIVFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF SPAAR NAVEQPP S+G W G Y MN+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMFTFKSPAARRNAVEQPPRSVGRWVGAYTMNVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASMVNF+ QI+TFG F KCYQCP
Sbjct  432  GFGFGGWASMVNFIHQIDTFGFFTKCYQCP  461



>ref|XP_003573729.1| PREDICTED: auxin transporter-like protein 3 [Brachypodium distachyon]
Length=522

 Score =   323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSASA YWAFGD LL HSNALSLLPR  +RD AVVLM
Sbjct  251  MWRPQKFKAIYLLATLYVLTLTLPSASAAYWAFGDQLLTHSNALSLLPRDAWRDAAVVLM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYFVWEKLIGLHDCKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPAMAHM+TF SP +RENAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  371  AVGSLLVSFTVYIIPAMAHMVTFRSPQSRENAVERPPRFAGGWTGAYVINSFVVAWVLVV  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWAS+ NFV+Q++TFGLFAKCYQCP   AA
Sbjct  431  GFGFGGWASITNFVQQVSTFGLFAKCYQCPPRPAA  465



>ref|NP_001105117.1| auxin import carrier1 [Zea mays]
 emb|CAB65535.1| AUX1 protein [Zea mays]
Length=529

 Score =   323 bits (828),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA+A YWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  268  MWRPQKFKAIYLLATLYVLTLTLPSAAASYWAFGDELLTHSNALALLPRTPFRDAAVVLM  327

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  328  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  387

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TF SP +RENAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  388  AVGSLLVSFTVYIIPALAHMVTFRSPQSRENAVERPPRFAGGWTGAYVINSFVVAWVLVV  447

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKH  636
            GFGFGGWAS+ NFV+Q+NTFGLFAKCYQCP H
Sbjct  448  GFGFGGWASITNFVQQVNTFGLFAKCYQCPPH  479



>ref|XP_004289854.1| PREDICTED: auxin transporter-like protein 2-like [Fragaria vesca 
subsp. vesca]
Length=492

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+ATIYVLTLTLPSASAVYWAFGD+LL+HSNA +LLP++ FRD AV+LM
Sbjct  253  MWKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKSPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHDCKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AH+ T+ S AARENAVE+PP  +GGW G Y +N+FVV WVF+V
Sbjct  373  TVGSLLVSFTVYIIPSLAHIFTYRSAAARENAVERPPRFLGGWIGSYTINVFVVVWVFVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWAS+ NFVRQI+TFGLF KCYQCP   A
Sbjct  433  GFGFGGWASITNFVRQIDTFGLFTKCYQCPPQAA  466



>ref|XP_006662765.1| PREDICTED: putative auxin transporter-like protein 4-like [Oryza 
brachyantha]
Length=477

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 183/214 (86%), Gaps = 2/214 (1%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQ+FK+IYLVAT+YVLTLTLPSASA+YWAFGDMLLDHSNA SLLPRTG+RD AVVLM
Sbjct  264  MWKPQRFKMIYLVATLYVLTLTLPSASAMYWAFGDMLLDHSNAFSLLPRTGWRDAAVVLM  323

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK IGVH+   + +RALARLPVV+PIWFLA+IFPFFGPINS
Sbjct  324  LVHQFITFGFACTPLYFVWEKAIGVHHGAGVLRRALARLPVVLPIWFLAVIFPFFGPINS  383

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvva-wvfi  537
            TVGS LVSFTVYIIPA+AHM TFA  AARENAVE PP ++GGWAG +  N FVVA  + +
Sbjct  384  TVGSFLVSFTVYIIPALAHMATFAPAAARENAVEPPPRALGGWAGTFAANCFVVAWVLVV  443

Query  538  vgfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
                 G   + VNFVRQ++TFGLF KCYQC PKH
Sbjct  444  GFGFGGWGRTPVNFVRQVDTFGLFTKCYQCPPKH  477



>ref|XP_003527602.1| PREDICTED: auxin transporter-like protein 5-like [Glycine max]
Length=481

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV+TLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLY VWEK IG+H  +SL KRALARLPVVIPIWFLAI+FPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYLVWEKAIGIHECRSLCKRALARLPVVIPIWFLAIVFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF SP+AR+NAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHMFTFKSPSARQNAVEQPPRLVGRWVGAYTINLFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASMVNF+ QI+TFG F KCYQCP
Sbjct  432  GFGFGGWASMVNFIHQIDTFGFFTKCYQCP  461



>gb|ACG35887.1| auxin transporter-like protein 3 [Zea mays]
Length=546

 Score =   323 bits (829),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA+A YWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  266  MWRPQKFKAIYLLATLYVLTLTLPSAAASYWAFGDELLTHSNALALLPRTPFRDAAVVLM  325

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  326  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  385

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TF SP +RENAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  386  AVGSLLVSFTVYIIPALAHMVTFRSPQSRENAVERPPRFAGGWTGAYVINSFVVAWVLVV  445

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKH  636
            GFGFGGWAS+ NFV+Q+NTFGLFAKCYQCP H
Sbjct  446  GFGFGGWASITNFVQQVNTFGLFAKCYQCPPH  477



>gb|EMT20447.1| hypothetical protein F775_12101 [Aegilops tauschii]
Length=529

 Score =   322 bits (826),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSASA YWAFGD LL HSNALSLLPR  +RD AV+LM
Sbjct  259  MWRPQKFKAIYLLATLYVLTLTLPSASAAYWAFGDELLTHSNALSLLPRDAWRDAAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPAMAHM+TF SP +RENAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  379  AVGSLLVSFTVYIIPAMAHMVTFRSPHSRENAVERPPRFAGGWTGAYVINSFVVAWVLVV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWAS+ NFV+Q++TFGLFAKCYQCP H A
Sbjct  439  GFGFGGWASITNFVQQVSTFGLFAKCYQCPPHPA  472



>ref|XP_008648314.1| PREDICTED: auxin import carrier1 isoform X1 [Zea mays]
 tpg|DAA46720.1| TPA: AUX1 protein [Zea mays]
Length=570

 Score =   323 bits (829),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA+A YWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  292  MWRPQKFKAIYLLATLYVLTLTLPSAAASYWAFGDELLTHSNALALLPRTPFRDAAVVLM  351

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  352  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  411

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TF SP +RENAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  412  AVGSLLVSFTVYIIPALAHMVTFRSPQSRENAVERPPRFAGGWTGAYVINSFVVAWVLVV  471

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKH  636
            GFGFGGWAS+ NFV+Q+NTFGLFAKCYQCP H
Sbjct  472  GFGFGGWASITNFVQQVNTFGLFAKCYQCPPH  503



>gb|KGN43238.1| hypothetical protein Csa_7G010800 [Cucumis sativus]
Length=493

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYLVAT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLP++  RD AV+LM
Sbjct  255  MWKPQKFKAIYLVATVYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPKSPLRDMAVILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF SPA+RENAVEQPP   G W G Y +N FVV WV +V
Sbjct  375  TVGSLLVSFTVYIIPALAHMFTFRSPASRENAVEQPPKFTGRWVGAYVINAFVVVWVLVV  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP    A
Sbjct  435  GFGFGGWASVTNFVHQIDTFGLFTKCYQCPPQTPA  469



>ref|XP_009400351.1| PREDICTED: auxin transporter-like protein 3 [Musa acuminata subsp. 
malaccensis]
Length=512

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL+HSNA SLLPRT FRD AVVLM
Sbjct  258  MWKPQKFKAIYLLATLYVLTLTLPSAASVYWAFGDALLNHSNAFSLLPRTAFRDAAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKAIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVY+IPA+AHM TF S  ARE+AVE+PP  +GGW G Y MN+FVVAWV +V
Sbjct  378  AVGSLLVSFTVYVIPALAHMFTFRSAVAREHAVERPPRLVGGWIGAYTMNMFVVAWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFG GGWASM NF+RQINTFGLFAKCYQC
Sbjct  438  GFGLGGWASMTNFIRQINTFGLFAKCYQC  466



>ref|XP_006851916.1| hypothetical protein AMTR_s00041p00165970 [Amborella trichopoda]
 gb|ERN13383.1| hypothetical protein AMTR_s00041p00165970 [Amborella trichopoda]
Length=480

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP++FK IYL+AT+YVLTLTLPSA++VYWAFGD+LL+HSNA SLLP++ FRD AVVLM
Sbjct  251  MWKPRRFKSIYLLATLYVLTLTLPSAASVYWAFGDLLLNHSNAFSLLPKSPFRDMAVVLM  310

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H+ KS+ KRA+ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  311  LIHQFITFGFACTPLYFVWEKVLGIHDVKSILKRAVARLPVVIPIWFLAIVFPFFGPINS  370

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM+TF S +ARENAVE+PP  MG WAG Y MN+FVV WV +V
Sbjct  371  TVGSLLVSFTVYIIPALAHMLTFRSASARENAVERPPKFMGSWAGSYAMNMFVVGWVLVV  430

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS++NFV QI+TFGLF KCYQCP
Sbjct  431  GFGFGGWASIINFVHQIDTFGLFTKCYQCP  460



>ref|XP_008235992.1| PREDICTED: auxin transporter-like protein 2 [Prunus mume]
Length=488

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGDMLL+HSNA SLLP++ FRD AV+LM
Sbjct  254  MWKPQKFKAIYLYATLYVLTLTLPSASAVYWAFGDMLLNHSNAFSLLPKSPFRDMAVILM  313

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  314  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  373

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ T+ S AARENAVE+PP  +GGW G Y +N+FVV WVF+V
Sbjct  374  TVGSLLVSFTVYIIPALAHIFTYKSAAARENAVERPPRFLGGWIGSYTINVFVVVWVFVV  433

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP
Sbjct  434  GFGFGGWASITNFVHQIDTFGLFTKCYQCP  463



>dbj|BAK03484.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSASA YWAFGD LL HSNALSLLPR  +RD AV+LM
Sbjct  258  MWRPQKFKAIYLLATLYVLTLTLPSASAAYWAFGDELLTHSNALSLLPRDAWRDAAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPAMAHM+TF SP +R+NAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  378  AVGSLLVSFTVYIIPAMAHMVTFRSPQSRQNAVERPPRFAGGWTGAYVINSFVVAWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWAS+ NFV+Q++TFGLFAKCYQCP H A
Sbjct  438  GFGFGGWASITNFVQQVSTFGLFAKCYQCPPHPA  471



>ref|XP_009615217.1| PREDICTED: auxin transporter-like protein 2 [Nicotiana tomentosiformis]
Length=491

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YV+TLTLPSA+AVYWAFGD LLDHSNA SLLPRT FRD AV+LM
Sbjct  253  MWKPQKFKAIYLWATLYVMTLTLPSAAAVYWAFGDFLLDHSNAFSLLPRTPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIVFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF S AARENAVEQPP  +G WAG + +NIFVV WVFI+
Sbjct  373  TVGSLLVSFTVYIIPALAHMFTFKSAAARENAVEQPPRFVGRWAGTFTINIFVVVWVFII  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NF+ QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASMLNFIHQIDTFGLFTKCYQCP  462



>ref|XP_008447968.1| PREDICTED: auxin transporter-like protein 2 [Cucumis melo]
Length=493

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYLVAT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLP++  RD AV+LM
Sbjct  255  MWKPQKFKAIYLVATVYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPKSPLRDMAVILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF SPA+RENAVEQPP   G W G Y +N FVV WV +V
Sbjct  375  TVGSLLVSFTVYIIPALAHMFTFRSPASRENAVEQPPKFTGRWVGAYVINAFVVVWVLVV  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP    A
Sbjct  435  GFGFGGWASVTNFVHQIDTFGLFTKCYQCPPQTPA  469



>ref|XP_006366614.1| PREDICTED: auxin transporter-like protein 2-like [Solanum tuberosum]
Length=488

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPS +AVYWAFGD+LLDHSNA SLLPRT  RD AV+LM
Sbjct  255  MWKPQKFKAIYLWATVYVLTLTLPSGAAVYWAFGDLLLDHSNAFSLLPRTPLRDMAVILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+  SL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKAIGMHDCNSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF S AARENAVEQPP  +G WAG + +NIFVV WVFI+
Sbjct  375  TVGSLLVSFTVYIIPALAHMFTFKSAAARENAVEQPPRFVGRWAGTFTINIFVVVWVFII  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF+ QI+TFGLF KCYQCP  K
Sbjct  435  GFGFGGWASMLNFIHQIDTFGLFTKCYQCPSPK  467



>ref|XP_004165789.1| PREDICTED: LOW QUALITY PROTEIN: auxin transporter-like protein 
5-like [Cucumis sativus]
Length=420

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT YVLTLTLPSA+AVYWAFGD+LL+HSNA +LLP++ FRD AVVLM
Sbjct  187  MWKPEKFKGIYLMATAYVLTLTLPSAAAVYWAFGDLLLNHSNAFALLPKSSFRDLAVVLM  246

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  247  LIHQFITFGFACTPLYFVWEKAIGMHKCKSLCKRAAARLPVVIPIWFLAIVFPFFGPINS  306

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM TF SP ARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  307  AVGSLLVSFTVYIIPALAHMFTFKSPTARENAVEQPPKFVGKWVGTYTINVFVVVWVLVV  366

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF+RQI+ FGLFAKCYQCP
Sbjct  367  GFGFGGWASMTNFIRQIDNFGLFAKCYQCP  396



>ref|XP_008457668.1| PREDICTED: auxin transporter-like protein 2 isoform X1 [Cucumis 
melo]
Length=492

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YVLTLTLPSA+AVYWAFGD+LL+HSNA +LLP++ FRD AVVLM
Sbjct  261  MWKPEKFKGIYLMATVYVLTLTLPSAAAVYWAFGDLLLNHSNAFALLPKSTFRDLAVVLM  320

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAI+FPFFGPINS
Sbjct  321  LIHQFITFGFACTPLYFVWEKAIGMHKCKSLCKRAAARLPVVVPIWFLAIVFPFFGPINS  380

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM TF SPAARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  381  AVGSLLVSFTVYIIPALAHMFTFKSPAARENAVEQPPKFVGRWVGTYTINVFVVVWVLVV  440

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF+RQI+ FGLFAKCYQCP
Sbjct  441  GFGFGGWASMTNFIRQIDNFGLFAKCYQCP  470



>ref|XP_004147069.1| PREDICTED: auxin transporter-like protein 5-like [Cucumis sativus]
Length=420

 Score =   317 bits (812),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT YVLTLTLPSA+AVYWAFGD+LL+HSNA +LLP++ FRD AVVLM
Sbjct  187  MWKPEKFKGIYLMATAYVLTLTLPSAAAVYWAFGDLLLNHSNAFALLPKSSFRDLAVVLM  246

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  247  LIHQFITFGFACTPLYFVWEKAIGMHKCKSLCKRAAARLPVVIPIWFLAIVFPFFGPINS  306

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM TF SP ARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  307  AVGSLLVSFTVYIIPALAHMFTFKSPTARENAVEQPPKFVGKWVGTYTINVFVVVWVLVV  366

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF+RQI+ FGLFAKCYQCP
Sbjct  367  GFGFGGWASMTNFIRQIDNFGLFAKCYQCP  396



>ref|XP_009798935.1| PREDICTED: auxin transporter-like protein 2 [Nicotiana sylvestris]
Length=491

 Score =   319 bits (818),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSA+AVYWAFGD+LLDHSNA SLLPRT FRD AV+LM
Sbjct  253  MWKPQKFKAIYLWATLYVLTLTLPSAAAVYWAFGDLLLDHSNAFSLLPRTPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL  RA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCTRAAARLPVVIPIWFLAIVFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF S AARENAVEQPP  +G WAG + +NIFVV WVFI+
Sbjct  373  TVGSLLVSFTVYIIPALAHMFTFKSAAARENAVEQPPRFVGRWAGTFTINIFVVVWVFII  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NF+ QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASMLNFIHQIDTFGLFTKCYQCP  462



>ref|NP_001233924.1| LAX5 protein [Solanum lycopersicum]
 gb|AEI69672.1| LAX5 protein [Solanum lycopersicum]
Length=490

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSA+ VYWAFGD+LLDHSNA SLLPRT  RD AV+LM
Sbjct  255  MWKPQKFKAIYLWATVYVLTLTLPSAATVYWAFGDLLLDHSNAFSLLPRTPLRDMAVILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+  SL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKAIGMHDCNSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF S AARENAVEQPP  +G WAG + +NIFVV WVFI+
Sbjct  375  TVGSLLVSFTVYIIPALAHMFTFKSAAARENAVEQPPRFVGRWAGTFTINIFVVVWVFII  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFGFGGWASM+NF+ QI+TFGLF KCYQCP  K
Sbjct  435  GFGFGGWASMLNFIHQIDTFGLFTKCYQCPSPK  467



>ref|XP_002312973.1| auxin influx carrier family protein [Populus trichocarpa]
 gb|ABK93389.1| unknown [Populus trichocarpa]
 gb|EEE86928.1| auxin influx carrier family protein [Populus trichocarpa]
Length=491

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLPR+  RD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPSRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+A+M TF S AARENAVEQPP  MG W G Y MN FVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAYMFTFKSSAARENAVEQPPKYMGRWVGTYVMNSFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP
Sbjct  432  GFGFGGWASVTNFVHQIDTFGLFTKCYQCP  461



>gb|AAK58522.1|AF263100_1 putative AUX1-like permease [Populus tremula x Populus tremuloides]
Length=491

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLPR+  RD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPSRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+A+M TF S AARENAVEQPP  MG W G Y MN FVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAYMFTFKSSAARENAVEQPPKYMGRWVGTYVMNSFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP
Sbjct  432  GFGFGGWASVTNFVHQIDTFGLFTKCYQCP  461



>ref|XP_002467350.1| hypothetical protein SORBIDRAFT_01g026240 [Sorghum bicolor]
 gb|EER94348.1| hypothetical protein SORBIDRAFT_01g026240 [Sorghum bicolor]
Length=553

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA+A YWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  272  MWRPQKFKAIYLLATLYVLTLTLPSAAAAYWAFGDELLTHSNALALLPRTRFRDAAVVLM  331

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  332  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  391

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+TF SP +RENAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  392  AVGSLLVSFTVYIIPALAHMVTFRSPQSRENAVERPPRFAGGWTGAYVINSFVVAWVLVV  451

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFV+Q+NTFGLFAKCYQC
Sbjct  452  GFGFGGWASITNFVQQVNTFGLFAKCYQC  480



>dbj|BAJ33981.1| unnamed protein product [Thellungiella halophila]
Length=331

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGDMLL+HSNA +LLP+  FRD AVVLM
Sbjct  103  MWKPQKFKSIYLFATVYVLTLTLPSASAVYWAFGDMLLNHSNAFALLPKNLFRDFAVVLM  162

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  163  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIVFPFFGPINS  222

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  223  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPKFLGRWTGAFTINAFIVVWVFIV  282

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  283  GFGFGGWASMINFVHQIDTFGLFTKCYQC  311



>ref|XP_007200986.1| hypothetical protein PRUPE_ppa004865mg [Prunus persica]
 gb|EMJ02185.1| hypothetical protein PRUPE_ppa004865mg [Prunus persica]
Length=488

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGDMLL+HSNA SLLP++ FRD AV+LM
Sbjct  254  MWKPQKFKAIYLYATLYVLTLTLPSASAVYWAFGDMLLNHSNAFSLLPKSPFRDMAVILM  313

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  314  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  373

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ T+ S AARENAVE+PP  +GGW G Y +N+FVV WVF+V
Sbjct  374  TVGSLLVSFTVYIIPALAHIFTYKSAAARENAVERPPRFLGGWIGSYTINVFVVVWVFVV  433

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFV QI+TFGLF KCYQC
Sbjct  434  GFGFGGWASITNFVHQIDTFGLFTKCYQC  462



>ref|XP_010090315.1| hypothetical protein L484_024980 [Morus notabilis]
 gb|EXB39285.1| hypothetical protein L484_024980 [Morus notabilis]
Length=494

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSASAVYWAFGDMLL+HSNA SLLP++ FRD AV+LM
Sbjct  253  MWKPQKFKAIYLLATLYVLTLTLPSASAVYWAFGDMLLNHSNAFSLLPKSPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+A++ TF S AARENAVEQPP   GGW G Y +N FVVAWV +V
Sbjct  373  TVGSLLVSFTVYIIPALAYIFTFKSAAARENAVEQPPRYFGGWVGTYVINGFVVAWVLVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  461



>gb|EPS72387.1| auxin influx carrier component, partial [Genlisea aurea]
Length=475

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YV+TLTLPSASAVYWAFGD+LL+HSNA +LLPR+ FRD AV+LM
Sbjct  244  MWKPQKFKAIYLYATLYVMTLTLPSASAVYWAFGDLLLNHSNAFALLPRSIFRDVAVILM  303

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  304  LIHQFITFGFACTPLYFVWEKLIGMHQCKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  363

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+A+  TF SP+ARENAVEQP   +G WAG Y +N FVV WVF+V
Sbjct  364  TVGSLLVSFTVYIIPALAYCFTFRSPSARENAVEQPSKYLGRWAGAYLINTFVVGWVFVV  423

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NFV QI+TFGLF KCYQCP
Sbjct  424  GFGFGGWASMTNFVHQIDTFGLFTKCYQCP  453



>ref|XP_008372897.1| PREDICTED: auxin transporter-like protein 2 [Malus domestica]
Length=491

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA SLLP++ FRD AV+LM
Sbjct  253  MWKPQKFKAIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFSLLPKSPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ T+ S AARENAVE PP  +GGW G Y +N+FVV WVF+V
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTYRSAAARENAVESPPRFLGGWIGSYTINVFVVVWVFVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASITNFVHQIDTFGLFTKCYQCP  462



>gb|KHN05411.1| Auxin transporter-like protein 5 [Glycine soja]
Length=488

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK +YL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA +LLP++ FRD AV+LM
Sbjct  252  MWKPQKFKALYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFALLPKSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRALVRLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF SP+AR+NAVEQPP  +G W G + +N FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSPSARQNAVEQPPKFVGRWVGTFIINTFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASMVNF+RQI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMVNFIRQIDTFGLFTKCYQC  460



>ref|XP_010553089.1| PREDICTED: auxin transporter-like protein 1 [Tarenaya hassleriana]
 ref|XP_010553090.1| PREDICTED: auxin transporter-like protein 1 [Tarenaya hassleriana]
 ref|XP_010553091.1| PREDICTED: auxin transporter-like protein 1 [Tarenaya hassleriana]
Length=483

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+TGFRD AV+LM
Sbjct  263  MWKPRKFKYIYLLATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTGFRDAAVILM  322

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H TKS+  RALARLPVV+PIWFLAI+FPFFGPINS
Sbjct  323  LIHQFITFGFACTPLYFVWEKVIGMHETKSICMRALARLPVVVPIWFLAIVFPFFGPINS  382

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AH++T+ S +AR+NA E+PP  MGGWAG Y +N F+V WV +V
Sbjct  383  AVGALLVSFTVYIIPSLAHILTYRSSSARQNAAEKPPLFMGGWAGVYVLNAFIVVWVLVV  442

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF++QI+TFGLFAKCYQC
Sbjct  443  GFGFGGWASMTNFIKQIDTFGLFAKCYQC  471



>ref|XP_009377677.1| PREDICTED: auxin transporter-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009377679.1| PREDICTED: auxin transporter-like protein 2 [Pyrus x bretschneideri]
Length=491

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA SLLP++ FRD AV+LM
Sbjct  253  MWKPQKFKAIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFSLLPKSPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ T+ S AARENAVE PP  +GGW G Y +N+FVV WVF+V
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTYRSAAARENAVESPPRFLGGWIGSYTINVFVVVWVFVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASITNFVHQIDTFGLFTKCYQCP  462



>ref|XP_003540652.1| PREDICTED: auxin transporter-like protein 5-like [Glycine max]
Length=488

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK +YL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA +LLP++ FRD AV+LM
Sbjct  252  MWKPQKFKALYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFALLPKSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRALVRLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF SP+AR+NAVEQPP  +G W G + +N FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSPSARQNAVEQPPKFVGRWVGTFIINTFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASMVNF+RQI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMVNFIRQIDTFGLFTKCYQC  460



>gb|KGN61915.1| hypothetical protein Csa_2G264590 [Cucumis sativus]
Length=494

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT YVLTLTLPSA+AVYWAFGD+LL+HSNA +LLP++ FRD AVVLM
Sbjct  261  MWKPEKFKGIYLMATAYVLTLTLPSAAAVYWAFGDLLLNHSNAFALLPKSSFRDLAVVLM  320

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  321  LIHQFITFGFACTPLYFVWEKAIGMHKCKSLCKRAAARLPVVIPIWFLAIVFPFFGPINS  380

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM TF SP ARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  381  AVGSLLVSFTVYIIPALAHMFTFKSPTARENAVEQPPKFVGKWVGTYTINVFVVVWVLVV  440

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF+RQI+ FGLFAKCYQCP
Sbjct  441  GFGFGGWASMTNFIRQIDNFGLFAKCYQCP  470



>ref|XP_008349394.1| PREDICTED: auxin transporter-like protein 2 [Malus domestica]
Length=491

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA SLLP++ FRD AV+LM
Sbjct  253  MWKPQKFKAIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFSLLPKSPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AH+ T+ S AARENAVE PP  +GGW G Y +N+FVV WVF+V
Sbjct  373  TVGSLLVSFTVYIIPSLAHIFTYRSAAARENAVESPPRFLGGWIGSYTINVFVVVWVFVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASITNFVHQIDTFGLFTKCYQCP  462



>ref|XP_009413688.1| PREDICTED: auxin transporter-like protein 2 [Musa acuminata subsp. 
malaccensis]
Length=522

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL+HSNA SLLPRT FRD AVVLM
Sbjct  258  MWKPQKFKAIYLLATLYVLTLTLPSAASVYWAFGDALLNHSNAFSLLPRTAFRDAAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKAIGLHDCRSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIP++AHM TF S  ARE+AVE+PP  +GGW G Y MN FVV WV +V
Sbjct  378  AVGSLLVSFTVYIIPSLAHMFTFRSAIARESAVERPPRFVGGWIGAYVMNTFVVGWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFG GGWASM NF+ QINTFGLFAKCYQC
Sbjct  438  GFGLGGWASMTNFIHQINTFGLFAKCYQC  466



>ref|XP_011046499.1| PREDICTED: auxin transporter-like protein 5 [Populus euphratica]
Length=491

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLPR+  RD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPSRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+A+M TF S AARENAVE+PP  MG W G Y MN FVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAYMFTFKSSAARENAVERPPKYMGRWVGTYVMNSFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP
Sbjct  432  GFGFGGWASVTNFVHQIDTFGLFTKCYQCP  461



>ref|XP_009340237.1| PREDICTED: auxin transporter-like protein 2 [Pyrus x bretschneideri]
Length=491

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP++ FRD AV+LM
Sbjct  253  MWKPQKFKAIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKSPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ T+ S AARENAVE PP  +GGW G Y +N+FVV WVF+V
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTYRSAAARENAVESPPRFLGGWIGSYTINVFVVVWVFVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASITNFVHQIDTFGLFTKCYQCP  462



>ref|XP_006422638.1| hypothetical protein CICLE_v10028271mg [Citrus clementina]
 gb|ESR35878.1| hypothetical protein CICLE_v10028271mg [Citrus clementina]
 gb|KDO67999.1| hypothetical protein CISIN_1g011022mg [Citrus sinensis]
Length=495

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV+TLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVMTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIVFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPKFVGRWVGTYTINVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  460



>ref|XP_006486767.1| PREDICTED: auxin transporter-like protein 5-like [Citrus sinensis]
Length=495

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV+TLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVITLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIVFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPKFVGRWVGTYTINVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  460



>ref|XP_011088581.1| PREDICTED: auxin transporter-like protein 5 [Sesamum indicum]
Length=495

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+A YWAFGD+LL+HSNA SLLPR+ FRD AV+LM
Sbjct  253  MWKPQKFKAIYLLATLYVLTLTLPSAAAAYWAFGDLLLNHSNAFSLLPRSPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAI+FPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVVPIWFLAIVFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENA+EQPP   G W G Y +NIFVV WV IV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFKSAAARENAIEQPPKYFGRWVGTYVINIFVVVWVLIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKH  636
            GFGFGGWASMVNF+ QI+TFGLF KCYQCP  
Sbjct  433  GFGFGGWASMVNFIHQIDTFGLFTKCYQCPSQ  464



>ref|XP_011092887.1| PREDICTED: auxin transporter-like protein 2 [Sesamum indicum]
Length=495

 Score =   317 bits (811),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGD+LL+HSNA SLLPR+ FRD AV+LM
Sbjct  256  MWKPQKFKAIYLLATLYVLTLTLPSAAAVYWAFGDLLLNHSNAFSLLPRSPFRDMAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP   G W G Y +NIFVV WV IV
Sbjct  376  TVGSLLVSFTVYIIPALAHIFTFRSAAARENAVEQPPKYFGRWVGAYVINIFVVVWVLIV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NF+ QI+TFGLF KCYQCP
Sbjct  436  GFGFGGWASVTNFIHQIDTFGLFTKCYQCP  465



>ref|XP_004505775.1| PREDICTED: auxin transporter-like protein 5-like [Cicer arietinum]
Length=487

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGD+LL+HSNA +LLP++ FRDTAV+LM
Sbjct  253  MWKPQKFKAIYLLATLYVLTLTLPSAAAVYWAFGDLLLNHSNAFALLPKSPFRDTAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRALVRLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S +AR+NAVEQPP  +G W G + +N+F+V WV +V
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFKSSSARQNAVEQPPKFVGRWVGSFVINVFIVVWVLVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASMVNFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASMVNFVHQIDTFGLFTKCYQCP  462



>ref|XP_010934176.1| PREDICTED: auxin transporter-like protein 2 [Elaeis guineensis]
Length=513

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA++VYWAFGD+LLDHSNA +LLPRTG+RD AVVLM
Sbjct  258  MWKPQKFKAIYLLATLYVLTLTLPSAASVYWAFGDLLLDHSNAFALLPRTGWRDAAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK +G+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LVHQFITFGFACTPLYFVWEKLVGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVY+IP++AHM+TF S AARENAVE PP  +G W G Y +N FVV WV +V
Sbjct  378  TVGSLLVSFTVYVIPSLAHMLTFRSAAARENAVEAPPRFVGRWIGTYTINAFVVGWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  438  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  466



>gb|KDP29622.1| hypothetical protein JCGZ_18784 [Jatropha curcas]
Length=491

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FR+ AV+LM
Sbjct  254  MWKPQKFKAIYLLATVYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRNMAVILM  313

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  314  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  373

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+A++ TF S AARENAVEQPP  MG W G Y +N+FVV WVFIV
Sbjct  374  TVGSLLVSFTVYIIPALAYIFTFRSAAARENAVEQPPKYMGRWVGTYMINVFVVIWVFIV  433

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NF+ QI+TFGLF KCYQCP
Sbjct  434  GFGFGGWASLTNFIHQIDTFGLFTKCYQCP  463



>ref|XP_009621128.1| PREDICTED: auxin transporter-like protein 2 [Nicotiana tomentosiformis]
Length=492

 Score =   316 bits (810),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSA+AVYWAFGD+LLDHSNA SLLP++ FRD AV+LM
Sbjct  254  MWKPQKFKAIYLWATLYVLTLTLPSAAAVYWAFGDLLLDHSNAFSLLPKSPFRDMAVILM  313

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  314  LIHQFITFGFACTPLYFVWEKVIGMHECKSLCKRAAARLPVVIPIWFLAIVFPFFGPINS  373

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            +VGSLLVSFTVYIIPA+AHM TF S AARENAVEQPP  +G WAG + +NIFVV WV IV
Sbjct  374  SVGSLLVSFTVYIIPALAHMFTFKSAAARENAVEQPPKFVGRWAGTFTINIFVVVWVLIV  433

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  434  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  462



>dbj|BAK07453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   317 bits (812),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT YVLTLTLPSA++VYWAFGD LL HSNALSLLPRT FRD AVVLM
Sbjct  260  MWRPQKFKAIYLMATAYVLTLTLPSAASVYWAFGDELLTHSNALSLLPRTAFRDAAVVLM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAI+FPFFGPINS
Sbjct  320  LVHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIVFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMIT+ S  ARENAVEQPP  +G W G Y +N FVV WV +V
Sbjct  380  AVGSLLVSFTVYIIPALAHMITYRSAHARENAVEQPPRFVGRWTGTYVINAFVVVWVLVV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFVRQI+TFGLF KCYQCP
Sbjct  440  GFGFGGWASITNFVRQIDTFGLFTKCYQCP  469



>ref|XP_008781006.1| PREDICTED: auxin transporter-like protein 2 [Phoenix dactylifera]
Length=527

 Score =   317 bits (813),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV+TLTLPSA++VYWAFGD+LLDHSNAL+LLPRTG+RD AVVLM
Sbjct  258  MWKPQKFKAIYLLATLYVMTLTLPSAASVYWAFGDLLLDHSNALALLPRTGWRDAAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK +G+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LVHQFITFGFACTPLYFVWEKLVGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVY+IP++AHM+TF S AARENAVE PP  +G W G Y +N FVV WV +V
Sbjct  378  TVGSLLVSFTVYVIPSLAHMLTFRSAAARENAVEPPPRFVGRWIGTYTINSFVVGWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  438  GFGFGGWASMANFIHQIDTFGLFTKCYQC  466



>emb|CCF23027.1| auxin influx carrier protein [Mangifera indica]
 gb|AFG18187.1| auxin influx carrier component [Mangifera indica]
Length=493

 Score =   316 bits (810),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSASAVYWAFGDMLL HSNA +LLP++ FRD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSASAVYWAFGDMLLSHSNAFALLPKSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGLHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G Y +N+F+V WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHVFTFKSAAARENAVEQPPRFVGRWIGTYTINVFIVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMINFIHQIDTFGLFTKCYQC  460



>ref|XP_003537799.1| PREDICTED: auxin transporter-like protein 5-like [Glycine max]
Length=488

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK +YL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA +LLP++ FRD AV+LM
Sbjct  252  MWKPQKFKALYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFALLPKSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRALVRLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF SP++R+NAVEQPP  +G W G + +N FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFRSPSSRQNAVEQPPKFVGRWVGTFIINTFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASMVNF+RQI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMVNFIRQIDTFGLFTKCYQC  460



>gb|KHN39891.1| Auxin transporter-like protein 5 [Glycine soja]
Length=488

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK +YL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA +LLP++ FRD AV+LM
Sbjct  252  MWKPQKFKALYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFALLPKSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRALVRLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF SP++R+NAVEQPP  +G W G + +N FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFRSPSSRQNAVEQPPKFVGRWVGTFIINTFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASMVNF+RQI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMVNFIRQIDTFGLFTKCYQC  460



>emb|CCF23028.1| auxin influx carrier protein [Mangifera indica]
 gb|AFG18188.1| auxin influx carrier component [Mangifera indica]
Length=494

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSASAVYWAFGDMLL+HSNA +L P++ FRD AVVLM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSASAVYWAFGDMLLNHSNAFALFPKSPFRDMAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGLHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPRFVGRWIGTYTINVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMINFIHQIDTFGLFTKCYQC  460



>ref|XP_010268655.1| PREDICTED: auxin transporter-like protein 2 [Nelumbo nucifera]
Length=496

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSA AVYWAFGD+LL+HSNA +LLPR+ FRD AVVLM
Sbjct  252  MWKPQKFKAIYLYATLYVLTLTLPSAIAVYWAFGDLLLNHSNAFALLPRSPFRDMAVVLM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S A+RENAVEQPP  +G WAG Y +N+FVV WV +V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFRSAASRENAVEQPPKLLGRWAGIYSINVFVVVWVLVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  460



>ref|NP_001049534.1| Os03g0244600 [Oryza sativa Japonica Group]
 gb|ABF94931.1| AUX1 protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11448.1| Os03g0244600 [Oryza sativa Japonica Group]
 dbj|BAG96129.1| unnamed protein product [Oryza sativa Japonica Group]
Length=524

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  262  MWRPQKFKAIYLMATLYVLTLTLPSAASVYWAFGDELLTHSNALALLPRTAFRDAAVVLM  321

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SLFKRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  322  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLFKRAAARLPVVVPIWFLAIIFPFFGPINS  381

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMITF S  ARENAVE PP  +G W G + +N FVVAWV +V
Sbjct  382  AVGSLLVSFTVYIIPALAHMITFRSAHARENAVEPPPRFVGRWTGTFIINAFVVAWVLVV  441

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQI+TFGLF KCYQC
Sbjct  442  GFGFGGWASMTNFVRQIDTFGLFTKCYQC  470



>emb|CDY71765.1| BnaCnng74340D [Brassica napus]
Length=376

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  FRD AVVLM
Sbjct  146  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLFRDFAVVLM  205

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  206  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  265

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  266  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  325

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  326  GFGFGGWASMINFVHQIDTFGLFTKCYQC  354



>ref|XP_007133922.1| hypothetical protein PHAVU_010G003600g [Phaseolus vulgaris]
 gb|ESW05916.1| hypothetical protein PHAVU_010G003600g [Phaseolus vulgaris]
Length=485

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA AVYWAFGDMLLDHSNA +LLP++ FRD AV+LM
Sbjct  260  MWKPQKFKYIYLLATLYVYTLTIPSAVAVYWAFGDMLLDHSNAFALLPKSAFRDAAVILM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  320  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIP++AHM+T+  P+AR+NA E+PP  M  W   Y +N F+V WVF+V
Sbjct  380  AVGSLLVSFTVYIIPSLAHMLTYRKPSARQNAAEKPPFFMPSWTAMYVLNAFIVVWVFVV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFG GGWAS+ NF+RQIN+FGLFAKCYQCP+
Sbjct  440  GFGLGGWASITNFIRQINSFGLFAKCYQCPR  470



>ref|XP_003557091.2| PREDICTED: auxin transporter-like protein 2-like, partial [Glycine 
max]
Length=240

 Score =   306 bits (784),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA AVYWAFGDMLL+HSNA SLLP+ GFRD AV+LM
Sbjct  15   MWKPQKFKYIYLLATLYVFTLTIPSAVAVYWAFGDMLLNHSNAFSLLPKNGFRDAAVILM  74

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  75   LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  134

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  M  W   Y  N F+V WVF+V
Sbjct  135  AVGSLLVSFTVYIIPALAHMLTYRKASARQNAAERPPFFMPSWTVMYVFNAFIVVWVFVV  194

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFG GGWASM NF+RQI+TFGLFAKCYQC
Sbjct  195  GFGLGGWASMTNFIRQIDTFGLFAKCYQC  223



>ref|XP_004173289.1| PREDICTED: LOW QUALITY PROTEIN: auxin transporter-like protein 
5-like, partial [Cucumis sativus]
Length=409

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYLVAT+YVLTLTLPSA+AVYWAFGDMLL++SNA SLLP++  RD AV+LM
Sbjct  171  MWKPQKFKAIYLVATVYVLTLTLPSAAAVYWAFGDMLLNYSNAFSLLPKSPLRDMAVILM  230

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  231  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  290

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF   A+RENAVEQPP   G W G Y +N FVV WV +V
Sbjct  291  TVGSLLVSFTVYIIPALAHMFTFRYAASRENAVEQPPKFTGRWVGAYVINAFVVVWVLVV  350

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWAS+ NFV QI+TFGLF KCYQCP    A
Sbjct  351  GFGFGGWASVTNFVHQIDTFGLFTKCYQCPPQTPA  385



>ref|XP_006404544.1| hypothetical protein EUTSA_v10000149mg [Eutrema salsugineum]
 gb|ESQ45997.1| hypothetical protein EUTSA_v10000149mg [Eutrema salsugineum]
Length=481

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGDMLL+HSNA +LLP+  FRD AVVLM
Sbjct  253  MWKPQKFKSIYLFATVYVLTLTLPSASAVYWAFGDMLLNHSNAFALLPKNLFRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIVFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPKFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQC  461



>ref|XP_002468184.1| hypothetical protein SORBIDRAFT_01g041270 [Sorghum bicolor]
 gb|EER95182.1| hypothetical protein SORBIDRAFT_01g041270 [Sorghum bicolor]
Length=523

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  261  MWRPQKFKAIYLMATLYVLTLTLPSAASVYWAFGDQLLTHSNALALLPRTPFRDAAVVLM  320

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  321  LVHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  380

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMITF S  ARENAVE PP  +G W G Y +N FVVAWV +V
Sbjct  381  AVGSLLVSFTVYIIPALAHMITFRSATARENAVEPPPRLVGRWTGTYMINAFVVAWVLVV  440

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQI+TFGLF KCYQC
Sbjct  441  GFGFGGWASMTNFVRQIDTFGLFTKCYQC  469



>ref|NP_001064161.1| Os10g0147400 [Oryza sativa Japonica Group]
 sp|Q7XGU4.1|LAX3_ORYSJ RecName: Full=Auxin transporter-like protein 3 [Oryza sativa 
Japonica Group]
 gb|AAK91876.1|AC091665_2 Putative AUX1-like permease [Oryza sativa]
 gb|AAP52113.1| AUX1 protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26075.1| Os10g0147400 [Oryza sativa Japonica Group]
 gb|EAZ15304.1| hypothetical protein OsJ_30723 [Oryza sativa Japonica Group]
 dbj|BAG95486.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=547

 Score =   316 bits (809),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSASA YWAFGD LL HSNAL+LLPRT +RD AVVLM
Sbjct  274  MWRPQKFKAIYLLATVYVLTLTLPSASAAYWAFGDALLTHSNALALLPRTPWRDAAVVLM  333

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H   SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  334  LIHQFITFGFACTPLYFVWEKLVGLHGCPSLCKRAAARLPVVLPIWFLAIIFPFFGPINS  393

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIP++A+M+TF SP +R+NAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  394  AVGSLLVSFTVYIIPSLAYMVTFRSPQSRQNAVERPPRFAGGWTGAYVINSFVVAWVLVV  453

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWAS+ NFV Q++TFGLFAKCYQCP H AA
Sbjct  454  GFGFGGWASITNFVHQVDTFGLFAKCYQCPPHPAA  488



>gb|EAY77705.1| hypothetical protein OsI_32746 [Oryza sativa Indica Group]
 dbj|BAF49452.1| putative AUX1-like permease [Oryza sativa Indica Group]
Length=547

 Score =   316 bits (809),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSASA YWAFGD LL HSNAL+LLPRT +RD AVVLM
Sbjct  274  MWRPQKFKAIYLLATVYVLTLTLPSASAAYWAFGDALLTHSNALALLPRTPWRDAAVVLM  333

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H   SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  334  LIHQFITFGFACTPLYFVWEKLVGLHGCPSLCKRAAARLPVVLPIWFLAIIFPFFGPINS  393

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIP++A+M+TF SP +R+NAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  394  AVGSLLVSFTVYIIPSLAYMVTFRSPQSRQNAVERPPRFAGGWTGAYVINSFVVAWVLVV  453

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWAS+ NFV Q++TFGLFAKCYQCP H AA
Sbjct  454  GFGFGGWASITNFVHQVDTFGLFAKCYQCPPHPAA  488



>ref|XP_010526556.1| PREDICTED: auxin transporter-like protein 2 [Tarenaya hassleriana]
Length=478

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSASAVYWAFGD+LL+HSNA SLLP+  FRD AV+LM
Sbjct  253  MWKPQKFKAIYLMATVYVLTLTLPSASAVYWAFGDLLLNHSNAFSLLPKNPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFG+ACTPLYFVWEK IG+H  +SL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGYACTPLYFVWEKLIGMHECRSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S ++RENAVEQPP  +G W G + +N FVV WV +V
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSSSRENAVEQPPRLVGRWVGSFTINAFVVVWVLVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQC  461



>ref|XP_002532696.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF29681.1| amino acid transporter, putative [Ricinus communis]
Length=493

 Score =   314 bits (804),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLPR+ FRD AV+LM
Sbjct  252  MWKPQKFKAIYLAATVYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP   G W G Y +N+FVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPKYFGRWVGAYVINVFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  460



>sp|Q8L883.1|LAX5_MEDTR RecName: Full=Auxin transporter-like protein 5; AltName: Full=AUX1-like 
protein 5; AltName: Full=MtLAX5 [Medicago truncatula]
 gb|AAM55306.1| auxin influx carrier protein [Medicago truncatula]
 gb|KEH30514.1| auxin influx transporter [Medicago truncatula]
Length=490

 Score =   313 bits (803),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLT+PSA+AVYWAFGDMLL+HSNA +LLP++ FRD AV+LM
Sbjct  255  MWKPQKFKAIYLLATLYVLTLTIPSATAVYWAFGDMLLNHSNAFALLPKSPFRDMAVILM  314

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H  KSL KRAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  315  LIHQFITFGFACTPLYFVWEKTVGMHECKSLCKRALVRLPVVIPIWFLAIIFPFFGPINS  374

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S +AR+NAVEQPP  +G W G + +N+F+V WV IV
Sbjct  375  TVGSLLVSFTVYIIPALAHIFTFKSSSARQNAVEQPPKFVGRWVGTFVINVFIVVWVLIV  434

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASMVNFV QI+TFGLF KCYQCP
Sbjct  435  GFGFGGWASMVNFVHQIDTFGLFTKCYQCP  464



>ref|XP_007041889.1| hypothetical protein TCM_006657 [Theobroma cacao]
 gb|EOX97720.1| hypothetical protein TCM_006657 [Theobroma cacao]
Length=492

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGDMLL+HSNA SLLPRT FRD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRTPFRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFASTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S  ARENAVEQPP   G W G Y +NIFVV WV IV
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFRSATARENAVEQPPKYFGRWVGTYVINIFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  460



>ref|XP_010416846.1| PREDICTED: LOW QUALITY PROTEIN: auxin transporter-like protein 
2 [Camelina sativa]
Length=486

 Score =   313 bits (803),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQCP  462



>ref|XP_010529889.1| PREDICTED: auxin transporter protein 1 [Tarenaya hassleriana]
Length=487

 Score =   313 bits (803),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LLDHSNA SL+PR+G+RD AV+LM
Sbjct  264  MWKPQKFKYIYLLATLYVFTLTLPSASAVYWAFGDELLDHSNAFSLIPRSGWRDAAVILM  323

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  324  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  383

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ S +ARENA E+PP  M  W   Y +N F+V WV +V
Sbjct  384  AVGALLVSFTVYIIPALAHMLTYRSSSARENAAEKPPRFMPSWTAMYVINAFIVVWVLVV  443

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC
Sbjct  444  GFGFGGWASVTNFVRQVDTFGLFAKCYQC  472



>dbj|BAD82312.1| putative AUX1-like permease [Oryza sativa Japonica Group]
 dbj|BAG96355.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90948.1| unnamed protein product [Oryza sativa Japonica Group]
Length=282

 Score =   306 bits (784),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP KFK IYL+AT+YV TLTLPSASA+YWAFGD LL HSNA SLLP+TG+RD AV+LM
Sbjct  57   MWKPAKFKYIYLLATLYVFTLTLPSASAMYWAFGDELLTHSNAFSLLPKTGWRDAAVILM  116

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLP+V+PIWFLAIIFPFFGPINS
Sbjct  117  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPIVVPIWFLAIIFPFFGPINS  176

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AH++T+ + +AR NA E+PP  +  W G + +N+F+V WV +V
Sbjct  177  AVGALLVSFTVYIIPALAHILTYRTASARMNAAEKPPFFLPSWTGMFVLNMFIVVWVLVV  236

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFG GGWASMVNF+RQI+TFGLFAKCYQCPK
Sbjct  237  GFGLGGWASMVNFIRQIDTFGLFAKCYQCPK  267



>ref|XP_010472082.1| PREDICTED: auxin transporter-like protein 2 isoform X1 [Camelina 
sativa]
 ref|XP_010472083.1| PREDICTED: auxin transporter-like protein 2 isoform X2 [Camelina 
sativa]
Length=486

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQCP  462



>ref|XP_010256603.1| PREDICTED: auxin transporter-like protein 2 [Nelumbo nucifera]
Length=477

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LLDHSNA SLLPR G+RD AV+LM
Sbjct  256  MWKPQKFKYIYLLATLYVFTLTLPSASAVYWAFGDQLLDHSNAFSLLPRNGWRDAAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP+MAHM+T+   +AR+NAVE+PP  +  W   Y +NIF+V WVF+V
Sbjct  376  AVGALLVSFTVYIIPSMAHMLTYRKASARQNAVEKPPFFLPSWTAMYAVNIFIVGWVFVV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASM NFV+Q++TFGLFAKCYQC K
Sbjct  436  GFGFGGWASMSNFVKQVDTFGLFAKCYQCAK  466



>ref|XP_003561828.1| PREDICTED: auxin transporter-like protein 3 [Brachypodium distachyon]
Length=525

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL HSNALSLLPRT FRD AVVLM
Sbjct  261  MWRPQKFKAIYLMATLYVLTLTLPSAASVYWAFGDDLLTHSNALSLLPRTAFRDAAVVLM  320

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAI+FPFFGPINS
Sbjct  321  LVHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIVFPFFGPINS  380

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMIT+ S  ARENAVE PP  +G W G Y +N FVVAWV +V
Sbjct  381  AVGSLLVSFTVYIIPALAHMITYRSAPARENAVEPPPRFVGRWTGTYMINAFVVAWVLVV  440

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF+RQI+TFGLF KCYQCP
Sbjct  441  GFGFGGWASMTNFIRQIDTFGLFTKCYQCP  470



>ref|XP_010428998.1| PREDICTED: auxin transporter-like protein 2 [Camelina sativa]
Length=485

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQCP  462



>gb|KFK37063.1| hypothetical protein AALP_AA4G208000 [Arabis alpina]
Length=484

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATVYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIVFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQCP  462



>emb|CDX83191.1| BnaA03g23150D [Brassica napus]
Length=483

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  FRD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLFRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQC  461



>ref|XP_010920178.1| PREDICTED: auxin transporter-like protein 2 [Elaeis guineensis]
Length=524

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA++VYWAFGD+LLDHSNA +LLPRT +RD AVVLM
Sbjct  258  MWKPQKFKAIYLLATLYVLTLTLPSAASVYWAFGDLLLDHSNAFALLPRTAWRDAAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKLVGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIP++AHM+TF + AARE+AVE PP  +G W G Y +N FVV WV +V
Sbjct  378  AVGSLLVSFTVYIIPSLAHMLTFRTAAARESAVEPPPRFVGRWIGMYTINAFVVGWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQI+TFGLF KCYQC
Sbjct  438  GFGFGGWASMTNFVRQIDTFGLFTKCYQC  466



>ref|XP_009770462.1| PREDICTED: auxin transporter-like protein 2 [Nicotiana sylvestris]
Length=492

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSA+AVYWAFGD+LLDHSNA SLLP++ FRD AV+LM
Sbjct  254  MWKPQKFKAIYLWATLYVLTLTLPSAAAVYWAFGDLLLDHSNAFSLLPKSPFRDMAVILM  313

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  314  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIVFPFFGPINS  373

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            +VGSLLVSFTVYIIPA+AHM TF S AARENAVEQPP  +G W G + +NIFVV WV IV
Sbjct  374  SVGSLLVSFTVYIIPALAHMFTFKSAAARENAVEQPPKFVGRWPGTFTINIFVVVWVLIV  433

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  434  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  462



>ref|XP_006662180.1| PREDICTED: auxin transporter-like protein 3-like [Oryza brachyantha]
Length=525

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA+A YWAFGD LL HSNAL+LLPRT +RD AVVLM
Sbjct  258  MWRPQKFKAIYLLATVYVLTLTLPSAAAAYWAFGDELLTHSNALALLPRTPWRDAAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H   SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKLVGLHGCASLCKRAAARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIP++AHM+TF SP +R+NAVE+PP   GGW G Y +N FVVAWV +V
Sbjct  378  AVGSLLVSFTVYIIPSLAHMVTFRSPQSRQNAVERPPRFAGGWTGAYVINSFVVAWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKH  636
            GFGFGGWAS+ NFV Q+NTFGLFAKC QCP H
Sbjct  438  GFGFGGWASITNFVHQVNTFGLFAKCSQCPPH  469



>gb|KCW49470.1| hypothetical protein EUGRSUZ_K02992 [Eucalyptus grandis]
Length=487

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LLDHSNA +LLP+TGFRD AV+LM
Sbjct  262  MWKPQKFKYIYLIATLYVFTLTIPSATAVYWAFGDRLLDHSNAFALLPKTGFRDAAVILM  321

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKSL  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  322  LIHQFITFGFACTPLYFVWEKVIGMHDTKSLCLRALARLPVVIPIWFLAIIFPFFGPINS  381

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+TF + +AR+NAVE+PP  +  W   Y  N FVV WV +V
Sbjct  382  AVGALLVSFTVYIIPSLAHMLTFRTASARQNAVEKPPFFLPSWTAMYVFNAFVVGWVLVV  441

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQ++TFGLFAKCYQC
Sbjct  442  GFGFGGWASMSNFVRQVDTFGLFAKCYQC  470



>ref|XP_010262806.1| PREDICTED: auxin transporter-like protein 2 [Nelumbo nucifera]
 ref|XP_010262807.1| PREDICTED: auxin transporter-like protein 2 [Nelumbo nucifera]
Length=481

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNALSLLPRTG+RD AV+LM
Sbjct  256  MWKPQKFKYIYLLATLYVYTLTLPSASAVYWAFGDQLLNHSNALSLLPRTGWRDAAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPAMAHM+T+   +AR+NA E+PP     W G Y +NIF+V WV +V
Sbjct  376  AVGALLVSFTVYIIPAMAHMLTYRKASARQNAAEKPPFFFPSWTGMYIVNIFIVVWVLVV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASM NFV+Q++ FGLFAKCYQC K
Sbjct  436  GFGFGGWASMSNFVKQVDNFGLFAKCYQCAK  466



>gb|KCW64113.1| hypothetical protein EUGRSUZ_G01769 [Eucalyptus grandis]
Length=467

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YV+TLTLPSA+AVYWAFGDMLL+H+NA SLLPR+ FRD AV+LM
Sbjct  228  MWKPQKFKAIYLWATLYVMTLTLPSAAAVYWAFGDMLLNHANAFSLLPRSPFRDMAVILM  287

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  288  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  347

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  348  TVGSLLVSFTVYIIPALAHICTFKSSAARENAVEQPPKFVGRWIGAYTINMFVVGWVLVV  407

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFV QI+TFGLF KCYQC
Sbjct  408  GFGFGGWASVTNFVHQIDTFGLFTKCYQC  436



>ref|XP_003520808.1| PREDICTED: auxin transporter-like protein 2-like [Glycine max]
Length=483

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA AVYWAFGDMLL+HSNA SLLP+ GFRD AV+LM
Sbjct  258  MWKPQKFKYIYLLATLYVFTLTIPSAVAVYWAFGDMLLNHSNAFSLLPKNGFRDAAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIP++AHM+T+   +AR+NA E+PP  M  W   Y  N F+V WVF+V
Sbjct  378  AVGSLLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFMPSWTAMYVFNAFIVVWVFVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFG GGWASM NF+RQI+TFGLFAKCYQCP
Sbjct  438  GFGLGGWASMTNFIRQIDTFGLFAKCYQCP  467



>ref|XP_010923085.1| PREDICTED: auxin transporter-like protein 2 [Elaeis guineensis]
 ref|XP_010923086.1| PREDICTED: auxin transporter-like protein 2 [Elaeis guineensis]
Length=483

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYLVAT+YV TLTLPSA+A+YWAFGD LL HSNA SLLP++ FRD AV+LM
Sbjct  262  MWKPQKFKYIYLVATLYVFTLTLPSAAAMYWAFGDQLLTHSNAFSLLPKSRFRDAAVILM  321

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  322  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFLRALARLPVVIPIWFLAIIFPFFGPINS  381

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVG+LLVSFTVYIIP++AHM+T+   +AR+NA E+PP  M  W   Y +N FVV WV +V
Sbjct  382  TVGALLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFMPSWTAMYVLNAFVVVWVLVV  441

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFG GGWASMVNFVRQ++TFGLFAKCYQC
Sbjct  442  GFGLGGWASMVNFVRQVDTFGLFAKCYQC  470



>ref|XP_006848158.1| hypothetical protein AMTR_s00029p00231910 [Amborella trichopoda]
 gb|ERN09739.1| hypothetical protein AMTR_s00029p00231910 [Amborella trichopoda]
Length=475

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSA+A+YWAFGD+LL+HSNA SLLP+T FRD+AV+LM
Sbjct  256  MWKPQKFKSIYLLATLYVFTLTLPSAAAMYWAFGDLLLNHSNAFSLLPKTRFRDSAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+   +AR+NAVE+PP  +  W G Y +N FVV WVF+V
Sbjct  376  AVGALLVSFTVYIIPSLAHMLTYRKASARQNAVEKPPFFLPSWTGMYIVNTFVVVWVFLV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKA  642
            GFGFGGWASM NF+RQ++TFGLFAKCYQCP+  +
Sbjct  436  GFGFGGWASMTNFIRQVDTFGLFAKCYQCPRRTS  469



>ref|XP_010037718.1| PREDICTED: auxin transporter-like protein 4 [Eucalyptus grandis]
 ref|XP_010037719.1| PREDICTED: auxin transporter-like protein 4 [Eucalyptus grandis]
 gb|KCW49471.1| hypothetical protein EUGRSUZ_K02992 [Eucalyptus grandis]
Length=495

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LLDHSNA +LLP+TGFRD AV+LM
Sbjct  270  MWKPQKFKYIYLIATLYVFTLTIPSATAVYWAFGDRLLDHSNAFALLPKTGFRDAAVILM  329

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKSL  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  330  LIHQFITFGFACTPLYFVWEKVIGMHDTKSLCLRALARLPVVIPIWFLAIIFPFFGPINS  389

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+TF + +AR+NAVE+PP  +  W   Y  N FVV WV +V
Sbjct  390  AVGALLVSFTVYIIPSLAHMLTFRTASARQNAVEKPPFFLPSWTAMYVFNAFVVGWVLVV  449

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQ++TFGLFAKCYQC
Sbjct  450  GFGFGGWASMSNFVRQVDTFGLFAKCYQC  478



>ref|XP_008788387.1| PREDICTED: auxin transporter-like protein 2 [Phoenix dactylifera]
Length=531

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA++VYWAFGD+LLDHSNA +LLPRT +RD AVVLM
Sbjct  258  MWKPQKFKAIYLLATLYVLTLTLPSAASVYWAFGDLLLDHSNAFALLPRTAWRDAAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKLVGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIP++AHM+TF S +ARENAVE PP  +G W G Y +N FVV WV +V
Sbjct  378  TVGSLLVSFTVYIIPSLAHMLTFRSASARENAVEPPPRFVGRWIGMYTINAFVVGWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFV QI+TFGLF KCYQC
Sbjct  438  GFGFGGWASVTNFVHQIDTFGLFTKCYQC  466



>dbj|BAF49450.1| putative AUX1-like permease [Oryza sativa Indica Group]
 gb|EEC74855.1| hypothetical protein OsI_10723 [Oryza sativa Indica Group]
Length=524

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  262  MWRPQKFKAIYLMATLYVLTLTLPSAASVYWAFGDELLTHSNALALLPRTAFRDAAVVLM  321

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  322  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  381

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMITF S  ARENAVE PP  +G W G + +N FVVAWV +V
Sbjct  382  AVGSLLVSFTVYIIPALAHMITFRSAHARENAVEPPPRFVGRWTGTFIINAFVVAWVLVV  441

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQI+TFGLF KCYQC
Sbjct  442  GFGFGGWASMTNFVRQIDTFGLFTKCYQC  470



>gb|EPS66996.1| auxin influx transport protein, partial [Genlisea aurea]
Length=468

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 190/212 (90%), Gaps = 2/212 (1%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK+IYLVA++YVLTLTLPSASAVYWAFGD LL+ SNA +LLPRTGFRD +VVLM
Sbjct  256  MWKPRKFKMIYLVASLYVLTLTLPSASAVYWAFGDSLLNRSNAFALLPRTGFRDASVVLM  315

Query  181  LIHQ--FITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPI  354
            LIHQ  FITFGFACTPLY VWEKFIGVH  KSLFKRA+ARLPVVIPIWFLAIIFPFFGPI
Sbjct  316  LIHQAIFITFGFACTPLYLVWEKFIGVHGAKSLFKRAIARLPVVIPIWFLAIIFPFFGPI  375

Query  355  NSTVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvf  534
            NSTVGSLLVSFTVYIIPA+AHM TFAS +ARE+AVE+P   +GGW G Y +N+FVV WV 
Sbjct  376  NSTVGSLLVSFTVYIIPALAHMATFASASARESAVERPRKYLGGWVGVYVVNVFVVVWVG  435

Query  535  ivgfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            IVGFGFGGWAS VNF+ QI+TFG+F KCYQCP
Sbjct  436  IVGFGFGGWASTVNFIHQIHTFGIFTKCYQCP  467



>ref|XP_006294110.1| hypothetical protein CARUB_v10023108mg [Capsella rubella]
 gb|EOA27008.1| hypothetical protein CARUB_v10023108mg [Capsella rubella]
Length=483

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WV IV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVLIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQC  461



>ref|XP_008785385.1| PREDICTED: auxin transporter-like protein 4 [Phoenix dactylifera]
 ref|XP_008785386.1| PREDICTED: auxin transporter-like protein 4 [Phoenix dactylifera]
 ref|XP_008785387.1| PREDICTED: auxin transporter-like protein 4 [Phoenix dactylifera]
 ref|XP_008785388.1| PREDICTED: auxin transporter-like protein 4 [Phoenix dactylifera]
 ref|XP_008785389.1| PREDICTED: auxin transporter-like protein 4 [Phoenix dactylifera]
 ref|XP_008785392.1| PREDICTED: auxin transporter-like protein 4 [Phoenix dactylifera]
 ref|XP_008785393.1| PREDICTED: auxin transporter-like protein 4 [Phoenix dactylifera]
Length=488

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYLVAT+YV TLTLPSASA+YWAFGD LL HSNA SLLP++GFRD AV+LM
Sbjct  263  MWKPQKFKYIYLVATVYVFTLTLPSASAMYWAFGDELLTHSNAFSLLPKSGFRDAAVILM  322

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  323  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  382

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVG+LLVSFTVYIIP++AHM+T+ +P+AR+NA E+PP  +  W   Y +N FVV WV +V
Sbjct  383  TVGALLVSFTVYIIPSLAHMLTYRTPSARQNAAEKPPFFLPSWTAIYVVNAFVVVWVLVV  442

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFG GGWAS VNFVRQ++TFGLFAKCYQCPK   A
Sbjct  443  GFGLGGWASTVNFVRQVDTFGLFAKCYQCPKPTVA  477



>gb|EYU37934.1| hypothetical protein MIMGU_mgv1a005137mg [Erythranthe guttata]
Length=495

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSASAVYWAFGD+LL+HSNA SLLP++ F+D AV+LM
Sbjct  253  MWKPQKFKAIYLLATLYVLTLTLPSASAVYWAFGDLLLNHSNAFSLLPKSPFKDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KS+ KRA ARLPVV+PIWFLAI+FPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSMCKRAAARLPVVVPIWFLAIVFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AHM TF S ++RENAVEQP    G W G Y +NIF+V WV IV
Sbjct  373  TVGSLLVSFTVYIIPALAHMFTFKSASSRENAVEQPSKYFGRWVGTYVINIFIVVWVLIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NFV QI+TFGLF KCYQCP
Sbjct  433  GFGFGGWASMTNFVHQIDTFGLFTKCYQCP  462



>ref|XP_006649726.1| PREDICTED: auxin transporter-like protein 3-like [Oryza brachyantha]
Length=525

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL HSNAL+LLPRT FRD AVVLM
Sbjct  260  MWRPQKFKAIYLMATLYVLTLTLPSAASVYWAFGDELLTHSNALALLPRTAFRDAAVVLM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  320  LIHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMITF S  ARENAVE PP  +G W G + +N FVVAWV +V
Sbjct  380  AVGSLLVSFTVYIIPALAHMITFRSAHARENAVEPPPQFVGRWTGTFIINTFVVAWVLVV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NFV QI+TFGLF KCYQCP
Sbjct  440  GFGFGGWASMTNFVHQIDTFGLFTKCYQCP  469



>ref|XP_002878531.1| hypothetical protein ARALYDRAFT_900513 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54790.1| hypothetical protein ARALYDRAFT_900513 [Arabidopsis lyrata subsp. 
lyrata]
Length=483

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQC  461



>ref|NP_179701.1| like AUXIN RESISTANT 2 [Arabidopsis thaliana]
 sp|Q9S836.1|LAX2_ARATH RecName: Full=Auxin transporter-like protein 2; AltName: Full=AUX1-like 
protein 2 [Arabidopsis thaliana]
 gb|AAD29811.1| AUX1-like amino acid permease [Arabidopsis thaliana]
 emb|CAB45643.1| putative AUX1-like permease [Arabidopsis thaliana]
 gb|AAK96875.1| AUX1-like amino acid permease [Arabidopsis thaliana]
 gb|AAM91114.1| AUX1-like amino acid permease [Arabidopsis thaliana]
 gb|AEC07116.1| like AUXIN RESISTANT 2 [Arabidopsis thaliana]
Length=483

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQC  461



>emb|CBI37897.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPSA+AVYWAFGD LL HSNA +LLPR+ FRD AV ++
Sbjct  252  MWKPQKFKAIYLLATVYVLTLTLPSAAAVYWAFGDALLSHSNAFALLPRSHFRDMAVHVV  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            ++ QFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  312  VLLQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G WAG Y +NIFVV WVF+V
Sbjct  372  TVGSLLVSFTVYIIPALAHIFTFKSAAARENAVEQPPKYLGRWAGAYTINIFVVVWVFVV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM+NFV QI+TFGLF KCYQCP
Sbjct  432  GFGFGGWASMINFVHQIDTFGLFTKCYQCP  461



>ref|XP_004985027.1| PREDICTED: auxin transporter-like protein 3-like [Setaria italica]
Length=519

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL HSNA +LLPRT FRD AVVLM
Sbjct  261  MWRPQKFKAIYLLATLYVLTLTLPSAASVYWAFGDQLLTHSNAFALLPRTAFRDAAVVLM  320

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L+HQFITFGFACTPLYFVWEK IG+H+ +SL KRA ARLPVV+PIWFLAI+FPFFGPINS
Sbjct  321  LVHQFITFGFACTPLYFVWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIVFPFFGPINS  380

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMITF S +ARENAVE PP  +G W G Y +N FVVAWV +V
Sbjct  381  AVGSLLVSFTVYIIPALAHMITFRSASARENAVEPPPRLVGRWTGTYMINAFVVAWVLVV  440

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFV QI+TFGLF KCYQC
Sbjct  441  GFGFGGWASMTNFVHQIDTFGLFTKCYQC  469



>ref|XP_002456658.1| hypothetical protein SORBIDRAFT_03g040320 [Sorghum bicolor]
 gb|EES01778.1| hypothetical protein SORBIDRAFT_03g040320 [Sorghum bicolor]
Length=493

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP KFK IYL+AT+YV TLTLPSA+A+YWAFGD LL HSNA SLLP+TG+RD AV+LM
Sbjct  267  MWKPAKFKYIYLLATLYVFTLTLPSAAAMYWAFGDELLTHSNAFSLLPKTGWRDAAVILM  326

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+FKRALARLP+V+PIWFLAIIFPFFGPINS
Sbjct  327  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFKRALARLPIVVPIWFLAIIFPFFGPINS  386

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AH++T+ + +AR NA E+PP  +  W G + +N+F+V WV +V
Sbjct  387  AVGALLVSFTVYIIPALAHILTYRTASARMNAAEKPPFFLPSWTGMFVLNMFIVVWVLVV  446

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFG GGWASMVNF+RQI+TFGLFAKCYQCPK
Sbjct  447  GFGLGGWASMVNFIRQIDTFGLFAKCYQCPK  477



>ref|XP_010066266.1| PREDICTED: LOW QUALITY PROTEIN: auxin transporter-like protein 
5 [Eucalyptus grandis]
Length=492

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YV+TLTLPSA+AVYWAFGDMLL+H+NA SLLPR+ FRD AV+LM
Sbjct  253  MWKPQKFKAIYLWATLYVMTLTLPSAAAVYWAFGDMLLNHANAFSLLPRSPFRDMAVILM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVVPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G Y +N+FVV WV +V
Sbjct  373  TVGSLLVSFTVYIIPALAHICTFKSSAARENAVEQPPKFVGRWIGAYTINMFVVGWVLVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASVTNFVHQIDTFGLFTKCYQC  461



>ref|XP_002268925.1| PREDICTED: auxin transporter-like protein 2 [Vitis vinifera]
 emb|CBI25506.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   310 bits (795),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYLVAT+YV TLT+PSA AVYWAFGD LLDHSNA SLLP+TGFRD AV+LM
Sbjct  256  MWKPQKFKYIYLVATLYVFTLTIPSAVAVYWAFGDQLLDHSNAFSLLPQTGFRDAAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +GVH+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVVGVHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  +  W+G Y +N FVV WVFIV
Sbjct  376  AVGALLVSFTVYIIPALAHMLTYRKASARKNAAEKPPFFLPSWSGMYMVNAFVVIWVFIV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF++Q++TFGLFAKCYQC
Sbjct  436  GFGFGGWASMNNFIKQVDTFGLFAKCYQC  464



>ref|XP_002306175.1| hypothetical protein POPTR_0004s17860g [Populus trichocarpa]
 gb|EEE86686.1| hypothetical protein POPTR_0004s17860g [Populus trichocarpa]
Length=491

 Score =   311 bits (797),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPS +AVYWAFGDMLL+HSNA +LLPR+  RD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSGAAVYWAFGDMLLNHSNAFALLPRSSSRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            +VGSLLVSFTVYIIPA+AHM TF S AARENAVEQP    G W G Y +N FVV WV IV
Sbjct  372  SVGSLLVSFTVYIIPALAHMFTFKSSAARENAVEQPSKYTGRWVGAYMINTFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  460



>gb|KHG20422.1| Auxin transporter-like protein 4 [Gossypium arboreum]
Length=457

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LL+HSNA SLLP+TGFRD AV+LM
Sbjct  238  MWKPQKFKCIYLLATLYVFTLTIPSASAVYWAFGDQLLNHSNAFSLLPKTGFRDAAVILM  297

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+T+S+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  298  LIHQFITFGFACTPLYFVWEKVIGMHDTRSICLRALARLPVVIPIWFLAIIFPFFGPINS  357

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ + +AR+NA E+PP  +  W   Y +N  VV WV +V
Sbjct  358  AVGALLVSFTVYIIPALAHMLTYRTASARQNAAEKPPFFLPSWTAMYAINAVVVMWVLVV  417

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQI+TFGLFAKCYQC
Sbjct  418  GFGFGGWASMTNFVRQIDTFGLFAKCYQC  446



>ref|XP_006359671.1| PREDICTED: auxin transporter-like protein 5-like [Solanum tuberosum]
Length=494

 Score =   311 bits (796),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSA++VYWAFGD+LLDHSNA SLLP++ FRD AV+LM
Sbjct  256  MWKPQKFKAIYLWATLYVLTLTLPSAASVYWAFGDLLLDHSNAFSLLPKSPFRDMAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KS+ +RA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKAIGMHECKSMCRRAAARLPVVIPIWFLAIVFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            +VGSLLVSFTVYIIPA+A+M+TF S AARENAVEQPP  +G WAG + +NIFVV WV IV
Sbjct  376  SVGSLLVSFTVYIIPALAYMLTFKSAAARENAVEQPPKFVGRWAGSFTINIFVVVWVLIV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  436  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  464



>ref|NP_001234675.1| LAX2 protein [Solanum lycopersicum]
 gb|AEI69669.1| LAX2 protein [Solanum lycopersicum]
Length=494

 Score =   311 bits (796),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSA++VYWAFGD+LLDHSNA SLLP++ FRD AV+LM
Sbjct  256  MWKPQKFKAIYLWATLYVLTLTLPSAASVYWAFGDLLLDHSNAFSLLPKSPFRDMAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KS+ KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKAIGMHECKSMCKRAAARLPVVIPIWFLAIVFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            +VGSLLVSFTVYIIPA+A+M TF S AARENAVEQPP  +G WAG + +NIFVV WV IV
Sbjct  376  SVGSLLVSFTVYIIPALAYMFTFKSAAARENAVEQPPKFVGRWAGSFTINIFVVVWVLIV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  436  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  464



>ref|XP_009117443.1| PREDICTED: auxin transporter-like protein 2 [Brassica rapa]
 emb|CDY13844.1| BnaA09g43460D [Brassica napus]
Length=483

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIVFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARE+AVEQPP  +G W G + +N F+V WVF+V
Sbjct  373  TVGSLLVSFTVYIIPALAHVFTFRSAAARESAVEQPPRFLGRWTGAFTINAFIVVWVFVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQC  461



>ref|XP_010030821.1| PREDICTED: auxin transporter-like protein 4 [Eucalyptus grandis]
 ref|XP_010030875.1| PREDICTED: auxin transporter-like protein 4 [Eucalyptus grandis]
 gb|KCW88117.1| hypothetical protein EUGRSUZ_A00514 [Eucalyptus grandis]
 gb|KCW88118.1| hypothetical protein EUGRSUZ_A00514 [Eucalyptus grandis]
Length=489

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSA+AVYWAFGD LL+HSNA SLLP+ GFRD AV+LM
Sbjct  267  MWKPQKFKYIYLMATLYVFTLTLPSATAVYWAFGDELLNHSNAFSLLPKNGFRDAAVILM  326

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  327  LIHQFITFGFACTPLYFVWEKVIGMHDTKSMCMRALARLPVVIPIWFLAIIFPFFGPINS  386

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+   +AR+NA E+PPS +  W   Y +N FVV WV +V
Sbjct  387  AVGALLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPSFLPSWTAMYVINAFVVGWVLVV  446

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQ++TFGLFAKCYQC
Sbjct  447  GFGFGGWASMTNFVRQVDTFGLFAKCYQC  475



>ref|NP_001065850.1| Os11g0169200 [Oryza sativa Japonica Group]
 sp|Q53JG7.1|LAX4_ORYSJ RecName: Full=Putative auxin transporter-like protein 4 [Oryza 
sativa Japonica Group]
 gb|AAX93011.1| probable AUX1-like permease, 10674-8589 [imported] - Arabidopsis 
thaliana [Oryza sativa Japonica Group]
 gb|ABA91603.1| AUX1-like permease; 10674-8589, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27695.1| Os11g0169200 [Oryza sativa Japonica Group]
Length=480

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+P++FK+IYL AT YVLTLTLPSA+A+YWAFGD LLDHSNA +LLPRT +RD AVVLM
Sbjct  268  MWRPRRFKMIYLAATAYVLTLTLPSAAAMYWAFGDALLDHSNAFALLPRTPWRDAAVVLM  327

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IGVH    + +RA ARLPVV+PIWFLA+IFPFFGPINS
Sbjct  328  LIHQFITFGFACTPLYFVWEKAIGVHGGAGVLRRAAARLPVVLPIWFLAVIFPFFGPINS  387

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGS LVSFTVYIIPAMAHM TFA  AARENAVE PP ++GGW G +  N FVVAWV +V
Sbjct  388  TVGSFLVSFTVYIIPAMAHMATFAPAAARENAVEPPPRALGGWPGTFAANCFVVAWVLVV  447

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS VNFVRQ++TFGLF KCYQCP
Sbjct  448  GFGFGGWASTVNFVRQVDTFGLFTKCYQCP  477



>gb|EAY80094.1| hypothetical protein OsI_35263 [Oryza sativa Indica Group]
Length=480

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+P++FK+IYL AT YVLTLTLPSA+A+YWAFGD LLDHSNA +LLPRT +RD AVVLM
Sbjct  268  MWRPRRFKMIYLAATAYVLTLTLPSAAAMYWAFGDALLDHSNAFALLPRTPWRDAAVVLM  327

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IGVH    + +RA ARLPVV+PIWFLA+IFPFFGPINS
Sbjct  328  LIHQFITFGFACTPLYFVWEKAIGVHGGAGVLRRAAARLPVVLPIWFLAVIFPFFGPINS  387

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGS LVSFTVYIIPAMAHM TFA  AARENAVE PP ++GGW G +  N FVVAWV +V
Sbjct  388  TVGSFLVSFTVYIIPAMAHMATFAPAAARENAVEPPPRALGGWPGTFAANCFVVAWVLVV  447

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS VNFVRQ++TFGLF KCYQCP
Sbjct  448  GFGFGGWASTVNFVRQVDTFGLFTKCYQCP  477



>gb|KHG12121.1| Auxin transporter-like protein 2 [Gossypium arboreum]
Length=482

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSA+AVYWAFGD LL+HSNA SLLP+ GFRD AV+LM
Sbjct  260  MWKPQKFKYIYLLATLYVFTLTLPSAAAVYWAFGDELLNHSNAFSLLPKNGFRDAAVILM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  320  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  M  W G Y +N F+V WV +V
Sbjct  380  AVGALLVSFTVYIIPALAHMLTYRKASARQNAAEKPPFFMPSWTGMYALNAFIVVWVLVV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+RQI++FGLFAKCYQC
Sbjct  440  GFGFGGWASMTNFIRQIDSFGLFAKCYQC  468



>gb|EMT10762.1| hypothetical protein F775_16607 [Aegilops tauschii]
Length=483

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 188/211 (89%), Gaps = 1/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASA+YWAFGD LLDHSNA SLLPRT FRD AVVLM
Sbjct  270  MWKPQKFKLIYLMATLYVLTLTLPSASAMYWAFGDALLDHSNAFSLLPRTPFRDAAVVLM  329

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKS-LFKRALARLPVVIPIWFLAIIFPFFGPIN  357
            LIHQFITFGFACTPLYFVWEK IGVH  ++ +F+RA ARLPVV PIWFLA++FPFFGPIN
Sbjct  330  LIHQFITFGFACTPLYFVWEKAIGVHGDRTGVFRRAAARLPVVAPIWFLAVVFPFFGPIN  389

Query  358  STVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfi  537
            STVGSLLVSFTVYIIPA AHM  FA+PAARE AVE+PP  +GGWAG Y  N FVVAWV +
Sbjct  390  STVGSLLVSFTVYIIPAAAHMAVFAAPAAREGAVERPPRGLGGWAGMYAANCFVVAWVLV  449

Query  538  vgfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            VGFGFGGWAS VNFVRQ+NTFGLF KCYQCP
Sbjct  450  VGFGFGGWASTVNFVRQVNTFGLFTKCYQCP  480



>ref|XP_010553246.1| PREDICTED: auxin transporter protein 1-like [Tarenaya hassleriana]
 ref|XP_010553247.1| PREDICTED: auxin transporter protein 1-like [Tarenaya hassleriana]
Length=488

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LLDHSNA SLLPRTG+RD AV+LM
Sbjct  264  MWKPQKFKYIYLLATLYVFTLTIPSAAAVYWAFGDELLDHSNAFSLLPRTGWRDAAVILM  323

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RA+ARLPVVIPIWFLAI+FPFFGPINS
Sbjct  324  LIHQFITFGFACTPLYFVWEKVIGMHDTKSMCLRAVARLPVVIPIWFLAIVFPFFGPINS  383

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AH++TF S +AR NA E+PP  M  W   Y MN  +V WV +V
Sbjct  384  AVGALLVSFTVYIIPALAHILTFRSASARRNAAEKPPRFMPSWTAMYVMNGIIVVWVLVV  443

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFVRQI+TFGLFAKCYQC
Sbjct  444  GFGFGGWASVTNFVRQIDTFGLFAKCYQC  472



>emb|CDX93326.1| BnaC04g45700D [Brassica napus]
Length=488

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LL+HSNA SLLP+ G+RD AV+LM
Sbjct  260  MWKPQKFKYIYLMATLYVFTLTIPSASAVYWAFGDALLNHSNAFSLLPKNGWRDAAVILM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  320  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFLRALARLPVVIPIWFLAIIFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ S +AR+NA E+PP  M  W   Y +N FVV WV IV
Sbjct  380  AVGALLVSFTVYIIPALAHMLTYRSASARQNAAEKPPFFMPSWTAMYVLNAFVVIWVLIV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC  
Sbjct  440  GFGFGGWASVTNFVRQVDTFGLFAKCYQCKS  470



>ref|XP_009141723.1| PREDICTED: auxin transporter protein 1-like [Brassica rapa]
Length=488

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LL+HSNA SLLP+ G+RD AV+LM
Sbjct  260  MWKPQKFKYIYLMATLYVFTLTIPSASAVYWAFGDALLNHSNAFSLLPKNGWRDAAVILM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  320  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFLRALARLPVVIPIWFLAIIFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ S +AR+NA E+PP  M  W   Y +N FVV WV IV
Sbjct  380  AVGALLVSFTVYIIPALAHMLTYRSASARQNAAEKPPFFMPSWTAMYVLNAFVVIWVLIV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC  
Sbjct  440  GFGFGGWASVTNFVRQVDTFGLFAKCYQCKS  470



>ref|NP_001234688.1| LAX4 protein [Solanum lycopersicum]
 ref|XP_010327677.1| PREDICTED: LAX4 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010327679.1| PREDICTED: LAX4 protein isoform X1 [Solanum lycopersicum]
 gb|AEI69671.1| LAX4 protein [Solanum lycopersicum]
Length=485

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LL+HSNA SLLP+ G+RD AV+LM
Sbjct  259  MWKPQKFKYIYLIATLYVFTLTIPSASAVYWAFGDQLLNHSNAFSLLPKDGWRDAAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RAL RLPVVIPIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALVRLPVVIPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVG+LLVSFTVYIIPA+AHM+T+ +P+AR+NA E+PPS M  W   Y +NIF+V WV +V
Sbjct  379  TVGALLVSFTVYIIPALAHMLTYRTPSARQNAAEKPPSFMPSWTIMYVINIFIVGWVLVV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF++Q++TFGLFAKCYQC
Sbjct  439  GFGFGGWASMSNFIKQVDTFGLFAKCYQC  467



>emb|CDY18404.1| BnaA04g21830D [Brassica napus]
Length=488

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LL+HSNA SLLP+ G+RD AV+LM
Sbjct  260  MWKPQKFKYIYLMATLYVFTLTIPSASAVYWAFGDALLNHSNAFSLLPKNGWRDAAVILM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  320  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFLRALARLPVVIPIWFLAIIFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ S +AR+NA E+PP  M  W   Y +N FVV WV IV
Sbjct  380  AVGALLVSFTVYIIPALAHMLTYRSASARQNAAEKPPFFMPSWTAMYVLNAFVVIWVLIV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC  
Sbjct  440  GFGFGGWASVTNFVRQVDTFGLFAKCYQCKS  470



>emb|CDX81996.1| BnaC08g36050D [Brassica napus]
Length=484

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  +RD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA  RLPVVIPIWFLAI+FPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAVRLPVVIPIWFLAIVFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S A+RENAVEQPP  +G W G + +N F+V WVF+V
Sbjct  373  TVGSLLVSFTVYIIPALAHVFTFRSAASRENAVEQPPRFLGRWTGAFTINAFIVVWVFVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TFGLF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFGLFTKCYQC  461



>ref|XP_010528794.1| PREDICTED: auxin transporter protein 1-like [Tarenaya hassleriana]
 ref|XP_010528802.1| PREDICTED: auxin transporter protein 1-like [Tarenaya hassleriana]
Length=488

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSA+AVYWAFGD LLDHSNA SLLPRT +RD AV+LM
Sbjct  265  MWKPQKFKYIYLLATLYVFTLTLPSAAAVYWAFGDELLDHSNAFSLLPRTAWRDAAVILM  324

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  325  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICVRALARLPVVIPIWFLAIIFPFFGPINS  384

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+TF S +AR+NA E+PP  M  W   Y  N F+V WV +V
Sbjct  385  AVGALLVSFTVYIIPALAHMLTFRSSSARQNAAEKPPRFMPSWTAMYVFNAFIVVWVLVV  444

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFV+Q++TFGLFAKCYQC
Sbjct  445  GFGFGGWASVTNFVKQVDTFGLFAKCYQC  473



>ref|NP_974719.1| auxin transporter-like protein 1 [Arabidopsis thaliana]
 gb|AED90316.1| auxin transporter-like protein 1 [Arabidopsis thaliana]
Length=408

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRDTAV+LM
Sbjct  185  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDTAVILM  244

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKSL  RAL RLPVV+PIWFLAIIFPFFGPINS
Sbjct  245  LIHQFITFGFACTPLYFVWEKAIGMHHTKSLCLRALVRLPVVVPIWFLAIIFPFFGPINS  304

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLV+FTVYIIPA+AHM+T+ + +AR NA E+PP  +  WAG Y +N F+V WV ++
Sbjct  305  AVGALLVTFTVYIIPALAHMLTYRTASARRNAAEKPPFFIPSWAGVYVINAFIVVWVLVL  364

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+RQI+TFGLFAKCYQC
Sbjct  365  GFGFGGWASMTNFIRQIDTFGLFAKCYQC  393



>ref|XP_009122846.1| PREDICTED: auxin transporter-like protein 1 isoform X3 [Brassica 
rapa]
Length=411

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRD AV+LM
Sbjct  185  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDAAVILM  244

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RA+ RLPVV+PIWFLAIIFPFFGPINS
Sbjct  245  LIHQFITFGFACTPLYFVWEKAIGMHHTKSIFLRAIVRLPVVVPIWFLAIIFPFFGPINS  304

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ + +AR NA E+PP  +  W+G Y +N FVV WV ++
Sbjct  305  AVGALLVSFTVYIIPALAHMLTYRTASARRNAAEKPPFFLPSWSGVYVINAFVVVWVLVL  364

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASM NF+RQI+TFGLFAKCYQC  
Sbjct  365  GFGFGGWASMTNFIRQIDTFGLFAKCYQCKS  395



>ref|XP_009134011.1| PREDICTED: auxin transporter-like protein 2 [Brassica rapa]
Length=483

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YVLTLTLPSASAVYWAFGD+LL+HSNA +LLP+  FRD AVVLM
Sbjct  253  MWKPQKFKSIYLFATLYVLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLFRDFAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  +S+ KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVGSLLVSFTVYIIPA+AH+ TF S AARENAVEQPP  +G W G + +N F+V WVFIV
Sbjct  373  TVGSLLVSFTVYIIPALAHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM+NFV QI+TF LF KCYQC
Sbjct  433  GFGFGGWASMINFVHQIDTFRLFTKCYQC  461



>gb|KFK24627.1| hypothetical protein AALP_AA8G003900 [Arabis alpina]
Length=530

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 188/213 (88%), Gaps = 1/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRD AV+LM
Sbjct  305  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDAAVILM  364

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+T+S+F+RA+ RLPVV+PIWFLAIIFPFFGPINS
Sbjct  365  LIHQFITFGFACTPLYFVWEKAIGMHHTRSIFRRAIVRLPVVVPIWFLAIIFPFFGPINS  424

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ + +AR NA E+PP  +  WAG Y +N FVV WV ++
Sbjct  425  AVGALLVSFTVYIIPALAHMLTYRTASARRNAAEKPPFFISSWAGVYVINAFVVVWVLVL  484

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC-PKH  636
            GFGFGGWASM NF+RQI+TFGLFAKCYQC P H
Sbjct  485  GFGFGGWASMTNFIRQIDTFGLFAKCYQCKPPH  517



>ref|XP_002316226.1| putative AUX1-like permease family protein [Populus trichocarpa]
 gb|EEF02397.1| putative AUX1-like permease family protein [Populus trichocarpa]
Length=473

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQ+FK IYL+AT+YV TLTLPSA+A YWAFGD LL HSNA SLLPRTG+RD AV+LM
Sbjct  256  MWKPQRFKYIYLLATLYVFTLTLPSAAATYWAFGDQLLTHSNAFSLLPRTGWRDAAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RAL RLPVVIPIWF AIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVIGMHDTKSILLRALCRLPVVIPIWFFAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLV+FTVYIIPA+AHM+T+ S +AR+NAVE+PP  +  W   Y +N F+V WV +V
Sbjct  376  AVGALLVTFTVYIIPALAHMLTYRSASARQNAVEKPPVFLPSWTAMYVLNAFIVVWVLVV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFG GGWASM NF++Q++TFGLFAKCYQCP   AA
Sbjct  436  GFGLGGWASMSNFIKQVDTFGLFAKCYQCPPSAAA  470



>ref|XP_009133231.1| PREDICTED: auxin transporter protein 1-like [Brassica rapa]
 ref|XP_009133232.1| PREDICTED: auxin transporter protein 1-like [Brassica rapa]
Length=493

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LLDHSNA SLLP+ G+RDTAV+LM
Sbjct  264  MWKPQKFKYIYLMATLYVFTLTIPSASAVYWAFGDELLDHSNAFSLLPKNGWRDTAVILM  323

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  324  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  383

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+ S  AR+NA E+PP  +  WA  Y +N FVV WV IV
Sbjct  384  AVGALLVSFTVYIIPSLAHMLTYRSACARQNAAEKPPFFLPSWAAMYVLNAFVVIWVLIV  443

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC 
Sbjct  444  GFGFGGWASVTNFVRQVDTFGLFAKCYQCK  473



>gb|KHG06629.1| Auxin transporter-like protein 2 [Gossypium arboreum]
Length=483

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+ GFRD AV+LM
Sbjct  259  MWKPQKFKYIYLLATLYVFTLTLPSASAVYWAFGDELLNHSNAFSLLPKNGFRDAAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  M  W   Y  N F+V WV +V
Sbjct  379  AVGALLVSFTVYIIPALAHMLTYRKASARQNAAEKPPFFMPSWTAMYAFNAFIVVWVLVV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+RQI+TFGLFAKCYQC
Sbjct  439  GFGFGGWASMTNFIRQIDTFGLFAKCYQC  467



>dbj|BAH47613.1| auxin influx carrier protein [Zinnia violacea]
Length=471

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPS++AVYWAFGD LL+HSNA SLLP+T +RD AVVLM
Sbjct  253  MWKPRKFKYIYLLATLYVFTLTLPSSAAVYWAFGDELLNHSNAFSLLPKTRWRDAAVVLM  312

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RA+ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  313  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFLRAVARLPVVIPIWFLAIIFPFFGPINS  372

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ +P+AR+NA E+PP  M  W   Y +N FVV W  +V
Sbjct  373  AVGALLVSFTVYIIPAIAHMLTYRTPSARQNAAEKPPRFMSSWTAMYVLNAFVVVWCLVV  432

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFV+Q++TFGLFAKCYQC
Sbjct  433  GFGFGGWASMTNFVKQVDTFGLFAKCYQC  461



>ref|XP_008442451.1| PREDICTED: auxin transporter-like protein 2 [Cucumis melo]
Length=478

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSA+AVYWAFGD LL+HSNA SLLP++GFRD AV+LM
Sbjct  256  MWKPQKFKYIYLMATLYVFTLTLPSATAVYWAFGDELLNHSNAFSLLPKSGFRDAAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RA+ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRAVARLPVVIPIWFLAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  +  W G Y +N FVVAWV +V
Sbjct  376  AVGALLVSFTVYIIPALAHMLTYRKASARQNAAEKPPFFIPSWVGMYVLNTFVVAWVLVV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQ++TFGLFAKCYQC
Sbjct  436  GFGFGGWASMTNFVRQVDTFGLFAKCYQC  464



>ref|XP_004970626.1| PREDICTED: auxin transporter-like protein 1-like [Setaria italica]
Length=490

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP KFK IYL+AT+YV TLTLPSA+A+YWAFGD LL+HSNA SLLP+T +RD AV+LM
Sbjct  264  MWKPAKFKYIYLLATLYVFTLTLPSAAAMYWAFGDELLNHSNAFSLLPKTAWRDAAVILM  323

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+FKRALARLP+V+PIWFLAIIFPFFGPINS
Sbjct  324  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFKRALARLPIVVPIWFLAIIFPFFGPINS  383

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AH++T+ + +AR NA E+PP  +  W G + +N+F+V WV +V
Sbjct  384  AVGALLVSFTVYIIPSLAHILTYRTASARMNAAEKPPFFLPSWTGMFVLNMFIVVWVLVV  443

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFG GGWASMVNF+RQI+TFGLFAKCYQCPK
Sbjct  444  GFGLGGWASMVNFIRQIDTFGLFAKCYQCPK  474



>ref|XP_011035981.1| PREDICTED: auxin transporter-like protein 2 [Populus euphratica]
Length=473

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQ+FK IYL+AT+YV TLTLPSA+A YWAFGD LL HSNA SLLPRTG+RD AV+LM
Sbjct  256  MWKPQRFKYIYLLATLYVFTLTLPSAAATYWAFGDQLLTHSNAFSLLPRTGWRDAAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RA+ RLPVVIPIWF AIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVIGMHDTKSILLRAICRLPVVIPIWFFAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLV+FTVYIIPA+AHM+T+ S +AR+NAVE+PP  +  W   Y +N F+V WV +V
Sbjct  376  AVGALLVTFTVYIIPALAHMLTYRSASARQNAVEKPPVFLPSWTAMYVLNAFIVVWVLVV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFG GGWASM NF++Q++TFGLFAKCYQCP   AA
Sbjct  436  GFGLGGWASMSNFIKQVDTFGLFAKCYQCPPSAAA  470



>emb|CCF23025.1| auxin influx carrier protein [Mangifera indica]
 gb|AFG18185.1| auxin influx carrier component [Mangifera indica]
Length=481

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YV TLT+PSA+AVYWAFGD LL+HSNA SLLPRTG+RDTAV+LM
Sbjct  258  MWKPQKFKYIYLFATLYVFTLTIPSATAVYWAFGDQLLNHSNAFSLLPRTGWRDTAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+   +AR+NA E+PP  M  WA  Y  N F+V WV +V
Sbjct  378  AVGALLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFMPSWAAMYAFNTFIVVWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFV+Q++TFGLFAKCYQC
Sbjct  438  GFGFGGWASMTNFVQQVDTFGLFAKCYQC  466



>ref|XP_009122845.1| PREDICTED: auxin transporter-like protein 1 isoform X2 [Brassica 
rapa]
Length=438

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRD AV+LM
Sbjct  212  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDAAVILM  271

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RA+ RLPVV+PIWFLAIIFPFFGPINS
Sbjct  272  LIHQFITFGFACTPLYFVWEKAIGMHHTKSIFLRAIVRLPVVVPIWFLAIIFPFFGPINS  331

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ + +AR NA E+PP  +  W+G Y +N FVV WV ++
Sbjct  332  AVGALLVSFTVYIIPALAHMLTYRTASARRNAAEKPPFFLPSWSGVYVINAFVVVWVLVL  391

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASM NF+RQI+TFGLFAKCYQC  
Sbjct  392  GFGFGGWASMTNFIRQIDTFGLFAKCYQCKS  422



>gb|KHM99981.1| Auxin transporter-like protein 2 [Glycine soja]
Length=483

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA AVYWAFGDMLL+HSNA SLLP+ GFRD AV+LM
Sbjct  258  MWKPQKFKYIYLLATLYVFTLTIPSAVAVYWAFGDMLLNHSNAFSLLPKNGFRDAAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  M  W   Y  N F+V WVF+V
Sbjct  378  AVGSLLVSFTVYIIPALAHMLTYRKASARQNAAERPPFFMPSWTVMYVFNAFIVVWVFVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFG GGWASM NF+RQI+TFGLFAKCYQC
Sbjct  438  GFGLGGWASMTNFIRQIDTFGLFAKCYQC  466



>ref|XP_002322969.2| auxin resistant 1 family protein [Populus trichocarpa]
 gb|EEF04730.2| auxin resistant 1 family protein [Populus trichocarpa]
Length=477

 Score =   308 bits (790),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LL+HSNA +LLPR GFRD AV+LM
Sbjct  258  MWKPQKFKYIYLMATLYVFTLTIPSATAVYWAFGDQLLNHSNAFALLPRNGFRDAAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+   +AR+NA E+PP  M  W   Y +N FVV WV +V
Sbjct  378  AVGALLVSFTVYIIPSLAHMLTYRKSSARQNAAEKPPFFMPSWTAMYVINTFVVVWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWASM NFVRQ++TFGLFAKCYQC    AA
Sbjct  438  GFGFGGWASMTNFVRQVDTFGLFAKCYQCKPAGAA  472



>ref|XP_009619160.1| PREDICTED: auxin transporter-like protein 4 [Nicotiana tomentosiformis]
Length=490

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+  +RD AV+LM
Sbjct  261  MWKPQKFKYIYLIATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKNAWRDAAVILM  320

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  321  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  380

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  M  W   Y +NIF+V WVF+V
Sbjct  381  AVGALLVSFTVYIIPALAHMLTYRKSSARQNAAEKPPFFMPSWTAMYAINIFIVGWVFVV  440

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQ++TFGLFAKCYQC
Sbjct  441  GFGFGGWASMTNFVRQVDTFGLFAKCYQC  469



>ref|XP_009407542.1| PREDICTED: auxin transporter-like protein 1 [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSA+AVYWAFGD LL HSNA SLLP +G+RD AV+LM
Sbjct  263  MWKPQKFKYIYLMATVYVFTLTLPSAAAVYWAFGDQLLSHSNAFSLLPNSGWRDAAVILM  322

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQ ITFGFACTPLYFVWEK IG+H+TKS+F RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  323  LIHQIITFGFACTPLYFVWEKVIGMHDTKSIFLRALARLPVVIPIWFLAIIFPFFGPINS  382

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            TVG+LLVSFTVYIIPAMAHM+T+ +P+AR++A E+PP  +  W   Y +N FVV WV +V
Sbjct  383  TVGALLVSFTVYIIPAMAHMLTYRTPSARQDAAEKPPFFLPSWTAMYAVNAFVVGWVLVV  442

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFG GGWAS+ NFV+Q++TFGLFAKCYQC
Sbjct  443  GFGLGGWASVTNFVKQVDTFGLFAKCYQC  471



>gb|ABK24607.1| unknown [Picea sitchensis]
Length=496

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSA +VYWAFGD LLDH+NALSLLP++GFRD AVVLM
Sbjct  258  MWKPKKFKAIYLLATLYVYTLTLPSAISVYWAFGDALLDHANALSLLPKSGFRDLAVVLM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+ KRALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIVKRALARLPVVIPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPAMAH++T+ +  AR+NAVE+PP  +  W   Y +NIFVV WV IV
Sbjct  378  AVGALLVSFTVYIIPAMAHILTYRTAFARKNAVEKPPFFLPSWTAVYLVNIFVVIWVLIV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GF FGGWAS+ NFVRQ+++FGLFAKCYQCP
Sbjct  438  GFAFGGWASLTNFVRQVDSFGLFAKCYQCP  467



>ref|XP_004169795.1| PREDICTED: LOW QUALITY PROTEIN: auxin transporter protein 1-like, 
partial [Cucumis sativus]
Length=224

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFKLIYL+AT+YV TLT+PSA+AVYWAFGD LL HSNA SLLP  G+R TAVVLM
Sbjct  6    MWKPRKFKLIYLIATLYVFTLTIPSATAVYWAFGDQLLTHSNAFSLLPTNGWRTTAVVLM  65

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFA TPLYFVWEK IG+H TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  66   LIHQFITFGFASTPLYFVWEKVIGMHETKSMCLRALARLPVVIPIWFLAIIFPFFGPINS  125

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+TF S +AR+NAVE+ P  +  WA  Y +N F+V WV ++
Sbjct  126  AVGALLVSFTVYIIPSLAHMLTFRSASARQNAVEKLPIFLPSWAAMYVVNSFIVIWVLVI  185

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWASM NF++Q++TFGLFAKCYQCP    A
Sbjct  186  GFGFGGWASMANFIKQVDTFGLFAKCYQCPPQGPA  220



>gb|AII98157.1| auxin influx transport protein [Discaria trinervis]
Length=481

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRD AV+LM
Sbjct  258  MWKPQKFKYIYLLATLYVFTLTLPSASAVYWAFGDELLNHSNAFSLLPKTRFRDAAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVV+PIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVVPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  +  W   Y +N FV+ WVF+V
Sbjct  378  AVGALLVSFTVYIIPALAHMLTYRKASARQNAAEKPPFFLPSWTAIYALNAFVIVWVFVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQ++TFGLFAKCYQC
Sbjct  438  GFGFGGWASMTNFVRQVDTFGLFAKCYQC  466



>ref|XP_002873019.1| hypothetical protein ARALYDRAFT_486953 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49278.1| hypothetical protein ARALYDRAFT_486953 [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRDTAV+LM
Sbjct  265  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDTAVILM  324

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKSL  RAL RLPVV+PIWFLAIIFPFFGPINS
Sbjct  325  LIHQFITFGFACTPLYFVWEKAIGMHHTKSLCLRALVRLPVVVPIWFLAIIFPFFGPINS  384

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ + +AR NA E+PP  +  WAG Y +N F+V WV ++
Sbjct  385  AVGALLVSFTVYIIPALAHMLTYRTASARRNAAEKPPFFIPSWAGVYVINAFIVVWVLVL  444

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF+RQI+TFGLFAKCYQC 
Sbjct  445  GFGFGGWASMTNFIRQIDTFGLFAKCYQCK  474



>ref|NP_001150441.1| LOC100284071 [Zea mays]
 gb|ACG39119.1| auxin transporter-like protein 3 [Zea mays]
Length=520

 Score =   310 bits (793),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL  SNAL+LLPRT FRD AVVLM
Sbjct  262  MWRPQKFKAIYLMATLYVLTLTLPSAASVYWAFGDQLLTRSNALALLPRTAFRDAAVVLM  321

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L HQFITFGFACTPLYFVWEK +G+H+ +SL +RA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  322  LAHQFITFGFACTPLYFVWEKLVGLHDCRSLCRRAAARLPVVVPIWFLAIIFPFFGPINS  381

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMITF S  ARENA+E PP  +G W G Y +N FVVAWV +V
Sbjct  382  AVGSLLVSFTVYIIPALAHMITFRSATARENAMEPPPRLLGRWTGAYMINAFVVAWVLVV  441

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQI+TFGLF KCYQC
Sbjct  442  GFGFGGWASMTNFVRQIDTFGLFTKCYQC  470



>ref|XP_011001993.1| PREDICTED: auxin transporter-like protein 2 [Populus euphratica]
Length=491

 Score =   308 bits (790),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 180/209 (86%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YVLTLTLPS +AVYWAFGD LL+HSNA +LLPR+  RD AV+LM
Sbjct  252  MWKPQKFKAIYLLATLYVLTLTLPSGAAVYWAFGDTLLNHSNAFALLPRSSSRDMAVILM  311

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H  KSL KRA ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  312  LIHQFITFGFACTPLYFVWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINS  371

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
            +VGSLLVSFTVYIIPA+AHM TF S AARENAVEQP    G W G Y +N FVV WV IV
Sbjct  372  SVGSLLVSFTVYIIPALAHMFTFKSSAARENAVEQPSKYTGRWVGAYMINTFVVVWVLIV  431

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+ QI+TFGLF KCYQC
Sbjct  432  GFGFGGWASMTNFIHQIDTFGLFTKCYQC  460



>emb|CDY07751.1| BnaA03g17600D [Brassica napus]
Length=536

 Score =   310 bits (794),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LLDHSNA SLLP+ G+RDTAV+LM
Sbjct  307  MWKPQKFKYIYLMATLYVFTLTIPSASAVYWAFGDELLDHSNAFSLLPKNGWRDTAVILM  366

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  367  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  426

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+ S  AR+NA E+PP  +  WA  Y +N FVV WV IV
Sbjct  427  AVGALLVSFTVYIIPSLAHMLTYRSACARQNAAEKPPFFLPSWAAMYVLNAFVVIWVLIV  486

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC 
Sbjct  487  GFGFGGWASVTNFVRQVDTFGLFAKCYQCK  516



>ref|XP_011094989.1| PREDICTED: auxin transporter-like protein 2 [Sesamum indicum]
Length=483

 Score =   308 bits (789),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+ G+RD AV+LM
Sbjct  259  MWKPQKFKYIYLLATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKNGWRDAAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+T+S+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKVIGMHDTRSICLRALARLPVVIPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  M  WA  Y +N FVV W+ +V
Sbjct  379  AVGALLVSFTVYIIPALAHMLTYRKASARQNAAEKPPPFMPSWAAMYAINTFVVIWILVV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC
Sbjct  439  GFGFGGWASVTNFVRQVDTFGLFAKCYQC  467



>tpg|DAA44356.1| TPA: auxin transporter-like protein 3 [Zea mays]
Length=520

 Score =   309 bits (792),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MW+PQKFK IYL+AT+YVLTLTLPSA++VYWAFGD LL  SNAL+LLPRT FRD AVVLM
Sbjct  262  MWRPQKFKAIYLMATLYVLTLTLPSAASVYWAFGDQLLTRSNALALLPRTAFRDAAVVLM  321

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            L HQFITFGFACTPLYFVWEK +G+H+ +SL +RA ARLPVV+PIWFLAIIFPFFGPINS
Sbjct  322  LAHQFITFGFACTPLYFVWEKLVGLHDCRSLCRRAAARLPVVVPIWFLAIIFPFFGPINS  381

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VGSLLVSFTVYIIPA+AHMITF S  ARENA+E PP  +G W G Y +N FVVAWV +V
Sbjct  382  AVGSLLVSFTVYIIPALAHMITFRSATARENAMEPPPRLLGRWTGAYMINAFVVAWVLVV  441

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQI+TFGLF KCYQC
Sbjct  442  GFGFGGWASMTNFVRQIDTFGLFTKCYQC  470



>ref|NP_001233919.1| LAX1 protein [Solanum lycopersicum]
 ref|XP_010325706.1| PREDICTED: LAX1 protein isoform X1 [Solanum lycopersicum]
 gb|AEI69668.1| LAX1 protein [Solanum lycopersicum]
Length=487

 Score =   308 bits (789),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+ G+RD AV+LM
Sbjct  260  MWKPQKFKYIYLIATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKNGWRDAAVILM  319

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+T+S+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  320  LIHQFITFGFACTPLYFVWEKVIGMHDTRSICLRALARLPVVIPIWFLAIIFPFFGPINS  379

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+   +AR+NA E+PP  M  W   Y +N F+V WVF+V
Sbjct  380  AVGALLVSFTVYIIPALAHMLTYRKSSARQNAAEKPPFFMPSWTAMYVINTFIVVWVFVV  439

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFV+Q++TFGLFAKCYQC
Sbjct  440  GFGFGGWASMTNFVKQVDTFGLFAKCYQC  468



>ref|XP_010095085.1| hypothetical protein L484_026394 [Morus notabilis]
 gb|EXB58191.1| hypothetical protein L484_026394 [Morus notabilis]
Length=482

 Score =   308 bits (789),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LL HSNA+SLLPR+G+RDT V+LM
Sbjct  259  MWKPQKFKYIYLLATLYVFTLTIPSAAAVYWAFGDQLLTHSNAISLLPRSGWRDTGVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+TF S +AR+NA E+PP  M  W   Y +N F+V WV IV
Sbjct  379  AVGALLVSFTVYIIPSLAHMLTFRSASARQNATEKPPFFMPSWTAMYVVNAFIVVWVLIV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF++Q++TFGLFAKCYQC
Sbjct  439  GFGFGGWASMRNFIKQVDTFGLFAKCYQC  467



>ref|XP_004492419.1| PREDICTED: auxin transporter-like protein 2-like [Cicer arietinum]
Length=489

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LL+HSNA SLLP+ GFRD AV+LM
Sbjct  262  MWKPQKFKYIYLLATLYVFTLTIPSASAVYWAFGDELLNHSNAFSLLPKNGFRDAAVILM  321

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  322  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  381

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP+ AHM+T+   +AR+NA E+PP  M  W   Y +N F+V WVF+V
Sbjct  382  AVGALLVSFTVYIIPSAAHMLTYRKASARQNAAEKPPFFMPSWTAMYILNAFIVVWVFVV  441

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+RQI+TFGLFAKCYQC
Sbjct  442  GFGFGGWASMTNFIRQIDTFGLFAKCYQC  470



>ref|XP_006398638.1| hypothetical protein EUTSA_v10013364mg [Eutrema salsugineum]
 ref|XP_006398639.1| hypothetical protein EUTSA_v10013364mg [Eutrema salsugineum]
 gb|ESQ40091.1| hypothetical protein EUTSA_v10013364mg [Eutrema salsugineum]
 gb|ESQ40092.1| hypothetical protein EUTSA_v10013364mg [Eutrema salsugineum]
Length=492

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRD AV+LM
Sbjct  267  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDAAVILM  326

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RA+ RLPVVIPIWFLAIIFPFFGPINS
Sbjct  327  LIHQFITFGFACTPLYFVWEKAIGMHHTKSIFVRAIVRLPVVIPIWFLAIIFPFFGPINS  386

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ + +AR NA E+PP  +  WAG Y +N FVV WV ++
Sbjct  387  AVGALLVSFTVYIIPALAHMLTYRTASARRNAAEKPPFFLPSWAGVYVINAFVVVWVLVL  446

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+RQI+TFGLFAKCYQC
Sbjct  447  GFGFGGWASMTNFIRQIDTFGLFAKCYQC  475



>gb|AAG17171.1|AF190880_1 putative AUX1-like permease [Populus tremula x Populus tremuloides]
Length=473

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQ+FK IYL+AT+YV TLTLPSA+A YWAFGD LL HSNA SLLPRTG+RD AV+LM
Sbjct  256  MWKPQRFKYIYLLATLYVFTLTLPSAAATYWAFGDQLLTHSNAFSLLPRTGWRDAAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RAL RLPVVIPIWF AIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVIGMHDTKSILLRALCRLPVVIPIWFFAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLV+FTVYIIPA+AHM+T+ S +AR+NAVE+PP  +  W   Y +N F+V WV +V
Sbjct  376  AVGALLVTFTVYIIPALAHMLTYRSASARQNAVEKPPVFLPSWTAMYVLNAFIVVWVLVV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFG GGWASM NF++Q++TFGLFAKC QCP+  AA
Sbjct  436  GFGLGGWASMSNFIKQVDTFGLFAKCCQCPRSAAA  470



>emb|CDY40307.1| BnaA10g27610D [Brassica napus]
Length=495

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRD AV+LM
Sbjct  269  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDAAVILM  328

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RA+ RLPVV+PIWFLAIIFPFFGPINS
Sbjct  329  LIHQFITFGFACTPLYFVWEKAIGMHHTKSIFLRAIVRLPVVVPIWFLAIIFPFFGPINS  388

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ + +AR NA E+PP  +  W+G Y +N FVV WV ++
Sbjct  389  AVGALLVSFTVYIIPALAHMLTYRTASARRNAAEKPPFFLPSWSGVYVINAFVVVWVLVL  448

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASM NF+RQI+TFGLFAKCYQC  
Sbjct  449  GFGFGGWASMTNFIRQIDTFGLFAKCYQCKS  479



>ref|XP_004137726.1| PREDICTED: auxin transporter-like protein 2-like [Cucumis sativus]
 gb|KGN58778.1| hypothetical protein Csa_3G731880 [Cucumis sativus]
Length=478

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLTLPSA+AVYWAFGD LL+HSNA SLLP++ FRD AV+LM
Sbjct  256  MWKPQKFKYIYLMATLYVFTLTLPSATAVYWAFGDELLNHSNAFSLLPKSRFRDAAVILM  315

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RA+ARLPVVIPIWFLAIIFPFFGPINS
Sbjct  316  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRAIARLPVVIPIWFLAIIFPFFGPINS  375

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPAMAHM+T+   +AR+NA E+PP  +  W G Y +N FVVAWV +V
Sbjct  376  AVGALLVSFTVYIIPAMAHMLTYRKASARQNAAEKPPFFIPSWVGMYALNTFVVAWVLVV  435

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NFVRQ++TFGLFAKCYQC
Sbjct  436  GFGFGGWASMTNFVRQVDTFGLFAKCYQC  464



>dbj|BAC98948.1| AUX1-like auxin influx carrier protein [Pisum sativum]
 dbj|BAH23797.1| putative auxin transport facilitator protein [Pisum sativum]
Length=487

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSASAVYWAFGD LL+HSNA SLLP+ GFRD AVVLM
Sbjct  261  MWKPQKFKYIYLLATLYVFTLTIPSASAVYWAFGDELLNHSNAFSLLPKNGFRDGAVVLM  320

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+T+S+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  321  LIHQFITFGFACTPLYFVWEKVIGMHDTRSICLRALARLPVVIPIWFLAIIFPFFGPINS  380

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP+ AHM+T+   +AR+NA E+PP  M  W   Y +N F+V WVF+V
Sbjct  381  AVGALLVSFTVYIIPSAAHMLTYRKASARQNAAEKPPFFMPSWTAMYILNAFIVVWVFVV  440

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF+RQI+TFGLFAKCYQC
Sbjct  441  GFGFGGWASMTNFIRQIDTFGLFAKCYQC  469



>ref|XP_009402291.1| PREDICTED: auxin transporter-like protein 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=230

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IY +AT+YV TLTLPSA+AVYWAFGD LL HSNA SLLP++G+RD AV+LM
Sbjct  4    MWKPRKFKYIYFLATVYVFTLTLPSAAAVYWAFGDQLLTHSNAFSLLPKSGWRDAAVILM  63

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+T+S+  R+LARLPVVIPIWFLAIIFPFFGPINS
Sbjct  64   LIHQFITFGFACTPLYFVWEKVIGMHDTESICMRSLARLPVVIPIWFLAIIFPFFGPINS  123

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPAMAHM+T+ +P+AR+NAVE+ P  +  W   Y +N FVV WV + 
Sbjct  124  AVGALLVSFTVYIIPAMAHMLTYRTPSARQNAVEKLPFFLPSWTAMYVVNAFVVGWVMVA  183

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFG GGWAS++NFV+Q++TFGLFAKCYQC
Sbjct  184  GFGLGGWASVINFVKQVDTFGLFAKCYQC  212



>ref|XP_002526879.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF35510.1| amino acid transporter, putative [Ricinus communis]
Length=472

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LL HSNA SLLP +G+RD AV+LM
Sbjct  258  MWKPQKFKYIYLLATLYVFTLTIPSATAVYWAFGDQLLTHSNAFSLLPHSGWRDAAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H+TKS+F RAL RLPVVIPIWF AIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKVVGMHDTKSIFLRALTRLPVVIPIWFFAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+ S +AR+NA E+PP  +  W   Y +N F+  WV +V
Sbjct  378  AVGALLVSFTVYIIPSLAHMLTYRSASARQNAAEKPPFFLPSWTAMYLVNAFIAIWVLVV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHK  639
            GFG GGWASM NF+RQ++TFGLFAKCYQCP  K
Sbjct  438  GFGLGGWASMTNFIRQVDTFGLFAKCYQCPGAK  470



>ref|NP_195744.1| auxin transporter-like protein 1 [Arabidopsis thaliana]
 sp|Q9LFB2.1|LAX1_ARATH RecName: Full=Auxin transporter-like protein 1; AltName: Full=AUX1-like 
protein 1 [Arabidopsis thaliana]
 emb|CAB69852.1| LAX1 / AUX1-like permease [Arabidopsis thaliana]
 gb|AED90315.1| auxin transporter-like protein 1 [Arabidopsis thaliana]
Length=488

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRDTAV+LM
Sbjct  265  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDTAVILM  324

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKSL  RAL RLPVV+PIWFLAIIFPFFGPINS
Sbjct  325  LIHQFITFGFACTPLYFVWEKAIGMHHTKSLCLRALVRLPVVVPIWFLAIIFPFFGPINS  384

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLV+FTVYIIPA+AHM+T+ + +AR NA E+PP  +  WAG Y +N F+V WV ++
Sbjct  385  AVGALLVTFTVYIIPALAHMLTYRTASARRNAAEKPPFFIPSWAGVYVINAFIVVWVLVL  444

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF+RQI+TFGLFAKCYQC 
Sbjct  445  GFGFGGWASMTNFIRQIDTFGLFAKCYQCK  474



>gb|AAR18696.1| auxin transporter protein 1 [Populus tomentosa]
Length=224

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LL+HSNA +LLP+ GFRD AV+LM
Sbjct  5    MWKPQKFKYIYLMATLYVFTLTIPSATAVYWAFGDDLLNHSNAFALLPKNGFRDAAVILM  64

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  65   LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  124

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+   +AR+NA E+PP  +  W   Y +N FVV WV +V
Sbjct  125  AVGALLVSFTVYIIPSLAHMLTYRKSSARQNAAEKPPFFLPSWTAMYVVNTFVVVWVLVV  184

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWASM NFVRQ++TFGLFAKCYQC    AA
Sbjct  185  GFGFGGWASMTNFVRQVDTFGLFAKCYQCKPAGAA  219



>ref|XP_009122843.1| PREDICTED: auxin transporter-like protein 1 isoform X1 [Brassica 
rapa]
 ref|XP_009122844.1| PREDICTED: auxin transporter-like protein 1 isoform X1 [Brassica 
rapa]
Length=495

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IYL+AT+YV TLTLPSASAVYWAFGD LL+HSNA SLLP+T FRD AV+LM
Sbjct  269  MWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDAAVILM  328

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RA+ RLPVV+PIWFLAIIFPFFGPINS
Sbjct  329  LIHQFITFGFACTPLYFVWEKAIGMHHTKSIFLRAIVRLPVVVPIWFLAIIFPFFGPINS  388

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA+AHM+T+ + +AR NA E+PP  +  W+G Y +N FVV WV ++
Sbjct  389  AVGALLVSFTVYIIPALAHMLTYRTASARRNAAEKPPFFLPSWSGVYVINAFVVVWVLVL  448

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPK  633
            GFGFGGWASM NF+RQI+TFGLFAKCYQC  
Sbjct  449  GFGFGGWASMTNFIRQIDTFGLFAKCYQCKS  479



>ref|XP_007141783.1| hypothetical protein PHAVU_008G225300g [Phaseolus vulgaris]
 gb|ESW13777.1| hypothetical protein PHAVU_008G225300g [Phaseolus vulgaris]
Length=479

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT++V TLTLPSA AVYWAFGD LLDHSNA SLLPR+G+RDT V+LM
Sbjct  257  MWKPQKFKYIYLYATLFVFTLTLPSAIAVYWAFGDQLLDHSNAFSLLPRSGWRDTGVILM  316

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  317  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  376

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLV+FTVYIIPA AHM+T+ S +AR+NA E+ P  +  W   Y +N FVV WV +V
Sbjct  377  AVGALLVTFTVYIIPASAHMLTYRSASARQNAAEKLPFFVPSWTLMYVINAFVVVWVLVV  436

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCPKHKAA  645
            GFGFGGWASM NF++Q++TFGLFAKCYQCP HK A
Sbjct  437  GFGFGGWASMTNFIKQVDTFGLFAKCYQCPPHKTA  471



>ref|XP_009787603.1| PREDICTED: auxin transporter-like protein 2 [Nicotiana sylvestris]
Length=218

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YV TLTLPSA+AVYWAFGD LLDH+NA SLLPR GFRDTAV+LM
Sbjct  4    MWKPQKFKYIYLYATLYVFTLTLPSAAAVYWAFGDQLLDHANAFSLLPRNGFRDTAVILM  63

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK +G+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  64   LIHQFITFGFACTPLYFVWEKVVGMHDTKSICWRALARLPVVIPIWFLAIIFPFFGPINS  123

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPA AHM+T+   +AR+NA E+PP  +  W   Y +N+FVV W F+V
Sbjct  124  AVGALLVSFTVYIIPAAAHMLTYRKASARQNAAEKPPFFLPSWTAVYAVNVFVVVWAFVV  183

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWASM NF++Q++TFGLFAKCYQC
Sbjct  184  GFGFGGWASMTNFIKQVDTFGLFAKCYQC  212



>ref|XP_009402290.1| PREDICTED: auxin transporter-like protein 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=251

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKP+KFK IY +AT+YV TLTLPSA+AVYWAFGD LL HSNA SLLP++G+RD AV+LM
Sbjct  25   MWKPRKFKYIYFLATVYVFTLTLPSAAAVYWAFGDQLLTHSNAFSLLPKSGWRDAAVILM  84

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+T+S+  R+LARLPVVIPIWFLAIIFPFFGPINS
Sbjct  85   LIHQFITFGFACTPLYFVWEKVIGMHDTESICMRSLARLPVVIPIWFLAIIFPFFGPINS  144

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIPAMAHM+T+ +P+AR+NAVE+ P  +  W   Y +N FVV WV + 
Sbjct  145  AVGALLVSFTVYIIPAMAHMLTYRTPSARQNAVEKLPFFLPSWTAMYVVNAFVVGWVMVA  204

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFG GGWAS++NFV+Q++TFGLFAKCYQC
Sbjct  205  GFGLGGWASVINFVKQVDTFGLFAKCYQC  233



>ref|XP_004490968.1| PREDICTED: auxin transporter-like protein 1-like isoform X1 [Cicer 
arietinum]
Length=479

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YV TLTLPSA AVYWAFGD LLDHSNA SLLPR G+RD AV+LM
Sbjct  258  MWKPQKFKSIYLFATLYVFTLTLPSAIAVYWAFGDQLLDHSNAFSLLPRNGWRDAAVILM  317

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  318  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFLRALARLPVVIPIWFLAIIFPFFGPINS  377

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVY+IPA AHM+T+ S +AR+NA E+ P  +  W   Y +NIFVV WV IV
Sbjct  378  AVGALLVSFTVYVIPASAHMLTYRSASARQNAAEKLPYFLPSWTAMYVINIFVVVWVTIV  437

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF++Q++TFGLFAKCYQCP
Sbjct  438  GFGFGGWASMTNFIKQVDTFGLFAKCYQCP  467



>ref|XP_004490969.1| PREDICTED: auxin transporter-like protein 1-like isoform X2 [Cicer 
arietinum]
Length=469

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL AT+YV TLTLPSA AVYWAFGD LLDHSNA SLLPR G+RD AV+LM
Sbjct  248  MWKPQKFKSIYLFATLYVFTLTLPSAIAVYWAFGDQLLDHSNAFSLLPRNGWRDAAVILM  307

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+F RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  308  LIHQFITFGFACTPLYFVWEKVIGMHDTKSIFLRALARLPVVIPIWFLAIIFPFFGPINS  367

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVY+IPA AHM+T+ S +AR+NA E+ P  +  W   Y +NIFVV WV IV
Sbjct  368  AVGALLVSFTVYVIPASAHMLTYRSASARQNAAEKLPYFLPSWTAMYVINIFVVVWVTIV  427

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            GFGFGGWASM NF++Q++TFGLFAKCYQCP
Sbjct  428  GFGFGGWASMTNFIKQVDTFGLFAKCYQCP  457



>ref|XP_010505424.1| PREDICTED: auxin transporter protein 1-like [Camelina sativa]
Length=485

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LLDHSNA SL+P+ G+RD AV+LM
Sbjct  259  MWKPQKFKYIYLMATLYVFTLTIPSAAAVYWAFGDALLDHSNAFSLMPKNGWRDAAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+ S +AR+NA E+PP  M  W   Y +N FVV WV IV
Sbjct  379  AVGALLVSFTVYIIPSLAHMLTYRSASARQNAAEKPPFFMPSWTAMYVLNAFVVVWVLIV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC
Sbjct  439  GFGFGGWASVTNFVRQVDTFGLFAKCYQC  467



>ref|XP_006293379.1| hypothetical protein CARUB_v10023103mg [Capsella rubella]
 gb|EOA26277.1| hypothetical protein CARUB_v10023103mg [Capsella rubella]
Length=485

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LLDHSNA SL+P+ G+RD AV+LM
Sbjct  259  MWKPQKFKYIYLMATLYVFTLTIPSAAAVYWAFGDALLDHSNAFSLMPKNGWRDAAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+ S +AR+NA E+PP  M  W   Y +N FVV WV IV
Sbjct  379  AVGALLVSFTVYIIPSLAHMLTYRSASARQNAAEKPPFFMPSWTAMYVLNAFVVIWVLIV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC
Sbjct  439  GFGFGGWASVTNFVRQVDTFGLFAKCYQC  467



>ref|XP_010509224.1| PREDICTED: auxin transporter protein 1 isoform X1 [Camelina sativa]
 ref|XP_010509225.1| PREDICTED: auxin transporter protein 1 isoform X2 [Camelina sativa]
Length=485

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFK IYL+AT+YV TLT+PSA+AVYWAFGD LLDHSNA SL+P+ G+RD AV+LM
Sbjct  259  MWKPQKFKYIYLMATLYVFTLTIPSAAAVYWAFGDALLDHSNAFSLMPKNGWRDAAVILM  318

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKSLFKRALARLPVVIPIWFLAIIFPFFGPINS  360
            LIHQFITFGFACTPLYFVWEK IG+H+TKS+  RALARLPVVIPIWFLAIIFPFFGPINS
Sbjct  319  LIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS  378

Query  361  TVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfiv  540
             VG+LLVSFTVYIIP++AHM+T+ S +AR+NA E+PP  M  W   Y +N FVV WV IV
Sbjct  379  AVGALLVSFTVYIIPSLAHMLTYRSASARQNAAEKPPFFMPSWTAMYVLNAFVVIWVLIV  438

Query  541  gfgfggwaSMVNFVRQINTFGLFAKCYQC  627
            GFGFGGWAS+ NFVRQ++TFGLFAKCYQC
Sbjct  439  GFGFGGWASVTNFVRQVDTFGLFAKCYQC  467



>dbj|BAJ88422.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 187/211 (89%), Gaps = 1/211 (0%)
 Frame = +1

Query  1    MWKPQKFKLIYLVATIYVLTLTLPSASAVYWAFGDMLLDHSNALSLLPRTGFRDTAVVLM  180
            MWKPQKFKLIYL+AT+YVLTLTLPSASA+YWAFGD LLDHSNA SLLPR+ FRD AVVLM
Sbjct  272  MWKPQKFKLIYLMATLYVLTLTLPSASAMYWAFGDALLDHSNAFSLLPRSPFRDAAVVLM  331

Query  181  LIHQFITFGFACTPLYFVWEKFIGVHNTKS-LFKRALARLPVVIPIWFLAIIFPFFGPIN  357
            LIHQFITFGFACTPLYFVWEK IGVH  ++ + +RA ARLPVV PIWFLA++FPFFGPIN
Sbjct  332  LIHQFITFGFACTPLYFVWEKAIGVHGDRTGVLRRAAARLPVVAPIWFLAVVFPFFGPIN  391

Query  358  STVGSLLVSFTVYIIPAMAHMITFASPAARENAVEQPPSSMGGWAGFYCMNifvvawvfi  537
            STVGSLLVSFTVYIIPA AHM  FA+PAARE AVE+PP  +GGWAG Y  N FVVAWV +
Sbjct  392  STVGSLLVSFTVYIIPAAAHMAVFAAPAAREGAVERPPRGLGGWAGMYAANCFVVAWVLV  451

Query  538  vgfgfggwaSMVNFVRQINTFGLFAKCYQCP  630
            VGFGFGGWAS VNFVRQ+NTFGLF KCYQCP
Sbjct  452  VGFGFGGWASTVNFVRQVNTFGLFTKCYQCP  482



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1907210278062