BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14316_g2_i1 len=315 path=[2299:0-54 581:55-79 606:80-314]

Length=315
                                                                      Score     E

ref|XP_010257658.1|  PREDICTED: uncharacterized protein LOC104597668  90.1    1e-20   
ref|XP_009614780.1|  PREDICTED: uncharacterized protein LOC104107633  87.4    9e-20   
ref|XP_011071703.1|  PREDICTED: uncharacterized protein LOC105157100  85.9    4e-19   
ref|XP_007037380.1|  Disulfide bond formation protein B 2, putative   84.7    2e-18   
ref|XP_009778626.1|  PREDICTED: uncharacterized protein LOC104227941  82.8    6e-18   
emb|CBI15215.3|  unnamed protein product                              82.4    7e-18   
ref|XP_010089913.1|  hypothetical protein L484_008601                 81.6    2e-17   
gb|KDO55556.1|  hypothetical protein CISIN_1g034319mg                 79.0    2e-16   
ref|XP_006477463.1|  PREDICTED: uncharacterized protein LOC102629387  79.0    3e-16   
ref|XP_008393167.1|  PREDICTED: uncharacterized protein LOC103455361  77.4    6e-16   
gb|KDP31261.1|  hypothetical protein JCGZ_11637                       76.6    1e-15   
ref|XP_008239934.1|  PREDICTED: uncharacterized protein LOC103338502  76.3    2e-15   
ref|XP_006440608.1|  hypothetical protein CICLE_v10022899mg           76.6    2e-15   
ref|XP_002514747.1|  conserved hypothetical protein                   75.9    3e-15   Ricinus communis
gb|KEH33317.1|  transmembrane protein, putative                       72.8    4e-14   
ref|XP_007211066.1|  hypothetical protein PRUPE_ppa018164mg           70.9    1e-13   
emb|CDP12297.1|  unnamed protein product                              70.9    2e-13   
gb|KHG17616.1|  Protein rhsA                                          70.5    3e-13   
ref|XP_011087241.1|  PREDICTED: uncharacterized protein LOC105168788  68.2    2e-12   
ref|XP_008442734.1|  PREDICTED: uncharacterized protein LOC103486492  67.8    3e-12   
gb|KGN64005.1|  hypothetical protein Csa_1G033240                     67.0    5e-12   
ref|XP_010917058.1|  PREDICTED: uncharacterized protein LOC105041...  65.5    2e-11   
ref|XP_008787105.1|  PREDICTED: uncharacterized protein LOC103705237  64.3    6e-11   
emb|CDP00346.1|  unnamed protein product                              63.9    6e-11   
ref|XP_010029913.1|  PREDICTED: uncharacterized protein LOC104419825  63.5    1e-10   
gb|KHN26251.1|  hypothetical protein glysoja_032821                   63.2    2e-10   
ref|XP_003549681.1|  PREDICTED: uncharacterized protein LOC100527473  62.8    2e-10   
ref|XP_010939812.1|  PREDICTED: uncharacterized protein LOC105058551  62.8    2e-10   
ref|XP_006292129.1|  hypothetical protein CARUB_v10018333mg           61.6    5e-10   
gb|KHN01869.1|  hypothetical protein glysoja_038964                   61.2    8e-10   
ref|XP_006374466.1|  hypothetical protein POPTR_0015s07360g           60.8    1e-09   
ref|XP_003524765.2|  PREDICTED: uncharacterized protein LOC100819493  60.8    2e-09   
gb|KHN48692.1|  hypothetical protein glysoja_015840                   60.8    2e-09   
ref|XP_011047177.1|  PREDICTED: uncharacterized protein LOC105141...  60.1    2e-09   
ref|XP_004514962.1|  PREDICTED: uncharacterized protein LOC101503829  60.1    2e-09   
ref|XP_004514961.1|  PREDICTED: uncharacterized protein LOC101503173  60.1    2e-09   
ref|XP_010678508.1|  PREDICTED: uncharacterized protein LOC104894040  60.1    2e-09   
ref|XP_010917057.1|  PREDICTED: uncharacterized protein LOC105041...  58.2    1e-08   
ref|XP_007155303.1|  hypothetical protein PHAVU_003G189400g           58.2    1e-08   
ref|XP_011047178.1|  PREDICTED: uncharacterized protein LOC105141...  57.8    1e-08   
gb|KCW48843.1|  hypothetical protein EUGRSUZ_K02478                   57.8    2e-08   
ref|XP_010037172.1|  PREDICTED: uncharacterized protein LOC104425979  57.4    2e-08   
ref|XP_010055020.1|  PREDICTED: uncharacterized protein LOC104443364  57.4    3e-08   
ref|XP_010538056.1|  PREDICTED: uncharacterized protein LOC104812541  55.8    9e-08   
ref|XP_003521876.1|  PREDICTED: uncharacterized protein LOC100776350  55.5    1e-07   
ref|XP_004493240.1|  PREDICTED: uncharacterized protein LOC101504239  54.3    2e-07   
emb|CAD56224.1|  hypothetical protein                                 54.3    2e-07   Cicer arietinum [garbanzo]
ref|XP_010550598.1|  PREDICTED: uncharacterized protein LOC104821419  54.3    2e-07   
ref|XP_007138176.1|  hypothetical protein PHAVU_009G186700g           54.3    3e-07   
ref|XP_002458674.1|  hypothetical protein SORBIDRAFT_03g037890        54.3    3e-07   Sorghum bicolor [broomcorn]
ref|XP_003548675.2|  PREDICTED: uncharacterized protein LOC100809764  53.5    8e-07   
gb|KHN46726.1|  hypothetical protein glysoja_014977                   53.5    9e-07   
gb|KCW89932.1|  hypothetical protein EUGRSUZ_A02145                   52.8    1e-06   
ref|XP_002312251.1|  hypothetical protein POPTR_0008s08730g           51.6    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007029945.1|  Uncharacterized protein TCM_025809               50.8    5e-06   
ref|XP_009149904.1|  PREDICTED: uncharacterized protein LOC103873234  50.4    6e-06   
ref|XP_006390422.1|  hypothetical protein EUTSA_v10019380mg           50.1    9e-06   
gb|KEH25543.1|  transmembrane protein, putative                       50.1    9e-06   
ref|XP_009353061.1|  PREDICTED: uncharacterized protein LOC103944347  49.7    1e-05   
emb|CDY61269.1|  BnaA06g38590D                                        49.3    2e-05   
gb|EYU20877.1|  hypothetical protein MIMGU_mgv1a017313mg              49.3    2e-05   
ref|XP_002275199.1|  PREDICTED: uncharacterized protein LOC100241637  48.9    2e-05   Vitis vinifera
gb|KFK34048.1|  hypothetical protein AALP_AA5G095400                  48.5    3e-05   
ref|NP_190335.1|  uncharacterized protein                             47.8    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417865.1|  PREDICTED: uncharacterized protein LOC103998...  47.8    6e-05   
ref|XP_002875843.1|  hypothetical protein ARALYDRAFT_485116           47.0    9e-05   
gb|KFK41893.1|  hypothetical protein AALP_AA2G185900                  46.6    1e-04   
gb|KDO36742.1|  hypothetical protein CISIN_1g034425mg                 46.6    1e-04   
ref|XP_007161898.1|  hypothetical protein PHAVU_001G106900g           46.6    1e-04   
ref|XP_003578108.1|  PREDICTED: uncharacterized protein LOC100834251  46.6    1e-04   
ref|XP_004493226.1|  PREDICTED: uncharacterized protein LOC101500413  46.2    2e-04   
gb|EMS45553.1|  hypothetical protein TRIUR3_31710                     46.2    2e-04   
ref|XP_009417864.1|  PREDICTED: uncharacterized protein LOC103998...  45.8    3e-04   
ref|XP_009382954.1|  PREDICTED: uncharacterized protein LOC103970766  45.4    3e-04   
ref|XP_004970359.1|  PREDICTED: uncharacterized protein LOC101758...  45.4    3e-04   
ref|XP_004970358.1|  PREDICTED: uncharacterized protein LOC101758...  45.4    4e-04   
gb|KHN34637.1|  hypothetical protein glysoja_011190                   45.1    5e-04   
gb|KDO36741.1|  hypothetical protein CISIN_1g034425mg                 44.7    7e-04   



>ref|XP_010257658.1| PREDICTED: uncharacterized protein LOC104597668 [Nelumbo nucifera]
 ref|XP_010257668.1| PREDICTED: uncharacterized protein LOC104597668 [Nelumbo nucifera]
 ref|XP_010257676.1| PREDICTED: uncharacterized protein LOC104597668 [Nelumbo nucifera]
 ref|XP_010257687.1| PREDICTED: uncharacterized protein LOC104597668 [Nelumbo nucifera]
Length=95

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDAD  112
            MA + LHLLVILL FSHLI LNA+PITR+R L+  ++        +  +Q   E  W+ +
Sbjct  1    MAGSPLHLLVILLSFSHLISLNAVPITRTRNLLSDTRVLLPADSENTHLQASTEEVWE-E  59

Query  111  NIVMRRVVAELNDYPGSGANNRHTPKP  31
             +   R+  ELNDYPGSGANNRHTPKP
Sbjct  60   ELANGRMGLELNDYPGSGANNRHTPKP  86



>ref|XP_009614780.1| PREDICTED: uncharacterized protein LOC104107633 [Nicotiana tomentosiformis]
Length=89

 Score = 87.4 bits (215),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 9/97 (9%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRL-VQKSQENDELIDTHIKMQDMVENSWDA  115
            MA    HL V  LCFSH     AIP+TRSR L V  SQE+  L +TH  M +M E   + 
Sbjct  1    MAGPFFHLFVAFLCFSH-----AIPVTRSRSLLVDISQEHKVLENTH--MANM-EERLEV  52

Query  114  DNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            +  + R + AE+NDYPGSGANNRHTP+PQ   +CV C
Sbjct  53   EETIRRVMEAEINDYPGSGANNRHTPRPQLGRSCVEC  89



>ref|XP_011071703.1| PREDICTED: uncharacterized protein LOC105157100 [Sesamum indicum]
Length=87

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 11/97 (11%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNA-IPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDA  115
            MA T + LLV +LCFS+LIC N  IP TRSR L+   Q+            + +  SW  
Sbjct  1    MAGTCIRLLVFVLCFSYLICKNGGIPFTRSRDLMTIMQKPG---------LEKLARSWKT  51

Query  114  DNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            D+   RR+  E+NDYPGSGANNRHTP+PQ    C+ C
Sbjct  52   DS-TKRRMEIEVNDYPGSGANNRHTPRPQLGRGCIDC  87



>ref|XP_007037380.1| Disulfide bond formation protein B 2, putative [Theobroma cacao]
 gb|EOY21881.1| Disulfide bond formation protein B 2, putative [Theobroma cacao]
Length=130

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = -1

Query  315  ITAIGVRTMATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDM  136
            + + G   M +T   ++V+LL   H++CLNA+PITR   L   +Q +    +TH+     
Sbjct  36   VQSTGKSAMESTLFRMIVVLLGLYHIVCLNAVPITRIGSLTHGAQVHQVPENTHLVA---  92

Query  135  VENSWDADNIVMRRVVAELNDYPGSGANNRHTPKPQ  28
             E S +A  I+  R+V ELNDYPGSGANNRHTP+PQ
Sbjct  93   AEKSSEAQ-IIKGRMVVELNDYPGSGANNRHTPRPQ  127



>ref|XP_009778626.1| PREDICTED: uncharacterized protein LOC104227941 [Nicotiana sylvestris]
Length=91

 Score = 82.8 bits (203),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 61/100 (61%), Gaps = 13/100 (13%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRL-VQKSQENDELIDTHIKMQDMVENSWDA  115
            MA    HL V  LCFSH     AIPITRSR L V  SQE+  L +TH+ +   +E   + 
Sbjct  1    MAGHFFHLFVAFLCFSH-----AIPITRSRSLLVDISQEHKVLENTHMAI---MEERLEV  52

Query  114  DNIVMRRVV---AELNDYPGSGANNRHTPKPQ*EHACVGC  4
            D  + RRV+   AE+NDYPGSGANNRH P+PQ   +C  C
Sbjct  53   DETI-RRVLEAEAEVNDYPGSGANNRHMPRPQLGRSCAEC  91



>emb|CBI15215.3| unnamed protein product [Vitis vinifera]
Length=83

 Score = 82.4 bits (202),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = -1

Query  285  TTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNI  106
             ++L LLVILL FS+LIC+NA+P+ R+RR+    Q +     + +   + +E  W+  NI
Sbjct  2    ASNLRLLVILLGFSYLICVNAVPVARTRRMHGYHQGHQV---SEVSFLNNMEKIWEEQNI  58

Query  105  VMRRVVAELNDYPGSGANNRHTPKPQ  28
               R+ AELNDYPGSGANNRHTP P 
Sbjct  59   -RARMDAELNDYPGSGANNRHTPNPH  83



>ref|XP_010089913.1| hypothetical protein L484_008601 [Morus notabilis]
 gb|EXB38573.1| hypothetical protein L484_008601 [Morus notabilis]
Length=95

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -1

Query  285  TTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNI  106
            T  L +LVI+LCFSHLI  NA+P+TR R L+  +Q +D L    I  Q   E   + +  
Sbjct  5    TLFLQVLVIVLCFSHLIFSNAVPVTRIRGLMHGNQAHD-LPQGTIHKQVTTEKILE-EKT  62

Query  105  VMRRVVAELNDYPGSGANNRHTPKPQ  28
            V  R+  EL+DYPGSGANNRHTPKPQ
Sbjct  63   VAERMDVELHDYPGSGANNRHTPKPQ  88



>gb|KDO55556.1| hypothetical protein CISIN_1g034319mg [Citrus sinensis]
Length=98

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -1

Query  288  ATTSLHLLVILLCFSHL-ICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDAD  112
            A +   LLV  L FSHL I LNA+P+TR   ++  +Q    L + +I++ D+ +    + 
Sbjct  4    AGSLFRLLVASLVFSHLVIFLNAVPVTRIGSIMNGAQVPQLLENGNIEVNDVTKLMKKSS  63

Query  111  NIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            N V  R+  ELNDYPGSGANNRHTP+PQ    CV C
Sbjct  64   N-VNERMALELNDYPGSGANNRHTPRPQFGRDCVAC  98



>ref|XP_006477463.1| PREDICTED: uncharacterized protein LOC102629387 [Citrus sinensis]
Length=120

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -1

Query  288  ATTSLHLLVILLCFSHL-ICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDAD  112
            A +   LLV  L FSHL I LNA+P+TR   ++  +Q    L + +I++ D+ +    + 
Sbjct  26   AGSLFRLLVASLVFSHLVIFLNAVPVTRIGSIMNGAQVPQLLENGNIEVNDVTKLMKKSS  85

Query  111  NIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            N V  R+  ELNDYPGSGANNRHTP+PQ    CV C
Sbjct  86   N-VNERMALELNDYPGSGANNRHTPRPQFGRDCVAC  120



>ref|XP_008393167.1| PREDICTED: uncharacterized protein LOC103455361 [Malus domestica]
Length=91

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 61/101 (60%), Gaps = 15/101 (15%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQ-----ENDELIDTHIKMQDMVEN  127
            MA++ LH+LVILL FSHL+ LNAIP TR   L    Q      +++L+ T        E 
Sbjct  1    MASSLLHVLVILLGFSHLVFLNAIPATRIGSLNHGPQLHQIAGSNKLVTT--------EK  52

Query  126  SWDADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            S+  +  +  R+  EL+DYPGSGANNRHTP+PQ E  C  C
Sbjct  53   SYK-EQAITERMDVELHDYPGSGANNRHTPRPQSER-CSDC  91



>gb|KDP31261.1| hypothetical protein JCGZ_11637 [Jatropha curcas]
Length=98

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 59/98 (60%), Gaps = 8/98 (8%)
 Frame = -1

Query  285  TTSLHLLVILLCFSHLI-CLNAIPITRSRRLVQKSQENDELIDTHI--KMQDMVENSWDA  115
            T+ LHL+VI L  SH I C NAIPITR  RLVQ  Q +    + H+  K +   EN  + 
Sbjct  5    TSLLHLIVIFLGISHFIFCNNAIPITRIGRLVQDPQIHPVQENIHMASKEESQEENMMNL  64

Query  114  DNIVMRRVVAELNDYPGSGANNRHTP-KPQ*EHACVGC  4
            D     R+V ELNDYPGSGAN+RHTP  PQ   +C  C
Sbjct  65   DG----RMVMELNDYPGSGANHRHTPWPPQLGRSCADC  98



>ref|XP_008239934.1| PREDICTED: uncharacterized protein LOC103338502 [Prunus mume]
Length=90

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 12/98 (12%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLIC-LNAIPITRSRRL-VQKSQENDELIDTHIKMQDMVENSWD  118
            +A T LHLLVI L FS LI  LNA+P+TR   L V +   N++L+ T        EN++ 
Sbjct  3    LAGTLLHLLVIFLGFSQLIIRLNAVPVTRIGSLQVHQIAGNNQLVTT--------ENNF-  53

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
             +  +  R+  EL+DYPGSGANNRHTPKPQ    CV C
Sbjct  54   YEQTITERMDVELHDYPGSGANNRHTPKPQ-FGRCVDC  90



>ref|XP_006440608.1| hypothetical protein CICLE_v10022899mg [Citrus clementina]
 gb|ESR53848.1| hypothetical protein CICLE_v10022899mg [Citrus clementina]
Length=121

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = -1

Query  270  LLVILLCFSHL-ICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMRR  94
            LLV  L FSHL I LNA+P+TR   ++   Q    L + +I++ D+ +    + N V  R
Sbjct  33   LLVASLVFSHLVIFLNAVPVTRIGSIMNGVQVPQLLENGNIEVNDVTKLMKKSSN-VNER  91

Query  93   VVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            +  ELNDYPGSGANNRHTP+PQ    CV C
Sbjct  92   MALELNDYPGSGANNRHTPRPQFGRDCVAC  121



>ref|XP_002514747.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47853.1| conserved hypothetical protein [Ricinus communis]
Length=92

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDAD  112
            MA T L LLV+ L  S+LICLNAIPITR  RL    Q       TH+  +D         
Sbjct  1    MAGTFLRLLVLFLGISNLICLNAIPITRIGRLTHGPQVLTVSETTHMVAKDKNLEE---H  57

Query  111  NIVMRRVVAELNDYPGSGANNRHTPKP  31
              +  R+ AELNDYPGSGAN+RHTP P
Sbjct  58   ENLEERIAAELNDYPGSGANHRHTPWP  84



>gb|KEH33317.1| transmembrane protein, putative [Medicago truncatula]
Length=92

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMV--ENSWD  118
            M     HL VI L  SHL+C  A+PITRS  L+Q++Q +  L + +   +DMV  E +W 
Sbjct  1    MKGNIFHLFVIFLGLSHLVCFKAVPITRSESLIQRAQIHLVLENAN-NHKDMVINERNWP  59

Query  117  ADN-IVMRRVVAELNDYPGSGANNRHTPK  34
             +   V+ R+  EL+DYP SGAN RHTP+
Sbjct  60   REEPTVVERMNLELHDYPPSGANGRHTPR  88



>ref|XP_007211066.1| hypothetical protein PRUPE_ppa018164mg [Prunus persica]
 gb|EMJ12265.1| hypothetical protein PRUPE_ppa018164mg [Prunus persica]
Length=76

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 54/97 (56%), Gaps = 24/97 (25%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLI-CLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDA  115
            +A T LHLLVI L FS LI CLNA+P+T+                     Q   EN++  
Sbjct  3    LAGTLLHLLVIFLGFSQLIICLNAVPVTK---------------------QVTAENNF-Y  40

Query  114  DNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            +  +  R+  EL+DYPGSGANNRHTPKPQ    CV C
Sbjct  41   EQTITERMDVELHDYPGSGANNRHTPKPQ-FGRCVDC  76



>emb|CDP12297.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = -1

Query  252  CFSHLIC-LNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMRRVVAELN  76
            C S LIC +NA+P+TR   L  K Q  D+ +  +  M+ + +NS + + I   R+  ELN
Sbjct  15   CVSQLICFMNAVPVTRITSLQHKFQGFDQ-VSEYNNMEIVEKNSLNLETIGRSRMDLELN  73

Query  75   DYPGSGANNRHTPKPQ  28
            DYPGSGANNRHTP+PQ
Sbjct  74   DYPGSGANNRHTPRPQ  89



>gb|KHG17616.1| Protein rhsA [Gossypium arboreum]
Length=87

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDAD  112
            M  T  HL ++LL FSH+I LNA+ +TR   LV   Q +    + H  + +  ++S +  
Sbjct  1    MERTLFHLFLVLLGFSHIISLNAVSVTRIESLVHGPQVHHVPENPHPVIAE--KSSKEG-  57

Query  111  NIVMRRVVAELNDYPGSGANNRHTPKPQ  28
                 RV  ELNDYPGSGAN RHTP+PQ
Sbjct  58   -----RVFMELNDYPGSGANYRHTPRPQ  80



>ref|XP_011087241.1| PREDICTED: uncharacterized protein LOC105168788 [Sesamum indicum]
Length=86

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 12/93 (13%)
 Frame = -1

Query  267  LVILLCFSHLICLN-AIP-ITRSRRLVQKSQENDELIDTHIKMQDMV---ENSWDADNIV  103
            ++++LC S LIC+N AIP +T +  LVQ+  +      +++  + +V   E S D D   
Sbjct  1    MLVVLCLSFLICMNGAIPAVTGTSDLVQQKPQ------SYLAAKGVVLGMEKSGD-DESR  53

Query  102  MRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            MRR+  E+NDYPG GANNRHTP+PQ    C  C
Sbjct  54   MRRMGIEVNDYPGWGANNRHTPRPQLGRGCTDC  86



>ref|XP_008442734.1| PREDICTED: uncharacterized protein LOC103486492 [Cucumis melo]
Length=91

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 53/96 (55%), Gaps = 9/96 (9%)
 Frame = -1

Query  288  ATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELI-DTHIKMQDMVENSWDAD  112
            A+  L LLVI L   +L+C NA+P +RS  L+  S     +  DTH+  +   E S    
Sbjct  4    ASHFLRLLVIFLGLYNLLCSNAVPTSRSVSLLHGSLPFLHVSSDTHMVTKTEEEESHG--  61

Query  111  NIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
                 R+V  LNDYPGSGANNRHTP+PQ    C  C
Sbjct  62   -----RMVVALNDYPGSGANNRHTPRPQ-FRGCADC  91



>gb|KGN64005.1| hypothetical protein Csa_1G033240 [Cucumis sativus]
Length=91

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 7/95 (7%)
 Frame = -1

Query  288  ATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADN  109
            A+  L LLVI L   +L+C NA+P +RS  L+  S     L   H+    ++    + + 
Sbjct  4    ASHFLRLLVIFLGLYNLLCSNAVPTSRSVSLLHGS-----LPFPHVSSNTLMVTKTEEEE  58

Query  108  IVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
               R VVA LNDYPGSGANNRHTP+PQ    C  C
Sbjct  59   SHGRMVVA-LNDYPGSGANNRHTPRPQ-FRGCADC  91



>ref|XP_010917058.1| PREDICTED: uncharacterized protein LOC105041740 isoform X2 [Elaeis 
guineensis]
Length=81

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 13/85 (15%)
 Frame = -1

Query  282  TSLHLLVILLCFSHLICLN-AIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNI  106
            +S H LVI+L FSHLI  + A+P TR++R++Q++  +  + +T    Q+ V N       
Sbjct  5    SSFHGLVIVLAFSHLIDFSHAVPSTRAQRMMQETGNHGAVTET---AQEYVRNE------  55

Query  105  VMRRVVAELNDYPGSGANNRHTPKP  31
               R+  ++NDYPGS AN+RHTP+P
Sbjct  56   ---RMDLDINDYPGSSANDRHTPRP  77



>ref|XP_008787105.1| PREDICTED: uncharacterized protein LOC103705237 [Phoenix dactylifera]
Length=88

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 7/89 (8%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLN-AIPITRSRRLVQKSQENDELIDT-HIKMQDMVENSWD  118
            M    LHLLVILL F H I  + A+P TR ++L+Q++ +   L DT  I +++ +     
Sbjct  1    MGRAFLHLLVILLVFCHHITPSHAVPSTRVQKLLQETGDLPSLGDTSKINIEEAI-----  55

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKP  31
            ++ I  R  +   NDYPGSGANNRHTPKP
Sbjct  56   SEVISGRMDLQISNDYPGSGANNRHTPKP  84



>emb|CDP00346.1| unnamed protein product [Coffea canephora]
Length=81

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 6/86 (7%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDA-  115
            MA  +LHLLV  L  S L+ LNA+P +R   L+ + +    L        + ++N+  A 
Sbjct  1    MAGGALHLLVTFLALSFLLPLNALPTSRKMHLLYEKRAIQGLDGI-----NKIKNAEVAR  55

Query  114  DNIVMRRVVAELNDYPGSGANNRHTP  37
            D+I  RR+  ++NDYPG GANNRHTP
Sbjct  56   DDITSRRMDVQVNDYPGPGANNRHTP  81



>ref|XP_010029913.1| PREDICTED: uncharacterized protein LOC104419825 [Eucalyptus grandis]
 gb|KCW83619.1| hypothetical protein EUGRSUZ_B00514 [Eucalyptus grandis]
Length=98

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = -1

Query  300  VRTMATT-SLHLLVILLCFSHLICLN-AIPITRSRRLVQKSQENDELIDTHIKMQDMVEN  127
            V  MA++ + H+LV LL FS L+  N A+PITR+  L+ + + +  +     K   M + 
Sbjct  5    VEAMASSRAFHMLVALLTFSLLVSSNIAVPITRTGSLMHRPRVHYAIP---AKAHVMKQG  61

Query  126  SWDADNIVMRRVVAELNDYPGSGANNRHTPKPQ  28
                 ++V RR+   LNDYPG G+NNRHTPK +
Sbjct  62   RNLEGSVVSRRMTVNLNDYPGPGSNNRHTPKAE  94



>gb|KHN26251.1| hypothetical protein glysoja_032821 [Glycine soja]
Length=92

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = -1

Query  291  MATTSLHLL-VILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDA  115
            M ++  HLL VILL  SH  CL A+P+TR+  L+Q+ +     +D     + +    W  
Sbjct  1    MKSSLFHLLFVILLGLSHFACLKAVPVTRTESLMQEPKVLHHALDNIHNHKVITGIKWQQ  60

Query  114  DNI-VMRRVVAELNDYPGSGANNRHTPKP  31
            +      R+  EL+DYP S AN RHTPKP
Sbjct  61   EEPSFAERMDLELHDYPPSAANGRHTPKP  89



>ref|XP_003549681.1| PREDICTED: uncharacterized protein LOC100527473 [Glycine max]
 gb|ACU16565.1| unknown [Glycine max]
 gb|KHN18557.1| hypothetical protein glysoja_006970 [Glycine soja]
Length=86

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 49/91 (54%), Gaps = 12/91 (13%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQ-----ENDELIDTHIKMQDMVEN  127
            MA T   L VILL  SHL+CL A+P+TR+  L+Q  Q     EN+  + T   +      
Sbjct  1    MAGTLFRLFVILLGLSHLMCLKAVPVTRTENLMQGPQVHLTLENNYKVITERNLH-----  55

Query  126  SWDADNIVMRRVVAELNDYPGSGANNRHTPK  34
             W+   I   R+  EL+DY  SG N RHTP+
Sbjct  56   -WEEQPIT-ERMELELHDYSPSGPNGRHTPR  84



>ref|XP_010939812.1| PREDICTED: uncharacterized protein LOC105058551 [Elaeis guineensis]
Length=88

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 51/90 (57%), Gaps = 9/90 (10%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHL-ICLNAIPITRSRRLVQKSQENDELIDT-HIKMQDMVENSWD  118
            M     HLLVILL FS L I  NA P TR  +L+Q++ +   L DT  I M++ +     
Sbjct  1    MGRVFFHLLVILLAFSQLTIFSNATPSTRPGKLLQETGDLPALGDTSKINMEEAISE---  57

Query  117  ADNIVMRRVVAEL-NDYPGSGANNRHTPKP  31
               ++  R+  E+ NDYPG G N RHTPKP
Sbjct  58   ---LIGGRMDLEVSNDYPGPGPNPRHTPKP  84



>ref|XP_006292129.1| hypothetical protein CARUB_v10018333mg [Capsella rubella]
 gb|EOA25027.1| hypothetical protein CARUB_v10018333mg [Capsella rubella]
Length=82

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 48/91 (53%), Gaps = 15/91 (16%)
 Frame = -1

Query  276  LHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMR  97
             HLLVI L  SH   L + P +R    ++K         THI   D+ ++  D    V  
Sbjct  7    FHLLVIFLSLSHFFFLPS-PASRPWSSMEKP--------THI---DLPQHDVDLKEKVKE  54

Query  96   RVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            R+V ELNDYPGSGANNRH P+   +  CV C
Sbjct  55   RMVMELNDYPGSGANNRHLPR---QRGCVDC  82



>gb|KHN01869.1| hypothetical protein glysoja_038964 [Glycine soja]
Length=92

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -1

Query  291  MATTSLHLL-VILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVE-NSWD  118
            M  +  HLL VIL   SH +CL A+PITR+  L+Q  +     +D     + + E     
Sbjct  1    MKGSLFHLLFVILFGLSHFVCLKAVPITRTESLMQDLKVIHHALDNIHNHKIITEIKGQQ  60

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKP  31
             + I   R+  EL+DYP  GAN  HTPKP
Sbjct  61   EEPIFAERMDLELHDYPPYGANGHHTPKP  89



>ref|XP_006374466.1| hypothetical protein POPTR_0015s07360g [Populus trichocarpa]
 gb|ERP52263.1| hypothetical protein POPTR_0015s07360g [Populus trichocarpa]
Length=93

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 56/101 (55%), Gaps = 13/101 (13%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDE----LIDTHI-KMQDMVEN  127
            MA     LLV  L  S+L+  + I I+ +RR   +   +D+    L DTH+ K +D  E+
Sbjct  1    MAGMLFRLLVSFLLISNLVYWSNISIS-TRRTGSQVHGHDQVRPILDDTHLSKKKDHDEH  59

Query  126  SWDADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
                  I   R + ELNDYPGSGANNRHTP+PQ    CV C
Sbjct  60   ------IAHGRKIVELNDYPGSGANNRHTPRPQ-FGRCVDC  93



>ref|XP_003524765.2| PREDICTED: uncharacterized protein LOC100819493 [Glycine max]
Length=112

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 11/90 (12%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQK----SQENDELIDTHIKMQDMVENS  124
            MA T   L VILL  SHL+CL A+P+TR+  L+Q     + EN+  + T   +       
Sbjct  28   MAGTLFRLFVILLGLSHLVCLKAVPVTRTENLMQGQVHLTLENNHKVITERNLH------  81

Query  123  WDADNIVMRRVVAELNDYPGSGANNRHTPK  34
            W+   I   R+  EL+DY  SG N RHTP+
Sbjct  82   WEEPTIT-ERMELELHDYSPSGPNGRHTPR  110



>gb|KHN48692.1| hypothetical protein glysoja_015840 [Glycine soja]
Length=125

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 11/90 (12%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQK----SQENDELIDTHIKMQDMVENS  124
            MA T   L VILL  SHL+CL A+P+TR+  L+Q     + EN+  + T   +       
Sbjct  41   MAGTLFRLFVILLGLSHLVCLKAVPVTRTENLMQGQVHLTLENNHKVITERNLH------  94

Query  123  WDADNIVMRRVVAELNDYPGSGANNRHTPK  34
            W+   I   R+  EL+DY  SG N RHTP+
Sbjct  95   WEEPTIT-ERMELELHDYSPSGPNGRHTPR  123



>ref|XP_011047177.1| PREDICTED: uncharacterized protein LOC105141608 isoform X1 [Populus 
euphratica]
Length=95

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLIC-LNAIPITRSRRLVQ-KSQENDELIDTHIKMQDMVENSWD  118
            MA      LV  L  S+L+   N+I   R+ R V    Q    L DTH+ +Q   ++   
Sbjct  1    MAGMLFRFLVSFLLISNLVYGSNSISTRRTGRQVHGHDQVRPILEDTHLVLQSKKKDH--  58

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
             ++I   R + ELNDYPGSGANNRHTP+PQ    CV C
Sbjct  59   DEHIAHGRKIVELNDYPGSGANNRHTPRPQ-FGRCVDC  95



>ref|XP_004514962.1| PREDICTED: uncharacterized protein LOC101503829 [Cicer arietinum]
Length=91

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 5/89 (6%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQEN--DELIDTHIKMQDMVENSWD  118
            M   + +L+VI    S L+C  AIPITR+   +Q  Q     ++++ +  M +    +W 
Sbjct  1    MKGITFNLIVIFFGLSSLVCFKAIPITRTESFMQSGQAQLAPKIVNNYKVMIN--GRNWS  58

Query  117  ADN-IVMRRVVAELNDYPGSGANNRHTPK  34
             +   V  R+  EL+DYP SGAN RHTP+
Sbjct  59   VEEPTVHERMDLELHDYPPSGANGRHTPR  87



>ref|XP_004514961.1| PREDICTED: uncharacterized protein LOC101503173 [Cicer arietinum]
Length=91

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 5/89 (6%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQEN--DELIDTHIKMQDMVENSWD  118
            M   + +L+VI    S L+C  AIPITR+   +Q  Q     ++++ +  M +    +W 
Sbjct  1    MKGITFNLIVIFFGLSSLVCFKAIPITRTESFMQSGQAQLASKIVNNYKVMIN--GRNWP  58

Query  117  ADN-IVMRRVVAELNDYPGSGANNRHTPK  34
             +   V  R+  EL+DYP SGAN RHTP+
Sbjct  59   VEEPTVHERMDLELHDYPPSGANGRHTPR  87



>ref|XP_010678508.1| PREDICTED: uncharacterized protein LOC104894040 [Beta vulgaris 
subsp. vulgaris]
Length=96

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 10/101 (10%)
 Frame = -1

Query  294  TMATTSLHLLVI-LLCFSHLICLNAIPITRSRRLVQKSQENDELI-DTHIKMQDMVENSW  121
             +A + L L VI LL FS +I +NA+P TR++ L+  +  +     ++H+   D VE   
Sbjct  2    ALAKSLLRLFVIVLLGFSCIIGINAVPTTRTKSLMHGNLASFRASRNSHL---DAVEAMQ  58

Query  120  DADNIVMRRV--VAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            D + +  R++    EL DYPGSGANNRHTP+ +    CV C
Sbjct  59   DGNILKERKMQQTIELQDYPGSGANNRHTPRSR---ECVDC  96



>ref|XP_010917057.1| PREDICTED: uncharacterized protein LOC105041740 isoform X1 [Elaeis 
guineensis]
Length=86

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 18/90 (20%)
 Frame = -1

Query  282  TSLHLLVILLCFSHLICLN-AIPITRS-----RRLVQKSQENDELIDTHIKMQDMVENSW  121
            +S H LVI+L FSHLI  + A+P T S     +R++Q++  +  + +T    Q+ V N  
Sbjct  5    SSFHGLVIVLAFSHLIDFSHAVPSTTSIAAGAQRMMQETGNHGAVTET---AQEYVRN--  59

Query  120  DADNIVMRRVVAELNDYPGSGANNRHTPKP  31
                    R+  ++NDYPGS AN+RHTP+P
Sbjct  60   -------ERMDLDINDYPGSSANDRHTPRP  82



>ref|XP_007155303.1| hypothetical protein PHAVU_003G189400g [Phaseolus vulgaris]
 gb|ESW27297.1| hypothetical protein PHAVU_003G189400g [Phaseolus vulgaris]
Length=92

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 12/92 (13%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQ------ENDELIDTHIKMQDMVE  130
            MA T   L VILL  SHL+CL A+P+TR   ++Q  Q      EN   + T    + + E
Sbjct  5    MAGTLFRLFVILLGLSHLMCLKAVPVTRIENIMQGPQVHYLRPENSHKVITEKYYRHLEE  64

Query  129  NSWDADNIVMRRVVAELNDYPGSGANNRHTPK  34
             +         R+  EL DY  SG N RHTP+
Sbjct  65   AT------TTERMELELQDYSPSGPNGRHTPR  90



>ref|XP_011047178.1| PREDICTED: uncharacterized protein LOC105141608 isoform X2 [Populus 
euphratica]
Length=92

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 52/99 (53%), Gaps = 10/99 (10%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLIC-LNAIPITRSRRLVQ-KSQENDELIDTHI-KMQDMVENSW  121
            MA      LV  L  S+L+   N+I   R+ R V    Q    L DTH+ K +D  E+  
Sbjct  1    MAGMLFRFLVSFLLISNLVYGSNSISTRRTGRQVHGHDQVRPILEDTHLSKKKDHDEH--  58

Query  120  DADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
                I   R + ELNDYPGSGANNRHTP+PQ    CV C
Sbjct  59   ----IAHGRKIVELNDYPGSGANNRHTPRPQ-FGRCVDC  92



>gb|KCW48843.1| hypothetical protein EUGRSUZ_K02478 [Eucalyptus grandis]
Length=98

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 12/87 (14%)
 Frame = -1

Query  249  FSHLIC-LNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMRRVVA----  85
             S +IC  +A+P+TR+  LVQ++         H      V        + + R+      
Sbjct  19   ISGIICSAHAVPVTRTGSLVQEA-------GVHQVASGSVLRPVPGGVLGLARIGGRMDI  71

Query  84   ELNDYPGSGANNRHTPKPQ*EHACVGC  4
            E+NDYPGSGANNRHTPKPQ    C+ C
Sbjct  72   EVNDYPGSGANNRHTPKPQLGRGCMAC  98



>ref|XP_010037172.1| PREDICTED: uncharacterized protein LOC104425979 [Eucalyptus grandis]
Length=109

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 12/87 (14%)
 Frame = -1

Query  249  FSHLIC-LNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMRRVVA----  85
             S +IC  +A+P+TR+  LVQ++         H      V        + + R+      
Sbjct  30   ISGIICSAHAVPVTRTGSLVQEA-------GVHQVASGSVLRPVPGGVLGLARIGGRMDI  82

Query  84   ELNDYPGSGANNRHTPKPQ*EHACVGC  4
            E+NDYPGSGANNRHTPKPQ    C+ C
Sbjct  83   EVNDYPGSGANNRHTPKPQLGRGCMAC  109



>ref|XP_010055020.1| PREDICTED: uncharacterized protein LOC104443364 [Eucalyptus grandis]
 gb|KCW89933.1| hypothetical protein EUGRSUZ_A02145 [Eucalyptus grandis]
Length=124

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = -1

Query  279  SLHLLVILLCFSHLICLNAIPITRSRRLVQKSQEND-ELIDTHIKMQDMVENSWDADNIV  103
            ++ LLV+ L FS L+   A+P TRS  L   S+E+D EL   ++  QD +        +V
Sbjct  37   AMRLLVLFLGFSCLLSSLAVPSTRS--LKSSSEEDDGELSVPNLLAQDEIMGMSGGGEMV  94

Query  102  M--RRVVAELNDYPGSGANNRHTPK  34
               RR+  E NDYPG+GANN H PK
Sbjct  95   FMERRMEMESNDYPGTGANNHHDPK  119



>ref|XP_010538056.1| PREDICTED: uncharacterized protein LOC104812541 [Tarenaya hassleriana]
Length=96

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            A   + RR+  E+NDYPGSGANNRHTP+PQ    C+ C
Sbjct  59   ARRTIDRRMDVEMNDYPGSGANNRHTPRPQSNRGCIDC  96



>ref|XP_003521876.1| PREDICTED: uncharacterized protein LOC100776350 [Glycine max]
 gb|KHN42182.1| hypothetical protein glysoja_021672 [Glycine soja]
Length=96

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 6/88 (7%)
 Frame = -1

Query  282  TSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWD-----  118
            + L LL+ILL FS ++   A+  TR R L  K +   ++     +  + ++N  +     
Sbjct  5    SPLQLLIILLVFSFVLSSAALQTTR-RLLPNKEKTPTQITSDKFQGVEELKNGEEMFDMA  63

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPK  34
             + +V RR+  E NDYPG+GANNRH PK
Sbjct  64   EEFMVERRIDLESNDYPGTGANNRHDPK  91



>ref|XP_004493240.1| PREDICTED: uncharacterized protein LOC101504239 [Cicer arietinum]
Length=84

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 7/86 (8%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDAD  112
            M+   L LL I+L FS L+   A+P TRS  L+      D+ +    ++++  E     +
Sbjct  1    MSKAPLQLLTIILLFSFLLSSAAVPTTRS--LLNWKNTLDDQLHGGPELRNEEE-----E  53

Query  111  NIVMRRVVAELNDYPGSGANNRHTPK  34
             +  +R+  E NDYPG+GANNRH PK
Sbjct  54   LMAEKRIDFENNDYPGTGANNRHVPK  79



>emb|CAD56224.1| hypothetical protein [Cicer arietinum]
Length=85

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 7/86 (8%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDAD  112
            M+   L LL I+L FS L+   A+P TRS  L+      D+ +    ++++  E     +
Sbjct  2    MSKAPLQLLTIILLFSFLLSSAAVPTTRS--LLNWKNTLDDQLHGGPELRNEEE-----E  54

Query  111  NIVMRRVVAELNDYPGSGANNRHTPK  34
             +  +R+  E NDYPG+GANNRH PK
Sbjct  55   LMAEKRIDFENNDYPGTGANNRHVPK  80



>ref|XP_010550598.1| PREDICTED: uncharacterized protein LOC104821419 [Tarenaya hassleriana]
Length=94

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 14/102 (14%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQ------ENDELIDTHIKMQDMVE  130
            MA T  HLLVI L  S    ++    +R    ++++       + D L+    K ++  E
Sbjct  1    MANTLFHLLVIFLSLSPFFMISPSNASRVGSFIERTNNVYYQPQQDTLLGVKEKRREEEE  60

Query  129  NSWDADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            +          R++ EL+DYPGSGANNRH P+ Q    C+ C
Sbjct  61   HG--------ERMMVELDDYPGSGANNRHVPRQQFGRGCIDC  94



>ref|XP_007138176.1| hypothetical protein PHAVU_009G186700g [Phaseolus vulgaris]
 gb|ESW10170.1| hypothetical protein PHAVU_009G186700g [Phaseolus vulgaris]
Length=90

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -1

Query  246  SHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQD-MVENSWD-ADNIVMRRVVAELND  73
            SH +CL A+P+TR+  L    +  D L   +I     M+   W+  +  +  R+  EL+D
Sbjct  15   SHFVCLEAVPVTRTESLTHDLKVLD-LAGVNIHNHKVMIGMKWELVEARIAERMDMELHD  73

Query  72   YPGSGANNRHTPKP  31
            YP SGAN RHTPKP
Sbjct  74   YPPSGANGRHTPKP  87



>ref|XP_002458674.1| hypothetical protein SORBIDRAFT_03g037890 [Sorghum bicolor]
 gb|EES03794.1| hypothetical protein SORBIDRAFT_03g037890 [Sorghum bicolor]
Length=98

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 49/95 (52%), Gaps = 11/95 (12%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICL-------NAIPITRSRRLV--QKSQENDELIDTHIKMQD  139
            M  TS    V+LLCF  L CL       +A P++RS  L   Q   +N  L     + Q 
Sbjct  1    MEFTSKQKAVLLLCFFMLSCLLLLPRASSAAPLSRSLSLTNRQLPTKNPALEVPAQQDQG  60

Query  138  MVENSWDADNIVMRRVVAELNDYPGSGANNRHTPK  34
             VE+    +  V  R+  E+NDYPGSGANNRH P+
Sbjct  61   AVEDGNLGE--VAARMDIEVNDYPGSGANNRHEPR  93



>ref|XP_003548675.2| PREDICTED: uncharacterized protein LOC100809764 [Glycine max]
Length=131

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDA-  115
            M    + LL+  LCFS+++ ++AIP TR++ L  + +E+   + +  ++   + N     
Sbjct  36   MQRNFMRLLMFFLCFSYVLSVSAIPATRTQNLKGEEEEDFSALPSLTRVDHALGNGEVVL  95

Query  114  ----DNIVMRRVVAELNDYPGSGANNRHTPK  34
                +  + RRV  E  DY G+GAN  H PK
Sbjct  96   IDMNEGFIERRVDLETQDYEGTGANKDHDPK  126



>gb|KHN46726.1| hypothetical protein glysoja_014977 [Glycine soja]
Length=146

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDA-  115
            M    + LL+  LCFS+++ ++AIP TR++ L  + +E+   + +  ++   + N     
Sbjct  51   MQRNFMRLLMFFLCFSYVLSVSAIPATRTQNLKGEEEEDFSALPSLTRVDHALGNGEVVL  110

Query  114  ----DNIVMRRVVAELNDYPGSGANNRHTPK  34
                +  + RRV  E  DY G+GAN  H PK
Sbjct  111  IDMNEGFIERRVDLETQDYEGTGANKDHDPK  141



>gb|KCW89932.1| hypothetical protein EUGRSUZ_A02145 [Eucalyptus grandis]
Length=131

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 8/90 (9%)
 Frame = -1

Query  279  SLHLLVILLCFSHLICLNAIPITR-----SRRLVQKSQEND-ELIDTHIKMQDMVENSWD  118
            ++ LLV+ L FS L+   A+P T+     +  L   S+E+D EL   ++  QD +     
Sbjct  37   AMRLLVLFLGFSCLLSSLAVPSTKLLFCFTGSLKSSSEEDDGELSVPNLLAQDEIMGMSG  96

Query  117  ADNIVM--RRVVAELNDYPGSGANNRHTPK  34
               +V   RR+  E NDYPG+GANN H PK
Sbjct  97   GGEMVFMERRMEMESNDYPGTGANNHHDPK  126



>ref|XP_002312251.1| hypothetical protein POPTR_0008s08730g [Populus trichocarpa]
 gb|EEE89618.1| hypothetical protein POPTR_0008s08730g [Populus trichocarpa]
Length=95

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 17/92 (18%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDAD  112
            MA   LH LVILL  S LI LNA   +R+          D+L+D     QDM+    +  
Sbjct  9    MAGKFLHSLVILLVVSQLIFLNATSTSRT---------GDDLLDNS---QDMLSPDRNTQ  56

Query  111  NIVMRRVVA-----ELNDYPGSGANNRHTPKP  31
            +  + +  A     E  DY G+G NNRHTP+P
Sbjct  57   HQTITKRGAGRENLEYTDYSGTGPNNRHTPEP  88



>ref|XP_007029945.1| Uncharacterized protein TCM_025809 [Theobroma cacao]
 gb|EOY10447.1| Uncharacterized protein TCM_025809 [Theobroma cacao]
Length=97

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 7/87 (8%)
 Frame = -1

Query  276  LHLLVILLCFSHLI--CLNAIPITRSRRLVQK---SQENDELIDTHIKMQDMVENSWDAD  112
            + L+++ L FS+L+  C+ A+P TRS +  ++   S   D L    +K+ +  E++ + D
Sbjct  7    VRLMILFLGFSYLLLSCV-AVPTTRSLKSYKELPSSSVQDLLAQDVMKLNEAEESTGEGD  65

Query  111  NIVM-RRVVAELNDYPGSGANNRHTPK  34
             I    R++ E  DYPG+GAN  H PK
Sbjct  66   AIFSDERMLMESTDYPGTGANKNHDPK  92



>ref|XP_009149904.1| PREDICTED: uncharacterized protein LOC103873234 [Brassica rapa]
Length=86

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 43/94 (46%), Gaps = 13/94 (14%)
 Frame = -1

Query  282  TSLHLLVIL-LCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNI  106
             S HLL+I  L  S          +R   L+++  +        +  QD +    D    
Sbjct  5    ASFHLLMIFCLTLSQFFFFFPTNASRYGSLMERPDQ------IFLPQQDTI---LDVKKD  55

Query  105  VMRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            V  RV  ELNDYPGSGANNRH P+ +    C+ C
Sbjct  56   VEERVTMELNDYPGSGANNRHLPRGR---GCIDC  86



>ref|XP_006390422.1| hypothetical protein EUTSA_v10019380mg [Eutrema salsugineum]
 gb|ESQ27708.1| hypothetical protein EUTSA_v10019380mg [Eutrema salsugineum]
Length=91

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 48/96 (50%), Gaps = 12/96 (13%)
 Frame = -1

Query  300  VRTMATTSLHLLVILLCFSHLICLNAIPITRSRRLV----QKSQENDELIDTHIKMQDMV  133
             RT     L + +IL   S +I L  + IT    +      K QE  +   +H++  +  
Sbjct  2    ARTRHLFQLRMFLILAVLSLMILLKPVLITARTEISTDCENKGQELHQF--SHLRRIE--  57

Query  132  ENSWDADNIVMRRV--VAELNDYPGSGANNRHTPKP  31
              S+       RR+  V ELNDYPGSGANNRHTP+P
Sbjct  58   --SYAKRRTKTRRLMNVEELNDYPGSGANNRHTPRP  91



>gb|KEH25543.1| transmembrane protein, putative [Medicago truncatula]
Length=88

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 3/79 (4%)
 Frame = -1

Query  270  LLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMRRV  91
            L VILL FS+ + + AIP TR++ L   + E++ +  +  K           + ++ RRV
Sbjct  8    LFVILLSFSYFLQVFAIPATRTKNL---NSEDESVFASLYKDHGEKMMVHMDERLIGRRV  64

Query  90   VAELNDYPGSGANNRHTPK  34
              EL+DY G GAN  H PK
Sbjct  65   NLELHDYEGPGANKEHNPK  83



>ref|XP_009353061.1| PREDICTED: uncharacterized protein LOC103944347 [Pyrus x bretschneideri]
Length=116

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = -1

Query  249  FSHLICLNAIPITRSRRLVQKS---QENDELIDTHIKMQDMVENSWDADNIVMRRVVAEL  79
            FS+   L+A+P TRS R  +K    QE   L+D  +   D + ++ + ++ +  R+  E 
Sbjct  39   FSYDRSLSAVPATRSLRSEEKDLSVQEPLGLVD--VGRGDELFDAGEGESFIEGRMAIES  96

Query  78   NDYPGSGANNRHTPK  34
             DYPG+GANN H P+
Sbjct  97   EDYPGTGANNHHDPR  111



>emb|CDY61269.1| BnaA06g38590D [Brassica napus]
 emb|CDY47403.1| BnaCnng15120D [Brassica napus]
Length=86

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 13/93 (14%)
 Frame = -1

Query  279  SLHLLVIL-LCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIV  103
            + HLL+I  L  S          +R   L+++  +        +  QD +    D    V
Sbjct  6    TFHLLMIFCLTLSQFFFFFPTNASRFGSLMERPDQ------IFLPQQDTI---LDVKKDV  56

Query  102  MRRVVAELNDYPGSGANNRHTPKPQ*EHACVGC  4
              RV  ELNDYPGSGANNRH P+ +    C+ C
Sbjct  57   EERVTMELNDYPGSGANNRHLPRGR---GCIDC  86



>gb|EYU20877.1| hypothetical protein MIMGU_mgv1a017313mg [Erythranthe guttata]
Length=82

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 44/89 (49%), Gaps = 12/89 (13%)
 Frame = -1

Query  291  MATTSLHLLVILLCFSHLICL--NAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWD  118
            MA     L+ +LL +  L+ +  +A+PI+RS +  Q            +KM+ +VE    
Sbjct  1    MAFRQRQLVAVLLLYFFLLMVTSSAVPISRSLKTFQNQVSVTYFPYQDVKMEKLVEG---  57

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKP  31
                   R+  EL DYPG+GAN+ H P P
Sbjct  58   -------RMEMELADYPGTGANHNHDPTP  79



>ref|XP_002275199.1| PREDICTED: uncharacterized protein LOC100241637 [Vitis vinifera]
 emb|CAN60285.1| hypothetical protein VITISV_028934 [Vitis vinifera]
Length=93

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 9/87 (10%)
 Frame = -1

Query  276  LHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTH-----IKMQDMVENSWDAD  112
            LHL++I L FS L+   A+P +RS +L+++      +  +       K  ++ E      
Sbjct  7    LHLMIIFLGFSWLLSCAAVPSSRSFQLIKEELSAQAVFLSQKGRGFYKFPEVEEGYKRVG  66

Query  111  NIVMRRVVAELNDYPGSGANNRHTPKP  31
             I M  +    +DY G+GAN  H PKP
Sbjct  67   RIAMEGI----DDYAGTGANTHHDPKP  89



>gb|KFK34048.1| hypothetical protein AALP_AA5G095400 [Arabis alpina]
Length=86

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 50/96 (52%), Gaps = 15/96 (16%)
 Frame = -1

Query  291  MATTSL-HLLVIL-LCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWD  118
            MA  +L HLL+I  L  SHL        + + RL    +  D++   +I  +D +    D
Sbjct  1    MANKALFHLLIIFFLTQSHLFFFP----SNASRLGSLMERPDQI---YISQKDTL---LD  50

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACV  10
                V  R+V ELNDYPGSGANNRH P+   +  CV
Sbjct  51   VKKDVEERMVMELNDYPGSGANNRHLPR---QRGCV  83



>ref|NP_190335.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB61977.1| putative protein [Arabidopsis thaliana]
 gb|AEE78291.1| uncharacterized protein AT3G47510 [Arabidopsis thaliana]
Length=85

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 50/96 (52%), Gaps = 16/96 (17%)
 Frame = -1

Query  291  MATTSL-HLLVIL-LCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWD  118
            MA  +L HLLVI  L  SH+    +   +R   L++K +      DT + ++  VE    
Sbjct  1    MANKALIHLLVIFFLALSHIFFFPS-HASRLGSLMEKPKIVRPQQDTLMDVKKEVEE---  56

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACV  10
                   R+V ELNDYPGSGANNRH P+   +  CV
Sbjct  57   -------RMVMELNDYPGSGANNRHLPR---QRGCV  82



>ref|XP_009417865.1| PREDICTED: uncharacterized protein LOC103998189 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=88

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 4/78 (5%)
 Frame = -1

Query  267  LVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMRRVV  88
            L  LLCFS ++ L A+P+     L  +     ++ D  I  + ++     AD    RR+ 
Sbjct  10   LCTLLCFSWILSLVAVPLPGKLDLRNQKISVMKVADQVINRKILINEKAIAD----RRMD  65

Query  87   AELNDYPGSGANNRHTPK  34
             ELNDYP SGAN+RH PK
Sbjct  66   IELNDYPVSGANSRHDPK  83



>ref|XP_002875843.1| hypothetical protein ARALYDRAFT_485116 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52102.1| hypothetical protein ARALYDRAFT_485116 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 51/96 (53%), Gaps = 20/96 (21%)
 Frame = -1

Query  291  MATTSL-HLLVIL-LCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWD  118
            MA  +L HLLVI  L  SH+    +   +R   L++K + +    DT +++++       
Sbjct  1    MANKALIHLLVIFFLSLSHIFFFPSH-ASRLGSLMEKPKIDLPPQDTLMEVEE-------  52

Query  117  ADNIVMRRVVAELNDYPGSGANNRHTPKPQ*EHACV  10
                   RVV ELNDYPGSGANNRH P+   +  CV
Sbjct  53   -------RVVMELNDYPGSGANNRHLPR---QRGCV  78



>gb|KFK41893.1| hypothetical protein AALP_AA2G185900 [Arabis alpina]
Length=95

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 4/89 (4%)
 Frame = -1

Query  270  LLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMRRV  91
            + +I    S  I LN   I+      ++ +   + ++  I ++ +  +            
Sbjct  11   IFLIFALLSLYISLNPFLISARTETSKEFETKGQELNQIIHLRSIETDLNRRTRTRRMMN  70

Query  90   VAELNDYPGSGANNRHTPKPQ*EHACVGC  4
            V E+NDYPGSGANNRHTPKP     C  C
Sbjct  71   VEEINDYPGSGANNRHTPKP----YCPDC  95



>gb|KDO36742.1| hypothetical protein CISIN_1g034425mg [Citrus sinensis]
Length=94

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (51%), Gaps = 10/87 (11%)
 Frame = -1

Query  276  LHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMR  97
            L LLV+ L FS ++   A+P TR    + KS   + +    +  Q+ +E S   + + M 
Sbjct  7    LKLLVLFLGFSFVLSSTAVPATR----MAKSDNENPIQVQELLAQEAMEVSDSEELLGME  62

Query  96   ------RVVAELNDYPGSGANNRHTPK  34
                  R+  E  DYPG+GANN H PK
Sbjct  63   QGYIEGRMDMESTDYPGTGANNHHDPK  89



>ref|XP_007161898.1| hypothetical protein PHAVU_001G106900g [Phaseolus vulgaris]
 gb|ESW33892.1| hypothetical protein PHAVU_001G106900g [Phaseolus vulgaris]
Length=92

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 40/79 (51%), Gaps = 13/79 (16%)
 Frame = -1

Query  252  CFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNI------VMRRV  91
             FS +I   A+   ++RRL+     N E I T I     VE     + +      + RR+
Sbjct  16   AFSFVISSAAV---KTRRLLP----NKENISTQISSDKGVEKLGSGEEMFDLAEELERRI  68

Query  90   VAELNDYPGSGANNRHTPK  34
              E NDYPG+GANNRH PK
Sbjct  69   DLENNDYPGTGANNRHDPK  87



>ref|XP_003578108.1| PREDICTED: uncharacterized protein LOC100834251 [Brachypodium 
distachyon]
Length=95

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 6/88 (7%)
 Frame = -1

Query  285  TTSLHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELI---DTHIKMQDMVENSWDA  115
            + SL L++ LL F  L+  NAIP++R ++LV   QEN E++   ++  K +         
Sbjct  5    SASLCLVITLLAFYFLVPSNAIPLSRVQKLVAL-QENSEMLSVEESTPKPELETGRVVPV  63

Query  114  DNIVM--RRVVAELNDYPGSGANNRHTP  37
            D+ VM   R+  E  DY  SG NN H P
Sbjct  64   DDEVMIGARMALETQDYAPSGPNNHHKP  91



>ref|XP_004493226.1| PREDICTED: uncharacterized protein LOC101500413 [Cicer arietinum]
Length=95

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 47/88 (53%), Gaps = 15/88 (17%)
 Frame = -1

Query  270  LLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVM---  100
            LL+I L FS+ +  +AIP TR++ L     E+   + +  K    V N++  + +++   
Sbjct  11   LLIIFLGFSYFLSTSAIPATRTQNL---KCEDASTLPSLAK----VGNNYGEEVVLVHMD  63

Query  99   -----RRVVAELNDYPGSGANNRHTPKP  31
                 RR+  E+ DY G+GAN  H PKP
Sbjct  64   EGFTERRIDLEIQDYDGTGANRDHEPKP  91



>gb|EMS45553.1| hypothetical protein TRIUR3_31710 [Triticum urartu]
Length=95

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 48/93 (52%), Gaps = 11/93 (12%)
 Frame = -1

Query  288  ATTSLHLLVILLCFSHLICLNAIPITRSRRLV--QKSQENDELIDTHIKMQDM------V  133
            ++ SL L++ LL F  L+  NAIP++R +RLV  Q + E    I+ +     M      +
Sbjct  3    SSASLCLVITLLAFYFLVPSNAIPLSRVQRLVPLQHASEQVPWIEENTPKPKMDMGRVIL  62

Query  132  ENSWDADNIVMRRVVAELNDYPGSGANNRHTPK  34
            E+  DA N V  R+  E  DY  SG NN H P 
Sbjct  63   ED--DAVN-VSARMALETQDYAPSGPNNHHKPP  92



>ref|XP_009417864.1| PREDICTED: uncharacterized protein LOC103998189 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=89

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = -1

Query  267  LVILLCFSHLICLNAIPITRSRRLVQKSQEND--ELIDTHIKMQDMVENSWDADNIVMRR  94
            L  LLCFS ++ L A+P+  + +L  ++Q+    ++ D  I  + ++     AD    RR
Sbjct  10   LCTLLCFSWILSLVAVPLP-AGKLDLRNQKISVMKVADQVINRKILINEKAIAD----RR  64

Query  93   VVAELNDYPGSGANNRHTPK  34
            +  ELNDYP SGAN+RH PK
Sbjct  65   MDIELNDYPVSGANSRHDPK  84



>ref|XP_009382954.1| PREDICTED: uncharacterized protein LOC103970766 [Musa acuminata 
subsp. malaccensis]
Length=84

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 38/65 (58%), Gaps = 10/65 (15%)
 Frame = -1

Query  225  AIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMRRVVAELNDYPGSGANNR  46
            A+P TR  R+++  +           + D V+   + +   ++R+  E+NDYPGSGAN+R
Sbjct  28   AVPSTRDGRMLRGCR----------SVGDAVQVINEDEEAKIQRMDIEINDYPGSGANDR  77

Query  45   HTPKP  31
            HTPKP
Sbjct  78   HTPKP  82



>ref|XP_004970359.1| PREDICTED: uncharacterized protein LOC101758274 isoform X2 [Setaria 
italica]
Length=91

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 9/87 (10%)
 Frame = -1

Query  285  TTSLHLLVILLCFSHLI---CLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDA  115
            T+    L++L  FS L+     +A P++RS  L         +++  + +Q    N  + 
Sbjct  6    TSKKKALLVLFMFSCLLVPMASSAAPLSRSLSLTNNRVPEPAVVE--VPLQGEERNLGE-  62

Query  114  DNIVMRRVVAELNDYPGSGANNRHTPK  34
               V  R+  E+NDYPGSGANNRH P+
Sbjct  63   ---VAARMDIEVNDYPGSGANNRHEPR  86



>ref|XP_004970358.1| PREDICTED: uncharacterized protein LOC101758274 isoform X1 [Setaria 
italica]
Length=92

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 8/87 (9%)
 Frame = -1

Query  285  TTSLHLLVILLCFSHLI---CLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDA  115
            T+    L++L  FS L+     +A P++RS  L         +++  + +Q   E +   
Sbjct  6    TSKKKALLVLFMFSCLLVPMASSAAPLSRSLSLTNNRVPEPAVVE--VPLQQGEERNLGE  63

Query  114  DNIVMRRVVAELNDYPGSGANNRHTPK  34
               V  R+  E+NDYPGSGANNRH P+
Sbjct  64   ---VAARMDIEVNDYPGSGANNRHEPR  87



>gb|KHN34637.1| hypothetical protein glysoja_011190 [Glycine soja]
Length=98

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = -1

Query  252  CFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSW----DADNIVM-RRVV  88
            CFS+++ ++AIP TR++ L  + +E   L  +  ++  +V N      D +   M RRV 
Sbjct  17   CFSYVLSVSAIPATRTQNLKGEEEEFSAL-PSLTRLDHVVGNGEVVLVDMNEGFMERRVD  75

Query  87   AELNDYPGSGANNRHTPK  34
             E  DY G+GAN  H PK
Sbjct  76   LETQDYEGTGANKDHDPK  93



>gb|KDO36741.1| hypothetical protein CISIN_1g034425mg [Citrus sinensis]
Length=95

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 9/87 (10%)
 Frame = -1

Query  276  LHLLVILLCFSHLICLNAIPITRSRRLVQKSQENDELIDTHIKMQDMVENSWDADNIVMR  97
            L LLV+ L FS ++   A+P T     + KS   + +    +  Q+ +E S   + + M 
Sbjct  7    LKLLVLFLGFSFVLSSTAVPATTG---MAKSDNENPIQVQELLAQEAMEVSDSEELLGME  63

Query  96   ------RVVAELNDYPGSGANNRHTPK  34
                  R+  E  DYPG+GANN H PK
Sbjct  64   QGYIEGRMDMESTDYPGTGANNHHDPK  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510229923304