BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14312_g1_i3 len=1225 path=[1203:0-720 1924:721-749 2646:750-751
1955:752-1224]

Length=1225
                                                                      Score     E

ref|XP_009620084.1|  PREDICTED: protein UPSTREAM OF FLC                 248   3e-73   
ref|XP_009782303.1|  PREDICTED: protein UPSTREAM OF FLC                 247   4e-73   
ref|XP_006363367.1|  PREDICTED: protein UPSTREAM OF FLC-like            236   5e-69   
ref|XP_006350748.1|  PREDICTED: protein UPSTREAM OF FLC-like            234   2e-68   
emb|CDP08997.1|  unnamed protein product                                230   2e-66   
ref|XP_002281433.1|  PREDICTED: protein UPSTREAM OF FLC                 224   1e-64   Vitis vinifera
emb|CAN67325.1|  hypothetical protein VITISV_012830                     221   1e-60   Vitis vinifera
ref|XP_010112912.1|  hypothetical protein L484_010843                   211   1e-59   
ref|XP_011089821.1|  PREDICTED: protein UPSTREAM OF FLC-like            208   4e-59   
ref|XP_008222935.1|  PREDICTED: protein UPSTREAM OF FLC                 207   5e-58   
ref|XP_007205207.1|  hypothetical protein PRUPE_ppa005864mg             207   5e-58   
ref|XP_006488258.1|  PREDICTED: protein UPSTREAM OF FLC-like            200   2e-55   
gb|KDO72962.1|  hypothetical protein CISIN_1g015443mg                   198   6e-55   
ref|XP_009384890.1|  PREDICTED: protein UPSTREAM OF FLC-like            200   7e-55   
ref|NP_001234635.1|  auxin-regulated protein                            198   7e-55   
ref|XP_011089425.1|  PREDICTED: LOW QUALITY PROTEIN: protein UPST...    195   2e-54   
gb|KHG03526.1|  hypothetical protein F383_27518                         194   1e-53   
ref|XP_010920698.1|  PREDICTED: protein UPSTREAM OF FLC-like            194   2e-53   
ref|XP_010658613.1|  PREDICTED: protein UPSTREAM OF FLC                 191   2e-53   
ref|XP_009402338.1|  PREDICTED: protein UPSTREAM OF FLC-like            194   2e-53   
ref|XP_008385167.1|  PREDICTED: protein UPSTREAM OF FLC-like            194   3e-53   
ref|XP_009338350.1|  PREDICTED: uncharacterized protein LOC103930...    191   1e-52   
ref|XP_009338349.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    192   1e-52   
ref|XP_010937705.1|  PREDICTED: protein UPSTREAM OF FLC-like            192   2e-52   
ref|XP_007009444.1|  Domain of Uncharacterized protein function, ...    185   3e-51   
ref|XP_008357689.1|  PREDICTED: protein UPSTREAM OF FLC                 187   2e-50   
ref|XP_004505888.1|  PREDICTED: uncharacterized protein LOC101507317    186   2e-50   
ref|XP_010541386.1|  PREDICTED: protein UPSTREAM OF FLC-like            185   5e-50   
ref|XP_002534353.1|  conserved hypothetical protein                     184   2e-49   Ricinus communis
ref|XP_010253296.1|  PREDICTED: protein UPSTREAM OF FLC                 184   2e-49   
gb|KDP44192.1|  hypothetical protein JCGZ_05659                         184   3e-49   
ref|XP_010322315.1|  PREDICTED: auxin-regulated protein isoform X1      183   4e-49   
ref|XP_010043592.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      182   5e-49   
ref|XP_011000299.1|  PREDICTED: protein UPSTREAM OF FLC                 183   5e-49   
ref|XP_010043593.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      182   5e-49   
ref|XP_010535531.1|  PREDICTED: protein UPSTREAM OF FLC                 183   6e-49   
gb|KGN65672.1|  hypothetical protein Csa_1G481740                       182   7e-49   
ref|XP_007016521.1|  Domain of Uncharacterized protein function, ...    183   7e-49   
gb|KHN21983.1|  hypothetical protein glysoja_008895                     182   8e-49   
ref|XP_006590994.1|  PREDICTED: protein UPSTREAM OF FLC-like            182   8e-49   
emb|CDX80229.1|  BnaC09g35130D                                          181   9e-49   
ref|XP_002299892.2|  hypothetical protein POPTR_0001s24240g             182   9e-49   Populus trichocarpa [western balsam poplar]
ref|XP_004169610.1|  PREDICTED: uncharacterized LOC101205220            182   9e-49   
gb|KHG11212.1|  Nipped-B-like protein                                   179   2e-48   
emb|CDY66123.1|  BnaAnng21550D                                          180   2e-48   
ref|XP_009358323.1|  PREDICTED: protein UPSTREAM OF FLC-like            181   2e-48   
ref|XP_008457538.1|  PREDICTED: protein UPSTREAM OF FLC                 180   6e-48   
ref|XP_006848694.1|  hypothetical protein AMTR_s00178p00038720          179   6e-48   
gb|KHG09613.1|  Isoleucine--tRNA ligase                                 179   1e-47   
ref|XP_010503224.1|  PREDICTED: protein UPSTREAM OF FLC-like            176   3e-47   
ref|XP_004251456.1|  PREDICTED: protein UPSTREAM OF FLC                 176   6e-47   
gb|KHN32101.1|  hypothetical protein glysoja_028896                     177   7e-47   
ref|XP_003539698.1|  PREDICTED: protein UPSTREAM OF FLC-like            177   9e-47   
ref|XP_004149057.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    176   2e-46   
ref|XP_004295945.1|  PREDICTED: uncharacterized protein LOC101300994    176   2e-46   
ref|XP_002875764.1|  hypothetical protein ARALYDRAFT_905792             173   2e-46   
ref|XP_010426039.1|  PREDICTED: protein UPSTREAM OF FLC-like            174   2e-46   
ref|XP_007132101.1|  hypothetical protein PHAVU_011G066900g             176   3e-46   
ref|NP_974389.1|  uncharacterized protein                               172   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011041950.1|  PREDICTED: protein UPSTREAM OF FLC-like            174   7e-46   
emb|CAB90938.1|  putative protein                                       172   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905712.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    173   1e-45   
ref|NP_190197.2|  uncharacterized protein                               171   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009402366.1|  PREDICTED: protein UPSTREAM OF FLC-like            172   1e-45   
ref|XP_010905713.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    172   2e-45   
ref|XP_010470135.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    174   3e-45   
ref|XP_006280519.1|  hypothetical protein CARUB_v10026455mg             172   4e-45   
ref|XP_009120499.1|  PREDICTED: protein UPSTREAM OF FLC-like            172   6e-45   
ref|XP_011023173.1|  PREDICTED: protein UPSTREAM OF FLC-like            168   7e-45   
ref|XP_002314199.1|  hypothetical protein POPTR_0009s03260g             170   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_008776398.1|  PREDICTED: protein UPSTREAM OF FLC-like            167   4e-44   
ref|XP_010514936.1|  PREDICTED: protein UPSTREAM OF FLC-like            168   4e-44   
ref|XP_010510680.1|  PREDICTED: protein UPSTREAM OF FLC-like            171   5e-44   
ref|XP_006409836.1|  hypothetical protein EUTSA_v10016498mg             170   9e-44   
ref|XP_006592714.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    170   9e-44   
gb|KHG19421.1|  hypothetical protein F383_07328                         165   9e-44   
ref|XP_010414585.1|  PREDICTED: protein UPSTREAM OF FLC-like            171   1e-43   
ref|XP_006592713.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    170   1e-43   
gb|KHN41368.1|  hypothetical protein glysoja_048780                     170   1e-43   
gb|KEH30111.1|  auxin-regulated protein                                 167   3e-43   
ref|XP_002311147.1|  hypothetical protein POPTR_0008s05080g             164   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006291332.1|  hypothetical protein CARUB_v10017467mg             164   3e-43   
ref|XP_003606621.1|  Auxin-regulated protein                            167   4e-43   
emb|CDX71378.1|  BnaC04g16130D                                          168   5e-43   
ref|XP_006291333.1|  hypothetical protein CARUB_v10017467mg             165   6e-43   
ref|XP_007150145.1|  hypothetical protein PHAVU_005G130600g             167   7e-43   
gb|KFK32341.1|  hypothetical protein AALP_AA6G229200                    167   9e-43   
gb|KHN21075.1|  hypothetical protein glysoja_006554                     168   1e-42   
ref|XP_009419473.1|  PREDICTED: protein UPSTREAM OF FLC                 162   1e-42   
ref|XP_006378940.1|  hypothetical protein POPTR_0009s01120g             166   1e-42   
ref|XP_004970518.1|  PREDICTED: uncharacterized protein LOC101753415    164   2e-42   
ref|NP_180382.2|  uncharacterized protein                               166   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470136.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    166   3e-42   
ref|NP_200787.1|  uncharacterized protein                               164   4e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33966.1|  hypothetical protein AALP_AA5G084800                    162   4e-42   
ref|XP_006591104.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    166   4e-42   
gb|KHN38706.1|  hypothetical protein glysoja_008255                     165   5e-42   
ref|XP_006591107.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    165   5e-42   
ref|XP_002880947.1|  hypothetical protein ARALYDRAFT_901702             165   6e-42   
ref|XP_010067373.1|  PREDICTED: protein UPSTREAM OF FLC-like            160   6e-42   
ref|XP_009103650.1|  PREDICTED: protein UPSTREAM OF FLC                 165   6e-42   
emb|CDY04542.1|  BnaA07g13680D                                          165   7e-42   
ref|XP_003543446.2|  PREDICTED: protein UPSTREAM OF FLC-like isof...    165   7e-42   
ref|XP_006594962.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    165   7e-42   
gb|KHN21485.1|  hypothetical protein glysoja_021065                     165   7e-42   
ref|XP_006384958.1|  hypothetical protein POPTR_0004s22580g             165   7e-42   
ref|XP_004506071.1|  PREDICTED: serine-rich adhesin for platelets...    165   8e-42   
ref|XP_010521721.1|  PREDICTED: protein UPSTREAM OF FLC                 164   9e-42   
ref|XP_004487565.1|  PREDICTED: uncharacterized protein DDB_G0271...    164   9e-42   
ref|XP_004487564.1|  PREDICTED: uncharacterized protein DDB_G0271...    165   1e-41   
ref|XP_010096649.1|  hypothetical protein L484_025396                   159   1e-41   
ref|XP_004506072.1|  PREDICTED: serine-rich adhesin for platelets...    164   1e-41   
ref|XP_010443759.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    162   1e-41   
ref|XP_007205039.1|  hypothetical protein PRUPE_ppa004193mg             164   1e-41   
ref|XP_010443758.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    162   1e-41   
emb|CBI17137.3|  unnamed protein product                                155   2e-41   
ref|XP_010111845.1|  hypothetical protein L484_020637                   164   2e-41   
emb|CDY65697.1|  BnaA02g06840D                                          162   2e-41   
ref|XP_009126662.1|  PREDICTED: protein UPSTREAM OF FLC                 162   2e-41   
emb|CDY65698.1|  BnaA02g06850D                                          162   2e-41   
emb|CDP07033.1|  unnamed protein product                                164   2e-41   
ref|XP_011028263.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    164   2e-41   
ref|XP_010483624.1|  PREDICTED: protein UPSTREAM OF FLC-like            162   2e-41   
ref|XP_011028265.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    163   2e-41   
ref|XP_006592290.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    163   2e-41   
ref|XP_006592288.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    164   2e-41   
ref|XP_010455528.1|  PREDICTED: protein UPSTREAM OF FLC-like            162   3e-41   
ref|XP_010031412.1|  PREDICTED: protein UPSTREAM OF FLC                 163   3e-41   
ref|XP_008226607.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3      163   3e-41   
ref|XP_010922980.1|  PREDICTED: protein UPSTREAM OF FLC-like            158   3e-41   
ref|XP_008226601.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      163   3e-41   
gb|KCW50706.1|  hypothetical protein EUGRSUZ_J00387                     163   3e-41   
gb|KHG01769.1|  SCO-spondin                                             163   4e-41   
emb|CDM84909.1|  unnamed protein product                                160   4e-41   
ref|XP_008226595.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      163   4e-41   
gb|KDP43968.1|  hypothetical protein JCGZ_05435                         163   4e-41   
gb|KEH38874.1|  auxin-regulated protein                                 162   5e-41   
ref|XP_002458734.1|  hypothetical protein SORBIDRAFT_03g039280          160   6e-41   Sorghum bicolor [broomcorn]
gb|KFK27515.1|  hypothetical protein AALP_AA8G393300                    160   1e-40   
gb|AFW84642.1|  hypothetical protein ZEAMMB73_096878                    158   1e-40   
gb|AES88533.2|  auxin-regulated protein                                 161   1e-40   
ref|XP_006400915.1|  hypothetical protein EUTSA_v10013653mg             160   1e-40   
ref|XP_010543043.1|  PREDICTED: protein UPSTREAM OF FLC-like            160   1e-40   
ref|XP_003606336.1|  Auxin-regulated protein                            161   1e-40   
ref|XP_002274821.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      161   2e-40   Vitis vinifera
ref|XP_002864651.1|  hypothetical protein ARALYDRAFT_496114             159   2e-40   
ref|XP_008674847.1|  PREDICTED: protein UPSTREAM OF FLC-like            159   2e-40   
ref|XP_006424453.1|  hypothetical protein CICLE_v10028190mg             160   2e-40   
gb|KDO60276.1|  hypothetical protein CISIN_1g009456mg                   160   2e-40   
ref|XP_007149422.1|  hypothetical protein PHAVU_005G069000g             160   3e-40   
ref|XP_011028262.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    160   3e-40   
ref|XP_006488005.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    160   4e-40   
ref|XP_011028264.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    160   4e-40   
ref|XP_010689153.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      160   5e-40   
ref|XP_006488007.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    160   5e-40   
ref|XP_010689155.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3      159   5e-40   
ref|XP_008465413.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      159   6e-40   
ref|XP_009356938.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      159   6e-40   
ref|XP_002523717.1|  conserved hypothetical protein                     159   6e-40   Ricinus communis
ref|XP_008465404.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      159   7e-40   
ref|XP_009796780.1|  PREDICTED: protein UPSTREAM OF FLC-like            155   7e-40   
ref|XP_010689154.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      159   8e-40   
ref|XP_007016883.1|  Domain of Uncharacterized protein function i...    159   1e-39   
ref|XP_007016884.1|  Domain of Uncharacterized protein function i...    159   1e-39   
ref|XP_009604697.1|  PREDICTED: uncharacterized protein LOC104099418    154   1e-39   
gb|KGN46878.1|  hypothetical protein Csa_6G148200                       158   1e-39   
ref|XP_006589751.1|  PREDICTED: protein UPSTREAM OF FLC-like            153   1e-39   
gb|KDP43970.1|  hypothetical protein JCGZ_05437                         157   1e-39   
ref|XP_008359674.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    158   2e-39   
ref|XP_008359681.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    158   2e-39   
ref|XP_007016886.1|  Domain of Uncharacterized protein function i...    158   2e-39   
ref|XP_009759415.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      158   2e-39   
ref|XP_009356937.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      158   2e-39   
ref|XP_007016887.1|  Domain of Uncharacterized protein function i...    157   2e-39   
ref|XP_009335982.1|  PREDICTED: protein UPSTREAM OF FLC-like            158   2e-39   
ref|XP_007016882.1|  Domain of Uncharacterized protein function i...    158   2e-39   
ref|XP_003555186.1|  PREDICTED: protein UPSTREAM OF FLC-like            153   2e-39   
ref|XP_007016885.1|  Domain of Uncharacterized protein function i...    158   2e-39   
ref|XP_009759418.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      158   2e-39   
ref|XP_008788149.1|  PREDICTED: protein UPSTREAM OF FLC-like            154   2e-39   
ref|XP_007016881.1|  Domain of Uncharacterized protein function i...    158   2e-39   
ref|XP_004166308.1|  PREDICTED: uncharacterized protein LOC101230215    157   3e-39   
ref|XP_010243223.1|  PREDICTED: protein UPSTREAM OF FLC                 157   3e-39   
ref|XP_002531982.1|  conserved hypothetical protein                     153   3e-39   Ricinus communis
ref|XP_004145766.1|  PREDICTED: uncharacterized protein LOC101221316    157   3e-39   
gb|KHN37326.1|  hypothetical protein glysoja_013541                     152   3e-39   
gb|EYU36129.1|  hypothetical protein MIMGU_mgv1a004545mg                157   4e-39   
dbj|BAJ91411.1|  predicted protein                                      155   4e-39   
ref|XP_006378734.1|  hypothetical protein POPTR_0010s21670g             149   7e-39   
dbj|BAK08284.1|  predicted protein                                      154   7e-39   
ref|XP_009394652.1|  PREDICTED: uncharacterized protein LOC103980089    157   7e-39   
ref|XP_008385503.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      157   8e-39   
ref|XP_009603382.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3      155   9e-39   
ref|XP_008385506.1|  PREDICTED: protein UPSTREAM OF FLC isoform X5      157   9e-39   
ref|XP_008385505.1|  PREDICTED: protein UPSTREAM OF FLC isoform X4      156   9e-39   
ref|XP_009603377.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      156   1e-38   
ref|XP_009603381.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      155   1e-38   
ref|XP_009618966.1|  PREDICTED: protein UPSTREAM OF FLC-like            154   1e-38   
ref|XP_010267249.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    155   1e-38   
ref|XP_004287551.1|  PREDICTED: uncharacterized protein LOC101295074    155   2e-38   
ref|XP_009759862.1|  PREDICTED: protein UPSTREAM OF FLC-like            154   2e-38   
gb|KDP29868.1|  hypothetical protein JCGZ_18443                         150   2e-38   
ref|XP_010267244.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    155   2e-38   
ref|XP_008385502.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      155   2e-38   
ref|XP_008385504.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3      155   2e-38   
gb|KDO60279.1|  hypothetical protein CISIN_1g009456mg                   154   5e-38   
ref|XP_009418260.1|  PREDICTED: uncharacterized protein LOC103998501    154   6e-38   
emb|CDP00043.1|  unnamed protein product                                147   6e-38   
gb|AAC98451.1|  hypothetical protein                                    154   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007142718.1|  hypothetical protein PHAVU_007G011100g             148   7e-38   
ref|XP_006346819.1|  PREDICTED: protein UPSTREAM OF FLC-like            152   7e-38   
ref|XP_009403454.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    151   9e-38   
ref|XP_002533140.1|  conserved hypothetical protein                     151   1e-37   Ricinus communis
ref|XP_011088794.1|  PREDICTED: LOW QUALITY PROTEIN: protein UPST...    153   1e-37   
ref|XP_006349033.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    152   2e-37   
gb|EEC84037.1|  hypothetical protein OsI_30284                          152   2e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_006349036.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    152   2e-37   
ref|XP_010313307.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      152   2e-37   
ref|XP_010935824.1|  PREDICTED: uncharacterized protein LOC105055627    152   3e-37   
ref|XP_006349037.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    150   3e-37   
ref|XP_010313304.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      152   3e-37   
ref|XP_009382784.1|  PREDICTED: uncharacterized protein LOC103970646    149   3e-37   
ref|XP_009403452.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    150   4e-37   
ref|XP_011032320.1|  PREDICTED: protein UPSTREAM OF FLC                 151   5e-37   
ref|XP_011089964.1|  PREDICTED: protein UPSTREAM OF FLC-like            150   8e-37   
ref|XP_004240776.1|  PREDICTED: protein UPSTREAM OF FLC-like            149   9e-37   
ref|XP_002266219.3|  PREDICTED: protein UPSTREAM OF FLC                 149   1e-36   Vitis vinifera
ref|XP_006826977.1|  hypothetical protein AMTR_s00010p00200600          146   3e-36   
ref|XP_008672066.1|  PREDICTED: uncharacterized protein LOC100191...    149   4e-36   
gb|ACF79011.1|  unknown                                                 149   5e-36   Zea mays [maize]
ref|NP_001130693.1|  uncharacterized protein LOC100191796               149   5e-36   Zea mays [maize]
gb|EPS59694.1|  hypothetical protein M569_15111                         148   5e-36   
tpg|DAA48592.1|  TPA: hypothetical protein ZEAMMB73_676706              149   5e-36   
ref|XP_009420457.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    148   5e-36   
ref|XP_009420458.1|  PREDICTED: uncharacterized protein LOC104000...    148   6e-36   
ref|XP_009420456.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    148   7e-36   
ref|NP_001062513.1|  Os08g0561600                                       148   8e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004236760.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    144   1e-35   
gb|EPS64977.1|  hypothetical protein M569_09806                         141   1e-35   
ref|XP_006659704.1|  PREDICTED: uncharacterized protein LOC102700546    147   1e-35   
gb|EEE55291.1|  hypothetical protein OsJ_03239                          147   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006365723.1|  PREDICTED: protein UPSTREAM OF FLC-like            146   2e-35   
ref|XP_011090510.1|  PREDICTED: protein UPSTREAM OF FLC                 145   2e-35   
gb|EMS48462.1|  hypothetical protein TRIUR3_32429                       140   4e-35   
ref|XP_010261234.1|  PREDICTED: protein UPSTREAM OF FLC-like            144   4e-35   
ref|XP_006840165.1|  hypothetical protein AMTR_s00089p00083270          144   6e-35   
ref|XP_010027838.1|  PREDICTED: protein UPSTREAM OF FLC                 143   1e-34   
ref|XP_008807694.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      144   1e-34   
ref|XP_008807695.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3      144   1e-34   
ref|XP_008807693.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      144   1e-34   
dbj|BAJ84976.1|  predicted protein                                      143   2e-34   
emb|CDP01423.1|  unnamed protein product                                142   2e-34   
ref|XP_006646467.1|  PREDICTED: protein UPSTREAM OF FLC-like            140   3e-34   
ref|XP_004974229.1|  PREDICTED: uncharacterized protein LOC101754127    143   3e-34   
ref|XP_003576884.1|  PREDICTED: uncharacterized protein LOC100829033    142   3e-34   
ref|XP_009408735.1|  PREDICTED: uncharacterized protein LOC103991099    143   5e-34   
ref|XP_004289325.1|  PREDICTED: uncharacterized protein LOC101308228    141   5e-34   
emb|CBI31719.3|  unnamed protein product                                138   5e-34   
ref|XP_010685833.1|  PREDICTED: protein UPSTREAM OF FLC                 141   1e-33   
ref|XP_009412830.1|  PREDICTED: uncharacterized protein LOC103994221    141   1e-33   
ref|XP_011030965.1|  PREDICTED: protein UPSTREAM OF FLC                 140   1e-33   
ref|XP_010918909.1|  PREDICTED: protein UPSTREAM OF FLC                 141   2e-33   
gb|EAY76435.1|  hypothetical protein OsI_04368                          139   2e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001044751.1|  Os01g0839200                                       139   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KDP46870.1|  hypothetical protein JCGZ_24079                         139   2e-33   
ref|XP_010319265.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    137   2e-33   
ref|XP_008787457.1|  PREDICTED: uncharacterized protein LOC103705...    140   3e-33   
ref|NP_001146001.1|  uncharacterized protein LOC100279531               140   3e-33   Zea mays [maize]
ref|XP_007048006.1|  Domain of Uncharacterized protein function, ...    139   3e-33   
gb|ACG46847.1|  hypothetical protein                                    140   3e-33   Zea mays [maize]
ref|XP_008677102.1|  PREDICTED: uncharacterized protein LOC100279...    140   4e-33   
ref|XP_007048007.1|  Domain of Uncharacterized protein function, ...    139   4e-33   
ref|XP_008245046.1|  PREDICTED: protein UPSTREAM OF FLC-like            139   4e-33   
gb|EMS64249.1|  hypothetical protein TRIUR3_00433                       139   4e-33   
ref|XP_008234699.1|  PREDICTED: protein UPSTREAM OF FLC-like            139   4e-33   
ref|XP_003572509.1|  PREDICTED: uncharacterized protein LOC100837491    140   4e-33   
ref|XP_008779079.1|  PREDICTED: uncharacterized protein LOC103698807    139   4e-33   
ref|XP_010940524.1|  PREDICTED: protein UPSTREAM OF FLC-like            139   5e-33   
ref|XP_010269198.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    138   6e-33   
ref|XP_010269199.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    138   7e-33   
ref|XP_004147719.1|  PREDICTED: uncharacterized protein LOC101206550    135   7e-33   
ref|XP_008388623.1|  PREDICTED: protein UPSTREAM OF FLC                 138   8e-33   
ref|NP_001168626.1|  hypothetical protein                               137   8e-33   
ref|XP_008655224.1|  PREDICTED: hypothetical protein isoform X1         137   9e-33   
ref|XP_008461641.1|  PREDICTED: uncharacterized protein LOC103500195    134   1e-32   
ref|XP_010269197.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    137   1e-32   
ref|NP_001050959.1|  Os03g0692400                                       138   1e-32   
gb|ABF98310.1|  auxin-regulated protein, putative, expressed            138   1e-32   
gb|AFW82025.1|  hypothetical protein ZEAMMB73_390698                    136   1e-32   
ref|XP_010090548.1|  hypothetical protein L484_016598                   137   2e-32   
emb|CDM87234.1|  unnamed protein product                                136   2e-32   
ref|XP_004982119.1|  PREDICTED: uncharacterized protein LOC101770...    137   3e-32   
ref|XP_004982117.1|  PREDICTED: uncharacterized protein LOC101770...    137   3e-32   
dbj|BAK04931.1|  predicted protein                                      137   3e-32   
ref|XP_008646528.1|  PREDICTED: protein UPSTREAM OF FLC-like            136   5e-32   
tpg|DAA44026.1|  TPA: hypothetical protein ZEAMMB73_656538              130   6e-32   
gb|EPS70313.1|  hypothetical protein M569_04454                         129   6e-32   
ref|XP_011097596.1|  PREDICTED: protein UPSTREAM OF FLC-like            135   6e-32   
gb|KDO56622.1|  hypothetical protein CISIN_1g015170mg                   135   7e-32   
ref|XP_009345472.1|  PREDICTED: protein UPSTREAM OF FLC-like            135   8e-32   
ref|XP_006428157.1|  hypothetical protein CICLE_v10027553mg             135   8e-32   
ref|XP_010917112.1|  PREDICTED: protein UPSTREAM OF FLC                 134   1e-31   
ref|XP_009378536.1|  PREDICTED: protein UPSTREAM OF FLC-like            134   1e-31   
ref|XP_007207905.1|  hypothetical protein PRUPE_ppa020536mg             134   1e-31   
ref|XP_006650428.1|  PREDICTED: protein UPSTREAM OF FLC-like            135   1e-31   
dbj|BAD09604.1|  putative auxin-regulated protein                       134   2e-31   
ref|XP_008665215.1|  PREDICTED: protein UPSTREAM OF FLC-like            135   2e-31   
gb|KEH44478.1|  DUF966 domain protein                                   130   2e-31   
ref|XP_009766935.1|  PREDICTED: protein UPSTREAM OF FLC                 134   3e-31   
gb|EPS69663.1|  hypothetical protein M569_05104                         132   3e-31   
ref|XP_002464058.1|  hypothetical protein SORBIDRAFT_01g011460          134   4e-31   
gb|EMS65512.1|  hypothetical protein TRIUR3_24591                       127   4e-31   
ref|XP_008670664.1|  PREDICTED: uncharacterized protein LOC100276...    132   5e-31   
ref|XP_004962441.1|  PREDICTED: uncharacterized protein DDB_G0271...    132   6e-31   
tpg|DAA44025.1|  TPA: hypothetical protein ZEAMMB73_656538              132   6e-31   
ref|XP_010319750.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      131   8e-31   
gb|EAZ25897.1|  hypothetical protein OsJ_09736                          130   9e-31   
ref|XP_004237416.2|  PREDICTED: protein UPSTREAM OF FLC isoform X1      131   1e-30   
ref|NP_001144781.1|  uncharacterized protein LOC100277848               131   1e-30   
ref|NP_001049238.1|  Os03g0192300                                       130   1e-30   
ref|NP_001143874.1|  uncharacterized protein LOC100276675               131   2e-30   
gb|ABF94410.1|  expressed protein                                       130   2e-30   
gb|KHG27923.1|  hypothetical protein F383_34335                         130   2e-30   
gb|EEC74668.1|  hypothetical protein OsI_10346                          130   2e-30   
ref|XP_002444579.1|  hypothetical protein SORBIDRAFT_07g023960          132   3e-30   
gb|EMT02390.1|  hypothetical protein F775_02108                         131   3e-30   
gb|EMS49875.1|  hypothetical protein TRIUR3_07098                       131   3e-30   
ref|XP_009382164.1|  PREDICTED: protein UPSTREAM OF FLC-like            132   3e-30   
ref|XP_009608278.1|  PREDICTED: protein UPSTREAM OF FLC                 130   3e-30   
ref|XP_002465712.1|  hypothetical protein SORBIDRAFT_01g044370          130   4e-30   
gb|KHN38195.1|  hypothetical protein glysoja_003860                     128   7e-30   
ref|XP_006580287.1|  PREDICTED: protein UPSTREAM OF FLC-like            128   8e-30   
ref|XP_010229051.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    128   1e-29   
ref|XP_006585286.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    128   1e-29   
gb|EYU31034.1|  hypothetical protein MIMGU_mgv1a008596mg                128   1e-29   
ref|XP_003532837.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    128   1e-29   
ref|XP_006585287.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    128   1e-29   
gb|KHN29085.1|  hypothetical protein glysoja_008420                     128   1e-29   
ref|XP_003558611.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    128   1e-29   
ref|XP_009381727.1|  PREDICTED: protein UPSTREAM OF FLC-like            128   1e-29   
ref|XP_003567543.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    128   2e-29   
ref|XP_010232885.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    128   2e-29   
gb|EMT08241.1|  hypothetical protein F775_20369                         125   2e-29   
ref|XP_010232886.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    127   2e-29   
ref|XP_010527163.1|  PREDICTED: protein UPSTREAM OF FLC                 127   3e-29   
ref|XP_006399508.1|  hypothetical protein EUTSA_v10013690mg             127   3e-29   
ref|XP_010231366.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    127   4e-29   
ref|XP_007159722.1|  hypothetical protein PHAVU_002G261900g             127   4e-29   
ref|XP_010231357.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...    127   5e-29   
dbj|BAK08194.1|  predicted protein                                      126   7e-29   
ref|XP_009391157.1|  PREDICTED: protein UPSTREAM OF FLC-like            126   7e-29   
ref|XP_009125325.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      125   1e-28   
gb|KGN53217.1|  hypothetical protein Csa_4G027920                       125   1e-28   
emb|CDX85775.1|  BnaA02g00380D                                          125   1e-28   
ref|XP_006646745.1|  PREDICTED: protein UPSTREAM OF FLC-like            124   1e-28   
ref|XP_006424750.1|  hypothetical protein CICLE_v10029908mg             125   2e-28   
ref|XP_003630056.1|  hypothetical protein MTR_8g091300                  124   2e-28   
gb|EYU24009.1|  hypothetical protein MIMGU_mgv1a006009mg                125   3e-28   
ref|XP_004985384.1|  PREDICTED: uncharacterized protein LOC101776...    124   3e-28   
ref|XP_004985383.1|  PREDICTED: uncharacterized protein LOC101776...    124   3e-28   
ref|XP_004504049.1|  PREDICTED: uncharacterized protein LOC101499085    122   9e-28   
gb|ACQ44223.1|  unknown                                                 122   1e-27   
gb|ACK44510.1|  AT5G10150-like protein                                  122   1e-27   
ref|XP_004956245.1|  PREDICTED: cell wall protein AWA1-like isofo...    124   1e-27   
ref|NP_196577.1|  uncharacterized protein                               122   1e-27   
ref|XP_009390423.1|  PREDICTED: protein UPSTREAM OF FLC-like            122   2e-27   
ref|XP_002459864.1|  hypothetical protein SORBIDRAFT_02g012540          123   3e-27   
ref|XP_006287841.1|  hypothetical protein CARUB_v10001062mg             121   4e-27   
ref|XP_010453039.1|  PREDICTED: protein UPSTREAM OF FLC-like            120   5e-27   
ref|XP_010422884.1|  PREDICTED: protein UPSTREAM OF FLC                 120   6e-27   
ref|XP_002873442.1|  hypothetical protein ARALYDRAFT_350224             120   7e-27   
ref|XP_010491669.1|  PREDICTED: protein UPSTREAM OF FLC-like            120   7e-27   
ref|XP_008787456.1|  PREDICTED: uncharacterized protein LOC103705...    121   1e-26   
gb|AFW67942.1|  hypothetical protein ZEAMMB73_527740                    121   1e-26   
ref|XP_006399507.1|  hypothetical protein EUTSA_v10013690mg             119   2e-26   
emb|CDY40082.1|  BnaC02g00480D                                          118   3e-26   
ref|XP_010680850.1|  PREDICTED: protein UPSTREAM OF FLC                 119   4e-26   
ref|XP_008652458.1|  PREDICTED: uncharacterized protein LOC103632...    117   3e-25   
gb|EMT17601.1|  hypothetical protein F775_25267                         113   4e-25   
ref|XP_008652457.1|  PREDICTED: uncharacterized protein LOC103632...    117   5e-25   
emb|CDM84198.1|  unnamed protein product                                112   3e-24   
tpg|DAA60716.1|  TPA: hypothetical protein ZEAMMB73_671634              115   4e-24   
ref|XP_009125326.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      110   1e-23   
gb|KCW65504.1|  hypothetical protein EUGRSUZ_G02909                     104   1e-23   
ref|XP_010523156.1|  PREDICTED: uncharacterized protein LOC104801546    110   1e-23   
gb|EYU42246.1|  hypothetical protein MIMGU_mgv1a010598mg                107   7e-23   
ref|XP_006661575.1|  PREDICTED: uncharacterized protein LOC102720269    108   8e-23   
ref|XP_009118583.1|  PREDICTED: uncharacterized protein LOC103843...    106   2e-22   
ref|XP_009118584.1|  PREDICTED: uncharacterized protein LOC103843...    106   2e-22   
ref|XP_008672322.1|  PREDICTED: hypothetical protein isoform X4         105   5e-22   
ref|NP_683277.1|  uncharacterized protein                               105   5e-22   
emb|CDY10019.1|  BnaC08g44320D                                          105   5e-22   
ref|XP_008672320.1|  PREDICTED: hypothetical protein isoform X3         105   6e-22   
ref|XP_006418011.1|  hypothetical protein EUTSA_v10009387mg             105   6e-22   
ref|NP_001140262.1|  hypothetical protein                               105   1e-21   
emb|CDY06173.1|  BnaA09g50300D                                          105   2e-21   
ref|XP_002892301.1|  hypothetical protein ARALYDRAFT_470558             103   2e-21   
ref|XP_010485074.1|  PREDICTED: uncharacterized protein LOC104763394    103   2e-21   
ref|XP_007020150.1|  Domain of Uncharacterized protein function, ...    103   2e-21   
ref|XP_010457646.1|  PREDICTED: protein UPSTREAM OF FLC-like            103   3e-21   
ref|XP_006306148.1|  hypothetical protein CARUB_v10011656mg             103   4e-21   
ref|XP_010257613.1|  PREDICTED: uncharacterized protein LOC104597...    101   9e-21   
ref|XP_011093403.1|  PREDICTED: protein UPSTREAM OF FLC-like            101   1e-20   
ref|XP_010475258.1|  PREDICTED: protein UPSTREAM OF FLC-like            100   2e-20   
ref|XP_002968229.1|  hypothetical protein SELMODRAFT_409423             102   2e-20   
ref|XP_002972394.1|  hypothetical protein SELMODRAFT_413112             102   3e-20   
ref|XP_002971870.1|  hypothetical protein SELMODRAFT_412562             102   3e-20   
emb|CDY10127.1|  BnaC05g03700D                                          100   3e-20   
emb|CDY47267.1|  BnaA10g03790D                                          100   3e-20   
ref|XP_004970173.1|  PREDICTED: uncharacterized protein LOC101754226    100   3e-20   
ref|XP_010659608.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      100   3e-20   
ref|XP_011086835.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3      100   6e-20   
ref|XP_011086801.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1      100   7e-20   
ref|XP_011086827.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2      100   7e-20   
ref|XP_010276351.1|  PREDICTED: protein UPSTREAM OF FLC               99.8    8e-20   
gb|EMT20352.1|  hypothetical protein F775_24165                       93.6    9e-20   
ref|XP_011041982.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...  99.8    1e-19   
ref|XP_011041981.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...  99.8    1e-19   
ref|XP_002976150.1|  hypothetical protein SELMODRAFT_416149             100   1e-19   
gb|KDO36153.1|  hypothetical protein CISIN_1g048680mg                 94.0    1e-19   
ref|XP_010659610.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3    99.0    1e-19   
ref|XP_010659607.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1    99.4    1e-19   
ref|XP_009620873.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3    99.0    2e-19   
emb|CDP07656.1|  unnamed protein product                              98.2    2e-19   
ref|XP_009620871.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1    99.0    2e-19   
ref|XP_009620872.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2    99.0    2e-19   
ref|XP_010323476.1|  PREDICTED: protein UPSTREAM OF FLC               98.2    2e-19   
ref|XP_002965856.1|  hypothetical protein SELMODRAFT_439304           99.0    2e-19   
ref|XP_009792718.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3    98.6    2e-19   
ref|XP_009792717.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2    99.0    2e-19   
ref|XP_002313462.2|  hypothetical protein POPTR_0009s02980g           99.0    2e-19   
ref|XP_009792716.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1    98.6    3e-19   
emb|CBI18662.3|  unnamed protein product                              97.4    3e-19   
gb|EYU27167.1|  hypothetical protein MIMGU_mgv1a026481mg              97.4    3e-19   
gb|KDP20371.1|  hypothetical protein JCGZ_05254                       97.4    4e-19   
ref|NP_001045560.1|  Os01g0975000                                     96.7    4e-19   
ref|XP_006359179.1|  PREDICTED: protein UPSTREAM OF FLC-like          97.4    4e-19   
ref|XP_006369486.1|  VfN-28 family protein                            97.8    5e-19   
ref|XP_004158830.1|  PREDICTED: uncharacterized protein LOC101227498  95.5    9e-19   
ref|XP_011009641.1|  PREDICTED: uncharacterized protein LOC105114701  97.1    1e-18   
emb|CAN82512.1|  hypothetical protein VITISV_002153                   98.2    1e-18   
ref|XP_004136105.1|  PREDICTED: uncharacterized protein LOC101207468  95.1    1e-18   
ref|XP_002993811.1|  hypothetical protein SELMODRAFT_449230           97.1    1e-18   
gb|EAZ10156.1|  hypothetical protein OsI_32472                        97.4    2e-18   
ref|XP_006483671.1|  PREDICTED: putative uncharacterized protein ...  97.4    2e-18   
ref|XP_010257611.1|  PREDICTED: uncharacterized protein LOC104597...  95.1    2e-18   
ref|XP_009400974.1|  PREDICTED: protein UPSTREAM OF FLC               94.0    2e-18   
ref|XP_007220012.1|  hypothetical protein PRUPE_ppb024912mg           96.3    2e-18   
ref|XP_001764538.1|  predicted protein                                96.7    3e-18   
ref|XP_004488584.1|  PREDICTED: uncharacterized protein LOC101493036  95.5    3e-18   
dbj|BAD46604.1|  hypothetical protein                                 95.9    4e-18   
ref|NP_001175996.1|  Os09g0571000                                     95.5    4e-18   
ref|XP_008231404.1|  PREDICTED: protein UPSTREAM OF FLC               94.7    7e-18   
ref|XP_007149122.1|  hypothetical protein PHAVU_005G042900g           94.4    8e-18   
ref|XP_003567175.1|  PREDICTED: uncharacterized protein LOC100842645  92.8    1e-17   
ref|XP_006858990.1|  hypothetical protein AMTR_s00068p00133150        93.2    2e-17   
ref|XP_008461227.1|  PREDICTED: uncharacterized protein LOC103499...  92.8    2e-17   
ref|XP_002456438.1|  hypothetical protein SORBIDRAFT_03g036300        93.2    3e-17   
gb|KHN49062.1|  hypothetical protein glysoja_031273                   91.7    3e-17   
ref|XP_008461228.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3    92.4    3e-17   
gb|KHN21338.1|  hypothetical protein glysoja_026539                   92.4    3e-17   
gb|EMT10074.1|  hypothetical protein F775_52409                       91.7    3e-17   
ref|XP_006585378.1|  PREDICTED: uncharacterized protein LOC100785...  92.4    3e-17   
ref|XP_009354670.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...  92.4    3e-17   
ref|XP_008461226.1|  PREDICTED: protein UPSTREAM OF FLC isoform X1    92.4    4e-17   
ref|XP_009354671.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...  92.4    4e-17   
ref|XP_006585379.1|  PREDICTED: uncharacterized protein LOC100785...  92.4    4e-17   
emb|CDM84459.1|  unnamed protein product                              92.0    4e-17   
ref|XP_003531461.2|  PREDICTED: uncharacterized protein LOC100785...  92.8    4e-17   
ref|XP_006585377.1|  PREDICTED: uncharacterized protein LOC100785...  92.4    5e-17   
ref|XP_008350350.1|  PREDICTED: protein UPSTREAM OF FLC-like          91.7    7e-17   
dbj|BAD87843.1|  unknown protein                                      90.1    7e-17   
gb|EEC71582.1|  hypothetical protein OsI_03955                        91.3    9e-17   
gb|EAZ08172.1|  hypothetical protein OsI_30432                        89.7    1e-16   
gb|EEE55481.1|  hypothetical protein OsJ_03664                        90.9    1e-16   
ref|XP_003595830.1|  hypothetical protein MTR_2g062310                91.3    1e-16   
ref|XP_011027348.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.9    1e-16   
gb|AES66081.2|  DUF966 domain protein                                 90.5    2e-16   
ref|XP_009119455.1|  PREDICTED: uncharacterized protein LOC103844422  89.4    3e-16   
ref|XP_002307105.2|  hypothetical protein POPTR_0005s08010g           87.0    7e-16   
ref|XP_010257614.1|  PREDICTED: uncharacterized protein LOC104597...  87.0    8e-16   
ref|XP_004292472.1|  PREDICTED: uncharacterized protein LOC101294143  86.7    1e-15   
ref|XP_008672319.1|  PREDICTED: hypothetical protein isoform X2       87.8    2e-15   
ref|XP_006598237.1|  PREDICTED: uncharacterized protein LOC100820603  87.0    3e-15   
ref|XP_008387549.1|  PREDICTED: uncharacterized protein LOC103450010  84.0    4e-15   
ref|XP_006488008.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...  84.3    3e-14   
ref|XP_008465414.1|  PREDICTED: protein UPSTREAM OF FLC isoform X3    82.4    1e-13   
gb|KCW50708.1|  hypothetical protein EUGRSUZ_J00387                   82.4    1e-13   
ref|XP_006594967.1|  PREDICTED: protein UPSTREAM OF FLC-like isof...  81.6    2e-13   
ref|XP_010651768.1|  PREDICTED: protein UPSTREAM OF FLC isoform X2    81.6    2e-13   
ref|XP_004497302.1|  PREDICTED: uncharacterized protein LOC101493418  76.6    7e-13   
ref|XP_001765400.1|  predicted protein                                79.7    1e-12   
ref|XP_001755748.1|  predicted protein                                78.6    2e-12   
ref|XP_001774137.1|  predicted protein                                78.6    3e-12   
gb|EMT27042.1|  hypothetical protein F775_04292                       78.2    3e-12   
ref|XP_001763752.1|  predicted protein                                76.6    1e-11   
ref|XP_001773619.1|  predicted protein                                70.9    8e-10   
gb|EMS65352.1|  hypothetical protein TRIUR3_26826                     70.1    1e-09   
ref|XP_001778748.1|  predicted protein                                69.7    2e-09   
gb|KCW66162.1|  hypothetical protein EUGRSUZ_G03434                   67.0    4e-09   



>ref|XP_009620084.1| PREDICTED: protein UPSTREAM OF FLC [Nicotiana tomentosiformis]
Length=457

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 152/346 (44%), Positives = 196/346 (57%), Gaps = 70/346 (20%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSSPR  837
            L M KKW+D++ SPERTKVWT+ P      ER+V VVYYL+ NG+L+HPHFME+ LSSP 
Sbjct  14   LQMPKKWKDRETSPERTKVWTETPNHKPKSERKVPVVYYLTRNGQLEHPHFMEVPLSSPD  73

Query  836  GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
            GL+LRDV++RLN LRG+GMASLYSWSAKR Y+NGFVW DL E+DFI+PAHG EY+LKGSE
Sbjct  74   GLYLRDVINRLNFLRGKGMASLYSWSAKRSYRNGFVWHDLSEHDFIFPAHGQEYVLKGSE  133

Query  656  LI---ITHSSSQE----------TPALTAAGEDREFPPLPPPRHN---------------  561
            L+   IT +S  E           P +    EDREFP +   R+                
Sbjct  134  LVDGAITITSQSEEVEFSSSKTPVPEVRKIAEDREFPAVSRRRNQSWCSADFHEYRVYKA  193

Query  560  ------------------------------VHAVEEDKESGRSGSSEPSNGEISTPPAGS  471
                                          V   E++++SG+S S+E S GEIS PP+ S
Sbjct  194  ESSEDSTGKAAADASTQTDDRRRRRREIGIVEEEEQERDSGQSQSTELSRGEISPPPSDS  253

Query  470  SPETLAALMKADRRRVI---LMNEARKAAAYYDPSA-ARPRTASVVMQILSCGSVAAREH  303
            SPETL  LMKAD R ++    +N+ + A      +     R +SV M +LSCGS++ ++ 
Sbjct  254  SPETLETLMKADGRVIVRSETVNDDQTANNNQSSNGKGSSRASSVFMHLLSCGSMSFKDC  313

Query  302  APPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENAVMELPLI  165
             P    K H  SLISH+K  + LP G   N     AEN  +E   I
Sbjct  314  GPGYYGKDHGLSLISHYK--SRLPRGAGLNQVEKDAENTTVEYQGI  357



>ref|XP_009782303.1| PREDICTED: protein UPSTREAM OF FLC [Nicotiana sylvestris]
Length=457

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 199/346 (58%), Gaps = 70/346 (20%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSSPR  837
            L M KKW+D++ SPERTKVWT+ P      ER++ VVYYL+ NG+L+HPHFME+ LSSP 
Sbjct  14   LQMPKKWKDRETSPERTKVWTETPNHKPKTERKLPVVYYLTRNGQLEHPHFMEVPLSSPD  73

Query  836  GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
            GL+LRDV++RLN LRG+GMASLYSWSAKR Y+NGFVW DL E+DFI+PAHG EY+LKGSE
Sbjct  74   GLYLRDVINRLNFLRGKGMASLYSWSAKRSYRNGFVWHDLSEHDFIFPAHGQEYVLKGSE  133

Query  656  LI---ITHSSSQE----------TPALTAAGEDREFPPLPPPR-----------HNVHAV  549
            L+   IT +S  E           P +   GEDREFP +   R           + V+  
Sbjct  134  LVDGAITIASQSEEVEFSSSKTPVPEVRKIGEDREFPAVSRRRNQSWCSADFHEYRVYKA  193

Query  548  E--ED--------------------------------KESGRSGSSEPSNGEISTPPAGS  471
            E  ED                                ++SG+S S+E S GEIS PP+ S
Sbjct  194  ESSEDSTGKAAADASTQTDDRRHRRREIGIVEEEEEERDSGQSQSTELSRGEISPPPSDS  253

Query  470  SPETLAALMKADRRRVI---LMNEARKAAAYYDPSA-ARPRTASVVMQILSCGSVAAREH  303
            SPETL  LMKAD R ++    +NE + A      +     R +SV MQ+LSCGS++ ++ 
Sbjct  254  SPETLETLMKADGRVIVRSETVNEDQTANNNQSSNGKGSSRASSVFMQLLSCGSMSFKDC  313

Query  302  APPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENAVMELPLI  165
             P    K H  SLISH+K  + LP G   N     AEN  +E   I
Sbjct  314  GPGYYGKDHGLSLISHYK--SRLPRGPGLNQVEKDAENTTVEYQGI  357



>ref|XP_006363367.1| PREDICTED: protein UPSTREAM OF FLC-like [Solanum tuberosum]
Length=457

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 200/356 (56%), Gaps = 75/356 (21%)
 Frame = -3

Query  1010  RWMELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRL  849
             R  +L M +KW+D++ SPER KVW + P      ER+V VVYYL+ NG+L+HPHFME+ L
Sbjct  9     RTKDLQMHQKWKDRETSPERNKVWIENPNHKLKSERKVPVVYYLTRNGQLEHPHFMEVPL  68

Query  848   SSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYIL  669
             SSP GL+LRDV++RLN LRG+GMASLYSWSAKR Y+NGFVW DL E+DFIYPAHG EY+L
Sbjct  69    SSPDGLYLRDVINRLNFLRGKGMASLYSWSAKRSYRNGFVWHDLAEHDFIYPAHGQEYVL  128

Query  668   KGSELI-----ITHSSSQE---------TPALTAAGEDREFPPLPPPRHN----------  561
             KGSEL+     +T  S +E          P +    ED EFP +   R+           
Sbjct  129   KGSELVDGATTLTSQSEEEVEFSTSKNQVPEVRKLSEDHEFPAVSRRRNQSWCSADFHEY  188

Query  560   -----------------------------------VHAVEEDKES---GRSGSSEPSNGE  495
                                                +   EED +S    +S S+E S GE
Sbjct  189   RVYKAESSSNESSGKAAADASTQTDERRRRRREIGIAEEEEDYQSIEQTQSQSTELSRGE  248

Query  494   ISTPPAGSSPETLAALMKADRRRVIL---MNEARKAAAYYDPSAARPRTASVVMQILSCG  324
             IS PP+ SSPETL  LMKAD R ++L   +NE +   A  + S  + + +SV+MQ+LSCG
Sbjct  249   ISPPPSDSSPETLETLMKADGRVIVLPETVNEDQ--TANNNQSNGKSKGSSVLMQLLSCG  306

Query  323   SVAAREHAPPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENAVMELPLITSV  156
             S++ ++  P    K H  SLISH+K  + +P G   N+    AE   +E   IT +
Sbjct  307   SMSFKDCGPGGYGKDHGLSLISHYK--SRVPRGPGLNSVEKGAEITTVEHHGITKL  360



>ref|XP_006350748.1| PREDICTED: protein UPSTREAM OF FLC-like [Solanum tuberosum]
Length=429

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 179/325 (55%), Gaps = 71/325 (22%)
 Frame = -3

Query  1013  SRWMELHMAKKWRDKDISPERTKVWTQPPE---RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             SR  EL M KKW+ ++ SPERTKVWT+PP    R+V VVYYLS NG+L+HPHFME+ LSS
Sbjct  2     SRTTELQMHKKWKGRETSPERTKVWTEPPNHKLRKVPVVYYLSRNGQLEHPHFMEVPLSS  61

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG+GMAS+YSWSAKR Y+NGFVW DL ENDFIYPAHG EY+LKG
Sbjct  62    PDGLYLRDVINRLNCLRGKGMASMYSWSAKRSYRNGFVWHDLTENDFIYPAHGQEYVLKG  121

Query  662   SEL-----------IITHSSSQETPALTAAGEDREFPPLPPPRHN-----------VHAV  549
             SEL           I   +S    P +    EDREFP +   R+            V+  
Sbjct  122   SELLDSALPSQPDEIACSNSRNPVPEIQKMSEDREFPAVARRRNQSWSSSDFHEYLVYKA  181

Query  548   EEDKE-SGRSGSS-------------------------------EPSN------------  501
             E   E  GR G+                                EP +            
Sbjct  182   ESPGELLGRIGADASTQTEDRRRRRRGMRIVEEEEEELREDRTIEPDDVEHSPNQSTELN  241

Query  500   -GEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCG  324
              GEIS P + SS ETL  LMKAD + ++  +   +       S+ + + ASV+MQ+L CG
Sbjct  242   RGEISPPLSDSSSETLETLMKADGKVILRPDTISEDPTANTQSSGKSKAASVLMQLLYCG  301

Query  323   SVAAREHAPPCKAKTHAFSLISHHK  249
             S++ ++   P   K + FSLIS +K
Sbjct  302   SMSFKQCG-PGYGKENGFSLISQYK  325



>emb|CDP08997.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 158/354 (45%), Positives = 196/354 (55%), Gaps = 89/354 (25%)
 Frame = -3

Query  1013  SRWMELHMAKKWRDKDISPERTKVWTQPP-------ERRVAVVYYLSLNGKLQHPHFMEL  855
             +R  EL M K+W+D+D SPERTKVWT+PP       +RRV V+YYLS NG+L+HPHFME+
Sbjct  8     ARPTELQMPKRWKDRDTSPERTKVWTEPPNSKLKSSDRRVPVIYYLSRNGQLEHPHFMEV  67

Query  854   RLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEY  675
              LSSP  L+L+DV++RLNSLRG+GMASLYSWS KR YKNG+VW DL ENDFIYPAHG EY
Sbjct  68    PLSSPDALYLKDVINRLNSLRGKGMASLYSWSCKRSYKNGYVWHDLSENDFIYPAHGQEY  127

Query  674   ILKGSELI----ITHSSSQ---ETPALTAAGE------DREFPPLPPPR-----------  567
             ILKGSE++    IT S       T  L A  E        EFPP+  PR           
Sbjct  128   ILKGSEILDGAFITKSDETVMCSTAKLPAPPEGPLRVHSEEFPPVKAPRRRNQSWSSFDL  187

Query  566   --HNVHAVE-------------EDK------------------------ESGRSGSSEPS  504
               + V+  E             +DK                        ES R  SS+  
Sbjct  188   HEYKVYTGESASRAAADASTQTDDKRRRRRAVREIEEVHEGENEEKSREESQRIVSSDEI  247

Query  503   NGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSA----------ARPRTA  354
               EIS PP+ SSPETL  LMKAD R ++     R  AA  DP+A           R + +
Sbjct  248   T-EISPPPSDSSPETLETLMKADGRIIL-----RSGAANEDPTAPASNSNHPPSGRSKAS  301

Query  353   SVVMQILSCGSVAAREHAPPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAE  192
             SV+MQ++SCGS+  +    P + K H FSLISH+K+   LP G   N+    AE
Sbjct  302   SVLMQLVSCGSIGFKACG-PGQGKDHGFSLISHYKVR--LPRGGGSNHVGKDAE  352



>ref|XP_002281433.1| PREDICTED: protein UPSTREAM OF FLC [Vitis vinifera]
 emb|CBI16188.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 179/310 (58%), Gaps = 60/310 (19%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
             EL + KKW++++ SPERTKVWT+P  R+V+VVYYLS NG+L+HPHFME+ LSS  GLFLR
Sbjct  11    ELQLPKKWKERETSPERTKVWTEPNRRKVSVVYYLSRNGQLEHPHFMEVPLSSSDGLFLR  70

Query  821   DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI---  651
             DV++RLN LRG GMA +Y WSAKR YKNGFVW DL ENDFIYPAHG EY+LKGSEL+   
Sbjct  71    DVINRLNVLRGNGMAGMYCWSAKRSYKNGFVWHDLAENDFIYPAHGQEYVLKGSELLEGS  130

Query  650   -------ITHSSSQETPALTAAGEDREFPPLPPPR-----------HNVHAVEEDKES-G  528
                       SS ++ P    + +D +FP +   R           + V+  E   ES G
Sbjct  131   PKPKSNETMSSSFRKPPETHKSSDDSDFPVVVRRRNQSWSSIDLHEYKVYKAESTGESTG  190

Query  527   RSG-----------------------------------SSEPSNGEISTPPAGSSPETLA  453
             ++                                    S+E S  EIS PP+ SSPETL 
Sbjct  191   KAAADASTQTDDKRRRRRMIREEEIEPKTEEQEPYQNHSTELSREEISPPPSDSSPETLE  250

Query  452   ALMKADRRRVILMNEAR--KAAAYYDPSAARPRTASVVMQILSCGSVAAREHAPPCKAKT  279
             +LMKAD R ++        + A+  +PS  R + +SV+MQ++SCGS++ ++  P    K 
Sbjct  251   SLMKADGRLILGAGGGNQDQTASMSNPSVGRMKASSVLMQLISCGSMSFKDCGPTI-VKD  309

Query  278   HAFSLISHHK  249
                +LIS +K
Sbjct  310   QGLALISQYK  319



>emb|CAN67325.1| hypothetical protein VITISV_012830 [Vitis vinifera]
Length=942

 Score =   221 bits (564),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 179/310 (58%), Gaps = 60/310 (19%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
             EL + KKW++++ SPERTKVWT+P  R+V+VVYYLS NG+L+HPHFME+ LSS  GLFLR
Sbjct  11    ELQLPKKWKERETSPERTKVWTEPNRRKVSVVYYLSRNGQLEHPHFMEVPLSSSDGLFLR  70

Query  821   DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI---  651
             DV++RLN LRG GMA +Y WSAKR YKNGFVW DL ENDFIYPAHG EY+LKGSEL+   
Sbjct  71    DVINRLNVLRGNGMAGMYCWSAKRSYKNGFVWHDLAENDFIYPAHGQEYVLKGSELLEGS  130

Query  650   -------ITHSSSQETPALTAAGEDREFPPLPPPR-----------HNVHAVEEDKES-G  528
                       SS ++ P    + +D +FP +   R           + V+  E   ES G
Sbjct  131   PKPKSNETMSSSFRKPPETHKSSDDSDFPVVVRRRNQSWSSIDLHEYKVYKAESTGESTG  190

Query  527   RSG-----------------------------------SSEPSNGEISTPPAGSSPETLA  453
             ++                                    S+E S  EIS PP+ SSPETL 
Sbjct  191   KAAADASTQTDDKRRRRRMIREEEIEPKTEEQEPYQNHSTELSREEISPPPSDSSPETLE  250

Query  452   ALMKADRRRVILMNEAR--KAAAYYDPSAARPRTASVVMQILSCGSVAAREHAPPCKAKT  279
             +LMKAD R ++        + A+  +PS  R + +SV+MQ++SCGS++ ++  P    K 
Sbjct  251   SLMKADGRLILGAGGGNQDQTASMSNPSVGRMKASSVLMQLISCGSMSFKDCGPTI-VKD  309

Query  278   HAFSLISHHK  249
                +LIS +K
Sbjct  310   QGLALISQYK  319



>ref|XP_010112912.1| hypothetical protein L484_010843 [Morus notabilis]
 gb|EXC35061.1| hypothetical protein L484_010843 [Morus notabilis]
Length=443

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 139/319 (44%), Positives = 181/319 (57%), Gaps = 75/319 (24%)
 Frame = -3

Query  986  KKWRDK-DISPERTKVWTQPP---ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRD  819
            K+W+++ + SPER +VWT+PP   ER+V VVYYLS NG+L+HPHFME+ LSSP GL+LRD
Sbjct  17   KRWKERSETSPERNRVWTEPPKLKERKVPVVYYLSRNGQLEHPHFMEVPLSSPEGLYLRD  76

Query  818  VLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL-----  654
            V++RLN+LRG+GMA++YSWS+KR Y+NGFVW DL ENDFIYPAHGHEY+LKGSEL     
Sbjct  77   VINRLNALRGKGMATMYSWSSKRSYRNGFVWHDLSENDFIYPAHGHEYVLKGSELHLDPV  136

Query  653  ----IITHSSS---QETPALTAAGEDREFPPLPPPR-----------HNVHAVEEDKESG  528
                ++  +SS   +  P L  +  D +FP +   R           + V+  E   ES 
Sbjct  137  YDPKVLETASSRCLKPPPELQKSSGDDDFPAVVRRRNQSWSSIDLNEYKVYKAESFGESA  196

Query  527  ------------------------------RSG------------SSEPSNGEISTPPAG  474
                                          R G            S+E S  EIS PP+ 
Sbjct  197  GKAAADASTQTDDKRRRRRAAREEEENEKVREGGGKSEGEICENQSTELSRDEISPPPSD  256

Query  473  SSPETLAALMKADRRRVILMN----EARKAAAYYDPSAARPRTASVVMQILSCGSVAARE  306
            SSPETL +LMKAD R V+  N    E     A   PS  R R +SV+MQ++SCGSV+ ++
Sbjct  257  SSPETLESLMKADGRLVLCANGENEEGPDRTAGNCPS-GRTRASSVLMQLISCGSVSFKD  315

Query  305  HAPPCKAKTHAFSLISHHK  249
              P    K H  SLI  +K
Sbjct  316  CGPTL-VKDHGLSLIGQYK  333



>ref|XP_011089821.1| PREDICTED: protein UPSTREAM OF FLC-like [Sesamum indicum]
Length=365

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/318 (42%), Positives = 171/318 (54%), Gaps = 71/318 (22%)
 Frame = -3

Query  1001  ELHMAKKWRD--KDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLS  846
             EL + K WRD  ++ISPERTKVW +P       +RRV VVYYLS NG+L+HPHFME+ LS
Sbjct  13    ELQLTKGWRDQQREISPERTKVWIEPANGKLKADRRVPVVYYLSRNGQLEHPHFMEVPLS  72

Query  845   SPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILK  666
             S  GLFL DV++RLN LRG+GMA++YSWS KR YKNGFVW DL ENDFIYPAHGHEY+LK
Sbjct  73    STHGLFLGDVINRLNVLRGKGMAAMYSWSCKRSYKNGFVWHDLSENDFIYPAHGHEYVLK  132

Query  665   GSELI-------ITHSSSQETPALTA------AGEDREFPPLPPPRH------------N  561
             GSEL+       +T    Q+  AL A      AG D ++P     R              
Sbjct  133   GSELLENTFLETVTSLQRQQPRALPAPETQITAG-DLDYPQTSDRRRRNQSCSSIDFNLQ  191

Query  560   VHAVEEDKESGRSGSSEPSNG-----------------EISTPPAGSSP-----------  465
              ++V + + S RS +++ S                   E S  P    P           
Sbjct  192   EYSVYKAESSCRSAAADASTQTGESRRRRRRPPPEIVEEKSKEPCEKEPQRDEIEISPPP  251

Query  464   -----ETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHA  300
                  ETL  LMKAD R ++    A++ +        R   +SV+MQ+LSCGS++ ++  
Sbjct  252   SDSSPETLETLMKADGRLMLHPENAKEESTASRQQIQRAGKSSVLMQLLSCGSMSFKD--  309

Query  299   PPCKAKTHAFSLISHHKM  246
               C A      LIS +KM
Sbjct  310   --CGAGQGGLGLISQYKM  325



>ref|XP_008222935.1| PREDICTED: protein UPSTREAM OF FLC [Prunus mume]
Length=440

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 175/319 (55%), Gaps = 70/319 (22%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
            L +  KWRD + SP RT +   P      R+V VVYY+S NG+L+HPHFME+ LSSPRGL
Sbjct  12   LQIPSKWRDSETSPNRTSITETPNLAMTPRKVPVVYYISRNGQLEHPHFMEVPLSSPRGL  71

Query  830  FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            FLRDV++RLN LRG+GMASLYSWS+KR YK GFVW DL ENDFI+P+HGHEY+LKGSEL+
Sbjct  72   FLRDVINRLNLLRGKGMASLYSWSSKRSYKTGFVWHDLSENDFIHPSHGHEYVLKGSELL  131

Query  650  --------ITHSSSQET---PALTAAGEDREFPPLPPPR-----------HNVHAVE---  546
                    +  +SS+     P    +G+D + P +   R           + V+  E   
Sbjct  132  DPPVNSLALESASSRSLRPPPEAEKSGDDFDSPLIVRRRNQSWSSIDLNEYKVYKTESVG  191

Query  545  ----------------------------EDKESGR---------SGSSEPSNGEISTPPA  477
                                        +DK  G+         S S+E S GEIS PP+
Sbjct  192  ESASKAAADASTQTDDKRHRRRVVREERDDKVQGQSQQEVLQIHSQSTELSRGEISPPPS  251

Query  476  GSSPETLAALMKADRRRVILMNEARKAAAYYDPS---AARPRTASVVMQILSCGSVAARE  306
             SSPETL +LMKAD R VI  N A     +         + + +SV+MQ+LSCGS++ R+
Sbjct  252  DSSPETLESLMKADGRLVICTNGASDEGLHRTAEVCPGGKMKASSVLMQLLSCGSISFRD  311

Query  305  HAPPCKAKTHAFSLISHHK  249
                   K   FSLI H+K
Sbjct  312  CGSTA-VKEEGFSLIGHYK  329



>ref|XP_007205207.1| hypothetical protein PRUPE_ppa005864mg [Prunus persica]
 gb|EMJ06406.1| hypothetical protein PRUPE_ppa005864mg [Prunus persica]
Length=440

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 175/319 (55%), Gaps = 70/319 (22%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
            L +  KWRD + SP RT +   P      R+V VVYYLS NG+L+HPHFME+ LSSPRGL
Sbjct  12   LQIPSKWRDSETSPNRTSIIETPNLAMTPRKVPVVYYLSRNGQLEHPHFMEVPLSSPRGL  71

Query  830  FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            FLRDV++RLN LRG+GMASLYSWS+KR YK GFVW DL ENDFI+P+HGHEY+LKGSEL+
Sbjct  72   FLRDVINRLNLLRGKGMASLYSWSSKRSYKTGFVWHDLSENDFIHPSHGHEYVLKGSELL  131

Query  650  --------ITHSSSQET---PALTAAGEDREFPPLPPPR-----------HNVHAVE---  546
                    +  +SS+     P    +G+D + P +   R           + V+  E   
Sbjct  132  DPPVNSLALESASSRSLRPPPEAEKSGDDFDSPLIVRRRNQSWSSIDLNEYKVYKTESVG  191

Query  545  ----------------------------EDKESGR---------SGSSEPSNGEISTPPA  477
                                        +DK  G+         S S+E S GEIS PP+
Sbjct  192  ESAGKAAADASTQTDDKRHRRRVVREERDDKVQGQSQQEVLQIHSQSTELSRGEISPPPS  251

Query  476  GSSPETLAALMKADRRRVILMNEARKAAAYYDPS---AARPRTASVVMQILSCGSVAARE  306
             SSPETL +LMKAD R VI  N A     +         + + +SV+MQ+LSCGS++ R+
Sbjct  252  DSSPETLESLMKADGRLVICTNGASDEGLHRTAEVCPGGKMKASSVLMQLLSCGSISFRD  311

Query  305  HAPPCKAKTHAFSLISHHK  249
                   +   FSLI H+K
Sbjct  312  CGSTA-VRGEGFSLIGHYK  329



>ref|XP_006488258.1| PREDICTED: protein UPSTREAM OF FLC-like [Citrus sinensis]
Length=457

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 137/369 (37%), Positives = 195/369 (53%), Gaps = 98/369 (27%)
 Frame = -3

Query  1001  ELHMAKKWRDKD-----ISPERTKVWTQP----------PERRVAVVYYLSLNGKLQHPH  867
             +L +++KW+ +D     ISPERTKVWT+P            R+V V+YYLS NG+L+HPH
Sbjct  11    DLQVSRKWKGRDRQQQRISPERTKVWTEPNKNNKTSAAAANRKVPVIYYLSRNGQLEHPH  70

Query  866   FMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAH  687
             FM++ LSSP GLFL+DV++RLN LRG+GMAS+YSWS+KR YKNGFVW DL E+D IYPAH
Sbjct  71    FMDVPLSSPEGLFLKDVINRLNLLRGKGMASMYSWSSKRSYKNGFVWHDLSEDDLIYPAH  130

Query  686   GHEYILKGSELI----ITHSSSQETPA------LTAAGEDREFPPLPPPR----------  567
             G EY+LKGSE++    ++ + + E  A      L +  E  +FP +   R          
Sbjct  131   GQEYVLKGSEIVDPSPLSGAKAHEMAASSSFRVLKSGDESADFPVITRRRNQSWSSIDLN  190

Query  566   -HNVHAVEEDKESGR-----------------------------------------SGSS  513
              + V+  E + ES R                                         + ++
Sbjct  191   EYKVYKAEPNSESFRRLAADASTQTDDKRRRRRPVKVDEEGEQEQKSQSPSQEMYANQTT  250

Query  512   EPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKA----------AAYYDPSAARP  363
             E S  EIS PP+ SSPETL +LMKAD R ++    +              A  +PS  R 
Sbjct  251   ELSREEISPPPSDSSPETLESLMKADGRLILCDTSSNNKNNNDDSLSNRTADNNPS-GRM  309

Query  362   RTASVVMQILSCGSVAAREHAPPCKA---KTHAFSLISHHKMATLLPCGTRRNNPPDVAE  192
             + ++V+MQ++SCGS++ ++    C A   K   FSLI H+K    LP G + +    VA+
Sbjct  310   KASTVLMQLISCGSISFKD----CGAGNVKDQGFSLIGHYK--ARLPRG-QGDKKEAVAD  362

Query  191   NAVMELPLI  165
               +   P +
Sbjct  363   GEIRNFPRV  371



>gb|KDO72962.1| hypothetical protein CISIN_1g015443mg [Citrus sinensis]
Length=406

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 134/366 (37%), Positives = 192/366 (52%), Gaps = 92/366 (25%)
 Frame = -3

Query  1001  ELHMAKKWRDKD-----ISPERTKVWTQP----------PERRVAVVYYLSLNGKLQHPH  867
             +L +++KW+ +D     ISPERTKVWT+P            R+V V+YYLS NG+L+HPH
Sbjct  11    DLQVSRKWKGRDRQQQRISPERTKVWTEPNKNNKTSAAAANRKVPVIYYLSRNGQLEHPH  70

Query  866   FMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAH  687
             FM++ LSSP GLFL+DV++RLN LRG+GMAS+YSWS+KR YKNGFVW DL E+D IYPAH
Sbjct  71    FMDVPLSSPEGLFLKDVINRLNLLRGKGMASMYSWSSKRSYKNGFVWHDLSEDDLIYPAH  130

Query  686   GHEYILKGSELI----ITHSSSQETPA------LTAAGEDREFPPLPPPR----------  567
             G EY+LKGSE++    ++ + + E  A      L +  E  +FP +   R          
Sbjct  131   GQEYVLKGSEIVDPSPLSGAKAHEMAASSSFRVLKSGDESADFPVITRRRNQSWSSIDLN  190

Query  566   -HNVHAVEEDKESGR-----------------------------------------SGSS  513
              + V+  E + ES R                                         + ++
Sbjct  191   EYKVYKAEPNSESFRRLAADASTQTDDKRRRRRPVKVDEEEEQEQKSQSQSQEMYANQTT  250

Query  512   EPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKA----------AAYYDPSAARP  363
             E S  EIS PP+ SSPETL +LMKAD R ++    +              A  +PS  R 
Sbjct  251   ELSREEISPPPSDSSPETLESLMKADGRLILCDTSSNNKNNNDDSLSNRTADNNPS-GRM  309

Query  362   RTASVVMQILSCGSVAAREHAPPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENAV  183
             + ++V+MQ++SCGS++ ++       K   FS+I H+K    LP G +      VA+  +
Sbjct  310   KASTVLMQLISCGSISFKD-CGAGNVKDQGFSVIGHYK--ARLPRG-QGGKKEAVADGEI  365

Query  182   MELPLI  165
                P +
Sbjct  366   RNFPRV  371



>ref|XP_009384890.1| PREDICTED: protein UPSTREAM OF FLC-like [Musa acuminata subsp. 
malaccensis]
Length=484

 Score =   200 bits (508),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/279 (43%), Positives = 161/279 (58%), Gaps = 49/279 (18%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRD  819
            +   ++WR ++ SPERTKVW +P  ++V VVYYLS NG+L+HPHFME+ LSS  GL+LRD
Sbjct  78   METMRQWRGRETSPERTKVWKEPKPKKVPVVYYLSRNGQLEHPHFMEVTLSSGDGLYLRD  137

Query  818  VLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL--IIT  645
            V+DRLN LRG+G+A LYSWS+KR YKNGFVW DL E D I+PAHGHEY+LKGSEL  II+
Sbjct  138  VIDRLNFLRGKGIADLYSWSSKRSYKNGFVWHDLSEGDLIHPAHGHEYVLKGSELPQIIS  197

Query  644  HSSSQETPA-------LTAAGEDREF----------------------PPLPPPRHNVHA  552
              SSQ+T A         +  ED E                         +P     + A
Sbjct  198  SPSSQDTIASEKTLSIRKSVDEDPEILQIGRKKAPWGSFDINEYKVYKTAVPAQTGGLMA  257

Query  551  VEEDKE----------------SGRSGSSEPSNGEISTPPAGSSPETLAALMKADRRRVI  420
             +   +                 GR+  +E  + EIS PP+ SSPETL  L+KAD R V+
Sbjct  258  ADASTQTDDRRIRRRAASTRDAGGRAEITELDSDEISPPPSSSSPETLETLIKADGRAVV  317

Query  419  LMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREH  303
               +  +    Y  ++ R R ++V+M +LSCGS+  ++ 
Sbjct  318  GTEDHDRTVGRY--ASGRMRASAVLMHLLSCGSINVKDQ  354



>ref|NP_001234635.1| auxin-regulated protein [Solanum lycopersicum]
 gb|AAL08561.1| auxin-regulated protein [Solanum lycopersicum]
Length=433

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 117/159 (74%), Gaps = 14/159 (9%)
 Frame = -3

Query  1013  SRWMELHMAKKWRDKDISPERTKVWTQPPERR---VAVVYYLSLNGKLQHPHFMELRLSS  843
             SR  EL M KKW+ ++ SPERTKVWT+PP  +   V VVYYLS NG+L+HPHFME+ LSS
Sbjct  2     SRTTELQMHKKWKGRETSPERTKVWTEPPNHKLSKVPVVYYLSRNGQLEHPHFMEVPLSS  61

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG+GMAS+YSWSAKR Y+NGFVW DL ENDFIYPAHG EY+LKG
Sbjct  62    RDGLYLRDVINRLNCLRGKGMASMYSWSAKRSYRNGFVWHDLTENDFIYPAHGQEYVLKG  121

Query  662   SELI----------ITHSSSQET-PALTAAGEDREFPPL  579
             SEL+          I  S+S+ T P      EDREFP +
Sbjct  122   SELLDSALPSQPDEIACSNSRNTVPEKQKLSEDREFPAV  160


 Score = 60.8 bits (146),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = -3

Query  518  SSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQ  339
            S+E + GEIS P + SS ETL  LMKAD + ++  +   +       S+ + + ASV+MQ
Sbjct  241  STELNRGEISPPLSDSSSETLETLMKADGKLILRPDTISEDPTANTHSSGKSKAASVLMQ  300

Query  338  ILSCGSVAAREHAPPCKAKTHAFSLISHHK  249
            +L CGS++ ++   P   K + FSLIS +K
Sbjct  301  LLYCGSMSFKQ-CGPGYGKENGFSLISQYK  329



>ref|XP_011089425.1| PREDICTED: LOW QUALITY PROTEIN: protein UPSTREAM OF FLC [Sesamum 
indicum]
Length=368

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 162/276 (59%), Gaps = 33/276 (12%)
 Frame = -3

Query  1001  ELHMAKK--WRD-KDISPE--RTKVWTQPPE-----RRVAVVYYLSLNGKLQHPHFMELR  852
             E+H   K  WR+ ++ISP+  RT +W++P +     +RV V+YYL  NG+LQHPHFME+ 
Sbjct  15    EVHQLSKTYWREQREISPDGRRTILWSEPHDNATSCKRVPVLYYLCRNGQLQHPHFMEVP  74

Query  851   LSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYI  672
             LSSP+GLFL DV+ RLN LRG+ MASLYSWS KR YKNGFVW DL ENDFIYPAHGHEY+
Sbjct  75    LSSPQGLFLTDVISRLNVLRGKAMASLYSWSCKRSYKNGFVWHDLSENDFIYPAHGHEYV  134

Query  671   LKGSELII--------THSSSQETPALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGS  516
             LKGSEL +        +           +  +D +       R   H+   +K+  R   
Sbjct  135   LKGSELPVKALLDAGSSSPPPPPAETQGSGADDLDSLQAADSRRRNHSCLGNKQQQR---  191

Query  515   SEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARK----AAAYYD-PSAARPRTAS  351
              +    EIS P + SSPETL  LMKAD R  +   +A +       + D P   R R+ S
Sbjct  192   -DECEIEISPPLSDSSPETLETLMKADGRPTVSAAKANENPPATNTHQDHPDIQRCRS-S  249

Query  350   VVMQILSCGSVAAREHAPPCKA-KTHAFSLISHHKM  246
             V+MQ++SCGS+  ++    C A +     L+  +KM
Sbjct  250   VLMQLISCGSMPFKD----CGAGQVQVQGLMGQYKM  281



>gb|KHG03526.1| hypothetical protein F383_27518 [Gossypium arboreum]
Length=370

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/344 (36%), Positives = 178/344 (52%), Gaps = 80/344 (23%)
 Frame = -3

Query  992  MAKKWRDK-DISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            +++KW++  +ISPER KVW +P        R+VAVVYYLS NG+LQHPHFM++ LSS  G
Sbjct  15   VSRKWKETVEISPERNKVWVEPKPLNTLVVRKVAVVYYLSRNGQLQHPHFMQVPLSSNAG  74

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
            L+L+DV+ RLN LRG+GMASLYSWS+KR YKNGFVW DL E+DFIYP+HG EY+LKGSE+
Sbjct  75   LYLKDVIKRLNLLRGKGMASLYSWSSKRSYKNGFVWHDLAEDDFIYPSHGQEYVLKGSEI  134

Query  653  IITHSSSQETPALTAAGEDREFPPL----PPPRHNVHAVEEDKESGRSGSSEPS----NG  498
            +    +  E+  L   G+D +F P+     P R ++   E    +  S S  P     + 
Sbjct  135  LDHSINLLESEKL---GKDHDFQPIRRQRDPSRSSIDLPEHKIFTADSSSDSPGKLAVDA  191

Query  497  EISTPPAGSSP--------------------------------------ETLAALMKADR  432
               T      P                                      ETL +LMKAD 
Sbjct  192  STQTDDKRRKPVVKESKIERLQSQELEQNQSTELRREDISPPRPSDSSSETLESLMKADA  251

Query  431  RRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAPPCKAKTHAFSLISHH  252
             R +   + ++        + R + ++V+MQ++SCGSV+ +E     + +   FSL  H+
Sbjct  252  LRSLCEGDGKEDNL---NRSGRMKASAVLMQLISCGSVSIKEFGGESE-RDQGFSLTGHY  307

Query  251  KMATLLPCG------------------TRRNNPPDVAENAVMEL  174
            +  + LP G                  T+R   PD+  ++ ++L
Sbjct  308  Q--SRLPRGAGNRNQMGKEHFSGSLSETKREGAPDLKRSSGLQL  349



>ref|XP_010920698.1| PREDICTED: protein UPSTREAM OF FLC-like [Elaeis guineensis]
Length=430

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 170/305 (56%), Gaps = 68/305 (22%)
 Frame = -3

Query  992  MAKKWRDKDISPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFL  825
            + ++W+D++ SPE TKV T+P     ER+V VVYYLS NG+L+HPHFME+ LSS  GL+L
Sbjct  11   LVRQWKDRETSPEATKVRTEPKPGITERKVPVVYYLSRNGQLEHPHFMEVSLSSSDGLYL  70

Query  824  RDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI--  651
            RDV++RL+ LRG+GMAS+YSWS+KR YKNGFVW D+ E+DFIYPAHGHEYILKGSEL+  
Sbjct  71   RDVINRLDVLRGKGMASMYSWSSKRSYKNGFVWHDICEDDFIYPAHGHEYILKGSELLHP  130

Query  650  ----------ITHSSSQETP----------------------------------------  621
                      +  SS  E P                                        
Sbjct  131  ANSSPMSQDTVASSSGSEKPLEIAKSVHYDSDYSLVRRNKKPWSSLDLNEYKVYKSELTS  190

Query  620  --ALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGSSEPSNGEISTPPAGSSPETLAAL  447
              AL AA    +       RH V   ++++    + ++E    EIS PP+ SSPETL +L
Sbjct  191  ETALKAADAATQTDEKKQRRHAVVGRDDNRADEENPTTELGRDEISPPPSSSSPETLESL  250

Query  446  MKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAPPCKAKTHAFS  267
            MKAD R V   +  ++      PS  R R ++V+M ++SCGS+       P K +   FS
Sbjct  251  MKADGRLVPDASGYQERTVDSYPS-GRFRASAVLMHLISCGSI-------PIKDR--GFS  300

Query  266  LISHH  252
            L+SH+
Sbjct  301  LVSHY  305



>ref|XP_010658613.1| PREDICTED: protein UPSTREAM OF FLC [Vitis vinifera]
 ref|XP_010658614.1| PREDICTED: protein UPSTREAM OF FLC [Vitis vinifera]
 ref|XP_010658615.1| PREDICTED: protein UPSTREAM OF FLC [Vitis vinifera]
Length=321

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 160/288 (56%), Gaps = 70/288 (24%)
 Frame = -3

Query  989  AKKWRDKDISPERTKVWTQPP--ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDV  816
            +KKW   +ISPER+KVW +P   ER+ AVVYYL  NG+L+HPHFME+ +SSP+GLFLRDV
Sbjct  5    SKKW---EISPERSKVWKEPKPMERKAAVVYYLCRNGQLEHPHFMEIPISSPQGLFLRDV  61

Query  815  LDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIIT---  645
            ++RLNSLRG+GMAS+YSWS+KR Y+NGFVW DL ENDFIYP  GHEY+LKG+EL+ T   
Sbjct  62   VERLNSLRGQGMASMYSWSSKRSYRNGFVWHDLTENDFIYPTQGHEYVLKGTELLQTSLS  121

Query  644  -----HSSSQETPALTAAGEDREFP-----------PLPPPRHNVH--------------  555
                   SS+  P    +G+D  FP              P  + V+              
Sbjct  122  FGYYEKISSENKPETNNSGDDCNFPFIIRKRNQSWGSFNPREYKVYKDDPATEHAGKAMD  181

Query  554  --------------AVEEDKES--GRSGS-SEPSNGEISTPPAGSSPE------TLAALM  444
                          A+EE +E+  G S S +E S  EIS P + +S E      +  A  
Sbjct  182  AATQTEDKRRRRRTAIEEGEEAEYGHSTSTTELSREEISPPLSNTSSEEAPVGQSSVAAP  241

Query  443  KADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHA  300
             AD          R  AA  D  + R + ++V+  ++ CGSV+ ++ A
Sbjct  242  SAD---------IRNQAAENDRPSGRMKASAVLKHLIRCGSVSVKDQA  280



>ref|XP_009402338.1| PREDICTED: protein UPSTREAM OF FLC-like [Musa acuminata subsp. 
malaccensis]
Length=435

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 10/153 (7%)
 Frame = -3

Query  986  KKWRDKDISPERTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            ++WRD++ SPERTKVW +P  RRV VVYYLS NG+L+HPHFME+ LSS  GL+LRDV++R
Sbjct  14   RQWRDRETSPERTKVWKEPKPRRVPVVYYLSRNGQLEHPHFMEVTLSSSHGLYLRDVIER  73

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI--ITHSSS  633
            LN LRG+GMASLYSWS+KR YKNGFVW DL E+D IYPAHGHEY+LKGSEL+  ++  SS
Sbjct  74   LNFLRGQGMASLYSWSSKRCYKNGFVWHDLSEDDLIYPAHGHEYVLKGSELLQPVSSPSS  133

Query  632  QETPALTAAGEDREFPPLPPPRHNVHAVEEDKE  534
            Q+T A   A +     PLP P+    +V ED E
Sbjct  134  QDTIAPFYASDK----PLPIPK----SVHEDPE  158



>ref|XP_008385167.1| PREDICTED: protein UPSTREAM OF FLC-like [Malus domestica]
Length=448

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 128/321 (40%), Positives = 170/321 (53%), Gaps = 72/321 (22%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPPE-----RRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            L +  KWRD + SP+R       P      R+V VVYYLS NG+L+HPHFME+ LSSPRG
Sbjct  12   LQIPSKWRDSETSPDRISPAQTGPSLPITPRKVPVVYYLSRNGQLEHPHFMEVPLSSPRG  71

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
            LFL+DV++RLN LRG+GMA +YSWS+KR YK GFVW DL E+D I+P+HGHEY+LKGSEL
Sbjct  72   LFLKDVINRLNLLRGKGMALMYSWSSKRSYKTGFVWHDLTEDDLIHPSHGHEYVLKGSEL  131

Query  653  I---ITHSSSQET--------PALTAAGEDREFPPLPPPR-----------HNVHAVEED  540
            +   + H + +          P    + ED E P +   R           + V+  E  
Sbjct  132  LDPPLNHMALETASSRSLRPPPEALKSAEDFESPVISRQRNQSWSSIDLNEYKVYKTESV  191

Query  539  KESGR----------------------------------------SGSSEPSNGEISTPP  480
             ES R                                        S S+E S GE+S PP
Sbjct  192  GESARKAAADASTQTDENRHRRRVVRDEHEEKGQGQSQREVIQIQSQSTELSRGEMSPPP  251

Query  479  AGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARP----RTASVVMQILSCGSVAA  312
            + SSPETL +LMKAD R V+  N A +  A    +   P    + ++V+MQ+LSCGS++ 
Sbjct  252  SDSSPETLESLMKADGRLVLCTNGANEEEAVNQTAEICPTGKMKASTVLMQLLSCGSISF  311

Query  311  REHAPPCKAKTHAFSLISHHK  249
            R+       +   FSLI H+K
Sbjct  312  RD-CGSTAVREQGFSLIGHYK  331



>ref|XP_009338350.1| PREDICTED: uncharacterized protein LOC103930705 isoform X2 [Pyrus 
x bretschneideri]
Length=391

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 129/321 (40%), Positives = 171/321 (53%), Gaps = 72/321 (22%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPPE-----RRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            L +  KWRD +ISP+R       P      ++V VVYYLS NG+L+HPHFME+ LSSP G
Sbjct  12   LQIPSKWRDSEISPDRISPAQTGPSLPITPQKVPVVYYLSRNGQLEHPHFMEVPLSSPSG  71

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
            LFL+DV++RLN LRG+GMA +YSWS+KR YK GFVW DL E+D I+P+HGHEY+LKGSEL
Sbjct  72   LFLKDVINRLNLLRGKGMALMYSWSSKRSYKTGFVWHDLTEDDLIHPSHGHEYVLKGSEL  131

Query  653  I--------ITHSSSQET---PALTAAGEDREFPPLPPPR-----------HNVHAVEED  540
            +        +  +SS+     P    + ED E P +   R           + V+  E  
Sbjct  132  LDPPLNHLALEAASSRSLRPPPEALKSAEDFESPVISRRRNQSWNSIDLNEYKVYKTESV  191

Query  539  KESGR----------------------------------------SGSSEPSNGEISTPP  480
             ES R                                        S S+E S GEIS PP
Sbjct  192  GESARKAAADASTQTDEKRHRRRVVRDENEEKGQGQSQREVIRIQSQSTELSRGEISPPP  251

Query  479  AGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARP----RTASVVMQILSCGSVAA  312
            + SSPETL +LMKAD R V+  N A +  A    +   P    + ++V+MQ+LSCGS++ 
Sbjct  252  SDSSPETLESLMKADGRLVLCTNGANEEEAVNQTAEICPTGKMKASTVLMQLLSCGSISF  311

Query  311  REHAPPCKAKTHAFSLISHHK  249
            R+       +   FSLI H+K
Sbjct  312  RDCG-STAVREQGFSLIGHYK  331



>ref|XP_009338349.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Pyrus x bretschneideri]
Length=446

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 129/321 (40%), Positives = 171/321 (53%), Gaps = 72/321 (22%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPPE-----RRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            L +  KWRD +ISP+R       P      ++V VVYYLS NG+L+HPHFME+ LSSP G
Sbjct  12   LQIPSKWRDSEISPDRISPAQTGPSLPITPQKVPVVYYLSRNGQLEHPHFMEVPLSSPSG  71

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
            LFL+DV++RLN LRG+GMA +YSWS+KR YK GFVW DL E+D I+P+HGHEY+LKGSEL
Sbjct  72   LFLKDVINRLNLLRGKGMALMYSWSSKRSYKTGFVWHDLTEDDLIHPSHGHEYVLKGSEL  131

Query  653  I--------ITHSSSQET---PALTAAGEDREFPPLPPPR-----------HNVHAVEED  540
            +        +  +SS+     P    + ED E P +   R           + V+  E  
Sbjct  132  LDPPLNHLALEAASSRSLRPPPEALKSAEDFESPVISRRRNQSWNSIDLNEYKVYKTESV  191

Query  539  KESGR----------------------------------------SGSSEPSNGEISTPP  480
             ES R                                        S S+E S GEIS PP
Sbjct  192  GESARKAAADASTQTDEKRHRRRVVRDENEEKGQGQSQREVIRIQSQSTELSRGEISPPP  251

Query  479  AGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARP----RTASVVMQILSCGSVAA  312
            + SSPETL +LMKAD R V+  N A +  A    +   P    + ++V+MQ+LSCGS++ 
Sbjct  252  SDSSPETLESLMKADGRLVLCTNGANEEEAVNQTAEICPTGKMKASTVLMQLLSCGSISF  311

Query  311  REHAPPCKAKTHAFSLISHHK  249
            R+       +   FSLI H+K
Sbjct  312  RDCGSTA-VREQGFSLIGHYK  331



>ref|XP_010937705.1| PREDICTED: protein UPSTREAM OF FLC-like [Elaeis guineensis]
Length=428

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = -3

Query  995  HMAKKWRDKDISPERTKVWTQPPER----RVAVVYYLSLNGKLQHPHFMELRLSSPRGLF  828
             + K+W+D++ SPERTKVWT+P  R    +V VVYYLS NG+L+HPHFME+ LSS  GL+
Sbjct  10   ELVKQWKDRETSPERTKVWTEPKSRSSPRKVPVVYYLSRNGQLEHPHFMEVSLSSSDGLY  69

Query  827  LRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELII  648
            L+DV+DRLN LRG+GMAS+YSWS+KR YKNGFVW DL E+DFIYP HGHEY+LKGSEL++
Sbjct  70   LKDVIDRLNFLRGKGMASMYSWSSKRSYKNGFVWHDLSEDDFIYPTHGHEYVLKGSELLL  129

Query  647  THSSSQETPALTAAGEDREFPPLPPPRHNVH  555
               SS  +    A+       PL  P+ +VH
Sbjct  130  PADSSPTSQDTAASSSSNSEKPLAIPK-SVH  159



>ref|XP_007009444.1| Domain of Uncharacterized protein function, putative [Theobroma 
cacao]
 gb|EOY18254.1| Domain of Uncharacterized protein function, putative [Theobroma 
cacao]
Length=299

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 161/280 (58%), Gaps = 51/280 (18%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP---ERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
             MEL M K  +D+  SPERT VW +     ER+V+VVYYLS NG+L+HPHF+E+ LSSP+G
Sbjct  9     MELPMQKINQDRKTSPERTMVWVESKSNKERKVSVVYYLSRNGQLEHPHFIEVPLSSPQG  68

Query  833   LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
             LFL+DV+ RLNSLRGEGMA+ YSWS+KR YKNG+VWQDL +NDFIYP+HGHEYILKGS L
Sbjct  69    LFLKDVIIRLNSLRGEGMANRYSWSSKRSYKNGYVWQDLSKNDFIYPSHGHEYILKGSLL  128

Query  653   IITHSSSQETPALT-------------AAGEDREFPPLPPPRHNVHAVEEDKE-------  534
             + T  S +    ++             ++GED  FP     +H  H+  E KE       
Sbjct  129   LQTSLSFRSYKTVSSTSSISKNSSETYSSGEDSNFPAKIRRKH--HSWSEFKELDEHKIY  186

Query  533   ---SGRSGSSEPSNGEISTPPAGSSPETLAALMKADRRR---------------------  426
                + R  SS+ +N  +ST    ++ +      +A+  +                     
Sbjct  187   EARTSREFSSKGNN--VSTQTDENARQRRVGGEEAEEHQRENGQQTPRPSSYSSSEVPEC  244

Query  425   VILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAARE  306
             + +  + R  +   D  + R + ++V+MQ+++CGS  A++
Sbjct  245   LNISADIRDQSVENDRPSGRIKASAVLMQLIACGSRRAKD  284



>ref|XP_008357689.1| PREDICTED: protein UPSTREAM OF FLC [Malus domestica]
Length=449

 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/321 (39%), Positives = 165/321 (51%), Gaps = 72/321 (22%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPPE-----RRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            L +  KWRD + SP+R       P      R+V VVYYLS+NG+L+HPHFME+ LSSPRG
Sbjct  12   LQIPSKWRDSETSPDRISPAQTGPNLPFTPRKVPVVYYLSMNGQLEHPHFMEVPLSSPRG  71

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
            LFLRDV++RLN LRG+GMA +YSWS+KR Y+ GFVW DL END IYP+HGHEY+LKGSEL
Sbjct  72   LFLRDVINRLNLLRGKGMALMYSWSSKRSYRTGFVWHDLTENDLIYPSHGHEYVLKGSEL  131

Query  653  I--------ITHSSSQET---PALTAAGEDREFPPL------------------------  579
            +        +  +SS+     P    +G+D + P +                        
Sbjct  132  LDPPLNHLALETASSRSLRPPPEALKSGDDFDSPVISRRRNQSWSSIDLNEYKVYKTESV  191

Query  578  ---------------PPPRHNVHAVEEDKESG-------------RSGSSEPSNGEISTP  483
                              RH     EE  E G             +S  +E    EIS P
Sbjct  192  GESTGKAAADASTQTDDKRHQRRFREEHDEKGQGQGQSQREVIQIQSHGTELGRDEISPP  251

Query  482  PAGSSPETLAALMKADRRRVILMNEARKAAAYYDPS---AARPRTASVVMQILSCGSVAA  312
            P+ SSPETL +LMKAD R V+  N   K           A + + ++V+MQ++SCGS + 
Sbjct  252  PSDSSPETLESLMKADGRLVLCANGVSKEPVNRTAEVCPAGKLKASTVLMQLISCGSTSF  311

Query  311  REHAPPCKAKTHAFSLISHHK  249
            R+       +    SL+ H+K
Sbjct  312  RD-CGSTAVREQGLSLVGHYK  331



>ref|XP_004505888.1| PREDICTED: uncharacterized protein LOC101507317 [Cicer arietinum]
Length=427

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 179/329 (54%), Gaps = 66/329 (20%)
 Frame = -3

Query  959  PERTKVWTQPPER--RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGE  786
            PERTKVWT+P  R  +V+VVYYLS NG+L+HPHFME+ LSSP GL+L+DV+ RLN LRG+
Sbjct  17   PERTKVWTEPRPRPKKVSVVYYLSRNGQLEHPHFMEVPLSSPHGLYLKDVIIRLNLLRGK  76

Query  785  GMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI-------ITHSSSQE  627
             M+++YSWS+KR YKNGFVW DL ENDFIYP  G +YILKGSE++       IT  +S+E
Sbjct  77   AMSTMYSWSSKRSYKNGFVWHDLSENDFIYPTQGQDYILKGSEILDHAATAAITSRTSEE  136

Query  626  ---TPALTAAGEDREFPPLPPPRHNVHAVEEDKES-------------------------  531
               +P +     ++ +  +    + V+  E   +S                         
Sbjct  137  ETDSPVVITRRRNQSWSSIDLNEYRVYKSESLGDSVGNIAADASTQTEDKRRRRKVVREK  196

Query  530  -------------------GR--SGSSEPSNGEISTPPAGSSPETLAALMKADRRRVILM  414
                               GR  + S+E S  EIS PP+ SSPETL  LMK D R  +  
Sbjct  197  EEEEEEEKNEIENEEVETEGRDQNQSTELSREEISPPPSDSSPETLGTLMKVDGRLGLRS  256

Query  413  NEARKAAAYYD--PSAARPRTASVVMQILSCGSVAAREH-APPCKAKTHAFSLISHHKMA  243
            +   K     D  PS  R + +SV++Q+LSCG+V+ +E  +     K   FSL+ H+K  
Sbjct  257  SVPAKENLTADNYPS-GRMKASSVLLQLLSCGAVSLKESMSGTGSGKDQRFSLVGHYK--  313

Query  242  TLLPCGTRRNNPPDVAENAVMELPLITSV  156
            + LP G       +V    +ME+P ++ V
Sbjct  314  SRLPRGAGNQEGKEVG--TLMEIPDLSRV  340



>ref|XP_010541386.1| PREDICTED: protein UPSTREAM OF FLC-like [Tarenaya hassleriana]
Length=428

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 119/300 (40%), Positives = 165/300 (55%), Gaps = 68/300 (23%)
 Frame = -3

Query  992  MAKKWRDKDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLF  828
            + K+ ++++ SP+RT++W++P      +R+V VVYYL  NG+L HPHFME+ LSSP GL+
Sbjct  17   IPKRLKEQETSPDRTRIWSEPRHQSSVDRKVPVVYYLCRNGQLDHPHFMEVPLSSPDGLY  76

Query  827  LRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE---  657
            LRDV++RLN LRG+GMASLYSWS+KR YKNGFVW DL ENDFI+P HG EY+LKGSE   
Sbjct  77   LRDVINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSENDFIFPVHGQEYVLKGSEIPD  136

Query  656  -LIITHSSSQETPALTA--------AGEDREFPPLPPPRHN-------------------  561
             L+       ET +  A        + +D +FP     R N                   
Sbjct  137  RLVQNPRGLLETSSFRAPRTFDPVNSRKDSDFPATVARRRNQSWSSIDLSEYKVYKAESS  196

Query  560  ----------------------VHAVEE-------DKESGRSGSSEPSNGEISTPPAGSS  468
                                  + A++E       D E   S S+E S GEIS PP+ SS
Sbjct  197  TASTHRLAADASTQTDDRRRRRIPAMDEEPSVKSPDPEPYESHSTELSRGEISPPPSDSS  256

Query  467  PETLAALMKADRRRVILMNEARKAA---AYYDPSAARPRTASVVMQILSCGSVAAREHAP  297
            PETL  LMK D R ++  +E  +           + R R ++V+MQ++SCG+++ +E  P
Sbjct  257  PETLETLMKTDGRLILHPSEGNERGLNRTVESIPSGRMRASTVLMQLISCGTMSFKECGP  316



>ref|XP_002534353.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28033.1| conserved hypothetical protein [Ricinus communis]
Length=441

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 124/311 (40%), Positives = 171/311 (55%), Gaps = 70/311 (23%)
 Frame = -3

Query  986  KKWRDKDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDV  816
            +K++D+D +   T  W +P    ++RV VVYYLS NG+L+HPHF+E+ LSSP GL+LRDV
Sbjct  22   RKFKDRD-NDTTTIPWVEPMPKSQKRVPVVYYLSRNGQLEHPHFIEVPLSSPDGLYLRDV  80

Query  815  LDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELII----  648
            + RLN LRG+GMASLYSWS+KR Y+NGFVW DL ENDFIYPAHGHEY+LKGSEL+     
Sbjct  81   ISRLNVLRGKGMASLYSWSSKRSYRNGFVWHDLAENDFIYPAHGHEYVLKGSELLDPSNR  140

Query  647  ------THSSSQETPA------LTAAGEDREFPPLPPPR-----------HNVHAVEEDK  537
                  T SS    P        +++ E+ +FP +   R           + V+  E   
Sbjct  141  PLLPEPTPSSMSVKPLKPPEIHKSSSSEESDFPVITRRRNQSWSSIDLNEYKVYKTESFS  200

Query  536  ESGRSGSSEPSNG--------------------------------EISTPPAGSSPETLA  453
            ES R  +++ S                                  EIS PP+ SSPETL 
Sbjct  201  ESTRKLAADASTQTTDDKRRRRRLVKKDEEIEEKSQEPEVNREEIEISPPPSDSSPETLE  260

Query  452  ALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAPPCKA---K  282
            +LMKAD R ++      ++      +  R + ++V+MQ++SCGS++ R+    C A   K
Sbjct  261  SLMKADGRLILGSRSNEESPNPTTENYGRIKASTVLMQLISCGSISFRD----CGATAVK  316

Query  281  THAFSLISHHK  249
                SLI H+K
Sbjct  317  EQGLSLIGHYK  327



>ref|XP_010253296.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo nucifera]
Length=444

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
             EL + KKW+D++ SPERTK+WT+P    ER+V VVYYLS NG L+HPHFME+ LSS  GL
Sbjct  10    ELQIPKKWKDRETSPERTKIWTEPRPKTERKVPVVYYLSRNGHLEHPHFMEVPLSSSEGL  69

Query  830   FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             +LRDV++RLN LRG+GM S+YSWS+KR YKNGFVW DL ENDFIYPAHG EY+LKG
Sbjct  70    YLRDVINRLNVLRGKGMPSMYSWSSKRSYKNGFVWHDLSENDFIYPAHGQEYVLKG  125



>gb|KDP44192.1| hypothetical protein JCGZ_05659 [Jatropha curcas]
Length=449

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 117/320 (37%), Positives = 175/320 (55%), Gaps = 71/320 (22%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPP-------ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
            + + ++++D++ +PERTK + QP        +R+VAVVYYLS NG+L+HPHFME+ L+S 
Sbjct  15   IQVPRRFKDRENTPERTKPFLQPSKPKNITDQRKVAVVYYLSRNGQLEHPHFMEVPLTSS  74

Query  839  RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
             GL+L+D+++RLN LRG+GMASLYSWS+KR YKNGFVW DL E+D IYPAHGHEY+LKGS
Sbjct  75   EGLYLKDIINRLNILRGKGMASLYSWSSKRSYKNGFVWHDLTEDDLIYPAHGHEYVLKGS  134

Query  659  E-----------LIITHSSSQETPAL-----TAAGEDREFPPLPPPR-----------HN  561
            E           L++  +SS  +P        ++ E+  FP +   R           + 
Sbjct  135  ELLDSSINPNKPLLLETTSSFTSPKQPEIRKLSSSEEANFPVVTRRRNQSWSSVDLNEYK  194

Query  560  VHAVEEDKESGRSGSSEPSNG-----------------------------------EIST  486
            V+  E   ES +  +++ S                                     EIS 
Sbjct  195  VYKTESFSESAQKLAADASTQTDEKRRRRRPAKQEDEIEELQEEKSPEPEVNREEIEISP  254

Query  485  PPAGSSPETLAALMKADRRRVILMNEARKAAAYYD-PSAARPRTASVVMQILSCGSVAAR  309
            PP+ SSPETL +L+KAD R ++      + +      +  R + ++V+M ++SCGS++ R
Sbjct  255  PPSDSSPETLESLLKADGRLILGSGSGNEESLNRTVENCGRTKASTVLMHLISCGSMSFR  314

Query  308  EHAPPCKAKTHAFSLISHHK  249
            +       +   FSLI H+K
Sbjct  315  DCGATA-VREQGFSLIGHYK  333



>ref|XP_010322315.1| PREDICTED: auxin-regulated protein isoform X1 [Solanum lycopersicum]
Length=428

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 112/159 (70%), Gaps = 19/159 (12%)
 Frame = -3

Query  1013  SRWMELHMAKKWRDKDISPERTKVWTQPPERR---VAVVYYLSLNGKLQHPHFMELRLSS  843
             SR  EL M KKW+ ++ SPERTKVWT+PP  +   V VVYYLS NG+L+HPHFME+ LSS
Sbjct  2     SRTTELQMHKKWKGRETSPERTKVWTEPPNHKLSKVPVVYYLSRNGQLEHPHFMEVPLSS  61

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
                    DV++RLN LRG+GMAS+YSWSAKR Y+NGFVW DL ENDFIYPAHG EY+LKG
Sbjct  62    -----RDDVINRLNCLRGKGMASMYSWSAKRSYRNGFVWHDLTENDFIYPAHGQEYVLKG  116

Query  662   SELI----------ITHSSSQET-PALTAAGEDREFPPL  579
             SEL+          I  S+S+ T P      EDREFP +
Sbjct  117   SELLDSALPSQPDEIACSNSRNTVPEKQKLSEDREFPAV  155


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = -3

Query  518  SSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQ  339
            S+E + GEIS P + SS ETL  LMKAD + ++  +   +       S+ + + ASV+MQ
Sbjct  236  STELNRGEISPPLSDSSSETLETLMKADGKLILRPDTISEDPTANTHSSGKSKAASVLMQ  295

Query  338  ILSCGSVAAREHAPPCKAKTHAFSLISHHK  249
            +L CGS++ ++   P   K + FSLIS +K
Sbjct  296  LLYCGSMSFKQ-CGPGYGKENGFSLISQYK  324



>ref|XP_010043592.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Eucalyptus grandis]
 gb|KCW85613.1| hypothetical protein EUGRSUZ_B02400 [Eucalyptus grandis]
Length=422

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 7/120 (6%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQP-------PERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             EL + K+W+D++ SPERTKVWT+P        +RRV VVYYLS NG+L+ PHFME+ LSS
Sbjct  23    ELQIPKRWKDRETSPERTKVWTEPSKPSKGSADRRVPVVYYLSRNGQLEQPHFMEVPLSS  82

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GLFL DV++RLN LRG+GMA++YSWS+KR YKNGFVW DL ENDFIYP+HG+EY+LKG
Sbjct  83    PEGLFLSDVINRLNLLRGKGMAAMYSWSSKRSYKNGFVWHDLAENDFIYPSHGNEYVLKG  142



>ref|XP_011000299.1| PREDICTED: protein UPSTREAM OF FLC [Populus euphratica]
Length=444

 Score =   183 bits (464),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 173/326 (53%), Gaps = 60/326 (18%)
 Frame = -3

Query  977  RDKDISPERTKV-WTQPPE--RRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            R+++ SPER +V W++  +  R+V VVYYLS NG+L+HPHFME+ LSS  GL+LRDV++R
Sbjct  19   RNRETSPERCRVAWSESNKLSRKVPVVYYLSRNGQLEHPHFMEVPLSSNDGLYLRDVINR  78

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL-------II  648
            L+ LRG+GMA LYSWS+KR YKNGFVW DL +NDFI+PAHGHEY+LKGSEL       ++
Sbjct  79   LDLLRGKGMAGLYSWSSKRSYKNGFVWHDLADNDFIHPAHGHEYVLKGSELLDHSNKQLL  138

Query  647  THSSSQETPALTAAGEDREFPPLPPPR-----------HNVHAVEEDKESGRSGSSEPSN  501
              +  QET   ++  +D +FP     R           + V+  E   ES R  +++ S 
Sbjct  139  LETKPQETLQSSSNSQDSDFPVTSRRRNQSWGSIDLNEYKVYKAESPSESNRKLAADAST  198

Query  500  G------------------------------------EISTPPAGSSPETLAALMKADRR  429
                                                 EIS PP+ SSPETL +LMKAD R
Sbjct  199  QTDDSRRRRRQAKPVVEGLQEEKKNSQELEVSGEEIIEISPPPSDSSPETLESLMKADGR  258

Query  428  RVILMNEARKAAAYYDP--SAARPRTASVVMQILSCGSVAAREHAPPCKAKTHAFSLISH  255
             ++  N             +  R + ++V+MQ++SCGS++ R+       K    SL + 
Sbjct  259  VILGANGEGSGLNLSQTVGTCGRMKASTVLMQLISCGSISFRDCGATA-VKDQGLSLFTG  317

Query  254  HKMATLLPCGTRRNNPPDVAENAVME  177
                 L   G R   P +++    +E
Sbjct  318  QYKGRLPRGGNREGTPREISNRVKLE  343



>ref|XP_010043593.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Eucalyptus grandis]
Length=417

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 7/120 (6%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQP-------PERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             EL + K+W+D++ SPERTKVWT+P        +RRV VVYYLS NG+L+ PHFME+ LSS
Sbjct  18    ELQIPKRWKDRETSPERTKVWTEPSKPSKGSADRRVPVVYYLSRNGQLEQPHFMEVPLSS  77

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GLFL DV++RLN LRG+GMA++YSWS+KR YKNGFVW DL ENDFIYP+HG+EY+LKG
Sbjct  78    PEGLFLSDVINRLNLLRGKGMAAMYSWSSKRSYKNGFVWHDLAENDFIYPSHGNEYVLKG  137



>ref|XP_010535531.1| PREDICTED: protein UPSTREAM OF FLC [Tarenaya hassleriana]
Length=444

 Score =   183 bits (464),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 163/302 (54%), Gaps = 72/302 (24%)
 Frame = -3

Query  986  KKWRDKDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
            ++ ++++ SPERT++W++P       R+V VVYYL  NG+L HPHFME+ LSS  GL+LR
Sbjct  19   RRVKEQETSPERTRIWSEPRHKPSGHRKVPVVYYLCRNGQLDHPHFMEVTLSSHEGLYLR  78

Query  821  DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE-----  657
            DV++RLN LRG+GMA+LYSWS+KR YKNGFVW DL ENDFI+P HG EY+LKGSE     
Sbjct  79   DVMNRLNDLRGKGMATLYSWSSKRSYKNGFVWHDLSENDFIFPVHGQEYVLKGSEILDPC  138

Query  656  LIITHSSSQETPALTA--------AGEDREFPPLPPPRHN------------VHAVEEDK  537
            L+    S  ET +  A         G+D +FP     R N            V+  E   
Sbjct  139  LVQNPRSLLETSSFRAPRTFDPVNTGKDSDFPADVARRRNQSWSSIDLSEYKVYKAESSA  198

Query  536  ESGR---------------------------------------SGSSEPSNGEISTPPAG  474
            ES +                                       + S+E S  EIS PP+ 
Sbjct  199  ESTQKLAADASTQTDDRRRRRKPVKDDEPSVKSPDPEPEEPYENQSTELSRDEISPPPSD  258

Query  473  SSPETLAALMKADRRRVIL---MNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREH  303
            SSPETL  LMKAD R ++    +N+        +  + R R ++V+MQ++SCG+++ +E 
Sbjct  259  SSPETLETLMKADGRLILRPGDVNDQASNRTVENFPSGRMRASTVLMQLISCGTMSFKEC  318

Query  302  AP  297
             P
Sbjct  319  GP  320



>gb|KGN65672.1| hypothetical protein Csa_1G481740 [Cucumis sativus]
Length=440

 Score =   182 bits (463),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 114/159 (72%), Gaps = 10/159 (6%)
 Frame = -3

Query  1001  ELHMAKKWRDKDI-SPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPR  837
             +LH+ K W+D+D  SPERTKVWT+P     +R+V VVYYLS NG L+HPHF+E+ LSS  
Sbjct  11    DLHIPKLWKDRDTTSPERTKVWTEPKLRTSDRKVPVVYYLSRNGLLEHPHFIEVPLSSSE  70

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
             GL+LRDV++RLN LRG GMAS YSWS+KR YKNGFVW DL ENDFIYP HG EY+LKGSE
Sbjct  71    GLYLRDVINRLNVLRGNGMASAYSWSSKRSYKNGFVWHDLSENDFIYPLHGKEYVLKGSE  130

Query  656   LIITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEED  540
             L+  HSS +    +  +   R   P PP  H + + + D
Sbjct  131   LL--HSSLE--TRVQGSESSRSLRP-PPEIHKLGSEDSD  164



>ref|XP_007016521.1| Domain of Uncharacterized protein function, putative [Theobroma 
cacao]
 gb|EOY34140.1| Domain of Uncharacterized protein function, putative [Theobroma 
cacao]
Length=454

 Score =   183 bits (464),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 14/133 (11%)
 Frame = -3

Query  992  MAKKWRDKDISPERTKVWTQP-------------PERRVAVVYYLSLNGKLQHPHFMELR  852
            ++KKW++++ISPER KVW +P              ER+VAVVYYLS NG+L+HPHFME+ 
Sbjct  15   VSKKWKEREISPERNKVWIEPKPHTTTNSSKSSNTERKVAVVYYLSRNGQLEHPHFMEVP  74

Query  851  LSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYI  672
            LSS  GL+L+DV++RLN LRG+GMASLYSWS+KR YKNGFVW DL ENDFIYP+HG EY+
Sbjct  75   LSSNDGLYLKDVINRLNLLRGKGMASLYSWSSKRSYKNGFVWHDLAENDFIYPSHGQEYV  134

Query  671  LKGSELIITHSSS  633
            LKGSE I+ HS S
Sbjct  135  LKGSE-ILDHSIS  146



>gb|KHN21983.1| hypothetical protein glysoja_008895 [Glycine soja]
Length=447

 Score =   182 bits (463),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQPPER---RVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
             EL + KKW D++ SPERTKVW +P  +   +V+VVYYLS NG+L+HPHFME+ LSSP GL
Sbjct  14    ELQVPKKWTDRETSPERTKVWAEPKTKTAKKVSVVYYLSRNGQLEHPHFMEVPLSSPHGL  73

Query  830   FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
             +L+DV++RLN+LRG+ MA+LYSWSAKR YKNGFVW DL ENDFI+P  G +YILKGSE++
Sbjct  74    YLKDVINRLNALRGKAMATLYSWSAKRGYKNGFVWHDLSENDFIHPTQGQDYILKGSEIV  133



>ref|XP_006590994.1| PREDICTED: protein UPSTREAM OF FLC-like [Glycine max]
Length=447

 Score =   182 bits (463),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQPPER---RVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
             EL + KKW D++ SPERTKVW +P  +   +V+VVYYLS NG+L+HPHFME+ LSSP GL
Sbjct  14    ELQVPKKWTDRETSPERTKVWAEPKTKTAKKVSVVYYLSRNGQLEHPHFMEVPLSSPHGL  73

Query  830   FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
             +L+DV++RLN+LRG+ MA+LYSWSAKR YKNGFVW DL ENDFI+P  G +YILKGSE++
Sbjct  74    YLKDVINRLNALRGKAMATLYSWSAKRGYKNGFVWHDLSENDFIHPTQGQDYILKGSEIV  133



>emb|CDX80229.1| BnaC09g35130D [Brassica napus]
Length=401

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 156/267 (58%), Gaps = 42/267 (16%)
 Frame = -3

Query  971  KDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            +D SP+R ++W++P       R+V VVYYLS NG+L HPHFME+ LSS  GL+L+DV++R
Sbjct  25   QDTSPDRNRIWSEPRHKPVANRKVPVVYYLSRNGQLDHPHFMEVTLSSGDGLYLKDVINR  84

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITH-----  642
            LN LRG+GMA+LYSWS+KR YKNGFVW DL E DFI P  G EY+LKGSE++ ++     
Sbjct  85   LNDLRGKGMANLYSWSSKRSYKNGFVWHDLSEEDFISPVQGQEYVLKGSEVLDSYPRSLN  144

Query  641  ---SSSQETPALTAAGEDREFPPLPPPRHNVH-AVEEDKESGR-----------------  525
               +S ++ P       ++ +  +    + V+ A E   ES R                 
Sbjct  145  PEKNSGEDIPPAVHRRRNQSWSSIDLSEYKVYKATESSAESARRLAADASTQTDDRRRRR  204

Query  524  ----------SGSSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDP-  378
                      + S E S  EIS PP+ SSPETL  L+KAD R ++  NE+       +  
Sbjct  205  KPAKEEIEEVNRSVELSRDEISPPPSDSSPETLENLIKADGRLILRQNESTNDHRTVESL  264

Query  377  SAARPRTASVVMQILSCGSVAAREHAP  297
            S+ R R ++V+MQ++SCG+++ +E  P
Sbjct  265  SSGRMRASAVLMQLISCGTMSFKECGP  291



>ref|XP_002299892.2| hypothetical protein POPTR_0001s24240g [Populus trichocarpa]
 gb|EEE84697.2| hypothetical protein POPTR_0001s24240g [Populus trichocarpa]
Length=445

 Score =   182 bits (463),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 177/328 (54%), Gaps = 63/328 (19%)
 Frame = -3

Query  977  RDKDISPERTKV-WTQPPE--RRVAVVYYLSLNGKLQHPHFMELRLSS-PRGLFLRDVLD  810
            R+++ SPER +  W++  +  R+V VVYYLS NG+L+HPHFME+ LSS   GL+LRDV++
Sbjct  19   RNRETSPERCRAAWSESNKLSRKVPVVYYLSRNGQLEHPHFMEVPLSSNDGGLYLRDVIN  78

Query  809  RLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL-------I  651
            RL+ LRG+GMA LYSWS+KR YKNGFVW DL +NDFI+PAHGHEY+LKGSEL       +
Sbjct  79   RLDLLRGKGMAGLYSWSSKRSYKNGFVWHDLADNDFIHPAHGHEYVLKGSELLDHSNKQL  138

Query  650  ITHSSSQETPALTAAGEDREFPPLPPPR-----------HNVHAVEEDKESGRSGSSEPS  504
            +  +  QET   ++  +D +FP     R           + V+  E   ES R  +++ S
Sbjct  139  LLETKPQETLQSSSNSQDSDFPVTSRRRNQSWGSIDLNEYKVYKAESPSESNRKLAADAS  198

Query  503  --------------------------------NG----EISTPPAGSSPETLAALMKADR  432
                                            NG    EIS PP+ SSPETL +LMKAD 
Sbjct  199  TQTDDSRRRRRQAKPVVEGLQEEKKNSQELEVNGEEIIEISPPPSDSSPETLESLMKAD-  257

Query  431  RRVILMNEARKAAAYYDPSA---ARPRTASVVMQILSCGSVAAREHAPPCKAKTHAFSLI  261
             RVIL      +      +     R + ++V+MQ++SCGS++ R+       K    SLI
Sbjct  258  GRVILGASGEGSGLNLSQTVGNCGRMKASTVLMQLISCGSISFRDCGATA-VKEQGLSLI  316

Query  260  SHHKMATLLPCGTRRNNPPDVAENAVME  177
            + H    L   G R   P +++    +E
Sbjct  317  TGHYKGRLPRGGNREGTPREISNRVKLE  344



>ref|XP_004169610.1| PREDICTED: uncharacterized LOC101205220 [Cucumis sativus]
Length=440

 Score =   182 bits (462),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 114/159 (72%), Gaps = 10/159 (6%)
 Frame = -3

Query  1001  ELHMAKKWRDKDI-SPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPR  837
             +LH+ K W+D+D  SPERTKVWT+P     +R+V VVYYLS NG L+HPHF+E+ LSS  
Sbjct  11    DLHIPKLWKDRDTTSPERTKVWTEPKLRTSDRKVPVVYYLSRNGLLEHPHFIEVPLSSSE  70

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
             GL+LRDV++RLN LRG GMAS YSWS+KR YKNGFVW DL ENDFIYP HG EY+LKGSE
Sbjct  71    GLYLRDVINRLNVLRGNGMASAYSWSSKRSYKNGFVWHDLSENDFIYPLHGKEYVLKGSE  130

Query  656   LIITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEED  540
             L+  HSS +    +  +   R   P PP  H + + + D
Sbjct  131   LL--HSSLE--TRVQGSESSRSLRP-PPEIHKLGSEDSD  164



>gb|KHG11212.1| Nipped-B-like protein [Gossypium arboreum]
Length=326

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%), Gaps = 10/138 (7%)
 Frame = -3

Query  992  MAKKWRDKDISPERTKVWTQP---------PERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
            +++KW D++ISPER KVW +P          ER+V+VVYYLS +G+L+ PHFME+ LSS 
Sbjct  16   VSRKWNDREISPERNKVWIEPKPHNNKSSLTERKVSVVYYLSRSGQLEQPHFMEVPLSSN  75

Query  839  RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
             GL+L+DV++RLN LRG+GMASLYSWS+KR YKNGFVW DL ENDFIYP+HG EYILKGS
Sbjct  76   DGLYLKDVINRLNLLRGKGMASLYSWSSKRSYKNGFVWHDLAENDFIYPSHGQEYILKGS  135

Query  659  ELIITHSSSQETPALTAA  606
            E I+ H+ + +   +T++
Sbjct  136  E-ILDHTINSQALDITSS  152



>emb|CDY66123.1| BnaAnng21550D [Brassica napus]
Length=390

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 154/264 (58%), Gaps = 39/264 (15%)
 Frame = -3

Query  971  KDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            +D SP+R ++W++P       R+V VVYYLS NG+L HPHFME+ LSS  GL+L+DV++R
Sbjct  25   QDTSPDRNRIWSEPRHKPVANRKVPVVYYLSRNGQLDHPHFMEVTLSSGDGLYLKDVINR  84

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITH-----  642
            LN LRG+GMA+LYSWS+KR YKNGFVW DL E DFI P  G EY+LKGSE++ ++     
Sbjct  85   LNDLRGKGMANLYSWSSKRSYKNGFVWHDLSEEDFISPVQGQEYVLKGSEVLDSYPRSLN  144

Query  641  ---SSSQETPALTAAGEDREFPPLPPPRHNVH-AVEEDKESGR-----------------  525
               +S  + P       ++ +  +    + V+ A E   ES R                 
Sbjct  145  PEKNSGDDIPPAVHRRRNQSWSSIDLSEYKVYKATESSAESARRLAADASTQTDDRRWRR  204

Query  524  -------SGSSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDP-SAA  369
                     S E S  EIS PP+ SSPETL  L+KAD R ++  NE+       +  S+ 
Sbjct  205  KPAKEEIEESVELSRDEISPPPSDSSPETLENLIKADGRLILRPNESSNDHRTVESLSSG  264

Query  368  RPRTASVVMQILSCGSVAAREHAP  297
            R R ++V+MQ++SCG+++ +E  P
Sbjct  265  RMRASAVLMQLISCGTMSFKECGP  288



>ref|XP_009358323.1| PREDICTED: protein UPSTREAM OF FLC-like [Pyrus x bretschneideri]
Length=449

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 121/321 (38%), Positives = 168/321 (52%), Gaps = 72/321 (22%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPPE-----RRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            L +  KWRD + SP+R       P      R+V VVYYLS+NG+L+HPHFME+ LSSPRG
Sbjct  12   LQIPSKWRDSETSPDRISPAQTGPSLPFTPRKVPVVYYLSMNGQLEHPHFMEVPLSSPRG  71

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE-  657
            LFLRD+++RLN LRG+GMA +YSWS+KR Y+ GFVW DL END IYP+HGHEY+LKGSE 
Sbjct  72   LFLRDIINRLNLLRGKGMALMYSWSSKRSYRTGFVWHDLTENDLIYPSHGHEYVLKGSEL  131

Query  656  -------LIITHSSSQET---PALTAAGEDREFPPLPPPR-----------HNVHAVE--  546
                   L +  +SS+     P    +G+D + P +   R           + V+  E  
Sbjct  132  LDPPLNHLALETASSRSLRPPPEALKSGDDFDSPVISRRRNQSWSSIDLNEYKVYKTESV  191

Query  545  ----------------------------EDKESGRSGS-----------SEPSNGEISTP  483
                                        ++K  G+  S           +E S  EIS P
Sbjct  192  GESTGKAAADASTQTDDKRHRRRVREEHDEKGQGQGQSKREEIQILSHGTELSRDEISPP  251

Query  482  PAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSA---ARPRTASVVMQILSCGSVAA  312
            P+ SSPETL +LMKAD R V+  +   + A           + + ++V+MQ++SCGS + 
Sbjct  252  PSYSSPETLESLMKADGRLVLCADGVSEEAVNRTVEVCPTGKLKASTVLMQLISCGSTSF  311

Query  311  REHAPPCKAKTHAFSLISHHK  249
            R+       +    SL+ H+K
Sbjct  312  RDCGSTA-VREQGLSLVGHYK  331



>ref|XP_008457538.1| PREDICTED: protein UPSTREAM OF FLC [Cucumis melo]
Length=436

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 114/159 (72%), Gaps = 10/159 (6%)
 Frame = -3

Query  1001  ELHMAKKWRDKDI-SPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPR  837
             +LH+ K W+++D  SPERTKVWT+P     +R+V VVYYLS NG L+HPHF+E+ LSS  
Sbjct  11    DLHIPKLWKERDTTSPERTKVWTEPKLRTSDRKVPVVYYLSRNGLLEHPHFIEVPLSSSE  70

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
             GL+LRDV++RLN LRG GMAS YSWS+KR YKNGFVW DL ENDFIYP HG EY+LKGSE
Sbjct  71    GLYLRDVINRLNVLRGNGMASAYSWSSKRSYKNGFVWHDLSENDFIYPLHGKEYVLKGSE  130

Query  656   LIITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEED  540
             L+  HSS +    +  +   R   P PP  H + + + D
Sbjct  131   LL--HSSLE--TRVQGSESSRSLRP-PPEIHKLGSEDSD  164



>ref|XP_006848694.1| hypothetical protein AMTR_s00178p00038720 [Amborella trichopoda]
 gb|ERN10275.1| hypothetical protein AMTR_s00178p00038720 [Amborella trichopoda]
Length=408

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = -3

Query  965  ISPERTKVWTQPP----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNS  798
            +SPERTK WT+P     ER+VAVVYYLS NG+L HPHF+E+ LSS  GL+LRDV++RLN+
Sbjct  1    MSPERTKKWTEPKANKQERKVAVVYYLSRNGQLDHPHFIEVSLSSSEGLYLRDVINRLNT  60

Query  797  LRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQE  627
            LRG+GMA++Y+WS+KR YKNGFVW DL ENDFIYPAHGHEYILKGSEL+   S++ E
Sbjct  61   LRGKGMAAMYTWSSKRSYKNGFVWHDLSENDFIYPAHGHEYILKGSELLKPCSNNTE  117



>gb|KHG09613.1| Isoleucine--tRNA ligase [Gossypium arboreum]
Length=446

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 101/123 (82%), Gaps = 9/123 (7%)
 Frame = -3

Query  992  MAKKWRDKDISPERTKVWTQP---------PERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
            +++KW+++DISPER K+W +P          E++V+VVYYLS NG+L+HPHFME+ LSS 
Sbjct  16   VSRKWKERDISPERHKIWIEPKSHPTTTNSSEKKVSVVYYLSRNGQLEHPHFMEVPLSSH  75

Query  839  RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
             GL+L+DV++RLN LRG+GMASLYSWS KR YKNGFVW DL ENDFIYP+HG EY+LKGS
Sbjct  76   HGLYLKDVINRLNLLRGKGMASLYSWSCKRSYKNGFVWHDLAENDFIYPSHGQEYVLKGS  135

Query  659  ELI  651
            E++
Sbjct  136  EVL  138



>ref|XP_010503224.1| PREDICTED: protein UPSTREAM OF FLC-like [Camelina sativa]
Length=358

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/255 (42%), Positives = 145/255 (57%), Gaps = 43/255 (17%)
 Frame = -3

Query  965  ISPERTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGE  786
            I P R        + +V+VVYYLS NG+L HPHF+E+ LSS  GL+L+DV++RLN LRG+
Sbjct  17   IDPSRMNHHKLDSKPKVSVVYYLSRNGQLDHPHFIEVPLSSQNGLYLKDVINRLNELRGK  76

Query  785  GMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL----------------  654
            GMA LYSWS+KR YKNGFVW DL E DFI+P HG EY+LKGS++                
Sbjct  77   GMACLYSWSSKRTYKNGFVWHDLSEEDFIFPVHGQEYVLKGSQILDLDNSNSGKESNFSA  136

Query  653  IITHSSSQ---------------ETPALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSG  519
            ++TH  +Q               E+ +L  A +          R    A E D E     
Sbjct  137  VVTHRRNQSWSSTDQYKVYKASAESSSLMLAADASTQTDDHRRRRKHIAKEVDDEVNEI-  195

Query  518  SSEPSNGEISTPP-AGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVM  342
             +E S  EI++PP + SSPETL +LMKAD  R++L  E        D +  + R ++V+M
Sbjct  196  -TELSREEITSPPQSDSSPETLESLMKAD-GRLVLRQE--------DRTVEKMRPSAVLM  245

Query  341  QILSCGSVAAREHAP  297
            Q+LSCG+++ R+  P
Sbjct  246  QLLSCGAMSFRKCGP  260



>ref|XP_004251456.1| PREDICTED: protein UPSTREAM OF FLC [Solanum lycopersicum]
Length=388

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 157/291 (54%), Gaps = 66/291 (23%)
 Frame = -3

Query  986  KKWRDKDISPERTKVWTQ------PPERRVAVVYYLSLNGKLQHPHFMELRLSSP-RGLF  828
            +KW+D++ S    KVW +        ER+V VVYYL+ NG+L+HPHFME+ LSSP  GL+
Sbjct  10   QKWKDRETS---NKVWIENQNHKLKSERKVPVVYYLTRNGQLEHPHFMEVTLSSPDEGLY  66

Query  827  LRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI-  651
            LRDV++RLN LRG+G+ASLYSWSAKR Y+NGFVW DL ++DFIYPAHG EY+LKGS+L+ 
Sbjct  67   LRDVINRLNFLRGKGIASLYSWSAKRSYRNGFVWHDLADHDFIYPAHGQEYVLKGSQLVE  126

Query  650  --ITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGSSEPSNGEISTPPA  477
               T +S  + P      E R+ P +   R N      D    R   +E S+ E S    
Sbjct  127  GATTLTSKNQVP------EVRKLPAV-SRRRNQSWCSADFHEYRVYKAESSSNEYSGKAG  179

Query  476  GSSP----------------------------------ETLAALMKADRRRVILMNEARK  399
              +                                   ETL  LMKAD  +VI+  E   
Sbjct  180  ADASTQTDDRRRRRREIGIGEEEEEEVSISPPPSDSSPETLETLMKAD-GKVIVRPET--  236

Query  398  AAAYYDPSAARPR-TASVVMQILSCGSVAAREHAPPCKAKTHAFSLISHHK  249
                 D S  + R ++SV+MQ+L CGS++ ++  P    K H    +SH+K
Sbjct  237  -----DESNGKSRGSSSVLMQLLWCGSMSFKDCGPGGYGKDHG---LSHYK  279



>gb|KHN32101.1| hypothetical protein glysoja_028896 [Glycine soja]
Length=448

 Score =   177 bits (449),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 112/153 (73%), Gaps = 7/153 (5%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQPPERR-----VAVVYYLSLNGKLQHPHFMELRLSSPR  837
             EL + KKW +++ SPERTKVW +P  +      V+VVYYLS NG+L+HPHFME+ LSSP 
Sbjct  14    ELQVPKKWTERETSPERTKVWAEPKPKPKTPRKVSVVYYLSRNGQLEHPHFMEVPLSSPH  73

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYP-AHGHEYILKGS  660
             GL+L+DV++RLN+LRG+GMA+LYSWSAKR YKNGFVW DL ENDFIYP   G +YILKGS
Sbjct  74    GLYLKDVINRLNALRGKGMATLYSWSAKRSYKNGFVWHDLSENDFIYPTTQGQDYILKGS  133

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPPRHN  561
             E I+ H+ +     +  + E+ + P +   R N
Sbjct  134   E-IVEHNVTGAGARVNKSEEESDSPVVITRRRN  165


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 6/122 (5%)
 Frame = -3

Query  518  SSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPS-AARPRTASVVM  342
            ++E S  EIS PP+ SSPETL  LM+AD R  +  +E+ K     +   + R R +SV++
Sbjct  246  TTELSREEISPPPSDSSPETLETLMRADGRLGLRSSESEKENLTVESCPSGRTRASSVLL  305

Query  341  QILSCGSVAAREHAPPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENAVMELPLIT  162
            Q+LSCG+V+ +E       K   FSL+ H+K       G    N    +    ME+P ++
Sbjct  306  QLLSCGAVSFKECGANA-VKDQGFSLVGHYKSRMPRGAGNHSGNETGTS----MEIPDLS  360

Query  161  SV  156
             V
Sbjct  361  RV  362



>ref|XP_003539698.1| PREDICTED: protein UPSTREAM OF FLC-like [Glycine max]
Length=448

 Score =   177 bits (449),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 112/153 (73%), Gaps = 7/153 (5%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQPPERR-----VAVVYYLSLNGKLQHPHFMELRLSSPR  837
             EL + KKW +++ SPERTKVW +P  +      V+VVYYLS NG+L+HPHFME+ LSSP 
Sbjct  14    ELQVPKKWTERETSPERTKVWAEPKPKPKTPRKVSVVYYLSRNGQLEHPHFMEVPLSSPH  73

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYP-AHGHEYILKGS  660
             GL+L+DV++RLN+LRG+GMA+LYSWSAKR YKNGFVW DL ENDFIYP   G +YILKGS
Sbjct  74    GLYLKDVINRLNALRGKGMATLYSWSAKRSYKNGFVWHDLSENDFIYPTTQGQDYILKGS  133

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPPRHN  561
             E I+ H+ +     +  + E+ + P +   R N
Sbjct  134   E-IVEHNVTGAGARVNKSEEESDSPVVITRRRN  165


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 6/122 (5%)
 Frame = -3

Query  518  SSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPS-AARPRTASVVM  342
            ++E S  EIS PP+ SSPETL  LM+AD R  +  +E+ K     +   + R R +SV++
Sbjct  246  TTELSREEISPPPSDSSPETLETLMRADGRLGLRSSESEKENLTVESCPSGRTRASSVLL  305

Query  341  QILSCGSVAAREHAPPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENAVMELPLIT  162
            Q+LSCG+V+ +E       K   FSL+ H+K       G    N    +    ME+P ++
Sbjct  306  QLLSCGAVSFKECGANA-VKDQGFSLVGHYKSRMPRGAGNHSGNETGTS----MEIPDLS  360

Query  161  SV  156
             V
Sbjct  361  RV  362



>ref|XP_004149057.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101205220, 
partial [Cucumis sativus]
Length=438

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 114/163 (70%), Gaps = 14/163 (9%)
 Frame = -3

Query  1001  ELHMAKKWRDKDI-SPERTKVWTQP----PERRVAVVYYLSLN----GKLQHPHFMELRL  849
             +LH+ K W+D+D  SPERTKVWT+P     +R+V VVYYLS N    G L+HPHF+E+ L
Sbjct  5     DLHIPKLWKDRDTTSPERTKVWTEPKLRTSDRKVPVVYYLSRNPPRTGLLEHPHFIEVPL  64

Query  848   SSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYIL  669
             SS  GL+LRDV++RLN LRG GMAS YSWS+KR YKNGFVW DL ENDFIYP HG EY+L
Sbjct  65    SSSEGLYLRDVINRLNVLRGNGMASAYSWSSKRSYKNGFVWHDLSENDFIYPLHGKEYVL  124

Query  668   KGSELIITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEED  540
             KGSEL+  HSS +    +  +   R   P PP  H + + + D
Sbjct  125   KGSELL--HSSLE--TRVQGSESSRSLRP-PPEIHKLGSEDSD  162



>ref|XP_004295945.1| PREDICTED: uncharacterized protein LOC101300994 [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 99/128 (77%), Gaps = 9/128 (7%)
 Frame = -3

Query  1007  WMELHMAKKWRDKDISPERT---------KVWTQPPERRVAVVYYLSLNGKLQHPHFMEL  855
             +  L +  KWRD D SP+ T         K+   P +R+V VVYYLS NG+L+HPHFME+
Sbjct  11    FTHLQIPNKWRDSDTSPDPTQEPEPEPKPKLAITPNDRKVPVVYYLSRNGQLEHPHFMEV  70

Query  854   RLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEY  675
              LSSPRGLFLRDV++RLN LRG+GMA++YSWSAKR YK GFVW DL ENDFI+P+HG+EY
Sbjct  71    PLSSPRGLFLRDVINRLNLLRGKGMATMYSWSAKRGYKTGFVWHDLSENDFIHPSHGNEY  130

Query  674   ILKGSELI  651
             +LKGSEL+
Sbjct  131   VLKGSELL  138



>ref|XP_002875764.1| hypothetical protein ARALYDRAFT_905792 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52023.1| hypothetical protein ARALYDRAFT_905792 [Arabidopsis lyrata subsp. 
lyrata]
Length=332

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 142/236 (60%), Gaps = 29/236 (12%)
 Frame = -3

Query  926  ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRK  747
            ER+V VVYYLS NG+L HPHF+E+ LSS  GL+L+DV++RLN LRG+ MASLYSWS+KR 
Sbjct  32   ERKVPVVYYLSRNGQLDHPHFIEVPLSSHNGLYLKDVINRLNDLRGKAMASLYSWSSKRT  91

Query  746  YKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETPALTAAGEDREFPPLPPPR  567
            YKNGFVW DL E DFI+P HG EY+LKGS+++   ++S +    +A    R         
Sbjct  92   YKNGFVWHDLSEEDFIFPVHGQEYVLKGSQILDLDNNSGKESNFSAVTHRRN-QSWSSID  150

Query  566  HNVHAVEEDKESGRSGS----------------------SEPSNGEISTPP-AGSSPETL  456
            H   + E  ++     S                      +E S  EI++PP + +SPETL
Sbjct  151  HYKASTESTRKLATDASTQTDDRRRRKSPAKEVDEVNEITELSKEEITSPPQSDTSPETL  210

Query  455  AALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAPPCK  288
             +LMKAD  R+IL  E ++     + +  + R ++V+MQ++SCG+++ ++  P  +
Sbjct  211  ESLMKAD-GRLILFPEDQE----LNGTVEKMRPSAVLMQLISCGAMSFKKCGPTLR  261



>ref|XP_010426039.1| PREDICTED: protein UPSTREAM OF FLC-like [Camelina sativa]
Length=363

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/254 (41%), Positives = 145/254 (57%), Gaps = 42/254 (17%)
 Frame = -3

Query  965  ISPERTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGE  786
            I+P R        + +V+VVYYLS NG+L HPHF+E+ LSS  GL+L+DV++RLN LRG+
Sbjct  17   IAPSRLNHHKLDSKPKVSVVYYLSRNGQLDHPHFIEVPLSSQNGLYLKDVINRLNDLRGK  76

Query  785  GMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL----------------  654
            GM  LYSWS+KR YKNGFVW DL E DFI+P HG EY+LKGS++                
Sbjct  77   GMPCLYSWSSKRTYKNGFVWHDLSEEDFIFPVHGQEYVLKGSQILDLDNNNSGKESNFSA  136

Query  653  IITH------SSSQETPALTAAGE--------DREFPPLPPPRHNVHAVEEDKESGRSGS  516
            ++TH      SS+ +     A+ E        D         R   H  +E  E      
Sbjct  137  VVTHRRNQSWSSTDQYKVYKASAESSSRKLATDASTQTDEHRRRRNHIAKEVNEVNE--I  194

Query  515  SEPSNGEISTPP-AGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQ  339
            +E S  EI++PP + SSPETL +LMKAD  R+IL  E        D +  + R ++++MQ
Sbjct  195  TELSREEITSPPQSDSSPETLESLMKAD-GRLILRQE--------DRTVEKMRPSAILMQ  245

Query  338  ILSCGSVAAREHAP  297
            ++SCG+++ R+  P
Sbjct  246  LISCGALSFRKCGP  259



>ref|XP_007132101.1| hypothetical protein PHAVU_011G066900g [Phaseolus vulgaris]
 ref|XP_007132102.1| hypothetical protein PHAVU_011G066900g [Phaseolus vulgaris]
 ref|XP_007132103.1| hypothetical protein PHAVU_011G066900g [Phaseolus vulgaris]
 gb|ESW04095.1| hypothetical protein PHAVU_011G066900g [Phaseolus vulgaris]
 gb|ESW04096.1| hypothetical protein PHAVU_011G066900g [Phaseolus vulgaris]
 gb|ESW04097.1| hypothetical protein PHAVU_011G066900g [Phaseolus vulgaris]
Length=443

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 3/120 (3%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
             EL + KK+ D++ SPERTKVW +P     RRV+VVYYLS NG+L+HPHFME+ LSS +GL
Sbjct  14    ELQVPKKFTDRETSPERTKVWAEPKPKTPRRVSVVYYLSRNGQLEHPHFMEVPLSSSQGL  73

Query  830   FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
             +L+DV++RLN LRG+ M ++YSWS+KR YKNGFVW DL ENDFIYP  G +YILKGSE++
Sbjct  74    YLKDVINRLNVLRGKSMPTMYSWSSKRSYKNGFVWHDLSENDFIYPTQGQDYILKGSEIV  133


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 78/158 (49%), Gaps = 17/158 (11%)
 Frame = -3

Query  632  QETPALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGSSEPSNGEISTPPAGSSPETLA  453
            QE      AG D E  P     +N++            ++E S  EIS PP+ SSPETL 
Sbjct  214  QEKNGGIDAGMDGERVPHVTCDNNINH-----------TTELSRDEISPPPSDSSPETLE  262

Query  452  ALMKADRRRVILMNEARKAAAYYDPS-AARPRTASVVMQILSCGSVAAREHAPPCKAKTH  276
             LMKAD R  +  +E+ K     +   + R R +SV++Q+LSCG+V+ +E      AK  
Sbjct  263  TLMKADGRLGLRSSESEKGNLTVESCPSGRMRASSVLLQLLSCGAVSFKECGANA-AKDQ  321

Query  275  AFSLISHHKMATLLPCGTRRNNPPDVAENAVMELPLIT  162
             FSL+ H+K  + +P G       D      ME+P ++
Sbjct  322  GFSLVGHYK--SRMPRGAGNQVGKDTG--ISMEIPDLS  355



>ref|NP_974389.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE78114.1| uncharacterized protein AT3G46110 [Arabidopsis thaliana]
Length=311

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 140/232 (60%), Gaps = 27/232 (12%)
 Frame = -3

Query  926  ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRK  747
            ER V VVYYLS NG+L HPHF+E+ LSS  GL+L+DV++RLN LRG GMA LYSWS+KR 
Sbjct  17   ERIVPVVYYLSRNGRLDHPHFIEVPLSSHNGLYLKDVINRLNDLRGNGMACLYSWSSKRT  76

Query  746  YKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETPALT-------------AA  606
            YKNGFVW DL + DFI+P HG EY+LKGS+++   ++S    A+T               
Sbjct  77   YKNGFVWYDLSDEDFIFPVHGQEYVLKGSQILDLDNNSGNFSAVTHRRNQSWSSVDHYKV  136

Query  605  GEDREFPPLPPPRHNVHAVEEDKESGRSGS--------SEPSNGEISTPP-AGSSPETLA  453
             +  E       + ++ A  +  +  R  S        +E S  EI++PP + SSPETL 
Sbjct  137  YKASELNAEATRKLSMDASTQTDDRRRRKSPVDEVNEVTELSREEITSPPQSDSSPETLE  196

Query  452  ALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAP  297
            +LM+AD R ++L  +        + +  + R ++V+MQ++SCG+++ ++  P
Sbjct  197  SLMRADGRLILLQEDQE-----LNRTVEKMRPSAVLMQLISCGAMSFKKCGP  243



>ref|XP_011041950.1| PREDICTED: protein UPSTREAM OF FLC-like [Populus euphratica]
Length=439

 Score =   174 bits (442),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 123/316 (39%), Positives = 169/316 (53%), Gaps = 59/316 (19%)
 Frame = -3

Query  1004  MELHMAKKW-RDKDISPERTKV-WTQPPE--RRVAVVYYLSLNGKLQHPHFMELRLSSPR  837
             +E  + +KW  D++ +PER +  W++  +  R+  VVYYLS NG+L+HP FME+ LSS  
Sbjct  14    VEFQIPRKWNEDRETTPERARAFWSESRKLSRKAPVVYYLSRNGQLEHPPFMEVPLSSND  73

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
             GL+L DV+++L+ LRG+GMASLYSWS+KR +KNGFVWQDL ENDFI+PAHGHEYILKGSE
Sbjct  74    GLYLSDVINQLDLLRGKGMASLYSWSSKRSFKNGFVWQDLTENDFIHPAHGHEYILKGSE  133

Query  656   LIITHSSSQ--ETPALTAAGEDREFPPLPPPR-----------HNVHAVEEDKESGRSGS  516
              I+ HS+ Q    P      +  EFP +   R           + V+  E   ES R  S
Sbjct  134   -ILDHSNQQLFLEPKPQETSQASEFPVITRRRNQSLSSINLNEYKVYKAESFSESARKLS  192

Query  515   SEPSNG------------------------------------EISTPPAGSSPETLAALM  444
             ++ S                                      EIS PP+ SSPETL +LM
Sbjct  193   ADASTQTDDSRRRRRHVKPEIKKMKEEKKISQEREANRDEIMEISPPPSDSSPETLESLM  252

Query  443   KADRRRVILMNEARKAAAYYDPSA---ARPRTASVVMQILSCGSVAAREHAPPCKAKTHA  273
             KAD  R+IL      +    + +A    + + ++V+MQ++SC S  +         K   
Sbjct  253   KAD-GRLILGGHNEGSGMDLNQTAKNCGKMKASTVLMQLISCSSSISFRDCGAMPGKEPG  311

Query  272   FSLISHHKMATLLPCG  225
               LIS H     +PCG
Sbjct  312   LPLISGHYKGR-VPCG  326



>emb|CAB90938.1| putative protein [Arabidopsis thaliana]
Length=340

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 140/232 (60%), Gaps = 27/232 (12%)
 Frame = -3

Query  926  ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRK  747
            ER V VVYYLS NG+L HPHF+E+ LSS  GL+L+DV++RLN LRG GMA LYSWS+KR 
Sbjct  17   ERIVPVVYYLSRNGRLDHPHFIEVPLSSHNGLYLKDVINRLNDLRGNGMACLYSWSSKRT  76

Query  746  YKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETPALT-------------AA  606
            YKNGFVW DL + DFI+P HG EY+LKGS+++   ++S    A+T               
Sbjct  77   YKNGFVWYDLSDEDFIFPVHGQEYVLKGSQILDLDNNSGNFSAVTHRRNQSWSSVDHYKV  136

Query  605  GEDREFPPLPPPRHNVHAVEEDKESGRSGS--------SEPSNGEISTPP-AGSSPETLA  453
             +  E       + ++ A  +  +  R  S        +E S  EI++PP + SSPETL 
Sbjct  137  YKASELNAEATRKLSMDASTQTDDRRRRKSPVDEVNEVTELSREEITSPPQSDSSPETLE  196

Query  452  ALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAP  297
            +LM+AD R ++L  +        + +  + R ++V+MQ++SCG+++ ++  P
Sbjct  197  SLMRADGRLILLQEDQE-----LNRTVEKMRPSAVLMQLISCGAMSFKKCGP  243



>ref|XP_010905712.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Elaeis guineensis]
Length=422

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 162/290 (56%), Gaps = 62/290 (21%)
 Frame = -3

Query  992  MAKKWRDKDISPERTKVWTQP------PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
            ++K+W+ ++ +P  TKVW++P        R+V+VVYYL+ +G  +HPHFME+ LSS  GL
Sbjct  11   LSKQWKKRETNPGITKVWSEPEPKPRTSRRKVSVVYYLARDGHFEHPHFMEVPLSSIEGL  70

Query  830  FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE--  657
            +LRDV+ RL+ LRG+GMA++YSWS+KR YKNGFVW DL E+DFIYP HG EYILKGSE  
Sbjct  71   YLRDVIHRLDVLRGKGMAAMYSWSSKRSYKNGFVWHDLSEDDFIYPVHGQEYILKGSELP  130

Query  656  -LIITHSSSQETPALTAAG------------EDREFP-----------------------  585
             L    S+SQE+ A +++             +D  FP                       
Sbjct  131  HLGNNPSNSQESLATSSSTYEKLPKIPNSVRDDSNFPVSRRKKTSWSSIDLNETPEYKSA  190

Query  584  PLPPP----------------RHNVHAVEEDKESGRSGSS-EPSNGEISTPPAGSSPETL  456
            P P P                R  V   EE +E   +  + +    EIS PP+ SSPETL
Sbjct  191  PKPAPAVTFSDASIQTDDLRHRWRVPIREERREKIPNLEALDLDIDEISPPPSPSSPETL  250

Query  455  AALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAARE  306
             AL+KAD R V +  + R      D S  R R +SV+M ++SCGS++ +E
Sbjct  251  EALIKADGRIVAIRPDYRHRTV-GDCSNGRVRASSVLMHLISCGSISVKE  299



>ref|NP_190197.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42479.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63381.1| At3g46110 [Arabidopsis thaliana]
 gb|AEE78115.1| uncharacterized protein AT3G46110 [Arabidopsis thaliana]
Length=343

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 140/232 (60%), Gaps = 27/232 (12%)
 Frame = -3

Query  926  ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRK  747
            ER V VVYYLS NG+L HPHF+E+ LSS  GL+L+DV++RLN LRG GMA LYSWS+KR 
Sbjct  17   ERIVPVVYYLSRNGRLDHPHFIEVPLSSHNGLYLKDVINRLNDLRGNGMACLYSWSSKRT  76

Query  746  YKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETPALT-------------AA  606
            YKNGFVW DL + DFI+P HG EY+LKGS+++   ++S    A+T               
Sbjct  77   YKNGFVWYDLSDEDFIFPVHGQEYVLKGSQILDLDNNSGNFSAVTHRRNQSWSSVDHYKV  136

Query  605  GEDREFPPLPPPRHNVHAVEEDKESGRSGS--------SEPSNGEISTPP-AGSSPETLA  453
             +  E       + ++ A  +  +  R  S        +E S  EI++PP + SSPETL 
Sbjct  137  YKASELNAEATRKLSMDASTQTDDRRRRKSPVDEVNEVTELSREEITSPPQSDSSPETLE  196

Query  452  ALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAP  297
            +LM+AD R ++L  +        + +  + R ++V+MQ++SCG+++ ++  P
Sbjct  197  SLMRADGRLILLQEDQE-----LNRTVEKMRPSAVLMQLISCGAMSFKKCGP  243



>ref|XP_009402366.1| PREDICTED: protein UPSTREAM OF FLC-like [Musa acuminata subsp. 
malaccensis]
Length=357

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  968  DISPERTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRG  789
            + SPERTK   +   RRV VVYYLS NG+L+HPHFME+ LSS RGLFLRDV+DRLN LRG
Sbjct  13   ETSPERTKASKETRPRRVPVVYYLSRNGQLEHPHFMEVTLSSCRGLFLRDVIDRLNFLRG  72

Query  788  EGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELII  648
            +GMA+LYSWS+KR YKNGFVWQDL E+D I+PAHGHEY+LKGSEL++
Sbjct  73   KGMANLYSWSSKRSYKNGFVWQDLVEDDLIHPAHGHEYVLKGSELLL  119



>ref|XP_010905713.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Elaeis guineensis]
Length=395

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/291 (40%), Positives = 160/291 (55%), Gaps = 62/291 (21%)
 Frame = -3

Query  995  HMAKKWRDKDISPERTKVWTQP------PERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
             ++K+W+ ++ +P  TKVW++P        R+V+VVYYL+ +G  +HPHFME+ LSS  G
Sbjct  10   ELSKQWKKRETNPGITKVWSEPEPKPRTSRRKVSVVYYLARDGHFEHPHFMEVPLSSIEG  69

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE-  657
            L+LRDV+ RL+ LRG+GMA++YSWS+KR YKNGFVW DL E+DFIYP HG EYILKGSE 
Sbjct  70   LYLRDVIHRLDVLRGKGMAAMYSWSSKRSYKNGFVWHDLSEDDFIYPVHGQEYILKGSEL  129

Query  656  -------------LIITHSSSQETPAL-TAAGEDREFP----------------------  585
                         L  + S+ ++ P +  +  +D  FP                      
Sbjct  130  PHLGNNPSNSQESLATSSSTYEKLPKIPNSVRDDSNFPVSRRKKTSWSSIDLNETPEYKS  189

Query  584  -PLPPP----------------RHNVHAVEEDKESGRSGSS-EPSNGEISTPPAGSSPET  459
             P P P                R  V   EE +E   +  + +    EIS PP+ SSPET
Sbjct  190  APKPAPAVTFSDASIQTDDLRHRWRVPIREERREKIPNLEALDLDIDEISPPPSPSSPET  249

Query  458  LAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAARE  306
            L AL+KAD R V +  + R      D S  R R +SV+M ++SCGS++ +E
Sbjct  250  LEALIKADGRIVAIRPDYRHRTV-GDCSNGRVRASSVLMHLISCGSISVKE  299



>ref|XP_010470135.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 110/151 (73%), Gaps = 8/151 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M K  R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ +SS
Sbjct  1     MEARMKKYSRE--VSPERAKVWTEKSPKYHQKIKKVPIVYYLSKNRQLEHPHFMEILMSS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PNGLYLRDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  118

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S Q +P +  AG++ +   + PP
Sbjct  119   SELFDESNSDQFSPIVNTAGQNMKQIVVEPP  149



>ref|XP_006280519.1| hypothetical protein CARUB_v10026455mg [Capsella rubella]
 gb|EOA13417.1| hypothetical protein CARUB_v10026455mg [Capsella rubella]
Length=428

 Score =   172 bits (436),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 157/292 (54%), Gaps = 67/292 (23%)
 Frame = -3

Query  971  KDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            +D SP+R ++W++P       R+V VVYYL  NG+L HPHFME+ LSS  GL+L+DVL+R
Sbjct  25   QDTSPDRNRIWSEPRHKPVLNRKVPVVYYLCRNGQLDHPHFMEVTLSSHDGLYLKDVLNR  84

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE----------  657
            LN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE          
Sbjct  85   LNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVLDSCLVSNP  144

Query  656  --LIITHS------------SSQETPALTAAGEDREFPPLPPPRHNVH-AVEEDKESGR-  525
              L+ T S            S  + PA+     ++ +  +    + V+ A E   ES + 
Sbjct  145  RSLLETTSFRDPRSLNPCKNSGDDIPAVINRRRNQSWSSIDLSEYKVYKATESSAESAQR  204

Query  524  ----------------------------------SGSSEPSNGEISTPPAGSSPETLAAL  447
                                              + S+E S  EIS PP+ SSPETL  L
Sbjct  205  LAADASTQTDDRRRRRKPAKEEVEEEVKSPASYENQSTELSRDEISPPPSDSSPETLENL  264

Query  446  MKADRRRVILMNEARKAA--AYYDPSAARPRTASVVMQILSCGSVAAREHAP  297
            +KAD R ++  +E+           S+ R R ++V+MQ++SCG+++ +E  P
Sbjct  265  IKADGRLILRPSESSTTDHRTVESLSSGRMRASAVLMQLISCGTMSFKECGP  316



>ref|XP_009120499.1| PREDICTED: protein UPSTREAM OF FLC-like [Brassica rapa]
Length=426

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 110/292 (38%), Positives = 154/292 (53%), Gaps = 67/292 (23%)
 Frame = -3

Query  971  KDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            +D SP+R ++W++P       R+V VVYYLS NG+L HPHFME+ LSS  GL+L+DV++R
Sbjct  25   QDTSPDRNRIWSEPRHKPVANRKVPVVYYLSRNGQLDHPHFMEVTLSSGDGLYLKDVINR  84

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIIT--HSSS  633
            LN LRG+GMA+LYSWS+KR YKNGFVW DL E DFI P  G EY+LKGSE++ +   S+ 
Sbjct  85   LNDLRGKGMANLYSWSSKRSYKNGFVWHDLSEEDFISPVQGQEYVLKGSEVLDSCLLSNP  144

Query  632  QETPALTAAGEDREFPP-------LPPPRHN----------------VHAVEEDKESGRS  522
            +     T+  + R   P       +PP  H                   A E   ES R 
Sbjct  145  RSLLGTTSFRDPRSLNPEKNSGDDIPPAVHRRRNQSWSSIDLSEYKVYKATESSAESARR  204

Query  521  GSSEPSN-----------------GEISTPPAG-------------------SSPETLAA  450
             +++ S                   E+   PAG                   SSPETL  
Sbjct  205  LAADASTQTDDRRRRRKPAKEEIEEEVVKSPAGCENQSVELSRDEISPPPSDSSPETLEN  264

Query  449  LMKADRRRVILMNEARKAAAYYDP-SAARPRTASVVMQILSCGSVAAREHAP  297
            L+KAD R ++  NE+       +  S+ R R ++V+MQ++SCG+++ +E  P
Sbjct  265  LIKADGRLILRQNESTNDHRTVESLSSGRMRASAVLMQLISCGTMSFKECGP  316



>ref|XP_011023173.1| PREDICTED: protein UPSTREAM OF FLC-like [Populus euphratica]
Length=296

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQPPER---RVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
             EL MA K+RD++ SP+RTK+   P  +   +VAVVYYL+ NG+ +HPHFME+ LSSP+GL
Sbjct  11    ELSMANKYRDRETSPDRTKMTILPKSKSDLKVAVVYYLTRNGQFEHPHFMEVPLSSPQGL  70

Query  830   FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
              L+DV DRLN LRG+GMAS+YSWS+KR+YKNGFVWQDL E D I+P  G EYILKGS L+
Sbjct  71    QLKDVTDRLNHLRGQGMASMYSWSSKRRYKNGFVWQDLSETDSIHPCGGQEYILKGSLLL  130

Query  650   ITHSS  636
              T  S
Sbjct  131   ETSMS  135



>ref|XP_002314199.1| hypothetical protein POPTR_0009s03260g [Populus trichocarpa]
 gb|EEE88154.1| hypothetical protein POPTR_0009s03260g [Populus trichocarpa]
Length=436

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/319 (38%), Positives = 171/319 (54%), Gaps = 64/319 (20%)
 Frame = -3

Query  998  LHMAKKW-RDKDISPERTKV-WTQPPE--RRVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
            + + +KW  D++ +PER +  W++  +  R+  VVYYLS NG+L HPHFME+ LSS  GL
Sbjct  16   VQIPRKWNEDREATPERARAFWSESRKLSRKAPVVYYLSRNGQLDHPHFMEVPLSSNDGL  75

Query  830  FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +L DV+++L+ LRG+GMASLYSWS+KR +KNGFVW DL ENDFI+PAHGHEYILKGSE I
Sbjct  76   YLSDVINQLDLLRGKGMASLYSWSSKRSFKNGFVWHDLTENDFIHPAHGHEYILKGSE-I  134

Query  650  ITHSSSQ-------ETPALTAAGEDREFPPLPPPR-----------HNVHAVEEDKESGR  525
            + HS+ Q       +  + ++A +  EFP +   R           + V+  E   ES R
Sbjct  135  LDHSNQQLFLETKPQETSQSSASQASEFPVITRRRNQSLSSINLNEYKVYKAESFSESAR  194

Query  524  SGSSEPSNG------------------------------------EISTPPAGSSPETLA  453
              +++ S                                      EIS PP+ SSPETL 
Sbjct  195  KLAADASTQTDDSRRRRRHVKPEIKKMKEEKKISQEREANRDEIMEISPPPSDSSPETLE  254

Query  452  ALMKADRRRVILMNEARKAAAYYDPSA---ARPRTASVVMQILSCGSVAAREHAPPCKAK  282
            +LMKAD  R+IL      +    + +A    + + ++V+MQ++SC S  +         K
Sbjct  255  SLMKAD-GRLILGGHNEGSGMDLNQTAKNCGKMKASTVLMQLISCSSSISFRDCGATPGK  313

Query  281  THAFSLISHHKMATLLPCG  225
                 LI+ H     LPCG
Sbjct  314  EPGLPLIAGHYKGR-LPCG  331



>ref|XP_008776398.1| PREDICTED: protein UPSTREAM OF FLC-like [Phoenix dactylifera]
Length=343

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = -3

Query  995  HMAKKWRDKDISPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLF  828
             ++++W+ ++ +PERTKVW +P      R+V+VVYYL+ +G L+ PHFME+ LS   GL+
Sbjct  10   ELSEQWKKRETNPERTKVWAEPKPKTSGRKVSVVYYLARDGHLEPPHFMEVPLSCTEGLY  69

Query  827  LRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELII  648
            LRDV++RL+ LRG GMA++YSWS+KR YKNGFVW DL E+DFIYP HG EYILKGSEL  
Sbjct  70   LRDVINRLDILRGRGMAAMYSWSSKRSYKNGFVWHDLSEDDFIYPVHGQEYILKGSELPH  129

Query  647  THSSSQETPALTAAGEDREFPPLPP  573
              + S     L A+  + E PP  P
Sbjct  130  LGNPSNSQEFLAASSSNSEKPPEIP  154



>ref|XP_010514936.1| PREDICTED: protein UPSTREAM OF FLC-like [Camelina sativa]
Length=369

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 136/242 (56%), Gaps = 48/242 (20%)
 Frame = -3

Query  920  RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYK  741
            +V+VVYYLS  G+L HPHF+E+ LSS  GL+L+DV++RLN LRG+GM  LYSWS+KR YK
Sbjct  32   KVSVVYYLSRTGQLDHPHFIEVPLSSHNGLYLKDVINRLNDLRGKGMVCLYSWSSKRTYK  91

Query  740  NGFVWQDLEENDFIYPAHGHEYILKGSEL----------------IITHSSSQETPALTA  609
            NGFVW DL E+DFI+P HG EY+LKGS++                ++TH  +Q   ++  
Sbjct  92   NGFVWHDLSEDDFIFPVHGQEYVLKGSQILDLDNNNSGKESNFSAVVTHRRNQSWSSIDQ  151

Query  608  -----AGEDREFPPLPPP------------RHNVHAVEEDKESGRSGSSEPSNGEISTPP  480
                 A  D     L               +H    V+E  E      +E S  EI++PP
Sbjct  152  YKVYKASADSSSRMLATDASTQTDDHRRRRKHIAKEVDEVNE-----ITELSREEITSPP  206

Query  479  -AGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREH  303
             + SSPETL +LMKAD          R      D +  + R ++V+MQ++SCG+++ R+ 
Sbjct  207  QSDSSPETLESLMKAD---------GRLGLRQEDRTVEKMRPSAVLMQLISCGAMSFRKC  257

Query  302  AP  297
             P
Sbjct  258  GP  259



>ref|XP_010510680.1| PREDICTED: protein UPSTREAM OF FLC-like [Camelina sativa]
Length=547

 Score =   171 bits (433),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 109/151 (72%), Gaps = 8/151 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M K  R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ +SS
Sbjct  1     MEARMKKYSRE--VSPERAKVWTEKSPKYHQKVKKVPIVYYLSKNRQLEHPHFMEVLMSS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PNGLYLRDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  118

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S Q +P +  A ++ +   + PP
Sbjct  119   SELFDESNSDQFSPIVNTASQNMKQIVVEPP  149



>ref|XP_006409836.1| hypothetical protein EUTSA_v10016498mg [Eutrema salsugineum]
 gb|ESQ51289.1| hypothetical protein EUTSA_v10016498mg [Eutrema salsugineum]
Length=533

 Score =   170 bits (431),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 110/151 (73%), Gaps = 8/151 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ +SS
Sbjct  1     MEARM-KKYREV-VSPERAKVWTEKSPKYHQKIKKVQIVYYLSKNRQLEHPHFMEVLISS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV+DRLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PNGLYLRDVIDRLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  118

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S   +P   +A ++ +   + PP
Sbjct  119   SELFDESNSDHFSPIANSATQNMKQIVVEPP  149



>ref|XP_006592714.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Glycine max]
Length=519

 Score =   170 bits (431),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 99/133 (74%), Gaps = 8/133 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M +K+R   +SPER KVWT+ P      R+V V+YYL  N +L+HPHFME++LSSP
Sbjct  1     MEARM-RKYRQ--VSPERAKVWTEKPPKYHQNRKVPVLYYLCRNRQLEHPHFMEVQLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN+LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGS
Sbjct  58    NGLYLRDVIDRLNALRGRGMASLYSWSCKRSYKNGFVWHDLCEDDIILPAHGSEYVLKGS  117

Query  659   ELIITHSSSQETP  621
             EL    +S +  P
Sbjct  118   ELFYESNSERSGP  130



>gb|KHG19421.1| hypothetical protein F383_07328 [Gossypium arboreum]
Length=280

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 155/272 (57%), Gaps = 60/272 (22%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQ----PPERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
             EL M K++  ++ SP+RT VW +      +++V VVYYLS NG L+HPHF+E+ LSSP+G
Sbjct  11    ELPMNKRY--QETSPDRTLVWFERKKPNNDQKVPVVYYLSRNGHLEHPHFLEVPLSSPQG  68

Query  833   LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS--  660
             LFL+DV+++LN+LRG+GMA+ +SWS+KR YKNGFVWQDL END+IYP +G EYILKGS  
Sbjct  69    LFLKDVINKLNTLRGDGMANRFSWSSKRSYKNGFVWQDLSENDYIYPCNGREYILKGSLL  128

Query  659   ----------ELII-----------THSSSQETPALTAAGEDR-------EFPPLPPPRH  564
                       E +            T+SSS+++     AG+ R       EF  L    H
Sbjct  129   LESSLSFRSYETVSSTSSISKNSSETYSSSEDS---NVAGKTRRKYHSWSEFKEL-DDEH  184

Query  563   NVHAVEEDKESGRSGSSEPSNG----------EISTPPAGSSPETLAAL-MKADRRRVIL  417
              ++  +  ++    G+S  +            E S P + S+ E L ++ + AD R   +
Sbjct  185   KIYKAKTSRDFSSKGNSVSTQTEHEMGSNQVQEDSRPSSNSNSEILKSMNIAADIRDQSV  244

Query  416   MNEARKAAAYYDPSAARPRTASVVMQILSCGS  321
              N         D  + R + A+V+MQ+++CGS
Sbjct  245   EN---------DRPSGRIKAAAVLMQLIACGS  267



>ref|XP_010414585.1| PREDICTED: protein UPSTREAM OF FLC-like [Camelina sativa]
Length=547

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 109/151 (72%), Gaps = 8/151 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M K  R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ +SS
Sbjct  1     MEARMKKYSRE--VSPERAKVWTEKSPKYHQKIKKVPIVYYLSKNRQLEHPHFMEVLMSS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PNGLYLRDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  118

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S Q +P +  A ++ +   + PP
Sbjct  119   SELFDESNSDQFSPIVNTASQNMKPIVVEPP  149



>ref|XP_006592713.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Glycine max]
Length=533

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 99/133 (74%), Gaps = 8/133 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M +K+R   +SPER KVWT+ P      R+V V+YYL  N +L+HPHFME++LSSP
Sbjct  1     MEARM-RKYRQ--VSPERAKVWTEKPPKYHQNRKVPVLYYLCRNRQLEHPHFMEVQLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN+LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGS
Sbjct  58    NGLYLRDVIDRLNALRGRGMASLYSWSCKRSYKNGFVWHDLCEDDIILPAHGSEYVLKGS  117

Query  659   ELIITHSSSQETP  621
             EL    +S +  P
Sbjct  118   ELFYESNSERSGP  130



>gb|KHN41368.1| hypothetical protein glysoja_048780 [Glycine soja]
Length=532

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 99/133 (74%), Gaps = 8/133 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M +K+R   +SPER KVWT+ P      R+V V+YYL  N +L+HPHFME++LSSP
Sbjct  1     MEARM-RKYRQ--VSPERAKVWTEKPPKYHQNRKVPVLYYLCRNRQLEHPHFMEVQLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN+LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGS
Sbjct  58    NGLYLRDVIDRLNALRGRGMASLYSWSCKRSYKNGFVWHDLCEDDIILPAHGSEYVLKGS  117

Query  659   ELIITHSSSQETP  621
             EL    +S +  P
Sbjct  118   ELFYESNSERSGP  130



>gb|KEH30111.1| auxin-regulated protein [Medicago truncatula]
Length=421

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 4/120 (3%)
 Frame = -3

Query  971  KDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            ++ SPERTKVWT+P     R+V+VVYYLS NG L+HPHFME+ LSSP GL+L+DV+ RLN
Sbjct  14   RETSPERTKVWTEPKPKTPRKVSVVYYLSRNGHLEHPHFMEVPLSSPHGLYLKDVIIRLN  73

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
             LRG+GM ++YSWS+KR YKNGFVW DL E+DFIYP  GH+YILKGSE I+ H ++   P
Sbjct  74   LLRGKGMPTMYSWSSKRSYKNGFVWHDLTESDFIYPTQGHDYILKGSE-ILEHETTARPP  132


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 72/130 (55%), Gaps = 5/130 (4%)
 Frame = -3

Query  545  EDKESGRSGSSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAAR  366
            E +   ++ S+E S  EIS PP+ SSPETL  LMK D R + L +  ++        + R
Sbjct  210  EGETENQNQSTELSREEISPPPSDSSPETLGTLMKVDGR-LGLRSVPKENPTVESCPSGR  268

Query  365  PRTASVVMQILSCGSVAAREHAPPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENA  186
             R +SV++Q+LSCG+V+ +E +     K   FSL+ H+K  + LP G   +   +V    
Sbjct  269  MRASSVLLQLLSCGAVSFKEGSGASSGKDQRFSLVGHYK--SRLPRGGGNHVGKEVG--T  324

Query  185  VMELPLITSV  156
            ++E+P +  V
Sbjct  325  LVEIPDLNRV  334



>ref|XP_002311147.1| hypothetical protein POPTR_0008s05080g [Populus trichocarpa]
 gb|EEE88514.1| hypothetical protein POPTR_0008s05080g [Populus trichocarpa]
Length=297

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
             EL MA K+RD++ SP+RTK+   P    E +VAVVYYL+ NG+ +HPHFME+ LSSP+GL
Sbjct  11    ELSMANKYRDRETSPDRTKMTILPKSKSELKVAVVYYLTRNGQFEHPHFMEVPLSSPQGL  70

Query  830   FLR-DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
              L+ DV DRLN LRG+GMA +YSWS+KR+YKNGFVWQDL E D I+P  GHEYILKGS L
Sbjct  71    QLKGDVTDRLNHLRGQGMARMYSWSSKRRYKNGFVWQDLSETDSIHPCGGHEYILKGSLL  130

Query  653   IIT  645
             + T
Sbjct  131   LET  133



>ref|XP_006291332.1| hypothetical protein CARUB_v10017467mg [Capsella rubella]
 gb|EOA24230.1| hypothetical protein CARUB_v10017467mg [Capsella rubella]
Length=330

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 146/240 (61%), Gaps = 41/240 (17%)
 Frame = -3

Query  926  ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRK  747
            +RRV+VVYYLS NG+  HPHF+E+ LSS  GL+L+DV++RLN LRG+GMA LYSWS+KR 
Sbjct  35   DRRVSVVYYLSRNGQFDHPHFIEVPLSSQNGLYLKDVINRLNELRGKGMACLYSWSSKRT  94

Query  746  YKNGFVWQDLEENDFIYPAHGHEYILKGSEL---------------IITH------SSSQ  630
            YKNGFVW DL E DFI+P HG EY+LKGS++               ++TH      SS+ 
Sbjct  95   YKNGFVWHDLSEEDFIFPVHGKEYVLKGSQILDLDDKSGKESNISAVVTHRRNQSWSSND  154

Query  629  ETPALTAAGE--DREFPPLPPPRHNVH------AVEEDKESGRSGSSEPSNGEIS-TPPA  477
            +     ++ E   R+       + + H      A EE +E      +E S  EI+  PP+
Sbjct  155  QYKVYKSSAESSSRKLATDASTQTDNHRRRKHIAKEEVEEVNE--ITELSREEITSPPPS  212

Query  476  GSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAP  297
             SSPETL +LMKAD R  ++M +        D +  + R ++V+MQ++SCG+++ ++ AP
Sbjct  213  DSSPETLESLMKADGR--LMMRQE-------DRTVEKIRPSAVLMQLISCGAMSFKKCAP  263



>ref|XP_003606621.1| Auxin-regulated protein [Medicago truncatula]
 gb|AES88818.1| auxin-regulated protein [Medicago truncatula]
Length=422

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 4/120 (3%)
 Frame = -3

Query  971  KDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            ++ SPERTKVWT+P     R+V+VVYYLS NG L+HPHFME+ LSSP GL+L+DV+ RLN
Sbjct  14   RETSPERTKVWTEPKPKTPRKVSVVYYLSRNGHLEHPHFMEVPLSSPHGLYLKDVIIRLN  73

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
             LRG+GM ++YSWS+KR YKNGFVW DL E+DFIYP  GH+YILKGSE I+ H ++   P
Sbjct  74   LLRGKGMPTMYSWSSKRSYKNGFVWHDLTESDFIYPTQGHDYILKGSE-ILEHETTARPP  132


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 72/130 (55%), Gaps = 5/130 (4%)
 Frame = -3

Query  545  EDKESGRSGSSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAAR  366
            E +   ++ S+E S  EIS PP+ SSPETL  LMK D R + L +  ++        + R
Sbjct  210  EGETENQNQSTELSREEISPPPSDSSPETLGTLMKVDGR-LGLRSVPKENPTVESCPSGR  268

Query  365  PRTASVVMQILSCGSVAAREHAPPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENA  186
             R +SV++Q+LSCG+V+ +E +     K   FSL+ H+K  + LP G   +   +V    
Sbjct  269  MRASSVLLQLLSCGAVSFKEGSGASSGKDQRFSLVGHYK--SRLPRGGGNHVGKEVG--T  324

Query  185  VMELPLITSV  156
            ++E+P +  V
Sbjct  325  LVEIPDLNRV  334



>emb|CDX71378.1| BnaC04g16130D [Brassica napus]
Length=524

 Score =   168 bits (426),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 112/152 (74%), Gaps = 9/152 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ LSS
Sbjct  1     MEGRM-KKYRE-GVSPERAKVWTEKSPKYHQKIKKVQIVYYLSKNRQLEHPHFMEVLLSS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PNGLYLRDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  118

Query  662   SELIITHSSSQETPALTAAGED-REFPPLPPP  570
             SE+I   ++   +P   +A ++ ++    PPP
Sbjct  119   SEIIDQPTTDHFSPIENSATQNMKQIVVEPPP  150



>ref|XP_006291333.1| hypothetical protein CARUB_v10017467mg [Capsella rubella]
 gb|EOA24231.1| hypothetical protein CARUB_v10017467mg [Capsella rubella]
Length=370

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 144/240 (60%), Gaps = 41/240 (17%)
 Frame = -3

Query  926  ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRK  747
            +RRV+VVYYLS NG+  HPHF+E+ LSS  GL+L+DV++RLN LRG+GMA LYSWS+KR 
Sbjct  35   DRRVSVVYYLSRNGQFDHPHFIEVPLSSQNGLYLKDVINRLNELRGKGMACLYSWSSKRT  94

Query  746  YKNGFVWQDLEENDFIYPAHGHEYILKGSEL---------------IITH------SSSQ  630
            YKNGFVW DL E DFI+P HG EY+LKGS++               ++TH      SS+ 
Sbjct  95   YKNGFVWHDLSEEDFIFPVHGKEYVLKGSQILDLDDKSGKESNISAVVTHRRNQSWSSND  154

Query  629  ETPALTAAGE--DREFPPLPPPRHNVH------AVEEDKESGRSGSSEPSNGEIS-TPPA  477
            +     ++ E   R+       + + H      A EE +E      +E S  EI+  PP+
Sbjct  155  QYKVYKSSAESSSRKLATDASTQTDNHRRRKHIAKEEVEEVNE--ITELSREEITSPPPS  212

Query  476  GSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAP  297
             SSPETL +LMKAD R  ++M +  +      PSA       V+MQ++SCG+++ ++ AP
Sbjct  213  DSSPETLESLMKADGR--LMMRQEDRTVEKIRPSA-------VLMQLISCGAMSFKKCAP  263



>ref|XP_007150145.1| hypothetical protein PHAVU_005G130600g [Phaseolus vulgaris]
 gb|ESW22139.1| hypothetical protein PHAVU_005G130600g [Phaseolus vulgaris]
Length=527

 Score =   167 bits (424),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 105/150 (70%), Gaps = 10/150 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M +K+R   +SPER KVWT+        R+V VVYYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARM-RKYRQ--VSPERAKVWTEKSPKYYQNRKVPVVYYLCRNRQLEHPHFMEVPLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL LRDV+DRLN+LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  58    DGLVLRDVIDRLNALRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPP  570
             EL    +S + +P  T+  + +    LP P
Sbjct  118   ELFYESNSERFSP--TSNVKTQNLKQLPEP  145



>gb|KFK32341.1| hypothetical protein AALP_AA6G229200 [Arabis alpina]
Length=542

 Score =   167 bits (424),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 6/140 (4%)
 Frame = -3

Query  971  KDISPERTKVWTQPPER------RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLD  810
            +++SPER KVWT+   +      +V +VYYLS N +L+HPHFME+ +SSP GL+LRDV+D
Sbjct  5    REVSPERAKVWTEKSPKYHQKINKVPIVYYLSKNRQLEHPHFMEVLISSPNGLYLRDVID  64

Query  809  RLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQ  630
            RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKGSEL    +S  
Sbjct  65   RLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAHGNEYVLKGSELFDESTSDH  124

Query  629  ETPALTAAGEDREFPPLPPP  570
             +P   +A ++ +     PP
Sbjct  125  FSPTANSASQNMKQIVAEPP  144



>gb|KHN21075.1| hypothetical protein glysoja_006554 [Glycine soja]
Length=566

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+ ++ +SPER KVWT+   +     +V V+YYLS N +L+HPHFME+ LSSP
Sbjct  1     MEARMKKKY-NRQVSPERAKVWTEKSPKYHQSLKVPVIYYLSRNRQLEHPHFMEVPLSSP  59

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YK+GFVW DL E+D I PAHG+EY+LKGS
Sbjct  60    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKSGFVWHDLCEDDIILPAHGNEYVLKGS  119

Query  659   ELIITHSSSQETPALTAAGEDREFPPLP  576
             EL    +S + +P      +  +  P P
Sbjct  120   ELFDESNSDRFSPISNVKTQSVKLLPGP  147



>ref|XP_009419473.1| PREDICTED: protein UPSTREAM OF FLC [Musa acuminata subsp. malaccensis]
Length=308

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/247 (41%), Positives = 147/247 (60%), Gaps = 22/247 (9%)
 Frame = -3

Query  992  MAKKWRDKDISPERTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVL  813
            MA  +R +    E +++  +    R AVVYYLS NG L+HPHFME+ LSS  GL+LRDV+
Sbjct  1    MAAAYRGR---AEHSRIERETSPARAAVVYYLSRNGHLEHPHFMEVPLSSSSGLYLRDVI  57

Query  812  DRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSS  633
            +RL+ LRG  M  LYSWS+KR Y+NG+VWQDL E+DFI+P HG+EY+LKG+EL+  +SSS
Sbjct  58   NRLHVLRGRAMVGLYSWSSKRSYRNGYVWQDLSEDDFIHPVHGNEYVLKGTELLHLNSSS  117

Query  632  QETPALTAAGEDREFPPLPPPRHNVHA------------VEEDKESGRSG-------SSE  510
                +  +    ++       + N  A             EE K   R         ++E
Sbjct  118  SSEDSAVSFSRGKQATRSSFYKSNTSAETTANSIDASTQTEEHKRQQRRAPVAEKHPATE  177

Query  509  PSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILS  330
             S  E+S PP+ SSPETL AL+KAD R ++ +    K  +     + R + ++V+M ++S
Sbjct  178  LSGDEVSPPPSSSSPETLEALIKADGRCIMAVRPEEKGWSVGGCLSGRVKASAVLMHLIS  237

Query  329  CGSVAAR  309
            CGS++A+
Sbjct  238  CGSISAK  244



>ref|XP_006378940.1| hypothetical protein POPTR_0009s01120g [Populus trichocarpa]
 gb|ERP56737.1| hypothetical protein POPTR_0009s01120g [Populus trichocarpa]
Length=451

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 7/149 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME    KK+ ++ +SPER KVWT      Q   R+V VVYYL  N +L+HPHF+E+ L+S
Sbjct  1     METMTMKKY-NRQVSPERAKVWTERSPKYQQQNRKVPVVYYLCRNRQLEHPHFIEVPLAS  59

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMASLYSWS+KR YKNGFVW DL E+D I PAHG EY+LKG
Sbjct  60    PDGLYLRDVIERLNVLRGRGMASLYSWSSKRSYKNGFVWHDLCEDDLILPAHGSEYVLKG  119

Query  662   SELIITHSSSQETPALTAAGEDREFPPLP  576
             SEL    +S +  PA T   ++ +  P P
Sbjct  120   SELFEESNSDRFAPAGTIKMQNLKLLPEP  148



>ref|XP_004970518.1| PREDICTED: uncharacterized protein LOC101753415 [Setaria italica]
Length=407

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 136/248 (55%), Gaps = 57/248 (23%)
 Frame = -3

Query  911  VVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGF  732
            VVYYLS NG L+HPHFME+ LSSP GL+LRDV+DRL++LRG+GMA +YSW++KR Y+NGF
Sbjct  43   VVYYLSRNGHLEHPHFMEVALSSPDGLYLRDVIDRLDALRGKGMARMYSWASKRSYRNGF  102

Query  731  VWQDLEENDFIYPAHGHEYILKGSELI----------------ITHSSSQETPALT----  612
            VW DL ++D+I+P  G EY+LKG+E +                 + S SQETP  +    
Sbjct  103  VWHDLADDDYIHPVVGREYVLKGTERLHPAVPPAPLLDAAAASSSSSGSQETPTSSSSAR  162

Query  611  ---------AAGEDR------EFPPLPPPRHNVHAVEEDKESGR-----------SGSSE  510
                     +AG  R      E+           A  + ++ GR           +   E
Sbjct  163  WEAHAHRKKSAGARRAADGLGEYVVYKGEECAADAATQTEDGGRGHPRRAHAQAAAPQDE  222

Query  509  PSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILS  330
             S  E S P A +SPETL AL+KAD R V  ++            + R R  SV+MQ++S
Sbjct  223  LSRAETSPPTASTSPETLEALIKADGRVVAAIS-----------GSGRARAPSVLMQLIS  271

Query  329  CGSVAARE  306
            CGSV+ R+
Sbjct  272  CGSVSVRD  279



>ref|NP_180382.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42061.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04115.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08085.1| uncharacterized protein AT2G28150 [Arabidopsis thaliana]
Length=540

 Score =   166 bits (421),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 108/151 (72%), Gaps = 8/151 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M K  R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ +SS
Sbjct  1     MEARMKKYSRE--VSPERAKVWTEKSPKYHQKIKKVQIVYYLSKNRQLEHPHFMEVLISS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PA+G+EY+LKG
Sbjct  59    PNGLYLRDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPANGNEYVLKG  118

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S   +P +  A ++ +   + PP
Sbjct  119   SELFDESNSDHFSPIVNLATQNMKQIVVEPP  149



>ref|XP_010470136.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Camelina 
sativa]
Length=542

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (72%), Gaps = 11/151 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M K  R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ +SS
Sbjct  1     MEARMKKYSRE--VSPERAKVWTEKSPKYHQKIKKVPIVYYLSKNRQLEHPHFMEILMSS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR   NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PNGLYLRDVIERLNVLRGRGMASMYSWSSKR---NGFVWHDLSEDDLILPAHGNEYVLKG  115

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S Q +P +  AG++ +   + PP
Sbjct  116   SELFDESNSDQFSPIVNTAGQNMKQIVVEPP  146



>ref|NP_200787.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08346.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13138.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37875.1| At5g59790 [Arabidopsis thaliana]
 dbj|BAE98600.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97234.1| uncharacterized protein AT5G59790 [Arabidopsis thaliana]
Length=423

 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/290 (34%), Positives = 153/290 (53%), Gaps = 65/290 (22%)
 Frame = -3

Query  971  KDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            +D SP+R ++W++P       R+V VVYYL  NG+L HPHF+E+ LSS  GL+L+DV++R
Sbjct  24   QDTSPDRNRIWSEPRLKPVVNRKVPVVYYLCRNGQLDHPHFIEVTLSSHDGLYLKDVINR  83

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIIT------  645
            LN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++ +      
Sbjct  84   LNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVLDSCLISNP  143

Query  644  ------------------HSSSQETPALTAAGEDREFPPLPPPRHNVH-AVEEDKESGRS  522
                               +S  + PA+     ++ +  +    + V+ A E   ES + 
Sbjct  144  RSLLETSSFRDPRSLNPDKNSGDDIPAVINRRRNQSWSSIDLSEYKVYKATESSAESTQR  203

Query  521  GSSEPSNG----------------EISTPPAGSSPET------------------LAALM  444
             +++ S                  E+ +P +  +  T                  L  L+
Sbjct  204  LAADASTQTDDRRRRRRPAKEEIEEVKSPASYENQSTELSRDEISPPPSDSSPETLENLI  263

Query  443  KADRRRVILMNEARKAAAYYDP-SAARPRTASVVMQILSCGSVAAREHAP  297
            KAD R ++  +E+       +  S+ R R ++V+MQ++SCG+++ +E  P
Sbjct  264  KADGRLILRPSESSTDHRTVESLSSGRMRASAVLMQLISCGTMSFKECGP  313



>gb|KFK33966.1| hypothetical protein AALP_AA5G084800 [Arabis alpina]
Length=339

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 141/250 (56%), Gaps = 28/250 (11%)
 Frame = -3

Query  926  ERRVAVVYYLS-LNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKR  750
            ER+V VVYYL   NG+L HPHF+E+ LSS  GL+L+DV++RLN LRG+ MA LYSWS+KR
Sbjct  27   ERKVPVVYYLCRKNGQLDHPHFIEVSLSSNHGLYLKDVINRLNHLRGKAMACLYSWSSKR  86

Query  749  KYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETPALTAAGEDREFPPLPPP  570
             YKNGFVWQDL END I+P  G EYILKGS+L+     ++E+   T     R    L   
Sbjct  87   IYKNGFVWQDLSENDLIFPVQGQEYILKGSQLL--EFDNKESDFSTVVTHHRRNQSLSSI  144

Query  569  RHNVH---------AVEEDKE-----------SGRSGSSEPSNGEISTPP--AGSSPETL  456
             + V+         A E   +           + +   +E S  E+ +PP  + SSPETL
Sbjct  145  DYKVYKSPESTRKLATEASTQTEDLRRRKKPTTEKDEITELSREEMISPPQESDSSPETL  204

Query  455  AALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAPPCKAKTH  276
             +LM +D R +++  +        + S+ +     V+MQ++SCG+++ ++  P    +  
Sbjct  205  ESLMNSDGRLIVIPEDEETNRTMENLSSGK---MGVLMQMISCGAMSFKKCGPMVMEECT  261

Query  275  AFSLISHHKM  246
              S   +++M
Sbjct  262  VGSGTGNYRM  271



>ref|XP_006591104.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Glycine max]
 ref|XP_006591105.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Glycine max]
 ref|XP_006591106.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X3 [Glycine max]
Length=539

 Score =   166 bits (419),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+ ++ +SPER KVWT+   +     +V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARMKKKY-NRQVSPERAKVWTEKSPKYHQSLKVPVIYYLCRNRQLEHPHFMEVPLSSP  59

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YK+GFVW DL E+D I PAHG+EY+LKGS
Sbjct  60    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKSGFVWHDLCEDDIILPAHGNEYVLKGS  119

Query  659   ELIITHSSSQETPALTAAGEDREFPPLP  576
             EL    +S + +P      +  +  P P
Sbjct  120   ELFDESNSDRFSPISNVKTQSVKLLPGP  147



>gb|KHN38706.1| hypothetical protein glysoja_008255 [Glycine soja]
Length=516

 Score =   165 bits (418),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+ ++ +SPER KVWT+   +     +V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARMKKKY-NRQVSPERAKVWTEKSPKYHQSLKVPVIYYLCRNRQLEHPHFMEVPLSSP  59

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YK+GFVW DL E+D I PAHG+EY+LKGS
Sbjct  60    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKSGFVWHDLCEDDIILPAHGNEYVLKGS  119

Query  659   ELIITHSSSQETPALTAAGEDREFPPLP  576
             EL    +S + +P      +  +  P P
Sbjct  120   ELFDESNSDRFSPISNVKTQSVKLLPGP  147



>ref|XP_006591107.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X4 [Glycine max]
Length=517

 Score =   165 bits (418),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 103/148 (70%), Gaps = 6/148 (4%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+ ++ +SPER KVWT+   +     +V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARMKKKY-NRQVSPERAKVWTEKSPKYHQSLKVPVIYYLCRNRQLEHPHFMEVPLSSP  59

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YK+GFVW DL E+D I PAHG+EY+LKGS
Sbjct  60    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKSGFVWHDLCEDDIILPAHGNEYVLKGS  119

Query  659   ELIITHSSSQETPALTAAGEDREFPPLP  576
             EL    +S + +P      +  +  P P
Sbjct  120   ELFDESNSDRFSPISNVKTQSVKLLPGP  147



>ref|XP_002880947.1| hypothetical protein ARALYDRAFT_901702 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57206.1| hypothetical protein ARALYDRAFT_901702 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   165 bits (418),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 8/151 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M K  R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ +SS
Sbjct  1     MEARMKKYSRE--VSPERAKVWTEKSPKYHQKIKKVQIVYYLSKNRQLEHPHFMEVLISS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV +RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PA+G+EY+LKG
Sbjct  59    PNGLYLRDVTERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPANGNEYVLKG  118

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S   +P +  A ++ +   + PP
Sbjct  119   SELFDESNSDHFSPIMNLASQNMKQIVVEPP  149



>ref|XP_010067373.1| PREDICTED: protein UPSTREAM OF FLC-like [Eucalyptus grandis]
Length=314

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 4/126 (3%)
 Frame = -3

Query  998  LHMAKKWRDKDISPERTKVWTQPP---ERRVAVVYYLSLNGKLQHPHFMELRLSSPRG-L  831
            L + +K++D D SPER + W +P    E +V VVYYLS NG L+HPHFME+ LSSP G L
Sbjct  13   LWVPQKFQDTDTSPERARKWIEPQAKMESKVPVVYYLSRNGHLEHPHFMEVPLSSPGGGL  72

Query  830  FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            FLRDV++RLN LRG G+AS+YSWS+KR YK+G+VWQDL E+D I+P HGHEYILKGS L+
Sbjct  73   FLRDVINRLNCLRGPGVASMYSWSSKRTYKSGYVWQDLTEDDLIHPCHGHEYILKGSLLL  132

Query  650  ITHSSS  633
               S S
Sbjct  133  QVPSPS  138



>ref|XP_009103650.1| PREDICTED: protein UPSTREAM OF FLC [Brassica rapa]
 ref|XP_009103651.1| PREDICTED: protein UPSTREAM OF FLC [Brassica rapa]
 ref|XP_009103652.1| PREDICTED: protein UPSTREAM OF FLC [Brassica rapa]
Length=527

 Score =   165 bits (418),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 10/153 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ LSS
Sbjct  1     MEGRM-KKYRE-GVSPERAKVWTEKSPKYHQKIKKVQIVYYLSKNRQLEHPHFMEVLLSS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PNGLYLRDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  118

Query  662   SELIITHSSSQ-ETPALTAAGED-REFPPLPPP  570
             SE+I   ++    +P   +A ++ ++    PPP
Sbjct  119   SEIIDQSTTDHFSSPIENSATQNMKQIVVEPPP  151



>emb|CDY04542.1| BnaA07g13680D [Brassica napus]
Length=528

 Score =   165 bits (417),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 8/124 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ LSS
Sbjct  1     MEGRM-KKYRE-GVSPERAKVWTEKSPKYHQKIKKVQIVYYLSKNRQLEHPHFMEVLLSS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PNGLYLRDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  118

Query  662   SELI  651
             SE+I
Sbjct  119   SEII  122



>ref|XP_003543446.2| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Glycine max]
Length=518

 Score =   165 bits (417),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 103/150 (69%), Gaps = 10/150 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M +K+R   +SPER KVWT+        R+V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARM-RKYRQ--VSPERAKVWTEKSPKYHQNRKVPVLYYLCRNRQLEHPHFMEVPLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN+LRG GM SLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGS
Sbjct  58    DGLYLRDVIDRLNALRGRGMTSLYSWSCKRSYKNGFVWHDLCEDDLILPAHGSEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPP  570
             EL    +S +  P   + G+ +    LP P
Sbjct  118   ELFYESNSERFGP--ISNGKIQSLKQLPEP  145



>ref|XP_006594962.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Glycine max]
 ref|XP_006594963.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X3 [Glycine max]
 ref|XP_006594964.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X4 [Glycine max]
 ref|XP_006594965.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X5 [Glycine max]
 ref|XP_006594966.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X6 [Glycine max]
Length=532

 Score =   165 bits (417),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 103/150 (69%), Gaps = 10/150 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M +K+R   +SPER KVWT+        R+V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARM-RKYRQ--VSPERAKVWTEKSPKYHQNRKVPVLYYLCRNRQLEHPHFMEVPLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN+LRG GM SLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGS
Sbjct  58    DGLYLRDVIDRLNALRGRGMTSLYSWSCKRSYKNGFVWHDLCEDDLILPAHGSEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPP  570
             EL    +S +  P   + G+ +    LP P
Sbjct  118   ELFYESNSERFGP--ISNGKIQSLKQLPEP  145



>gb|KHN21485.1| hypothetical protein glysoja_021065 [Glycine soja]
Length=518

 Score =   165 bits (417),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 103/150 (69%), Gaps = 10/150 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M +K+R   +SPER KVWT+        R+V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARM-RKYRQ--VSPERAKVWTEKSPKYHQNRKVPVLYYLCRNRQLEHPHFMEVPLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN+LRG GM SLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGS
Sbjct  58    DGLYLRDVIDRLNALRGRGMTSLYSWSCKRSYKNGFVWHDLCEDDLILPAHGSEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPP  570
             EL    +S +  P   + G+ +    LP P
Sbjct  118   ELFYESNSERFGP--ISNGKIQSLKQLPEP  145



>ref|XP_006384958.1| hypothetical protein POPTR_0004s22580g [Populus trichocarpa]
 gb|ERP62755.1| hypothetical protein POPTR_0004s22580g [Populus trichocarpa]
Length=530

 Score =   165 bits (417),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 104/149 (70%), Gaps = 7/149 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME    KK+ ++ +SPER KVWT      Q   R+VAVVYYL  N +L+HPHF+E+ L+S
Sbjct  1     METTRMKKY-NRQLSPERAKVWTERSPKYQQQNRKVAVVYYLCRNRQLEHPHFIEVPLAS  59

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RL+ LRG GMASLYSWS+KR YKNGFVW DL E+D I PAHG+EY+LKG
Sbjct  60    PDGLYLRDVIERLDVLRGRGMASLYSWSSKRSYKNGFVWHDLCEDDLILPAHGNEYVLKG  119

Query  662   SELIITHSSSQETPALTAAGEDREFPPLP  576
             SEL    +S    P  T   ++ +  P P
Sbjct  120   SELFEESNSDHFAPVGTIKMQNLKLLPQP  148



>ref|XP_004506071.1| PREDICTED: serine-rich adhesin for platelets-like isoform X1 
[Cicer arietinum]
Length=536

 Score =   165 bits (417),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 99/133 (74%), Gaps = 8/133 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+   +     +VAV+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARM-KKFRQ--VSPERAKVWTEKSPKYHQNLKVAVIYYLCRNRQLEHPHFMEVPLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YKNGFVW+DL E D I PAHG+EY+LKGS
Sbjct  58    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKNGFVWRDLCEADLILPAHGNEYVLKGS  117

Query  659   ELIITHSSSQETP  621
             EL    +S + +P
Sbjct  118   ELFDESNSDRFSP  130



>ref|XP_010521721.1| PREDICTED: protein UPSTREAM OF FLC [Tarenaya hassleriana]
Length=511

 Score =   164 bits (416),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 107/169 (63%), Gaps = 7/169 (4%)
 Frame = -3

Query  965  ISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRL  804
            +SPER KVWT      Q   ++V VVYYL  N +L+HPHFME+ LSSP GL+LRDV++RL
Sbjct  12   VSPERAKVWTEKSPKYQQKVKKVPVVYYLCRNRQLEHPHFMEVPLSSPDGLYLRDVIERL  71

Query  803  NSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQET  624
            N LRG GMA +YSWS KR Y+NGFVW DL E+D I PA G EY+LKGSEL    +S Q +
Sbjct  72   NVLRGRGMAPMYSWSCKRSYRNGFVWHDLSEDDLILPAQGSEYVLKGSELFDESNSGQFS  131

Query  623  PALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGSSEPSNGEISTPPA  477
            P ++   ++ +  P PP   ++            G+  P   E+S PPA
Sbjct  132  PVVSMRAQNLKQLPEPPSSRSLDDSSSSSSFNEKGTKHPQEDELS-PPA  179



>ref|XP_004487565.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X2 [Cicer arietinum]
Length=518

 Score =   164 bits (416),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 7/133 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R + +SPER+KVW +        R+V VVYYL  N +L+HPHFME+ +SSP
Sbjct  1     MEARM-KKYRQQ-VSPERSKVWKEKSPKYYQNRKVPVVYYLCRNRQLEHPHFMEVSISSP  58

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GLFLRDV+D+L++LRG GMASLYSWS KR Y+NG+VW DL E+D I PAHG EY+LKGS
Sbjct  59    DGLFLRDVIDKLDALRGRGMASLYSWSCKRSYRNGYVWHDLSEDDIILPAHGDEYVLKGS  118

Query  659   ELIITHSSSQETP  621
             EL    +S + +P
Sbjct  119   ELFCESNSDRFSP  131



>ref|XP_004487564.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Cicer arietinum]
Length=538

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 7/133 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R + +SPER+KVW +        R+V VVYYL  N +L+HPHFME+ +SSP
Sbjct  1     MEARM-KKYRQQ-VSPERSKVWKEKSPKYYQNRKVPVVYYLCRNRQLEHPHFMEVSISSP  58

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GLFLRDV+D+L++LRG GMASLYSWS KR Y+NG+VW DL E+D I PAHG EY+LKGS
Sbjct  59    DGLFLRDVIDKLDALRGRGMASLYSWSCKRSYRNGYVWHDLSEDDIILPAHGDEYVLKGS  118

Query  659   ELIITHSSSQETP  621
             EL    +S + +P
Sbjct  119   ELFCESNSDRFSP  131



>ref|XP_010096649.1| hypothetical protein L484_025396 [Morus notabilis]
 gb|EXB65317.1| hypothetical protein L484_025396 [Morus notabilis]
Length=291

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 98/124 (79%), Gaps = 7/124 (6%)
 Frame = -3

Query  1001  ELHMAKKWRD--KDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             E+ + + W+D  ++ + +R+K W +P      +++V V+YYLS NG+L+HPHFM + LSS
Sbjct  10    EISVPRIWKDMEENAASQRSKAWMEPKAMRKTDQKVPVIYYLSRNGQLEHPHFMVVPLSS  69

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P+GL+L+DV+ RL SLRG+G+A++YSWS+KR YKN FVWQDL E+DFIYP  GHEY+LKG
Sbjct  70    PQGLYLKDVISRLGSLRGQGLANMYSWSSKRSYKNSFVWQDLSEDDFIYPCQGHEYVLKG  129

Query  662   SELI  651
             S+L+
Sbjct  130   SQLL  133



>ref|XP_004506072.1| PREDICTED: serine-rich adhesin for platelets-like isoform X2 
[Cicer arietinum]
Length=530

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 99/133 (74%), Gaps = 8/133 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+   +     +VAV+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEARM-KKFRQ--VSPERAKVWTEKSPKYHQNLKVAVIYYLCRNRQLEHPHFMEVPLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YKNGFVW+DL E D I PAHG+EY+LKGS
Sbjct  58    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKNGFVWRDLCEADLILPAHGNEYVLKGS  117

Query  659   ELIITHSSSQETP  621
             EL    +S + +P
Sbjct  118   ELFDESNSDRFSP  130



>ref|XP_010443759.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Camelina 
sativa]
Length=396

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 5/116 (4%)
 Frame = -3

Query  983  KWRDKDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRD  819
            K + +D SP+R ++W++P       R+V VVYYL  NG+L HPHFME+ LSS  GL+L+D
Sbjct  24   KDQQQDTSPDRNRIWSEPRHKPIVNRKVPVVYYLCRNGQLDHPHFMEVTLSSHDGLYLKD  83

Query  818  VLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            V++RLN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  84   VINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  139



>ref|XP_007205039.1| hypothetical protein PRUPE_ppa004193mg [Prunus persica]
 gb|EMJ06238.1| hypothetical protein PRUPE_ppa004193mg [Prunus persica]
Length=524

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  11   VSPERAKVWTEKSPKYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLRDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            +LRG GMAS+YSWS+KR YKNGFVW DL E+D I PAHG+EY+LKGSEL    +S + +P
Sbjct  71   ALRGRGMASMYSWSSKRSYKNGFVWHDLSEDDLILPAHGNEYVLKGSELFEESNSDRFSP  130

Query  620  A  618
             
Sbjct  131  V  131



>ref|XP_010443758.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Camelina 
sativa]
Length=408

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 5/116 (4%)
 Frame = -3

Query  983  KWRDKDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRD  819
            K + +D SP+R ++W++P       R+V VVYYL  NG+L HPHFME+ LSS  GL+L+D
Sbjct  24   KDQQQDTSPDRNRIWSEPRHKPIVNRKVPVVYYLCRNGQLDHPHFMEVTLSSHDGLYLKD  83

Query  818  VLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            V++RLN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  84   VINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  139



>emb|CBI17137.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 95/127 (75%), Gaps = 8/127 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+        R+V VVYYL  N +L+HPHF+E+ LSS 
Sbjct  1     MEARM-KKYRQ--VSPERAKVWTEKSPRYQQSRKVPVVYYLCRNRQLEHPHFIEVPLSST  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMAS+YSWS KR YKNGFVW D+ E+D I PAHG+EY+LKGS
Sbjct  58    EGLYLRDVIDRLNVLRGRGMASMYSWSCKRSYKNGFVWHDISEDDIILPAHGNEYVLKGS  117

Query  659   ELIITHS  639
             EL  ++S
Sbjct  118   ELFESNS  124



>ref|XP_010111845.1| hypothetical protein L484_020637 [Morus notabilis]
 gb|EXC31810.1| hypothetical protein L484_020637 [Morus notabilis]
Length=519

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 106/146 (73%), Gaps = 9/146 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+        R+V VVYYL  N +L+HPHFME+  SSP
Sbjct  1     MEARM-KKYRQ--VSPERAKVWTEKSPKYQQNRKVPVVYYLCRNRQLEHPHFMEVPFSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN LRG GMAS+++WS+KR YKNGFVW DL E+D I+PAHG+EY+LKGS
Sbjct  58    DGLYLRDVIERLNVLRGRGMASMFAWSSKRSYKNGFVWHDLCEDDLIHPAHGNEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGED-REFP  585
             EL+   +S + +P +    +  ++FP
Sbjct  118   ELVEESNSDRFSPVVNVKTQSLKQFP  143



>emb|CDY65697.1| BnaA02g06840D [Brassica napus]
Length=417

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 6/118 (5%)
 Frame = -3

Query  986  KKWRDK-DISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFL  825
            ++ RD+ D SP+R ++WT+P       R+V VVYYL  NG+L HPHF+E+ LSS  GL+L
Sbjct  18   RRSRDQQDTSPDRNRIWTEPRHKPTLNRKVPVVYYLCRNGQLDHPHFIEVTLSSTDGLYL  77

Query  824  RDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +DV++RLN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  78   KDVINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  135



>ref|XP_009126662.1| PREDICTED: protein UPSTREAM OF FLC [Brassica rapa]
Length=417

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 6/118 (5%)
 Frame = -3

Query  986  KKWRDK-DISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFL  825
            ++ RD+ D SP+R ++WT+P       R+V VVYYL  NG+L HPHF+E+ LSS  GL+L
Sbjct  18   RRSRDQQDTSPDRNRIWTEPRHKPTLNRKVPVVYYLCRNGQLDHPHFIEVTLSSTDGLYL  77

Query  824  RDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +DV++RLN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  78   KDVINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  135



>emb|CDY65698.1| BnaA02g06850D [Brassica napus]
Length=417

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 6/118 (5%)
 Frame = -3

Query  986  KKWRDK-DISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFL  825
            ++ RD+ D SP+R ++WT+P       R+V VVYYL  NG+L HPHF+E+ LSS  GL+L
Sbjct  18   RRSRDQQDTSPDRNRIWTEPRHKPTLNRKVPVVYYLCRNGQLDHPHFIEVTLSSTDGLYL  77

Query  824  RDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +DV++RLN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  78   KDVINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  135



>emb|CDP07033.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 93/124 (75%), Gaps = 9/124 (7%)
 Frame = -3

Query  962  SPERTKVWT---------QPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLD  810
            SPER KVWT         QP + RVAVVYYL  N +L+HPHF+E+ LSSP GL+LRDV++
Sbjct  35   SPERAKVWTEKSPKYHYHQPRDSRVAVVYYLCRNRQLEHPHFIEVPLSSPDGLYLRDVVE  94

Query  809  RLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQ  630
            RLN LRG GMAS+YSWS KR YKNGFVW DL E+D I PAHG+EY+LKGSEL    +S +
Sbjct  95   RLNVLRGRGMASMYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGSELFEDSNSGR  154

Query  629  ETPA  618
             TPA
Sbjct  155  FTPA  158



>ref|XP_011028263.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Populus euphratica]
Length=544

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 102/149 (68%), Gaps = 7/149 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME    KK+ ++ +SP+R KVWT      Q   R+VAVVYYL  N +L+HPHF+E+ LSS
Sbjct  1     METTRMKKY-NRQLSPDRAKVWTERSPKYQQQNRKVAVVYYLCRNRQLEHPHFIEVPLSS  59

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV+ RL+ LRG GMASLYSWS+KR YKNGFVW DL E+D I PAHG+EY+LKG
Sbjct  60    PDGLYLRDVIGRLDVLRGRGMASLYSWSSKRSYKNGFVWHDLCEDDLILPAHGNEYVLKG  119

Query  662   SELIITHSSSQETPALTAAGEDREFPPLP  576
             SEL     S    P  T   ++ +  P P
Sbjct  120   SELFEESDSDHIAPGGTIKIQNLKLLPQP  148



>ref|XP_010483624.1| PREDICTED: protein UPSTREAM OF FLC-like [Camelina sativa]
Length=434

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 5/116 (4%)
 Frame = -3

Query  983  KWRDKDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRD  819
            K + +D SP+R ++W++P       R+V VVYYL  NG+L HPHFME+ LSS  GL+L+D
Sbjct  23   KDQQQDTSPDRNRIWSEPRHKPIVNRKVPVVYYLCRNGQLDHPHFMEVTLSSHDGLYLKD  82

Query  818  VLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            V++RLN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  83   VINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  138



>ref|XP_011028265.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X4 [Populus euphratica]
Length=522

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 102/149 (68%), Gaps = 7/149 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME    KK+ ++ +SP+R KVWT      Q   R+VAVVYYL  N +L+HPHF+E+ LSS
Sbjct  1     METTRMKKY-NRQLSPDRAKVWTERSPKYQQQNRKVAVVYYLCRNRQLEHPHFIEVPLSS  59

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV+ RL+ LRG GMASLYSWS+KR YKNGFVW DL E+D I PAHG+EY+LKG
Sbjct  60    PDGLYLRDVIGRLDVLRGRGMASLYSWSSKRSYKNGFVWHDLCEDDLILPAHGNEYVLKG  119

Query  662   SELIITHSSSQETPALTAAGEDREFPPLP  576
             SEL     S    P  T   ++ +  P P
Sbjct  120   SELFEESDSDHIAPGGTIKIQNLKLLPQP  148



>ref|XP_006592290.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X3 [Glycine max]
Length=516

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 7/148 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M K  R   +SPER KVWT+   +     +V V+YYLS N +L+HPHFME+ LSSP
Sbjct  1     MEARMKKYNRQ--VSPERAKVWTEKSPKYHQSLKVPVIYYLSRNRQLEHPHFMEVPLSSP  58

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YK+GFVW DL E+D I PAHG+EY+LKGS
Sbjct  59    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKSGFVWHDLCEDDIILPAHGNEYVLKGS  118

Query  659   ELIITHSSSQETPALTAAGEDREFPPLP  576
             EL    +S + +P      +  +  P P
Sbjct  119   ELFDESNSDRFSPISNVKTQSVKLLPGP  146



>ref|XP_006592288.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Glycine max]
 ref|XP_006592289.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Glycine max]
Length=538

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 7/148 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M K  R   +SPER KVWT+   +     +V V+YYLS N +L+HPHFME+ LSSP
Sbjct  1     MEARMKKYNRQ--VSPERAKVWTEKSPKYHQSLKVPVIYYLSRNRQLEHPHFMEVPLSSP  58

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YK+GFVW DL E+D I PAHG+EY+LKGS
Sbjct  59    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKSGFVWHDLCEDDIILPAHGNEYVLKGS  118

Query  659   ELIITHSSSQETPALTAAGEDREFPPLP  576
             EL    +S + +P      +  +  P P
Sbjct  119   ELFDESNSDRFSPISNVKTQSVKLLPGP  146



>ref|XP_010455528.1| PREDICTED: protein UPSTREAM OF FLC-like [Camelina sativa]
Length=440

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 5/116 (4%)
 Frame = -3

Query  983  KWRDKDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRD  819
            K + +D SP+R ++W++P       R+V VVYYL  NG+L HPHFME+ LSS  GL+L+D
Sbjct  26   KDQQQDTSPDRNRIWSEPRHKPIVNRKVPVVYYLCRNGQLDHPHFMEVTLSSHDGLYLKD  85

Query  818  VLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            V++RLN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  86   VINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  141



>ref|XP_010031412.1| PREDICTED: protein UPSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW50705.1| hypothetical protein EUGRSUZ_J00387 [Eucalyptus grandis]
Length=524

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 8/149 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+        R+V VVYYL  N +L+HPHF+E+ ++SP
Sbjct  1     MEARM-KKYRQ--VSPERAKVWTEKSPKYIQNRKVPVVYYLCRNRQLEHPHFIEVPVASP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMAS+YSWS+KR YKNGFVW DL E+D I P++G+EY+LKGS
Sbjct  58    EGLYLRDVIDRLNVLRGRGMASMYSWSSKRSYKNGFVWHDLCEDDLILPSNGNEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPP  573
             EL    +S + +P +     + +  P PP
Sbjct  118   ELFDESNSDRFSPVVNVGVRNLKQLPAPP  146



>ref|XP_008226607.1| PREDICTED: protein UPSTREAM OF FLC isoform X3 [Prunus mume]
Length=527

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  11   VSPERAKVWTEKSPKYHQNRKVPVVYYLSRNRQLEHPHFMEVTVTSPQGLYLRDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            +LRG GMAS+YSWS+KR YKNGFVW DL E+D I PAHG+EY+LKGSEL    +S + +P
Sbjct  71   ALRGRGMASMYSWSSKRSYKNGFVWHDLSEDDPILPAHGNEYVLKGSELFEESNSDRFSP  130

Query  620  A  618
             
Sbjct  131  V  131



>ref|XP_010922980.1| PREDICTED: protein UPSTREAM OF FLC-like, partial [Elaeis guineensis]
Length=300

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/299 (36%), Positives = 154/299 (52%), Gaps = 71/299 (24%)
 Frame = -3

Query  965  ISPER-TKVWTQ---PPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNS  798
            +SP R +++W Q     +R+ +VVYYLS +G L+HPH++E+ LSS  GL+LRDV++RL  
Sbjct  3    VSPRRRSELWGQERKTAQRKASVVYYLSRDGHLEHPHYLEVPLSSTEGLYLRDVINRLCV  62

Query  797  LRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETPA  618
            LRG+GMA++YSWS+KR+YKNGFVW DL E DFIYP H  EYILKGSE +   +SS    +
Sbjct  63   LRGKGMAAMYSWSSKRRYKNGFVWFDLCEEDFIYPVHSQEYILKGSEFLHLGNSSISQES  122

Query  617  LTAAGEDREFPP-----------LPPPRHN---------------------VHAVEEDKE  534
            L  +    E PP           +P  R                       V A++    
Sbjct  123  LATSSPTTEKPPEISNSVQDVSDIPVSRRKKPSWGSLDLNEPTAYTSEPTAVIAIKFSDA  182

Query  533  S--------------GRSGSSEPSN--------GEISTPPAGSSPETLAALMKADRRRVI  420
            S              G  G ++ +N         EIS P + SS ETL A+++AD R V 
Sbjct  183  STQTDGLRQGQRAPNGEDGQAKTANPEVTELGTDEISPPLSTSSSETLEAVIRADGRIVA  242

Query  419  --LMNEARKAAAYYDPSAARPRTASVVMQILSCGSVAAREHAPPCKAKTHAFSLISHHK  249
              L +   +         ARP  ++V+M ++SCGS++ +E            SL+S ++
Sbjct  243  RRLGDRCHRTVGACPKGRARP--SAVLMHLISCGSISVKE---------QGISLVSQYR  290



>ref|XP_008226601.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Prunus mume]
Length=547

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  11   VSPERAKVWTEKSPKYHQNRKVPVVYYLSRNRQLEHPHFMEVTVTSPQGLYLRDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            +LRG GMAS+YSWS+KR YKNGFVW DL E+D I PAHG+EY+LKGSEL    +S + +P
Sbjct  71   ALRGRGMASMYSWSSKRSYKNGFVWHDLSEDDPILPAHGNEYVLKGSELFEESNSDRFSP  130

Query  620  A  618
             
Sbjct  131  V  131



>gb|KCW50706.1| hypothetical protein EUGRSUZ_J00387 [Eucalyptus grandis]
 gb|KCW50707.1| hypothetical protein EUGRSUZ_J00387 [Eucalyptus grandis]
Length=517

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 8/149 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+        R+V VVYYL  N +L+HPHF+E+ ++SP
Sbjct  1     MEARM-KKYRQ--VSPERAKVWTEKSPKYIQNRKVPVVYYLCRNRQLEHPHFIEVPVASP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMAS+YSWS+KR YKNGFVW DL E+D I P++G+EY+LKGS
Sbjct  58    EGLYLRDVIDRLNVLRGRGMASMYSWSSKRSYKNGFVWHDLCEDDLILPSNGNEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPP  573
             EL    +S + +P +     + +  P PP
Sbjct  118   ELFDESNSDRFSPVVNVGVRNLKQLPAPP  146



>gb|KHG01769.1| SCO-spondin [Gossypium arboreum]
Length=528

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 101/139 (73%), Gaps = 9/139 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER KVWT+         R+V VVYYL  N +L+HPHF+E+ LSS
Sbjct  6     METRM-KKYRQ--VSPERAKVWTEKSPKYYQHNRKVPVVYYLCRNRQLEHPHFIEVPLSS  62

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN+LRG GMASLYSWS KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  63    PDGLYLRDVIERLNNLRGRGMASLYSWSCKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  122

Query  662   SELIITHSSSQETPALTAA  606
             SEL    +S + +P   ++
Sbjct  123   SELFEESNSDRFSPVANSS  141



>emb|CDM84909.1| unnamed protein product [Triticum aestivum]
Length=378

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/245 (39%), Positives = 128/245 (52%), Gaps = 53/245 (22%)
 Frame = -3

Query  914  AVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNG  735
            AVVYYLS NG+L+HPHFME+ LSSP GL+LRDV+DRL++LRG+GMA +YSW++KR Y+NG
Sbjct  55   AVVYYLSRNGQLEHPHFMEVALSSPDGLYLRDVIDRLDALRGKGMARMYSWASKRSYRNG  114

Query  734  FVWQDLEENDFIYPAHGHEYILKGSELI--------------------------------  651
            FVW DL ++D+++P  G EY+LKG+E +                                
Sbjct  115  FVWHDLADDDYVHPVGGREYVLKGTERLHPPAIHLPLLDAAAASSCSSGSQDTTTSSSSG  174

Query  650  ITHSSSQETPALTAAGEDREF-----PPLPPPRHNVHAVEEDKESGRS------GSSEPS  504
              H+  +        GE  E+             +     ED   GRS         E S
Sbjct  175  WEHAQRKGVAGACGTGELGEYRVYKAEDRAAAAADAATQTEDGHRGRSRGHQRRAQEELS  234

Query  503  NGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCG  324
              E S P A +SPETL AL+KAD R            A      +R R +SV+MQ++SCG
Sbjct  235  REETSPPTASTSPETLEALIKADGR----------VLATVPGGGSRARASSVLMQLISCG  284

Query  323  SVAAR  309
            SV+ +
Sbjct  285  SVSVK  289



>ref|XP_008226595.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Prunus mume]
Length=550

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  11   VSPERAKVWTEKSPKYHQNRKVPVVYYLSRNRQLEHPHFMEVTVTSPQGLYLRDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            +LRG GMAS+YSWS+KR YKNGFVW DL E+D I PAHG+EY+LKGSEL    +S + +P
Sbjct  71   ALRGRGMASMYSWSSKRSYKNGFVWHDLSEDDPILPAHGNEYVLKGSELFEESNSDRFSP  130

Query  620  A  618
             
Sbjct  131  V  131



>gb|KDP43968.1| hypothetical protein JCGZ_05435 [Jatropha curcas]
Length=528

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 8/148 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-----PPERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+        R+V VVYYL  N +L+HPHF+E+ +SSP
Sbjct  1     MEARM-KKYRQ--VSPERAKVWTERSPKYQQNRKVPVVYYLCRNRQLEHPHFIEVPISSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+L+DV++RLN LRG GMAS+YSWS KR YKNGFVW DL E+D I PAHGHEY+LKGS
Sbjct  58    EGLYLKDVIERLNVLRGRGMASMYSWSCKRSYKNGFVWHDLCEDDLILPAHGHEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLP  576
             EL+   +S +  P  T   ++ +  P P
Sbjct  118   ELLEESNSDRLAPVGTLKLQNLKQLPEP  145



>gb|KEH38874.1| auxin-regulated protein [Medicago truncatula]
Length=508

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 96/128 (75%), Gaps = 6/128 (5%)
 Frame = -3

Query  989  AKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFL  825
             KK+R + +SPER+KVW + P      R+V VVYYL  N +L+HPHFME+ +SSP GLFL
Sbjct  5    VKKYRQQ-LSPERSKVWKEKPPKYYKNRKVPVVYYLCRNRQLEHPHFMEVPISSPDGLFL  63

Query  824  RDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIIT  645
            RDV+ +L++LRG GMA LYSWS KR YKNG+VW DL E+D I PAHG+EY+LKGSEL   
Sbjct  64   RDVIHKLDALRGRGMADLYSWSCKRSYKNGYVWHDLSEDDLILPAHGNEYVLKGSELFCE  123

Query  644  HSSSQETP  621
             +S + +P
Sbjct  124  SNSDRFSP  131



>ref|XP_002458734.1| hypothetical protein SORBIDRAFT_03g039280 [Sorghum bicolor]
 gb|EES03854.1| hypothetical protein SORBIDRAFT_03g039280 [Sorghum bicolor]
Length=410

 Score =   160 bits (406),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 136/254 (54%), Gaps = 63/254 (25%)
 Frame = -3

Query  911  VVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGF  732
            VVYYL+ NG L+HPHFME+ LS P GL+LRDV+DRL++LRG+GMA +YSW++KR Y+NGF
Sbjct  46   VVYYLARNGHLEHPHFMEVVLSCPDGLYLRDVIDRLDALRGKGMARMYSWASKRSYRNGF  105

Query  731  VWQDLEENDFIYPAHGHEYILKGSELI---------------ITHSSSQETP--------  621
            VW DL ++D+I+P  G EY+LKG+E +                + S SQ+TP        
Sbjct  106  VWHDLADDDYIHPVVGREYVLKGTERLHPVPPAALLDAAAASSSSSGSQDTPTSSSSARW  165

Query  620  ------------ALTAAG--EDREFPPLPPPRHNVHAVEEDKESGR--------------  525
                        A +A G  +  E+           A  + ++ GR              
Sbjct  166  EAHGRPAHRMKSATSACGTADLGEYVVYKGEEGAADAATQTEDGGRAHGHGHSQRRVVLA  225

Query  524  -SGSSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASV  348
             +   E S  E S P A +SPETL AL+KAD R V  ++            + R R +SV
Sbjct  226  PAAQEELSGAETSPPTASTSPETLEALIKADGRVVAAVS-----------GSGRARASSV  274

Query  347  VMQILSCGSVAARE  306
            +MQ++SCGSV+ R+
Sbjct  275  LMQLISCGSVSVRD  288



>gb|KFK27515.1| hypothetical protein AALP_AA8G393300 [Arabis alpina]
Length=418

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = -3

Query  971  KDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            +D SP+R  +W++P       R+V VVYYL  NG+L HPHF+E+ LSS  GL+L+DV++R
Sbjct  27   QDTSPDRNPIWSEPRHKPVVNRKVPVVYYLCRNGQLDHPHFIEVTLSSLDGLYLKDVINR  86

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            LN LRG+GMASLYSWS+KR YKNGFVWQDL E+DFI+P  G EY+LKGSE++
Sbjct  87   LNELRGKGMASLYSWSSKRSYKNGFVWQDLSEDDFIFPVQGQEYVLKGSEVV  138



>gb|AFW84642.1| hypothetical protein ZEAMMB73_096878 [Zea mays]
Length=350

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 144/270 (53%), Gaps = 55/270 (20%)
 Frame = -3

Query  986  KKWRDKD-ISPERTK---VWTQP-PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
            ++WR+++  SPE        T P P R  AVVYYL+ NG L+HPHFME+ LS P GL LR
Sbjct  17   RQWREQEPRSPEMAAPPPRSTMPRPARAAAVVYYLARNGHLEHPHFMEVALSCPDGLHLR  76

Query  821  DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI---  651
            DV+DRL++LRG+GMA +YSW++KR Y+NGFVW DL E+D+I+P    EY+LKG+E +   
Sbjct  77   DVMDRLDALRGKGMARMYSWASKRSYRNGFVWHDLAEDDYIHPVVAREYVLKGTERLHPA  136

Query  650  ---------ITHSSSQETPALTAA---------------GED--REFPPLPPPRHNVHAV  549
                      + + SQETP  +++               G D                A 
Sbjct  137  LLDAAAASSSSSAGSQETPTTSSSARWEAHRMTMKGACGGADLGEYVAAYMGEERGADAA  196

Query  548  EEDKESGR---------SGSSEPSNGEISTPPAGSSPETLAALMKADRRRVILMNEARKA  396
             + ++ GR         +   E S  E S P A +SPE LA   KAD R V+    +   
Sbjct  197  TQTEDDGRGRQRRVQSPAAQEELSRAETSPPTASTSPEALA---KADGRAVLEGAVS---  250

Query  395  AAYYDPSAARPRTASVVMQILSCGSVAARE  306
                   + R R +SV+MQ++SCGSV+ R+
Sbjct  251  ------GSGRARASSVLMQLISCGSVSVRD  274



>gb|AES88533.2| auxin-regulated protein [Medicago truncatula]
Length=514

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SP+R KVWT+   +     +V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEGRM-KKYRQ--VSPDRAKVWTEKAPKYQHNLKVPVIYYLCRNRQLEHPHFMEVPLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+D+LN+LRG GMASLYSWS+KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  58    DGLYLRDVIDKLNALRGRGMASLYSWSSKRSYKNGFVWHDLCEDDLIQPAHGNEYVLKGS  117

Query  659   ELIITHSSSQETP  621
             EL    +S + +P
Sbjct  118   ELFDESNSDRFSP  130



>ref|XP_006400915.1| hypothetical protein EUTSA_v10013653mg [Eutrema salsugineum]
 gb|ESQ42368.1| hypothetical protein EUTSA_v10013653mg [Eutrema salsugineum]
Length=422

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = -3

Query  971  KDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            +D SP+R ++W++P       R+V VVYYL  NG+L HPHFME+ LSS  GL+L+DV++R
Sbjct  24   QDTSPDRNRIWSEPRHKPVGNRKVPVVYYLCRNGQLDHPHFMEVTLSSHDGLYLKDVINR  83

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            LN LRG+GMA+LYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  84   LNDLRGKGMANLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  135



>ref|XP_010543043.1| PREDICTED: protein UPSTREAM OF FLC-like, partial [Tarenaya hassleriana]
Length=458

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 97/124 (78%), Gaps = 8/124 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVW------TQPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK++ + +SPER KVW       Q   ++VAVVYYLS N +L+HPHFME+ LSS
Sbjct  1     MEGRM-KKYKQQ-VSPERAKVWREKSPKYQQKIKKVAVVYYLSRNRQLEHPHFMEVPLSS  58

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  59    PDGLYLRDVIERLNVLRGRGMASVYSWSSKRNYRNGFVWHDLSEDDLILPAHGNEYVLKG  118

Query  662   SELI  651
             SEL+
Sbjct  119   SELL  122



>ref|XP_003606336.1| Auxin-regulated protein [Medicago truncatula]
Length=530

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SP+R KVWT+   +     +V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     MEGRM-KKYRQ--VSPDRAKVWTEKAPKYQHNLKVPVIYYLCRNRQLEHPHFMEVPLSSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+D+LN+LRG GMASLYSWS+KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  58    DGLYLRDVIDKLNALRGRGMASLYSWSSKRSYKNGFVWHDLCEDDLIQPAHGNEYVLKGS  117

Query  659   ELIITHSSSQETP  621
             EL    +S + +P
Sbjct  118   ELFDESNSDRFSP  130



>ref|XP_002274821.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Vitis vinifera]
 emb|CAN64540.1| hypothetical protein VITISV_009523 [Vitis vinifera]
Length=536

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 95/127 (75%), Gaps = 8/127 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+        R+V VVYYL  N +L+HPHF+E+ LSS 
Sbjct  1     MEARM-KKYRQ--VSPERAKVWTEKSPRYQQSRKVPVVYYLCRNRQLEHPHFIEVPLSST  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMAS+YSWS KR YKNGFVW D+ E+D I PAHG+EY+LKGS
Sbjct  58    EGLYLRDVIDRLNVLRGRGMASMYSWSCKRSYKNGFVWHDISEDDIILPAHGNEYVLKGS  117

Query  659   ELIITHS  639
             EL  ++S
Sbjct  118   ELFESNS  124



>ref|XP_002864651.1| hypothetical protein ARALYDRAFT_496114 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40910.1| hypothetical protein ARALYDRAFT_496114 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = -3

Query  971  KDISPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            +D SP+R ++W++P       R+V VVYYL  NG+L HPHFME+ LSS  GL+L+DV++R
Sbjct  24   QDSSPDRNRIWSEPRHKPVVNRKVPVVYYLCRNGQLDHPHFMEVTLSSHDGLYLKDVINR  83

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            LN LRG+GMASLYSWS+KR YKNGFVW DL E+DFI+P  G EY+LKGSE++
Sbjct  84   LNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIFPVQGQEYVLKGSEVL  135



>ref|XP_008674847.1| PREDICTED: protein UPSTREAM OF FLC-like [Zea mays]
 tpg|DAA56922.1| TPA: hypothetical protein ZEAMMB73_287444 [Zea mays]
Length=418

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/255 (38%), Positives = 136/255 (53%), Gaps = 64/255 (25%)
 Frame = -3

Query  911  VVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGF  732
            VVYYL+ NG L+HPHFME+ LS P GL+LRDV+DRL++LRG+GMA +YSW++KR Y+NGF
Sbjct  45   VVYYLARNGHLEHPHFMEVALSCPDGLYLRDVIDRLDALRGKGMARVYSWASKRSYRNGF  104

Query  731  VWQDLEENDFIYPAHGHEYILKGSELI---------------ITHSSSQETPALT-----  612
            VW DL ++D+I+P  G EY+LKG+E +                + S SQETP  +     
Sbjct  105  VWHDLADDDYIHPVVGREYVLKGTERLHPVPPPALLDAAAASSSSSGSQETPTSSSSAGW  164

Query  611  ------------------AAGEDREFPPLPPPRHNVHAVEEDKESGR-------------  525
                              A  E  E+           A  + ++ GR             
Sbjct  165  EARGRTAHRMKSASACGAADAELGEYVAYKGEERAADAATQTEDGGRGHGHSHSQRRVLA  224

Query  524  -SGSSEPSNGEISTPP-AGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTAS  351
             +   E S  E ++PP A +SPETL AL++AD R V  ++            + R R +S
Sbjct  225  PAAQEELSRAETTSPPTASTSPETLEALIRADGRVVAAVS-----------GSGRARASS  273

Query  350  VVMQILSCGSVAARE  306
            V+MQ++SCGSV+ R+
Sbjct  274  VLMQLISCGSVSVRD  288



>ref|XP_006424453.1| hypothetical protein CICLE_v10028190mg [Citrus clementina]
 ref|XP_006424454.1| hypothetical protein CICLE_v10028190mg [Citrus clementina]
 gb|ESR37693.1| hypothetical protein CICLE_v10028190mg [Citrus clementina]
 gb|ESR37694.1| hypothetical protein CICLE_v10028190mg [Citrus clementina]
Length=527

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 98/138 (71%), Gaps = 9/138 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER KVWT+         R+V VVYY+  N +L+HPHF+E+ LSS
Sbjct  1     METRM-KKYRQ--VSPERAKVWTEKSPKYHQLTRKVPVVYYICRNRQLEHPHFIEVPLSS  57

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV+DRLN LRG GMAS+YSWS KR YKNGFVW DL E+D I PAHG EY+LKG
Sbjct  58    RDGLYLRDVIDRLNVLRGRGMASMYSWSCKRSYKNGFVWHDLCEDDLILPAHGDEYVLKG  117

Query  662   SELIITHSSSQETPALTA  609
             SEL    +S + +P +T 
Sbjct  118   SELFDESNSGRFSPGVTT  135



>gb|KDO60276.1| hypothetical protein CISIN_1g009456mg [Citrus sinensis]
 gb|KDO60277.1| hypothetical protein CISIN_1g009456mg [Citrus sinensis]
 gb|KDO60278.1| hypothetical protein CISIN_1g009456mg [Citrus sinensis]
Length=534

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 98/138 (71%), Gaps = 9/138 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER KVWT+         R+V VVYY+  N +L+HPHF+E+ LSS
Sbjct  1     METRM-KKYRQ--VSPERAKVWTEKSPKYHQLTRKVPVVYYICRNRQLEHPHFIEVPLSS  57

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV+DRLN LRG GMAS+YSWS KR YKNGFVW DL E+D I PAHG EY+LKG
Sbjct  58    RDGLYLRDVIDRLNVLRGRGMASMYSWSCKRSYKNGFVWHDLCEDDLILPAHGDEYVLKG  117

Query  662   SELIITHSSSQETPALTA  609
             SEL    +S + +P +T 
Sbjct  118   SELFDESNSGRFSPGVTT  135



>ref|XP_007149422.1| hypothetical protein PHAVU_005G069000g [Phaseolus vulgaris]
 gb|ESW21416.1| hypothetical protein PHAVU_005G069000g [Phaseolus vulgaris]
Length=523

 Score =   160 bits (406),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 7/134 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----RVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M K  R   +SPER KVWT+   +     +V V+YYL  N +L+HPHFME+ LSSP
Sbjct  1     METRMKKYNRQ--VSPERAKVWTEKSPKYHQSLKVPVIYYLCRNRQLEHPHFMEVPLSSP  58

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV+DRLN LRG GMASLYSWS KR YK+GFVW DL E+D I PAHG+EY+LKGS
Sbjct  59    DGLYLRDVIDRLNVLRGRGMASLYSWSCKRSYKHGFVWHDLCEDDIILPAHGNEYVLKGS  118

Query  659   ELIITHSSSQETPA  618
             EL    +S + +P 
Sbjct  119   ELFDESNSDRFSPV  132



>ref|XP_011028262.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Populus euphratica]
Length=547

 Score =   160 bits (406),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 94/124 (76%), Gaps = 7/124 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME    KK+ ++ +SP+R KVWT      Q   R+VAVVYYL  N +L+HPHF+E+ LSS
Sbjct  1     METTRMKKY-NRQLSPDRAKVWTERSPKYQQQNRKVAVVYYLCRNRQLEHPHFIEVPLSS  59

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV+ RL+ LRG GMASLYSWS+KR YKNGFVW DL E+D I PAHG+EY+LKG
Sbjct  60    PDGLYLRDVIGRLDVLRGRGMASLYSWSSKRSYKNGFVWHDLCEDDLILPAHGNEYVLKG  119

Query  662   SELI  651
             SEL 
Sbjct  120   SELF  123



>ref|XP_006488005.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Citrus sinensis]
 ref|XP_006488006.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Citrus sinensis]
Length=549

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER KVWT+         R+V VVYY+  N +L+HPHF+E+ LSS
Sbjct  1     METRM-KKYRQ--VSPERAKVWTEKSPKYHQLTRKVPVVYYICRNRQLEHPHFIEVLLSS  57

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMAS+YSWS KR YKNGFVW DL E+D I PAHG EY+LKG
Sbjct  58    RDGLYLRDVIERLNVLRGRGMASMYSWSCKRSYKNGFVWHDLCEDDLILPAHGDEYVLKG  117

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S + +P +T   +     P P P
Sbjct  118   SELFDESNSGRFSPGVTTKIQCLRQLPAPEP  148



>ref|XP_011028264.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X3 [Populus euphratica]
Length=524

 Score =   160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 94/124 (76%), Gaps = 7/124 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME    KK+ ++ +SP+R KVWT      Q   R+VAVVYYL  N +L+HPHF+E+ LSS
Sbjct  1     METTRMKKY-NRQLSPDRAKVWTERSPKYQQQNRKVAVVYYLCRNRQLEHPHFIEVPLSS  59

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             P GL+LRDV+ RL+ LRG GMASLYSWS+KR YKNGFVW DL E+D I PAHG+EY+LKG
Sbjct  60    PDGLYLRDVIGRLDVLRGRGMASLYSWSSKRSYKNGFVWHDLCEDDLILPAHGNEYVLKG  119

Query  662   SELI  651
             SEL 
Sbjct  120   SELF  123



>ref|XP_010689153.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=535

 Score =   160 bits (404),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 121/195 (62%), Gaps = 13/195 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-----PPERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R+  +SPER KVW +        R+V VVYYL  N +L+HPHF+E+ + SP
Sbjct  1     MEGRM-KKYRE--VSPERAKVWKERSPKYVQNRKVPVVYYLCRNRQLEHPHFIEVPICSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN+LRG GMAS+YSWS+KR YK+GFVW DL E+D I PAHG EYILKGS
Sbjct  58    EGLYLRDVIERLNNLRGRGMASMYSWSSKRSYKSGFVWHDLCEDDLILPAHGDEYILKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGSSEPSNGEISTPP  480
             E+I   +S + +P       + +  P PP   +         +    +  P   E+STP 
Sbjct  118   EIIEDSNSGRFSPVAVYRMHNLKQLPEPPTSRSEEDTSPSMSTDEKETKLPREDEMSTPS  177

Query  479   --AGS---SPETLAA  450
               +GS   SPE+ A 
Sbjct  178   QRSGSSAVSPESRAG  192



>ref|XP_006488007.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X3 [Citrus sinensis]
Length=527

 Score =   160 bits (404),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 102/151 (68%), Gaps = 9/151 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER KVWT+         R+V VVYY+  N +L+HPHF+E+ LSS
Sbjct  1     METRM-KKYRQ--VSPERAKVWTEKSPKYHQLTRKVPVVYYICRNRQLEHPHFIEVLLSS  57

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMAS+YSWS KR YKNGFVW DL E+D I PAHG EY+LKG
Sbjct  58    RDGLYLRDVIERLNVLRGRGMASMYSWSCKRSYKNGFVWHDLCEDDLILPAHGDEYVLKG  117

Query  662   SELIITHSSSQETPALTAAGEDREFPPLPPP  570
             SEL    +S + +P +T   +     P P P
Sbjct  118   SELFDESNSGRFSPGVTTKIQCLRQLPAPEP  148



>ref|XP_010689155.1| PREDICTED: protein UPSTREAM OF FLC isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=521

 Score =   159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 121/195 (62%), Gaps = 13/195 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-----PPERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R+  +SPER KVW +        R+V VVYYL  N +L+HPHF+E+ + SP
Sbjct  1     MEGRM-KKYRE--VSPERAKVWKERSPKYVQNRKVPVVYYLCRNRQLEHPHFIEVPICSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN+LRG GMAS+YSWS+KR YK+GFVW DL E+D I PAHG EYILKGS
Sbjct  58    EGLYLRDVIERLNNLRGRGMASMYSWSSKRSYKSGFVWHDLCEDDLILPAHGDEYILKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGSSEPSNGEISTPP  480
             E+I   +S + +P       + +  P PP   +         +    +  P   E+STP 
Sbjct  118   EIIEDSNSGRFSPVAVYRMHNLKQLPEPPTSRSEEDTSPSMSTDEKETKLPREDEMSTPS  177

Query  479   --AGS---SPETLAA  450
               +GS   SPE+ A 
Sbjct  178   QRSGSSAVSPESRAG  192



>ref|XP_008465413.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Cucumis melo]
Length=521

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 97/131 (74%), Gaps = 8/131 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE----RRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME+ M K      +SPER KVWT+  P+    R+V V+YYL  N +L+HPHFME+ LSS 
Sbjct  1     MEMRMKKY---NQLSPERAKVWTEKSPKYLQVRKVPVIYYLCRNRQLEHPHFMEVPLSSS  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN LRG GMA+LYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  58    EGLYLRDVINRLNVLRGRGMATLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  117

Query  659   ELIITHSSSQE  627
             EL    +SS++
Sbjct  118   ELFEESTSSKD  128



>ref|XP_009356938.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 5/120 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  11   VSPERAKVWTEKSPKYHQNRKVPVVYYLSRNRQLEHPHFMEVTVTSPQGLYLRDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            +LRG GMAS+YSWS+KR YK G+VW DL E+D I PAHG+EY+LKGSEL    +S + +P
Sbjct  71   ALRGRGMASMYSWSSKRSYKGGYVWHDLSEDDLIPPAHGNEYVLKGSELFEESNSGRFSP  130



>ref|XP_002523717.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38657.1| conserved hypothetical protein [Ricinus communis]
Length=525

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 105/152 (69%), Gaps = 11/152 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R + +SPER KVWT      Q   R+VAVVYYL  N +L+HPHF+E+ LSS
Sbjct  1     MEARM-KKYRQQ-VSPERAKVWTERSPKYQQKNRKVAVVYYLCRNRQLEHPHFIEVPLSS  58

Query  842   PR-GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILK  666
              + GL+L+DV++RLN LRG GMAS+YSWS KR YKNGFVW DL E+D I PAHG+EY+LK
Sbjct  59    QQDGLYLKDVIERLNVLRGRGMASMYSWSCKRSYKNGFVWHDLSEDDLILPAHGNEYVLK  118

Query  665   GSELIITHSSSQETPALTAAGEDREFPPLPPP  570
             GSEL    +S +  P  T   ++     LP P
Sbjct  119   GSELFDESNSDRFGPVGTIKMQN--LKQLPEP  148



>ref|XP_008465404.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
 ref|XP_008465405.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
 ref|XP_008465406.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
 ref|XP_008465407.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
 ref|XP_008465408.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
 ref|XP_008465409.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
 ref|XP_008465410.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
 ref|XP_008465411.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
 ref|XP_008465412.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Cucumis melo]
Length=544

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 97/131 (74%), Gaps = 8/131 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE----RRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME+ M K      +SPER KVWT+  P+    R+V V+YYL  N +L+HPHFME+ LSS 
Sbjct  1     MEMRMKKY---NQLSPERAKVWTEKSPKYLQVRKVPVIYYLCRNRQLEHPHFMEVPLSSS  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN LRG GMA+LYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  58    EGLYLRDVINRLNVLRGRGMATLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  117

Query  659   ELIITHSSSQE  627
             EL    +SS++
Sbjct  118   ELFEESTSSKD  128



>ref|XP_009796780.1| PREDICTED: protein UPSTREAM OF FLC-like [Nicotiana sylvestris]
Length=297

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 142/267 (53%), Gaps = 40/267 (15%)
 Frame = -3

Query  1001  ELHMAKKWRDKDI-SPERTKVWTQPPER---RVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
             EL + KKW  ++I SPER  +W +P  +    V V+YYL  NG+L+HPHF+E+  SS  G
Sbjct  14    ELLIPKKWNHREITSPERNMIWIEPKPKAFKTVPVIYYLCRNGQLEHPHFIEVPFSSSDG  73

Query  833   LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
             L+L DVL+RLN LRG+GMA L+SWS KR YKNG+VW DL EN+ I+P +GH+Y+LKGSEL
Sbjct  74    LYLPDVLNRLNLLRGKGMAYLFSWSCKRSYKNGYVWHDLSENELIHPTNGHDYVLKGSEL  133

Query  653   IITHSSSQ--ETPALTAAGEDRE---------------FPPLPPPRHN---VHAVEEDKE  534
             + T  SS+  E      + E+R+               +     PR     V+  E  +E
Sbjct  134   LETSMSSRFCEISRSDHSDENRDSSSSTTAIMRRRNQSWSSFENPRQEYSVVYKCESGRE  193

Query  533   -SGRSGSSEPSNGEISTPPAGS-----------SPETLAALMKADRRRVILMNEARKA--  396
              +G+  SSE +  + +T                S E L+  +  D    I      K   
Sbjct  194   IAGKFNSSEAAAADAATQTEEKRREQENKSVELSREELSPPLSMDSSDGIEGGSGSKGVD  253

Query  395   --AAYYDPSAARPRTASVVMQILSCGS  321
               A     S  R R + VVMQ+++CGS
Sbjct  254   QTAENEFSSGGRMRASRVVMQLITCGS  280



>ref|XP_010689154.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=528

 Score =   159 bits (402),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 121/195 (62%), Gaps = 13/195 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-----PPERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R+  +SPER KVW +        R+V VVYYL  N +L+HPHF+E+ + SP
Sbjct  1     MEGRM-KKYRE--VSPERAKVWKERSPKYVQNRKVPVVYYLCRNRQLEHPHFIEVPICSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN+LRG GMAS+YSWS+KR YK+GFVW DL E+D I PAHG EYILKGS
Sbjct  58    EGLYLRDVIERLNNLRGRGMASMYSWSSKRSYKSGFVWHDLCEDDLILPAHGDEYILKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGSSEPSNGEISTPP  480
             E+I   +S + +P       + +  P PP   +         +    +  P   E+STP 
Sbjct  118   EIIEDSNSGRFSPVAVYRMHNLKQLPEPPTSRSEEDTSPSMSTDEKETKLPREDEMSTPS  177

Query  479   --AGS---SPETLAA  450
               +GS   SPE+ A 
Sbjct  178   QRSGSSAVSPESRAG  192



>ref|XP_007016883.1| Domain of Uncharacterized protein function isoform 3 [Theobroma 
cacao]
 gb|EOY34502.1| Domain of Uncharacterized protein function isoform 3 [Theobroma 
cacao]
Length=555

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 9/135 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER K+WT+         R+V VVYYL  N +L+HPHF+E+ LSS
Sbjct  6     METRM-KKYRQ--VSPERAKIWTEKSPKYYQHNRKVPVVYYLCRNRQLEHPHFIEVPLSS  62

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMASLYSWS KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  63    RDGLYLRDVIERLNILRGRGMASLYSWSCKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  122

Query  662   SELIITHSSSQETPA  618
             SEL    SS + +P 
Sbjct  123   SELFEESSSDRFSPV  137



>ref|XP_007016884.1| Domain of Uncharacterized protein function isoform 4 [Theobroma 
cacao]
 gb|EOY34503.1| Domain of Uncharacterized protein function isoform 4 [Theobroma 
cacao]
Length=555

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 9/135 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER K+WT+         R+V VVYYL  N +L+HPHF+E+ LSS
Sbjct  6     METRM-KKYRQ--VSPERAKIWTEKSPKYYQHNRKVPVVYYLCRNRQLEHPHFIEVPLSS  62

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMASLYSWS KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  63    RDGLYLRDVIERLNILRGRGMASLYSWSCKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  122

Query  662   SELIITHSSSQETPA  618
             SEL    SS + +P 
Sbjct  123   SELFEESSSDRFSPV  137



>ref|XP_009604697.1| PREDICTED: uncharacterized protein LOC104099418 [Nicotiana tomentosiformis]
Length=294

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 139/272 (51%), Gaps = 53/272 (19%)
 Frame = -3

Query  1001  ELHMAKKWRDKDI-SPERTKVWTQP-PE--RRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
             EL + KKW  ++I SPER  +W +P P+  + V V+YYL  NG+L+HPHF+E+  SS  G
Sbjct  14    ELLIPKKWNHREINSPERNMIWIEPKPKAFKTVPVIYYLCRNGQLEHPHFIEVPFSSSDG  73

Query  833   LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
             L+L DVL+RLN LRG+GMA L+SWS KR YKNG+VW DL EN+ I+P +GH+Y+LKGSEL
Sbjct  74    LYLIDVLNRLNLLRGKGMAYLFSWSCKRSYKNGYVWHDLSENELIHPTNGHDYVLKGSEL  133

Query  653   IITHSSSQ--ETPALTAAGEDRE---------------FPPLPPPRHNVHAV--------  549
             + T  SS+  E      + E+R+               +     PR     V        
Sbjct  134   LETSMSSRFCEISRSDHSDENRDSSSSTTAIMRRRNQSWSSFENPRQEYSVVYKCESGLE  193

Query  548   ----------------EEDKESGRSGSSEPSNGEISTPPAGSSPETLAALMKADRRRVIL  417
                             EE +    + S E S  E+S P +  S + +     +    +  
Sbjct  194   IAGKFNSSAADAATQTEEKRREQENKSVELSREELSPPLSMDSSDGIDGGSGSKDVDLTA  253

Query  416   MNEARKAAAYYDPSAARPRTASVVMQILSCGS  321
              NE             R R + VVMQ+++CGS
Sbjct  254   ENEF--------SGGGRMRASRVVMQLITCGS  277



>gb|KGN46878.1| hypothetical protein Csa_6G148200 [Cucumis sativus]
Length=527

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 99/131 (76%), Gaps = 8/131 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE----RRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME+ M KK+    +SPER KVWT+  P+    R+V V+YYL  N +L+HPHFME+ LSS 
Sbjct  1     MEMRM-KKY--NQLSPERAKVWTEKSPKYQQVRKVPVIYYLCRNRQLEHPHFMEVPLSSS  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN LRG GMA+LYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  58    EGLYLRDVINRLNVLRGRGMATLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  117

Query  659   ELIITHSSSQE  627
             EL    ++S++
Sbjct  118   ELFEESTTSKD  128



>ref|XP_006589751.1| PREDICTED: protein UPSTREAM OF FLC-like [Glycine max]
Length=267

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = -3

Query  974  DKDISPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRG-LFLRDVLD  810
            +++ S E TK+W +P     E +V V+YYLS NG+L+HPH ME+ +SS +G L L+DV+D
Sbjct  3    EREASLESTKIWIEPKHQATEVKVPVIYYLSRNGQLEHPHLMEVPISSLQGVLCLKDVID  62

Query  809  RLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            RL+ LRG+GMA++YSWSAKR YKNG+VWQDL ENDFIYP+ GHEY+LKG+++I
Sbjct  63   RLSFLRGQGMANMYSWSAKRSYKNGYVWQDLSENDFIYPSSGHEYVLKGTQMI  115



>gb|KDP43970.1| hypothetical protein JCGZ_05437 [Jatropha curcas]
Length=443

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 8/148 (5%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-----PPERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+        R+V VVYYL  N +L+HPHF+E+ +SSP
Sbjct  1     MEARM-KKYRQ--VSPERAKVWTERSPKYQQNRKVPVVYYLCRNRQLEHPHFIEVPISSP  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+L+DV++RLN LRG GMAS+YSWS KR YKNG VW DL E+D + PAHGHEY+LKGS
Sbjct  58    EGLYLKDVIERLNVLRGRGMASMYSWSCKRSYKNGVVWHDLCEDDLVLPAHGHEYVLKGS  117

Query  659   ELIITHSSSQETPALTAAGEDREFPPLP  576
             EL+   +S +  P  T   ++ +  P P
Sbjct  118   ELLEESNSDRLAPVGTLKLQNLKQLPEP  145



>ref|XP_008359674.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Malus domestica]
Length=544

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 5/121 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+L+DV++RLN
Sbjct  11   VSPERAKVWTEKSXKYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLKDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            SLRG GMAS+YSWS+KR YK G+VW DL E D I PAHG+EY+LKGSEL    +S + +P
Sbjct  71   SLRGRGMASMYSWSSKRNYKGGYVWHDLSEGDLIPPAHGNEYVLKGSELFDESNSDRFSP  130

Query  620  A  618
             
Sbjct  131  V  131



>ref|XP_008359681.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Malus domestica]
Length=521

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 5/121 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+L+DV++RLN
Sbjct  11   VSPERAKVWTEKSXKYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLKDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            SLRG GMAS+YSWS+KR YK G+VW DL E D I PAHG+EY+LKGSEL    +S + +P
Sbjct  71   SLRGRGMASMYSWSSKRNYKGGYVWHDLSEGDLIPPAHGNEYVLKGSELFDESNSDRFSP  130

Query  620  A  618
             
Sbjct  131  V  131



>ref|XP_007016886.1| Domain of Uncharacterized protein function isoform 6 [Theobroma 
cacao]
 gb|EOY34505.1| Domain of Uncharacterized protein function isoform 6 [Theobroma 
cacao]
Length=533

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 9/135 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER K+WT+         R+V VVYYL  N +L+HPHF+E+ LSS
Sbjct  6     METRM-KKYRQ--VSPERAKIWTEKSPKYYQHNRKVPVVYYLCRNRQLEHPHFIEVPLSS  62

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMASLYSWS KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  63    RDGLYLRDVIERLNILRGRGMASLYSWSCKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  122

Query  662   SELIITHSSSQETPA  618
             SEL    SS + +P 
Sbjct  123   SELFEESSSDRFSPV  137



>ref|XP_009759415.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Nicotiana sylvestris]
 ref|XP_009759416.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Nicotiana sylvestris]
 ref|XP_009759417.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Nicotiana sylvestris]
Length=546

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 14/140 (10%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----------RVAVVYYLSLNGKLQHPHFME  858
             M+ HM KK+R   +SPER KVWT+   +           +V VVYYL  N +L+HPHF+E
Sbjct  1     MDGHM-KKYRQ--LSPERAKVWTEKSPKYQQQKPRLSNGKVPVVYYLCRNRQLEHPHFIE  57

Query  857   LRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHE  678
             + LSSP GL+LRDV++RLN LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG+E
Sbjct  58    VPLSSPEGLYLRDVIERLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNE  117

Query  677   YILKGSELIITHSSSQETPA  618
             Y+LKGSEL    ++   +PA
Sbjct  118   YVLKGSELFDESNAGCFSPA  137



>ref|XP_009356937.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Pyrus x bretschneideri]
Length=549

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 5/110 (5%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  11   VSPERAKVWTEKSPKYHQNRKVPVVYYLSRNRQLEHPHFMEVTVTSPQGLYLRDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +LRG GMAS+YSWS+KR YK G+VW DL E+D I PAHG+EY+LKGSEL 
Sbjct  71   ALRGRGMASMYSWSSKRSYKGGYVWHDLSEDDLIPPAHGNEYVLKGSELF  120



>ref|XP_007016887.1| Domain of Uncharacterized protein function isoform 7 [Theobroma 
cacao]
 ref|XP_007016888.1| Domain of Uncharacterized protein function isoform 7 [Theobroma 
cacao]
 gb|EOY34506.1| Domain of Uncharacterized protein function isoform 7 [Theobroma 
cacao]
 gb|EOY34507.1| Domain of Uncharacterized protein function isoform 7 [Theobroma 
cacao]
Length=442

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 9/135 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER K+WT+         R+V VVYYL  N +L+HPHF+E+ LSS
Sbjct  6     METRM-KKYRQ--VSPERAKIWTEKSPKYYQHNRKVPVVYYLCRNRQLEHPHFIEVPLSS  62

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMASLYSWS KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  63    RDGLYLRDVIERLNILRGRGMASLYSWSCKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  122

Query  662   SELIITHSSSQETPA  618
             SEL    SS + +P 
Sbjct  123   SELFEESSSDRFSPV  137



>ref|XP_009335982.1| PREDICTED: protein UPSTREAM OF FLC-like [Pyrus x bretschneideri]
Length=544

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 5/121 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+L+DV++RLN
Sbjct  11   VSPERAKVWTEKSPKYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLKDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            SLRG GMAS+YSWS+KR YK G+VW DL E D I PAHG+EY+LKGSEL    +S + +P
Sbjct  71   SLRGRGMASMYSWSSKRNYKGGYVWHDLSEGDLIPPAHGNEYVLKGSELFDESNSDRFSP  130

Query  620  A  618
             
Sbjct  131  V  131



>ref|XP_007016882.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
 gb|EOY34501.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
Length=540

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 9/135 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER K+WT+         R+V VVYYL  N +L+HPHF+E+ LSS
Sbjct  6     METRM-KKYRQ--VSPERAKIWTEKSPKYYQHNRKVPVVYYLCRNRQLEHPHFIEVPLSS  62

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMASLYSWS KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  63    RDGLYLRDVIERLNILRGRGMASLYSWSCKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  122

Query  662   SELIITHSSSQETPA  618
             SEL    SS + +P 
Sbjct  123   SELFEESSSDRFSPV  137



>ref|XP_003555186.1| PREDICTED: protein UPSTREAM OF FLC-like [Glycine max]
 gb|KHN23146.1| hypothetical protein glysoja_030206 [Glycine soja]
Length=268

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 91/113 (81%), Gaps = 5/113 (4%)
 Frame = -3

Query  974  DKDISPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSP-RGLFLRDVLD  810
            +++ S E +K+W +P     E +V V+YYLS NG+L+HPH ME+ +SSP R L L+DV+D
Sbjct  3    EREASLESSKIWIEPKHQATEVKVPVIYYLSRNGQLEHPHLMEVPISSPQRVLCLKDVID  62

Query  809  RLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            RL+ LRG+GMA++YSWS KR YKNGFVWQDL ENDFIYP+ GHEY+LKG+++I
Sbjct  63   RLSFLRGQGMANMYSWSTKRSYKNGFVWQDLSENDFIYPSSGHEYVLKGTQMI  115



>ref|XP_007016885.1| Domain of Uncharacterized protein function isoform 5 [Theobroma 
cacao]
 gb|EOY34504.1| Domain of Uncharacterized protein function isoform 5 [Theobroma 
cacao]
Length=524

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 9/135 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER K+WT+         R+V VVYYL  N +L+HPHF+E+ LSS
Sbjct  6     METRM-KKYRQ--VSPERAKIWTEKSPKYYQHNRKVPVVYYLCRNRQLEHPHFIEVPLSS  62

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMASLYSWS KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  63    RDGLYLRDVIERLNILRGRGMASLYSWSCKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  122

Query  662   SELIITHSSSQETPA  618
             SEL    SS + +P 
Sbjct  123   SELFEESSSDRFSPV  137



>ref|XP_009759418.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Nicotiana sylvestris]
Length=525

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 14/140 (10%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----------RVAVVYYLSLNGKLQHPHFME  858
             M+ HM KK+R   +SPER KVWT+   +           +V VVYYL  N +L+HPHF+E
Sbjct  1     MDGHM-KKYRQ--LSPERAKVWTEKSPKYQQQKPRLSNGKVPVVYYLCRNRQLEHPHFIE  57

Query  857   LRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHE  678
             + LSSP GL+LRDV++RLN LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG+E
Sbjct  58    VPLSSPEGLYLRDVIERLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNE  117

Query  677   YILKGSELIITHSSSQETPA  618
             Y+LKGSEL    ++   +PA
Sbjct  118   YVLKGSELFDESNAGCFSPA  137



>ref|XP_008788149.1| PREDICTED: protein UPSTREAM OF FLC-like [Phoenix dactylifera]
Length=331

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 150/283 (53%), Gaps = 58/283 (20%)
 Frame = -3

Query  953  RTKVWTQ---PPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEG  783
            ++++W Q     ER+ +VVYYLS +G+L+HPHF+E+ LSS  GL+LRDV++RL  LRG+ 
Sbjct  8    KSELWGQERRTAERKASVVYYLSRDGQLEHPHFLEVPLSSTEGLYLRDVINRLCVLRGKE  67

Query  782  MASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSS----------  633
            MA++YSWS++R+YKNGFVW DL E DF+YP H  EYILKGSEL    +SS          
Sbjct  68   MAAMYSWSSRRRYKNGFVWFDLCEEDFVYPIHDQEYILKGSELFHLGNSSPTSEKPPEIS  127

Query  632  -------------------------------QETPALTAAGEDREFPPLPPPRHNVHA-V  549
                                            E   +TA             RH   A +
Sbjct  128  NFVRDVSDIPVSRRKMTSWDSFDLNESTAYKSEPTGVTAVKFSDASTQTDGLRHGRRAPI  187

Query  548  EEDKESGRSGSSEPS---NGEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDP  378
             ED+++  + + EP+     EIS PP+ SSPETL A++KAD R V +  E R        
Sbjct  188  GEDRQA-ETANPEPTELGTDEISPPPSPSSPETLVAVIKADGRIVAIRPEDRSHRTVGAC  246

Query  377  SAARPRTASVVMQILSCGSVAAREHAPPCKAKTHAFSLISHHK  249
               R R ++V+M ++SCGS++ +E            SL+S ++
Sbjct  247  PKGRARASAVLMHLISCGSISVKE---------QGISLVSQYR  280



>ref|XP_007016881.1| Domain of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
 gb|EOY34500.1| Domain of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
Length=591

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 9/135 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER K+WT+         R+V VVYYL  N +L+HPHF+E+ LSS
Sbjct  6     METRM-KKYRQ--VSPERAKIWTEKSPKYYQHNRKVPVVYYLCRNRQLEHPHFIEVPLSS  62

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV++RLN LRG GMASLYSWS KR Y+NGFVW DL E+D I PAHG+EY+LKG
Sbjct  63    RDGLYLRDVIERLNILRGRGMASLYSWSCKRSYRNGFVWHDLSEDDLILPAHGNEYVLKG  122

Query  662   SELIITHSSSQETPA  618
             SEL    SS + +P 
Sbjct  123   SELFEESSSDRFSPV  137



>ref|XP_004166308.1| PREDICTED: uncharacterized protein LOC101230215 [Cucumis sativus]
Length=518

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 8/123 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE----RRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME+ M KK+    +SPER KVWT+  P+    R+V V+YYL  N +L+HPHFME+ LSS 
Sbjct  1     MEMRM-KKY--NQLSPERAKVWTEKSPKYQQVRKVPVIYYLCRNRQLEHPHFMEVPLSSS  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN LRG GMA+LYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  58    EGLYLRDVINRLNVLRGRGMATLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  117

Query  659   ELI  651
             EL 
Sbjct  118   ELF  120



>ref|XP_010243223.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo nucifera]
 ref|XP_010243224.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo nucifera]
 ref|XP_010243225.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo nucifera]
 ref|XP_010243226.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo nucifera]
 ref|XP_010243227.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo nucifera]
 ref|XP_010243228.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo nucifera]
Length=533

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -3

Query  989  AKKWRDKDISPERTKVWTQPP----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
             KK+R    SPER +VWT+P      R+V VVYYL  N  L+HPHF+E+ LSSP GL+LR
Sbjct  5    VKKYRQ--TSPERARVWTEPSPKHQNRKVPVVYYLCRNRHLEHPHFIEVPLSSPEGLYLR  62

Query  821  DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            DV++RLN LRG GM S+YSWS KR YKNGFVW D+ E+D I PAHG+EY+LKGSEL 
Sbjct  63   DVVERLNVLRGRGMPSMYSWSCKRSYKNGFVWHDISEDDLILPAHGNEYVLKGSELF  119



>ref|XP_002531982.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30418.1| conserved hypothetical protein [Ricinus communis]
Length=289

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 141/264 (53%), Gaps = 40/264 (15%)
 Frame = -3

Query  983  KWRDKDISPERTKVWTQ---PPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVL  813
            K++DK+ +  + K+  Q    PE++VAVVYYLS NG+L+HPHF+++ LSS +GL+LRDV+
Sbjct  16   KYQDKETNDGKAKMQIQLKPEPEKKVAVVYYLSRNGQLEHPHFVDVSLSSSQGLYLRDVM  75

Query  812  DRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSS-  636
            + L  LRG+GMAS+YSW++KR YKN F+WQDL ++D IYP HG +Y+LKGS L+ T  S 
Sbjct  76   NTLKILRGQGMASMYSWASKRSYKNAFLWQDLSDDDIIYPCHGQDYVLKGSLLLETSLSF  135

Query  635  --------------SQETPALTAAGEDREFPPL--------PPPRHNVHAVEEDKESGRS  522
                          S E    ++  ED   P +            H V+  E  + +G +
Sbjct  136  RSNDSISSSSNSRRSSEMNNSSSEAEDSNSPLIRSKSNSWSSIDEHTVYKAETARINGYN  195

Query  521  GSSEP-SNGEISTPPAGSSPETLAALMKADRR------------RVILMNEARKAAAYYD  381
             S++   N  +      + PE L  +    +             R    N   + A  Y+
Sbjct  196  VSTQTEDNRRVKMEIEETKPEGLGTIKLKQKEFSAPTSKSIEVYRSDSSNNRYQKAGGYN  255

Query  380  PSAARPRTASVVMQILSCGSVAAR  309
            PS AR   + V+M+++ CG  + R
Sbjct  256  PS-ARTNDSKVLMKLIRCGCGSKR  278



>ref|XP_004145766.1| PREDICTED: uncharacterized protein LOC101221316 [Cucumis sativus]
Length=518

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 8/123 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE----RRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME+ M KK+    +SPER KVWT+  P+    R+V V+YYL  N +L+HPHFME+ LSS 
Sbjct  1     MEMRM-KKY--NQLSPERAKVWTEKSPKYQQVRKVPVIYYLCRNRQLEHPHFMEVPLSSS  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
              GL+LRDV++RLN LRG GMA+LYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  58    EGLYLRDVINRLNVLRGRGMATLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  117

Query  659   ELI  651
             EL 
Sbjct  118   ELF  120



>gb|KHN37326.1| hypothetical protein glysoja_013541 [Glycine soja]
Length=267

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 91/113 (81%), Gaps = 5/113 (4%)
 Frame = -3

Query  974  DKDISPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRG-LFLRDVLD  810
            +++ S E TK+W  P     E +V V+YYLS NG+L+HPH ME+ +SS +G L L+DV+D
Sbjct  3    EREASLESTKIWIDPKHQATEVKVPVIYYLSRNGQLEHPHLMEVPISSLQGVLCLKDVID  62

Query  809  RLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            RL+ LRG+GMA++YSWSAKR YKNG+VWQDL ENDFIYP+ GHEY+LKG+++I
Sbjct  63   RLSFLRGQGMANMYSWSAKRSYKNGYVWQDLSENDFIYPSSGHEYVLKGTQMI  115



>gb|EYU36129.1| hypothetical protein MIMGU_mgv1a004545mg [Erythranthe guttata]
Length=521

 Score =   157 bits (397),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 103/158 (65%), Gaps = 17/158 (11%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT--------------QPPERRVAVVYYLSLNGKLQHPH  867
             ME  M KK+R   +SPER KVWT              Q    +V VVYYL  N +L+HPH
Sbjct  1     MEGRM-KKYRQ--VSPERAKVWTEKSPKYHYNHNYNQQQHNHKVPVVYYLCRNRQLEHPH  57

Query  866   FMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAH  687
             FME+ +SS  GL+LRDV +RLN LRG GMAS+YSWS KR YKNGFVW DL ++D I PAH
Sbjct  58    FMEVPISSTDGLYLRDVTERLNVLRGRGMASMYSWSCKRSYKNGFVWHDLCDDDLILPAH  117

Query  686   GHEYILKGSELIITHSSSQETPALTAAGEDREFPPLPP  573
             G+EY+LKGSEL    +S   +PA T   ++++  P PP
Sbjct  118   GNEYVLKGSELFEESNSGNFSPAETIILQNQKALPEPP  155



>dbj|BAJ91411.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=412

 Score =   155 bits (392),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 127/244 (52%), Gaps = 53/244 (22%)
 Frame = -3

Query  914  AVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNG  735
            AVVYYLS NG+L+HPHFME+ LSSP GL+LRDV+ RL++LRG+GMA +YSW++KR Y+NG
Sbjct  56   AVVYYLSRNGQLEHPHFMEVALSSPDGLYLRDVIGRLDALRGKGMARIYSWASKRSYRNG  115

Query  734  FVWQDLEENDFIYPAHGHEYILKGSELI--------------------------------  651
            FVW DL + D+++P  G EY+LKG+E +                                
Sbjct  116  FVWHDLADEDYVHPVGGREYVLKGTERLHPPAIQLPLPDAAAASSCSSGSQDTTTSSSSG  175

Query  650  ITHSSSQETPALTAAGEDREFPPLPPPRHNVHAVEEDKESGRSGSS----------EPSN  501
              H   +       A E R +           A  +  E GR G S          E S 
Sbjct  176  WEHGQRKGETGARGAAEYRVYKAEDRAGAAADAATQ-TEDGRRGRSRGHQRRAAQEELSR  234

Query  500  GEISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGS  321
             E S P A +SPETL AL+KAD R +          A      +R R +SV+MQ++SCGS
Sbjct  235  EETSPPTASTSPETLEALIKADGRVL----------ATVPGGGSRARASSVLMQLISCGS  284

Query  320  VAAR  309
            V+ +
Sbjct  285  VSVK  288



>ref|XP_006378734.1| hypothetical protein POPTR_0010s21670g [Populus trichocarpa]
 gb|ERP56531.1| hypothetical protein POPTR_0010s21670g [Populus trichocarpa]
Length=194

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -3

Query  926  ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRK  747
            E++V VVYYL+ NG+ +HPHFME+ LSSP+GL L+DV DRLN LRG GMA++YSWS+KR 
Sbjct  10   EQKVGVVYYLTRNGQFEHPHFMEVPLSSPQGLQLKDVTDRLNHLRGRGMANMYSWSSKRG  69

Query  746  YKNGFVWQDLEENDFIYPAHGHEYILKGSELIIT  645
            YKNGFVWQDL E D++ P HGHEYILKGS L+ T
Sbjct  70   YKNGFVWQDLSETDYVQPCHGHEYILKGSLLLET  103



>dbj|BAK08284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 126/243 (52%), Gaps = 51/243 (21%)
 Frame = -3

Query  914  AVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNG  735
            AVVYYLS NG+L+HPHFME+ LSSP GL+LRDV+ RL++LRG+GMA +YSW++KR Y+NG
Sbjct  77   AVVYYLSRNGQLEHPHFMEVALSSPDGLYLRDVIGRLDALRGKGMARIYSWASKRSYRNG  136

Query  734  FVWQDLEENDFIYPAHGHEYILKGSELI--------------------------------  651
            FVW DL + D+++P  G EY+LKG+E +                                
Sbjct  137  FVWHDLADEDYVHPVGGREYVLKGTERLHPPAIQLPLPDAAAASSCSSGSQDTTTSSSSG  196

Query  650  ITHSSSQETPALTAAGEDREFPPLPPPRHNVHAV--EEDKESGRS-------GSSEPSNG  498
              H   +       A E R +           A    ED   GRS          E S  
Sbjct  197  WEHGQRKGETGARGAAEYRVYKAEDRAGAAADAATQTEDGRRGRSRGHQRRAAQEELSRE  256

Query  497  EISTPPAGSSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCGSV  318
            E S P A +SPETL AL+KAD R +          A      +R R +SV+MQ++SCGSV
Sbjct  257  ETSPPTASTSPETLEALIKADGRVL----------ATVPGGGSRARASSVLMQLISCGSV  306

Query  317  AAR  309
            + +
Sbjct  307  SVK  309



>ref|XP_009394652.1| PREDICTED: uncharacterized protein LOC103980089 [Musa acuminata 
subsp. malaccensis]
Length=590

 Score =   157 bits (396),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 86/115 (75%), Gaps = 11/115 (10%)
 Frame = -3

Query  962  SPERTKVWTQPPE-----------RRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDV  816
            SPERTKVWT+PP            R+V VVYYL  N  L+HPHF+E+ LSSP GL+LRDV
Sbjct  13   SPERTKVWTEPPPKHPLQQQQQQGRKVPVVYYLCRNRHLEHPHFIEVPLSSPEGLYLRDV  72

Query  815  LDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +DRLN LRG  MA++YSWS KR YKNGFVW DL E+D I PA G+E++LKGSEL+
Sbjct  73   IDRLNVLRGRKMAAMYSWSCKRSYKNGFVWHDLSEDDLILPAQGNEFVLKGSELL  127



>ref|XP_008385503.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Malus domestica]
Length=651

 Score =   157 bits (397),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 5/120 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  116  VSPERAKVWTEKSPRYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLRDVINRLN  175

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            +LRG GMA++YSWS+KR YK G+VW DL E+D I PAHG+EY+LKGSEL    +S + +P
Sbjct  176  ALRGRGMATMYSWSSKRSYKGGYVWHDLSEDDLIPPAHGNEYVLKGSELFEESNSGRFSP  235



>ref|XP_009603382.1| PREDICTED: protein UPSTREAM OF FLC isoform X3 [Nicotiana tomentosiformis]
Length=445

 Score =   155 bits (392),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 13/134 (10%)
 Frame = -3

Query  986  KKWRDKDISPERTKVWTQPPER-----------RVAVVYYLSLNGKLQHPHFMELRLSSP  840
            KK+R   +SPER KVWT+   +           +V VVYYL  N +L+HPHF+E+ LSSP
Sbjct  6    KKYRQ--LSPERAKVWTEKSPKYQQQKPRLSNGKVPVVYYLCRNRQLEHPHFIEVPLSSP  63

Query  839  RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
             GL+LRDV++RLN LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  64   EGLYLRDVIERLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  123

Query  659  ELIITHSSSQETPA  618
            EL    ++   +PA
Sbjct  124  ELFDESNAGCFSPA  137



>ref|XP_008385506.1| PREDICTED: protein UPSTREAM OF FLC isoform X5 [Malus domestica]
Length=628

 Score =   157 bits (396),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 5/120 (4%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  116  VSPERAKVWTEKSPRYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLRDVINRLN  175

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETP  621
            +LRG GMA++YSWS+KR YK G+VW DL E+D I PAHG+EY+LKGSEL    +S + +P
Sbjct  176  ALRGRGMATMYSWSSKRSYKGGYVWHDLSEDDLIPPAHGNEYVLKGSELFEESNSGRFSP  235



>ref|XP_008385505.1| PREDICTED: protein UPSTREAM OF FLC isoform X4 [Malus domestica]
Length=549

 Score =   156 bits (395),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 5/110 (5%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  11   VSPERAKVWTEKSPRYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLRDVINRLN  70

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +LRG GMA++YSWS+KR YK G+VW DL E+D I PAHG+EY+LKGSEL 
Sbjct  71   ALRGRGMATMYSWSSKRSYKGGYVWHDLSEDDLIPPAHGNEYVLKGSELF  120



>ref|XP_009603377.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009603378.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009603380.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Nicotiana tomentosiformis]
Length=548

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 13/134 (10%)
 Frame = -3

Query  986  KKWRDKDISPERTKVWTQPPER-----------RVAVVYYLSLNGKLQHPHFMELRLSSP  840
            KK+R   +SPER KVWT+   +           +V VVYYL  N +L+HPHF+E+ LSSP
Sbjct  6    KKYRQ--LSPERAKVWTEKSPKYQQQKPRLSNGKVPVVYYLCRNRQLEHPHFIEVPLSSP  63

Query  839  RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
             GL+LRDV++RLN LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  64   EGLYLRDVIERLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  123

Query  659  ELIITHSSSQETPA  618
            EL    ++   +PA
Sbjct  124  ELFDESNAGCFSPA  137



>ref|XP_009603381.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Nicotiana tomentosiformis]
Length=527

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 13/134 (10%)
 Frame = -3

Query  986  KKWRDKDISPERTKVWTQPPER-----------RVAVVYYLSLNGKLQHPHFMELRLSSP  840
            KK+R   +SPER KVWT+   +           +V VVYYL  N +L+HPHF+E+ LSSP
Sbjct  6    KKYRQ--LSPERAKVWTEKSPKYQQQKPRLSNGKVPVVYYLCRNRQLEHPHFIEVPLSSP  63

Query  839  RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
             GL+LRDV++RLN LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG+EY+LKGS
Sbjct  64   EGLYLRDVIERLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGNEYVLKGS  123

Query  659  ELIITHSSSQETPA  618
            EL    ++   +PA
Sbjct  124  ELFDESNAGCFSPA  137



>ref|XP_009618966.1| PREDICTED: protein UPSTREAM OF FLC-like [Nicotiana tomentosiformis]
 ref|XP_009618968.1| PREDICTED: protein UPSTREAM OF FLC-like [Nicotiana tomentosiformis]
 ref|XP_009618969.1| PREDICTED: protein UPSTREAM OF FLC-like [Nicotiana tomentosiformis]
Length=444

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 102/155 (66%), Gaps = 14/155 (9%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT--------QPPER---RVAVVYYLSLNGKLQHPHFME  858
             ME  M KK+R   +SPER KVWT        Q P++   +V VVYYL  N +L+HPHFME
Sbjct  1     MEERM-KKYRQ--LSPERAKVWTEKSPKYVQQQPQKNDGKVPVVYYLYRNQRLEHPHFME  57

Query  857   LRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHE  678
             + LSSP GL LRDV++R N LRG GMASLYSWS KR YKN FVW DL ++D I PAHG+E
Sbjct  58    VPLSSPDGLHLRDVIERFNVLRGRGMASLYSWSCKRSYKNRFVWHDLCKDDLILPAHGNE  117

Query  677   YILKGSELIITHSSSQETPALTAAGEDREFPPLPP  573
             Y+LKGSEL    +S   +PA      + +  P PP
Sbjct  118   YVLKGSELCEESNSGHCSPAKNERLSNPKVLPEPP  152



>ref|XP_010267249.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Nelumbo nucifera]
Length=516

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 90/122 (74%), Gaps = 7/122 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP----ERRVAVVYYLSLNGKLQHPHFMELRLSSPR  837
             ME  M KK+R    SPER +VWT+P      R+V VVYYL  +  L+HPHF+E+ LSSP 
Sbjct  1     MEGRM-KKYRQ--TSPERARVWTEPSPKHQNRKVPVVYYLCRSRHLEHPHFIEVPLSSPE  57

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
             GL+LRDV+DRLN LRG GM  +YSWS KR YKNGFVW DL E+D I PAHG+EY+LKGSE
Sbjct  58    GLYLRDVIDRLNVLRGRGMPFMYSWSCKRSYKNGFVWHDLSEDDLILPAHGNEYVLKGSE  117

Query  656   LI  651
             L 
Sbjct  118   LF  119



>ref|XP_004287551.1| PREDICTED: uncharacterized protein LOC101295074 [Fragaria vesca 
subsp. vesca]
Length=538

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
             ME  M KK+R   +SPER KVWT+        R+V VVYYL  N +L+HPHFME+ +SS 
Sbjct  1     MEGRM-KKYRQ--VSPERAKVWTEKSPRYHQNRKVPVVYYLCRNRQLEHPHFMEVPVSSS  57

Query  839   RGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGS  660
             +GL+LRDV+++LN+LRG+G+AS+YSWS+KR YKNG+VW DL E+D I PAHG EY+LKGS
Sbjct  58    QGLYLRDVINKLNALRGKGIASMYSWSSKRSYKNGYVWHDLSEDDVILPAHGDEYVLKGS  117

Query  659   ELIITHSSSQETP  621
             E+    +S + +P
Sbjct  118   EIFDESNSGRFSP  130



>ref|XP_009759862.1| PREDICTED: protein UPSTREAM OF FLC-like [Nicotiana sylvestris]
 ref|XP_009759863.1| PREDICTED: protein UPSTREAM OF FLC-like [Nicotiana sylvestris]
Length=449

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 95/140 (68%), Gaps = 14/140 (10%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPPER-----------RVAVVYYLSLNGKLQHPHFME  858
             ME  M KK+R   +SPER KVWT+ P +           +V VVYYL  N +L+HPHFME
Sbjct  1     MEERM-KKYRQ--LSPERAKVWTEKPPKYVQQQPQKNDGKVPVVYYLCRNQRLEHPHFME  57

Query  857   LRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHE  678
             + LSSP GL+LRDV+ R N LRG GMAS YSWS KR YKN FVW DL E+D I PAHG+E
Sbjct  58    VPLSSPDGLYLRDVIVRFNVLRGRGMASSYSWSCKRSYKNRFVWHDLCEDDLILPAHGNE  117

Query  677   YILKGSELIITHSSSQETPA  618
             Y+LKGSEL    +S   +PA
Sbjct  118   YVLKGSELCEESNSGHCSPA  137



>gb|KDP29868.1| hypothetical protein JCGZ_18443 [Jatropha curcas]
Length=286

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 94/120 (78%), Gaps = 3/120 (3%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
             +E+ + KK++D++ S + TK   +P   PE++VAV+YYLS NG+ +HPHF+E+ LSS +G
Sbjct  6     IEIMVPKKYQDQESSLQITKKQNKPQLKPEKKVAVIYYLSRNGQFEHPHFVEVPLSSAQG  65

Query  833   LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
             L+LRDVL  LN LRG+GM S+YSW++KR YKNG++WQDL ++DFI+P    +YILKGS L
Sbjct  66    LYLRDVLKTLNLLRGQGMTSMYSWASKRSYKNGYIWQDLSDDDFIHPCQSQDYILKGSLL  125



>ref|XP_010267244.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Nelumbo nucifera]
 ref|XP_010267245.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Nelumbo nucifera]
 ref|XP_010267246.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Nelumbo nucifera]
 ref|XP_010267247.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Nelumbo nucifera]
 ref|XP_010267248.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Nelumbo nucifera]
Length=538

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 90/122 (74%), Gaps = 7/122 (6%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP----ERRVAVVYYLSLNGKLQHPHFMELRLSSPR  837
             ME  M KK+R    SPER +VWT+P      R+V VVYYL  +  L+HPHF+E+ LSSP 
Sbjct  1     MEGRM-KKYRQ--TSPERARVWTEPSPKHQNRKVPVVYYLCRSRHLEHPHFIEVPLSSPE  57

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
             GL+LRDV+DRLN LRG GM  +YSWS KR YKNGFVW DL E+D I PAHG+EY+LKGSE
Sbjct  58    GLYLRDVIDRLNVLRGRGMPFMYSWSCKRSYKNGFVWHDLSEDDLILPAHGNEYVLKGSE  117

Query  656   LI  651
             L 
Sbjct  118   LF  119



>ref|XP_008385502.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Malus domestica]
Length=654

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 5/110 (5%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  116  VSPERAKVWTEKSPRYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLRDVINRLN  175

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +LRG GMA++YSWS+KR YK G+VW DL E+D I PAHG+EY+LKGSEL 
Sbjct  176  ALRGRGMATMYSWSSKRSYKGGYVWHDLSEDDLIPPAHGNEYVLKGSELF  225



>ref|XP_008385504.1| PREDICTED: protein UPSTREAM OF FLC isoform X3 [Malus domestica]
Length=631

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 5/110 (5%)
 Frame = -3

Query  965  ISPERTKVWTQPP-----ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            +SPER KVWT+        R+V VVYYLS N +L+HPHFME+ ++SP+GL+LRDV++RLN
Sbjct  116  VSPERAKVWTEKSPRYHQNRKVPVVYYLSRNRQLEHPHFMEVPVTSPQGLYLRDVINRLN  175

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +LRG GMA++YSWS+KR YK G+VW DL E+D I PAHG+EY+LKGSEL 
Sbjct  176  ALRGRGMATMYSWSSKRSYKGGYVWHDLSEDDLIPPAHGNEYVLKGSELF  225



>gb|KDO60279.1| hypothetical protein CISIN_1g009456mg [Citrus sinensis]
Length=533

 Score =   154 bits (389),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 10/138 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M KK+R   +SPER KVWT+         R+V VVYY+  N +L+HPHF+E+ LSS
Sbjct  1     METRM-KKYRQ--VSPERAKVWTEKSPKYHQLTRKVPVVYYICRNRQLEHPHFIEVPLSS  57

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV+DRLN LRG GMAS+YSWS K  YKNGFVW DL E+D I PAHG EY+LKG
Sbjct  58    RDGLYLRDVIDRLNVLRGRGMASMYSWSCK-SYKNGFVWHDLCEDDLILPAHGDEYVLKG  116

Query  662   SELIITHSSSQETPALTA  609
             SEL    +S + +P +T 
Sbjct  117   SELFDESNSGRFSPGVTT  134



>ref|XP_009418260.1| PREDICTED: uncharacterized protein LOC103998501 [Musa acuminata 
subsp. malaccensis]
Length=563

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 89/114 (78%), Gaps = 10/114 (9%)
 Frame = -3

Query  962  SPERTKVWTQPP------ER----RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVL  813
            SPER+KVWT+P       ER    ++ VVYYL  N  L+HPHF+E+ LSSP GL+LRDV+
Sbjct  14   SPERSKVWTEPALKQRLQERQRGGKIPVVYYLCRNRHLEHPHFIEVPLSSPEGLYLRDVI  73

Query  812  DRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            DRLN LRG+GMA++YSWS+KR YKNGFVW DL E+D I P+ G+EY+LKGSEL+
Sbjct  74   DRLNVLRGKGMAAMYSWSSKRSYKNGFVWHDLSEDDLILPSQGNEYVLKGSELL  127



>emb|CDP00043.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 96/129 (74%), Gaps = 9/129 (7%)
 Frame = -3

Query  1001  ELHMAKKWRDK-DISPERTKVWTQPP------ERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             EL M KKW ++ D SPER K+ ++ P      + +V V+YYL+ NG L+HPHF+++ LSS
Sbjct  11    ELLMPKKWNERSDRSPERAKICSEHPKFNSILDGKVPVIYYLARNGHLEHPHFIQVPLSS  70

Query  842   PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
               GL+LRDV+++LN LRG GMA +YSWS+KR YKNG+VWQDL E+D I P +  +YILKG
Sbjct  71    SHGLYLRDVINKLNFLRGNGMAHMYSWSSKRNYKNGYVWQDLTEDDLIQPTNDRDYILKG  130

Query  662   SELIITHSS  636
             SEL+  HSS
Sbjct  131   SELL--HSS  137



>gb|AAC98451.1| hypothetical protein [Arabidopsis thaliana]
Length=541

 Score =   154 bits (388),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 16/132 (12%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-PPE-----RRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  M K  R+  +SPER KVWT+  P+     ++V +VYYLS N +L+HPHFME+ +SS
Sbjct  1     MEARMKKYSRE--VSPERAKVWTEKSPKYHQKIKKVQIVYYLSKNRQLEHPHFMEVLISS  58

Query  842   PRGLFLR--------DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAH  687
             P GL+LR        DV++RLN LRG GMAS+YSWS+KR Y+NGFVW DL E+D I PA+
Sbjct  59    PNGLYLRGNVIIYFKDVIERLNVLRGRGMASMYSWSSKRSYRNGFVWHDLSEDDLILPAN  118

Query  686   GHEYILKGSELI  651
             G+EY+LKGSEL 
Sbjct  119   GNEYVLKGSELF  130



>ref|XP_007142718.1| hypothetical protein PHAVU_007G011100g [Phaseolus vulgaris]
 gb|ESW14712.1| hypothetical protein PHAVU_007G011100g [Phaseolus vulgaris]
Length=258

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 89/113 (79%), Gaps = 5/113 (4%)
 Frame = -3

Query  974  DKDISPERTKVWTQP----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRG-LFLRDVLD  810
            +++   E +K+ T+P     E RV V+YYLS NG+L+HPH ME+ +SSPRG L ++DV+D
Sbjct  3    EREAGFESSKICTEPKHQATELRVPVIYYLSRNGQLEHPHLMEVPISSPRGVLCVKDVID  62

Query  809  RLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            RL+ LRG+GM ++YSWS KR YKNGFVWQDL END IYP+ GHEY+LKG+++I
Sbjct  63   RLSFLRGQGMTNMYSWSTKRSYKNGFVWQDLSENDLIYPSSGHEYVLKGTQMI  115



>ref|XP_006346819.1| PREDICTED: protein UPSTREAM OF FLC-like [Solanum tuberosum]
Length=425

 Score =   152 bits (384),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 101/155 (65%), Gaps = 14/155 (9%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT---------QPPER--RVAVVYYLSLNGKLQHPHFME  858
             ME  M +K+R   +SPER KVWT         QP +   +V VVYYL  N +L+HPHFME
Sbjct  1     MEERM-RKYRQ--LSPERAKVWTEKSPKYEQQQPNQNDGKVPVVYYLCRNQQLEHPHFME  57

Query  857   LRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHE  678
             + +SSP GL+LRDV+ R N LRG+GMAS YSWS KR YKNGFVW DL E+D I PA   E
Sbjct  58    VTMSSPDGLYLRDVIQRFNVLRGKGMASSYSWSCKRSYKNGFVWHDLSEHDLILPARPTE  117

Query  677   YILKGSELIITHSSSQETPALTAAGEDREFPPLPP  573
             Y+LKGSEL     S + +PA   +  +++  P PP
Sbjct  118   YVLKGSELCEELKSGRSSPAKNDSLSNQKVLPEPP  152



>ref|XP_009403454.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 5/109 (5%)
 Frame = -3

Query  962  SPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNS  798
            SPER  VW +        RR AVVYYLS NG L+HPHFME+ +SS  GLFLRDV+DRL  
Sbjct  22   SPERRMVWGEARARATTGRRAAVVYYLSRNGHLEHPHFMEVPVSSSEGLFLRDVVDRLRV  81

Query  797  LRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            LRG  MA LYSWS+KR YKNG+VW DL E DFI+P HG+EY+LKG+EL+
Sbjct  82   LRGPAMAGLYSWSSKRSYKNGYVWHDLSEGDFIHPVHGNEYVLKGTELL  130



>ref|XP_002533140.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29252.1| conserved hypothetical protein [Ricinus communis]
Length=427

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
             ME+   +  R+++ISP+R KV  QP   P ++V VVYYLS NG+L+HPH+ME+   +   
Sbjct  1     MEVRSKRSSREREISPDRAKVCMQPKVKPIKKVQVVYYLSRNGQLEHPHYMEVVHFTNHH  60

Query  833   LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
             L L+DV+DRL  LRG+GM SLYSWS KR YKNG+VW DL END IYP+ G EY+LKGSEL
Sbjct  61    LRLKDVMDRLTVLRGKGMPSLYSWSCKRSYKNGYVWNDLAENDIIYPSDGAEYVLKGSEL  120

Query  653   I  651
             +
Sbjct  121   V  121



>ref|XP_011088794.1| PREDICTED: LOW QUALITY PROTEIN: protein UPSTREAM OF FLC [Sesamum 
indicum]
Length=570

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 21/152 (14%)
 Frame = -3

Query  965  ISPERTKVWTQPPER---------------------RVAVVYYLSLNGKLQHPHFMELRL  849
            +SPER KVWT+   +                     +V VVYYL  N +L+HPHFME+ L
Sbjct  11   VSPERAKVWTEKSPKYHYNHQCNQQQQQQQQLQHNGKVPVVYYLCRNRQLEHPHFMEVPL  70

Query  848  SSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYIL  669
            SS  GL+LRDV++RLN+LRG GMAS+YSWS KR YKNG+VW DL ++D I PAHG+EY+L
Sbjct  71   SSTDGLYLRDVIERLNALRGRGMASMYSWSCKRSYKNGYVWHDLCDDDLILPAHGNEYVL  130

Query  668  KGSELIITHSSSQETPALTAAGEDREFPPLPP  573
            KGSEL    +S + +PA T   ++++  P PP
Sbjct  131  KGSELFEDSNSGRFSPAGTFILQNQKALPEPP  162



>ref|XP_006349033.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Solanum tuberosum]
 ref|XP_006349034.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Solanum tuberosum]
 ref|XP_006349035.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X3 [Solanum tuberosum]
Length=549

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = -3

Query  965  ISPERTKVWT--------QPPER----RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
            +SPER KVWT        Q P R    +V VVYYL  N +L+HPHF+E+ LSS  GL+LR
Sbjct  11   LSPERAKVWTEKSPKYQQQQPARLSNGKVPVVYYLCRNRQLEHPHFIEVPLSSTDGLYLR  70

Query  821  DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITH  642
            DV++RLN LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGSEL    
Sbjct  71   DVIERLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGKEYVLKGSELFDES  130

Query  641  SSSQETPA  618
             + + +PA
Sbjct  131  DAGRFSPA  138



>gb|EEC84037.1| hypothetical protein OsI_30284 [Oryza sativa Indica Group]
Length=576

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 17/121 (14%)
 Frame = -3

Query  962  SPERTKVWTQPP-----------------ERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            SP R KVW +PP                  +RVAVVYYL  N  L+HPHF+E+ L+SP G
Sbjct  16   SPGRNKVWVEPPGKTHHLRSPPPPPSPSSSKRVAVVYYLCRNRHLEHPHFIEVPLASPDG  75

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSEL  654
            L+LRDV++RLN LRG+GMA++YSWS KR YKNGFVW DL E+D + PA G+EYILKGSEL
Sbjct  76   LYLRDVINRLNVLRGKGMAAMYSWSCKRSYKNGFVWHDLSEDDLVLPAQGNEYILKGSEL  135

Query  653  I  651
            +
Sbjct  136  L  136



>ref|XP_006349036.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X4 [Solanum tuberosum]
Length=529

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = -3

Query  965  ISPERTKVWT--------QPPER----RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
            +SPER KVWT        Q P R    +V VVYYL  N +L+HPHF+E+ LSS  GL+LR
Sbjct  11   LSPERAKVWTEKSPKYQQQQPARLSNGKVPVVYYLCRNRQLEHPHFIEVPLSSTDGLYLR  70

Query  821  DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITH  642
            DV++RLN LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGSEL    
Sbjct  71   DVIERLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGKEYVLKGSELFDES  130

Query  641  SSSQETPA  618
             + + +PA
Sbjct  131  DAGRFSPA  138



>ref|XP_010313307.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Solanum lycopersicum]
Length=525

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 94/142 (66%), Gaps = 12/142 (8%)
 Frame = -3

Query  965  ISPERTKVWT--------QPPER----RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
            +SPER KVWT        Q P R    +V VVYYL  N +L+HPHF+E+ LSS  GL+LR
Sbjct  11   LSPERAKVWTEKSPKYQQQQPARLSNGKVPVVYYLCRNRQLEHPHFIEVPLSSTDGLYLR  70

Query  821  DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITH  642
            DV+ RLN LRG GMASLYSWS KR YKNGFVW DL E D I PAHG+EY+LKGSEL    
Sbjct  71   DVIKRLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEEDLILPAHGNEYVLKGSELFDES  130

Query  641  SSSQETPALTAAGEDREFPPLP  576
             + + +PA      +++  P P
Sbjct  131  DAGRFSPAGNVRLSNQKLLPEP  152



>ref|XP_010935824.1| PREDICTED: uncharacterized protein LOC105055627 [Elaeis guineensis]
Length=577

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 87/120 (73%), Gaps = 16/120 (13%)
 Frame = -3

Query  962  SPERTKVWTQPP----------------ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGL  831
            SPERTKVW +PP                 R++ VVYYL  N  L+HPHF+E+ +SSP GL
Sbjct  13   SPERTKVWVEPPPKHHHQLQHHQQQQQQGRKIPVVYYLCRNRHLEHPHFIEVPVSSPEGL  72

Query  830  FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +LRDV++RLNSLRG+ MAS+YSWS KR YKNGFVW DL E+D + PA G+EY+LKGSEL+
Sbjct  73   YLRDVINRLNSLRGKRMASMYSWSCKRSYKNGFVWHDLSEDDLVLPAQGNEYVLKGSELL  132



>ref|XP_006349037.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X5 [Solanum tuberosum]
Length=435

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = -3

Query  965  ISPERTKVWT--------QPPER----RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
            +SPER KVWT        Q P R    +V VVYYL  N +L+HPHF+E+ LSS  GL+LR
Sbjct  11   LSPERAKVWTEKSPKYQQQQPARLSNGKVPVVYYLCRNRQLEHPHFIEVPLSSTDGLYLR  70

Query  821  DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITH  642
            DV++RLN LRG GMASLYSWS KR YKNGFVW DL E+D I PAHG EY+LKGSEL    
Sbjct  71   DVIERLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEDDLILPAHGKEYVLKGSELFDES  130

Query  641  SSSQETPA  618
             + + +PA
Sbjct  131  DAGRFSPA  138



>ref|XP_010313304.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Solanum lycopersicum]
 ref|XP_004250983.2| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Solanum lycopersicum]
 ref|XP_010313305.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Solanum lycopersicum]
 ref|XP_010313306.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Solanum lycopersicum]
Length=545

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 94/142 (66%), Gaps = 12/142 (8%)
 Frame = -3

Query  965  ISPERTKVWT--------QPPER----RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLR  822
            +SPER KVWT        Q P R    +V VVYYL  N +L+HPHF+E+ LSS  GL+LR
Sbjct  11   LSPERAKVWTEKSPKYQQQQPARLSNGKVPVVYYLCRNRQLEHPHFIEVPLSSTDGLYLR  70

Query  821  DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITH  642
            DV+ RLN LRG GMASLYSWS KR YKNGFVW DL E D I PAHG+EY+LKGSEL    
Sbjct  71   DVIKRLNVLRGRGMASLYSWSCKRSYKNGFVWHDLCEEDLILPAHGNEYVLKGSELFDES  130

Query  641  SSSQETPALTAAGEDREFPPLP  576
             + + +PA      +++  P P
Sbjct  131  DAGRFSPAGNVRLSNQKLLPEP  152



>ref|XP_009382784.1| PREDICTED: uncharacterized protein LOC103970646 [Musa acuminata 
subsp. malaccensis]
Length=350

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 9/112 (8%)
 Frame = -3

Query  959  PERTKVWTQPP---------ERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            PERT++ T+PP          R+V+VVYYLS +  L+HPHF+E+ LSSP GL+LRDV+DR
Sbjct  14   PERTRLRTEPPPKHQSQQLEGRKVSVVYYLSRSHHLEHPHFLEVPLSSPAGLYLRDVVDR  73

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            L+ LRG+GMA++YSWS KR YKNGFVWQDL E D I P  G EY+LKGSEL+
Sbjct  74   LDVLRGKGMAAMYSWSCKRSYKNGFVWQDLSEGDLILPEQGDEYVLKGSELL  125



>ref|XP_009403452.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403453.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=455

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 5/109 (5%)
 Frame = -3

Query  962  SPERTKVWTQP-----PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNS  798
            SPER  VW +        RR AVVYYLS NG L+HPHFME+ +SS  GLFLRDV+DRL  
Sbjct  22   SPERRMVWGEARARATTGRRAAVVYYLSRNGHLEHPHFMEVPVSSSEGLFLRDVVDRLRV  81

Query  797  LRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            LRG  MA LYSWS+KR YKNG+VW DL E DFI+P HG+EY+LKG+EL+
Sbjct  82   LRGPAMAGLYSWSSKRSYKNGYVWHDLSEGDFIHPVHGNEYVLKGTELL  130



>ref|XP_011032320.1| PREDICTED: protein UPSTREAM OF FLC [Populus euphratica]
Length=489

 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 10/152 (7%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWT------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
             ME  + KK+ ++ +SPER KVWT      Q   R+V VVYYL  N +L+HPHF+E+ L+S
Sbjct  1     METMIMKKY-NRQVSPERAKVWTERSPKYQQQNRKVPVVYYLCRNHQLEHPHFIEVPLAS  59

Query  842   PRGLFLR---DVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYI  672
               GL+LR   +V++RLN LRG GM SLYSWS+KR YKNGFVW DL E+D I PAHG EY+
Sbjct  60    RDGLYLRGIFNVIERLNVLRGRGMTSLYSWSSKRSYKNGFVWHDLCEDDLILPAHGSEYV  119

Query  671   LKGSELIITHSSSQETPALTAAGEDREFPPLP  576
             LKGS+L    +  +  PA T   ++ +  P P
Sbjct  120   LKGSQLFEESNPDRFAPAGTIKMQNLKLLPEP  151



>ref|XP_011089964.1| PREDICTED: protein UPSTREAM OF FLC-like [Sesamum indicum]
Length=539

 Score =   150 bits (380),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 97/148 (66%), Gaps = 15/148 (10%)
 Frame = -3

Query  971  KDISPERTKVWTQPPER---------------RVAVVYYLSLNGKLQHPHFMELRLSSPR  837
            + +SPER KVWT+   R               +V VVYYL  N +L+HPHF+E+ +SSP 
Sbjct  9    RQLSPERAKVWTEKSPRYHYNHHYNQQQQQSCKVPVVYYLCRNRQLEHPHFIEVPISSPD  68

Query  836  GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
            GL+LRDV++RLN LRG GMAS+YSWS KR YKNG+VW DL  +D I PAH +EY+LKGSE
Sbjct  69   GLYLRDVIERLNVLRGRGMASMYSWSCKRSYKNGYVWHDLCYDDLILPAHRNEYVLKGSE  128

Query  656  LIITHSSSQETPALTAAGEDREFPPLPP  573
            L     S + +PA T    +++  P PP
Sbjct  129  LFQESDSGRFSPAETDILRNQKALPEPP  156



>ref|XP_004240776.1| PREDICTED: protein UPSTREAM OF FLC-like [Solanum lycopersicum]
Length=398

 Score =   149 bits (375),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 95/149 (64%), Gaps = 11/149 (7%)
 Frame = -3

Query  971  KDISPERTKVW---------TQPPER--RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFL  825
            + +SPER KVW          QP +   +V VVYYL  N +L+HPHFME+ +SSP GL+L
Sbjct  9    RQLSPERAKVWREKSPKYEQQQPSQSDGKVPVVYYLCRNQQLEHPHFMEVTMSSPDGLYL  68

Query  824  RDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIIT  645
            RDV+ R N LRG+GMAS YSWS KR YKN FVW DL E+D I PA   EY+LKGSE    
Sbjct  69   RDVIKRFNVLRGKGMASSYSWSCKRSYKNRFVWHDLSEDDLILPARTTEYVLKGSEFCEE  128

Query  644  HSSSQETPALTAAGEDREFPPLPPPRHNV  558
             +S + +PA      +R+  P PP +++ 
Sbjct  129  LNSGRSSPAKNEKLSNRKVLPEPPSQYDT  157



>ref|XP_002266219.3| PREDICTED: protein UPSTREAM OF FLC [Vitis vinifera]
 emb|CBI33036.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = -3

Query  971  KDISPERTKVWTQP---PERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLN  801
            ++ISP+R KV  QP   P R+V VVYYLS NG+L+HPH+ME+   + + L L+DV++RL 
Sbjct  10   REISPDRAKVCLQPRAKPFRKVQVVYYLSRNGQLEHPHYMEVTHLANQQLRLKDVMERLT  69

Query  800  SLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
             LRG+GM SLYSWS KR YKNG+VW DL END IYPA G EY+LKGSELI
Sbjct  70   VLRGKGMPSLYSWSCKRSYKNGYVWNDLAENDIIYPAEGAEYVLKGSELI  119



>ref|XP_006826977.1| hypothetical protein AMTR_s00010p00200600 [Amborella trichopoda]
 gb|ERM94214.1| hypothetical protein AMTR_s00010p00200600 [Amborella trichopoda]
Length=358

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/286 (35%), Positives = 145/286 (51%), Gaps = 27/286 (9%)
 Frame = -3

Query  977  RDKDISPERTKVWTQ---PPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            ++++ SP+R K++ Q      RRV ++YYLS NG+L+HPHFME+   + + L L+DV+DR
Sbjct  7    KNREASPDRAKIYMQSKTKQNRRVQILYYLSRNGQLEHPHFMEVGHPATQQLRLKDVMDR  66

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQE  627
            L  LRG+GM SL+SWS KR YKNG+VW DL END IYP  G EY+LKGSELI   S S +
Sbjct  67   LTVLRGKGMPSLFSWSCKRNYKNGYVWNDLSENDIIYPTEGAEYVLKGSELIDGCSESIQ  126

Query  626  TPALTAAGED------REFPPLPPPRHNVHA---VEEDKESGRSGSSEPSNGEISTPPAG  474
               L++   +      ++F     PR +  A   V+           E     +     G
Sbjct  127  QLQLSSRQINIETRGRKQFSENLTPRISRGASPEVQHKHIQEEREEREEREEVLKHQNNG  186

Query  473  SSPETLAALMKADRRRVILMNEARKAAAYYDPSAARPRTA----SVVMQILSCGSVAARE  306
             S E   +L             + KA    + S  +P       S ++Q+L+CGS+A + 
Sbjct  187  CSTEL--SLTDTSSPPSSSSTLSEKAETLENQSKKKPMIKTSRHSAILQLLACGSMAMKT  244

Query  305  HAPPCKAKTHAFSLISHHKMATLLPCGTRRNNPPDVAENAVMELPL  168
            H    K   + F  I +  +   + C T        A+NAV++  L
Sbjct  245  HE--MKKGRNLFPPIKNQSLHKRVVCKT-------AAKNAVLDEDL  281



>ref|XP_008672066.1| PREDICTED: uncharacterized protein LOC100191796 isoform X1 [Zea 
mays]
Length=617

 Score =   149 bits (375),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 87/129 (67%), Gaps = 18/129 (14%)
 Frame = -3

Query  983  KWRDKDISPERTKVWTQPP-----------------ERRVAVVYYLSLNGKLQHPHFMEL  855
            + R    SP RTKVW +PP                  +RVAVVYYL  N  L+HPHF+E+
Sbjct  17   RRRGTGTSPGRTKVWVEPPGKSHGHHHHQAPPPPSPPKRVAVVYYLCRNRHLEHPHFIEV  76

Query  854  RLSSPR-GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHE  678
             L+ P  GL+LRDV++RLN LRG+GMAS+YSWS KR YKNGFVW DL ++D + PA G E
Sbjct  77   PLAVPEEGLYLRDVMNRLNVLRGKGMASMYSWSCKRSYKNGFVWHDLSDDDLVLPAQGSE  136

Query  677  YILKGSELI  651
            YILKGSEL+
Sbjct  137  YILKGSELL  145



>gb|ACF79011.1| unknown [Zea mays]
 tpg|DAA48590.1| TPA: hypothetical protein ZEAMMB73_676706 [Zea mays]
 tpg|DAA48591.1| TPA: hypothetical protein ZEAMMB73_676706 [Zea mays]
Length=618

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 87/129 (67%), Gaps = 18/129 (14%)
 Frame = -3

Query  983  KWRDKDISPERTKVWTQPP-----------------ERRVAVVYYLSLNGKLQHPHFMEL  855
            + R    SP RTKVW +PP                  +RVAVVYYL  N  L+HPHF+E+
Sbjct  17   RRRGTGTSPGRTKVWVEPPGKSHGHHHHQAPPPPSPPKRVAVVYYLCRNRHLEHPHFIEV  76

Query  854  RLSSPR-GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHE  678
             L+ P  GL+LRDV++RLN LRG+GMAS+YSWS KR YKNGFVW DL ++D + PA G E
Sbjct  77   PLAVPEEGLYLRDVMNRLNVLRGKGMASMYSWSCKRSYKNGFVWHDLSDDDLVLPAQGSE  136

Query  677  YILKGSELI  651
            YILKGSEL+
Sbjct  137  YILKGSELL  145



>ref|NP_001130693.1| uncharacterized protein LOC100191796 [Zea mays]
 gb|ACG28985.1| hypothetical protein [Zea mays]
Length=618

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 87/129 (67%), Gaps = 18/129 (14%)
 Frame = -3

Query  983  KWRDKDISPERTKVWTQPP-----------------ERRVAVVYYLSLNGKLQHPHFMEL  855
            + R    SP RTKVW +PP                  +RVAVVYYL  N  L+HPHF+E+
Sbjct  17   RRRGTGTSPGRTKVWVEPPGKSHGHHHHQAPPPPSPPKRVAVVYYLCRNRHLEHPHFIEV  76

Query  854  RLSSPR-GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHE  678
             L+ P  GL+LRDV++RLN LRG+GMAS+YSWS KR YKNGFVW DL ++D + PA G E
Sbjct  77   PLAVPEEGLYLRDVMNRLNVLRGKGMASMYSWSCKRSYKNGFVWHDLSDDDLVLPAQGSE  136

Query  677  YILKGSELI  651
            YILKGSEL+
Sbjct  137  YILKGSELL  145



>gb|EPS59694.1| hypothetical protein M569_15111 [Genlisea aurea]
Length=557

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 88/130 (68%), Gaps = 17/130 (13%)
 Frame = -3

Query  971  KDISPERTKVWT-----------------QPPERRVAVVYYLSLNGKLQHPHFMELRLSS  843
            + +SP+R KVWT                 Q   R+V VVYYL  N +L+HPHFME+ L+S
Sbjct  9    RQLSPDRAKVWTEKSPKYYYDHDYGVHQQQKQIRKVPVVYYLCRNRQLEHPHFMEVPLAS  68

Query  842  PRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
              GL+LRDV++RLN LRG GMASLYSWS KR YK+GFVW DL END I P HG EY+LKG
Sbjct  69   SGGLYLRDVIERLNVLRGRGMASLYSWSCKRSYKSGFVWHDLCENDLILPVHGSEYVLKG  128

Query  662  SELIITHSSS  633
            SEL   H+S+
Sbjct  129  SELFEEHNSA  138



>tpg|DAA48592.1| TPA: hypothetical protein ZEAMMB73_676706 [Zea mays]
Length=594

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 86/127 (68%), Gaps = 18/127 (14%)
 Frame = -3

Query  977  RDKDISPERTKVWTQPP-----------------ERRVAVVYYLSLNGKLQHPHFMELRL  849
            R    SP RTKVW +PP                  +RVAVVYYL  N  L+HPHF+E+ L
Sbjct  19   RGTGTSPGRTKVWVEPPGKSHGHHHHQAPPPPSPPKRVAVVYYLCRNRHLEHPHFIEVPL  78

Query  848  SSPR-GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYI  672
            + P  GL+LRDV++RLN LRG+GMAS+YSWS KR YKNGFVW DL ++D + PA G EYI
Sbjct  79   AVPEEGLYLRDVMNRLNVLRGKGMASMYSWSCKRSYKNGFVWHDLSDDDLVLPAQGSEYI  138

Query  671  LKGSELI  651
            LKGSEL+
Sbjct  139  LKGSELL  145



>ref|XP_009420457.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=549

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -3

Query  965  ISPERTKVWTQPPE---------RRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVL  813
            ISPERTKVW +PP          R+V VVYYL  N  L  PH +E+ L SP GL+LRDV+
Sbjct  8    ISPERTKVWAEPPPKHHHWQQQGRKVPVVYYLCRNRHLDQPHSIEVPLCSPEGLYLRDVV  67

Query  812  DRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            DRLN  RG+GMA++YSWS KR YKNGFVWQDL  +D I P  G EY+LKGSEL+
Sbjct  68   DRLNVQRGKGMAAMYSWSCKRSYKNGFVWQDLSGDDLILPVQGTEYVLKGSELL  121



>ref|XP_009420458.1| PREDICTED: uncharacterized protein LOC104000195 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   148 bits (373),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -3

Query  965  ISPERTKVWTQPPE---------RRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVL  813
            ISPERTKVW +PP          R+V VVYYL  N  L  PH +E+ L SP GL+LRDV+
Sbjct  8    ISPERTKVWAEPPPKHHHWQQQGRKVPVVYYLCRNRHLDQPHSIEVPLCSPEGLYLRDVV  67

Query  812  DRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            DRLN  RG+GMA++YSWS KR YKNGFVWQDL  +D I P  G EY+LKGSEL+
Sbjct  68   DRLNVQRGKGMAAMYSWSCKRSYKNGFVWQDLSGDDLILPVQGTEYVLKGSELL  121



>ref|XP_009420456.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=566

 Score =   148 bits (373),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 81/114 (71%), Gaps = 9/114 (8%)
 Frame = -3

Query  965  ISPERTKVWTQPPE---------RRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVL  813
            ISPERTKVW +PP          R+V VVYYL  N  L  PH +E+ L SP GL+LRDV+
Sbjct  8    ISPERTKVWAEPPPKHHHWQQQGRKVPVVYYLCRNRHLDQPHSIEVPLCSPEGLYLRDVV  67

Query  812  DRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            DRLN  RG+GMA++YSWS KR YKNGFVWQDL  +D I P  G EY+LKGSEL+
Sbjct  68   DRLNVQRGKGMAAMYSWSCKRSYKNGFVWQDLSGDDLILPVQGTEYVLKGSELL  121



>ref|NP_001062513.1| Os08g0561600 [Oryza sativa Japonica Group]
 dbj|BAF24427.1| Os08g0561600 [Oryza sativa Japonica Group]
Length=577

 Score =   148 bits (373),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 18/122 (15%)
 Frame = -3

Query  962  SPERTKVWTQPP-----------------ERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            SP R KVW +PP                  +RVAVVYYL  N  L+HPHF+E+ L+SP G
Sbjct  16   SPGRNKVWVEPPGKTHHLRSPPPPPSPSSSKRVAVVYYLCRNRHLEHPHFIEVPLASPDG  75

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAK-RKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
            L+LRDV++RLN LRG+GMA++YSWS K R YKNGFVW DL E+D + PA G+EYILKGSE
Sbjct  76   LYLRDVINRLNVLRGKGMAAMYSWSCKSRSYKNGFVWHDLSEDDLVLPAQGNEYILKGSE  135

Query  656  LI  651
            L+
Sbjct  136  LL  137



>ref|XP_004236760.1| PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Solanum lycopersicum]
Length=315

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 92/127 (72%), Gaps = 8/127 (6%)
 Frame = -3

Query  992  MAKKWRDKDISPERTKVWTQP-PERR----VAVVYYLSLNGKLQHPHFMELRLS-SPRGL  831
            + KKW     SPER  +W +P P  +    V V+YY+S NG+L+HPHF+E+ LS S  GL
Sbjct  17   IQKKWNHN--SPERNMIWIEPKPNNKAIKSVPVIYYISRNGQLEHPHFIEVPLSFSDEGL  74

Query  830  FLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            +LRDV++RLN LRG+GM  L+SWS KR YKNG+VW DL END I+P +G +Y+LKGSE++
Sbjct  75   YLRDVINRLNFLRGKGMGYLFSWSCKRSYKNGYVWHDLSENDLIHPTNGQDYVLKGSEIL  134

Query  650  ITHSSSQ  630
             T  SS+
Sbjct  135  ETSISSR  141



>gb|EPS64977.1| hypothetical protein M569_09806, partial [Genlisea aurea]
Length=219

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 115/224 (51%), Gaps = 35/224 (16%)
 Frame = -3

Query  923  RRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKY  744
            R+V+VVYYL  NG+L+HPHFME+  SSP  LFLRDV+ RLN LRGEGMA+ YSWS KR Y
Sbjct  1    RKVSVVYYLCRNGQLEHPHFMEVIPSSPNALFLRDVIGRLNVLRGEGMAATYSWSCKRSY  60

Query  743  KNGFVWQDLEENDFIYPAHG-HEYILKGSELIITHSSSQETPALTAAGEDREFPPLPPPR  567
            K+GFVW DL ++DFI   +G  EY+LKGSE        +    L+  G       L    
Sbjct  61   KHGFVWHDLSDDDFILAVNGDDEYVLKGSEKKKIDVGERRRRNLSCGGA----IDLNVTE  116

Query  566  HNVHAVEEDKESGRSGSSEPSNG-----------------------EISTPPAGSSPETL  456
            ++V+     K  G   S++   G                       EI+ P + SS ETL
Sbjct  117  YSVY-----KALGTDASTQTDEGQRRRRREEEEKKKIAANGNEMEIEITPPASDSSSETL  171

Query  455  AALMKADRRRVILMNEARKAAAYYDPSAARPRTASVVMQILSCG  324
             ALMK+D  R     E   A      S      +  + Q++SCG
Sbjct  172  EALMKSDGVRASSATEESTAEGA--QSVKEEEKSWCIPQLISCG  213



>ref|XP_006659704.1| PREDICTED: uncharacterized protein LOC102700546 [Oryza brachyantha]
Length=582

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 86/124 (69%), Gaps = 20/124 (16%)
 Frame = -3

Query  962  SPERTKVWTQPP-------------------ERRVAVVYYLSLNGKLQHPHFMELRLSSP  840
            SP R KVW +PP                    +RVAVVYYL  N  L+HPHF+E+ L+SP
Sbjct  19   SPGRNKVWVEPPGKSHHQPPPRSPPPPLSPSSKRVAVVYYLCRNRHLEHPHFIEVPLASP  78

Query  839  RGLFLRDVLDRLNSLRGEGMASLYSWSAK-RKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
             GL+LRDV++RLN LRG+GMA++YSWS K R YKNGFVW DL E+D + PA G+EYILKG
Sbjct  79   EGLYLRDVINRLNVLRGKGMAAMYSWSCKSRSYKNGFVWHDLSEDDLVLPAQGNEYILKG  138

Query  662  SELI  651
            SEL+
Sbjct  139  SELL  142



>gb|EEE55291.1| hypothetical protein OsJ_03239 [Oryza sativa Japonica Group]
Length=579

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 86/124 (69%), Gaps = 20/124 (16%)
 Frame = -3

Query  962  SPERTKVWTQPP-----------------ERRVAVVYYLSLNGKLQHPHFMELRLSSPRG  834
            SP R KVW +PP                  +RVAVVYYL  N  L+HPHF+E+ L+SP G
Sbjct  16   SPGRNKVWVEPPGKTHHLRSPPPPPSPSSSKRVAVVYYLCRNRHLEHPHFIEVPLASPDG  75

Query  833  LFLRDVLDRLNSLRGEGMASLYSWSAK---RKYKNGFVWQDLEENDFIYPAHGHEYILKG  663
            L+LRDV++RLN LRG+GMA++YSWS K   R YKNGFVW DL E+D + PA G+EYILKG
Sbjct  76   LYLRDVINRLNVLRGKGMAAMYSWSCKSFSRSYKNGFVWHDLSEDDLVLPAQGNEYILKG  135

Query  662  SELI  651
            SEL+
Sbjct  136  SELL  139



>ref|XP_006365723.1| PREDICTED: protein UPSTREAM OF FLC-like [Solanum tuberosum]
Length=537

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 93/129 (72%), Gaps = 7/129 (5%)
 Frame = -3

Query  1001  ELHMAKKWRDKDISPERTKVWTQPPERR----VAVVYYLSLNGKLQHPHFMELRLSS-PR  837
             E+ + KKW     SPER  +W +P   +    V V+YY+S NG+L+HPHF+E+ LSS   
Sbjct  14    EILIPKKW--NHTSPERNIIWIEPKPNKALKSVPVIYYISRNGQLEHPHFIEVPLSSSDD  71

Query  836   GLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
             GL+LRDV++RLN LRG+GM  L+SWS KR YKNG+VW DL END I+P +G +Y+LKGSE
Sbjct  72    GLYLRDVINRLNFLRGKGMGYLFSWSCKRSYKNGYVWHDLSENDLIHPTNGQDYVLKGSE  131

Query  656   LIITHSSSQ  630
             L+ T  SS+
Sbjct  132   LLETSISSR  140



>ref|XP_011090510.1| PREDICTED: protein UPSTREAM OF FLC [Sesamum indicum]
Length=446

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  953  RTKVWTQPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMAS  774
            +T++  QP  ++V VVYYLS NG LQHPH+ME+   + + L L+DV+DRL  LRG+GM S
Sbjct  31   QTRIMRQPTFKKVQVVYYLSRNGHLQHPHYMEVTHLAHQQLRLKDVMDRLTVLRGKGMPS  90

Query  773  LYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSSQETPALTAAGEDR  594
            LYSWS KR YKNG+VW DL END IYP+ G EY+LKGSELI   +       +  AG+D 
Sbjct  91   LYSWSCKRSYKNGYVWNDLVENDVIYPSEGAEYVLKGSELIEGCTEKLHHLQVGYAGQDS  150

Query  593  EFPP  582
            +F P
Sbjct  151  DFQP  154



>gb|EMS48462.1| hypothetical protein TRIUR3_32429 [Triticum urartu]
Length=244

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  935  QPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDRLNSLRGEGMASLYSWSA  756
            +P   RVAVVYYLS NG+L+HPHFME+ LSSP GL+LRDV+DRL++LRG+GMA +YSW++
Sbjct  57   RPGPARVAVVYYLSRNGQLEHPHFMEVALSSPDGLYLRDVIDRLDALRGKGMARMYSWAS  116

Query  755  KRKYKNGFVWQDLEENDFIYPAHGHEYILKGSE  657
            KR Y+NGFVW DL ++D+++P  G EY+LKG+E
Sbjct  117  KRSYRNGFVWHDLADDDYVHPVGGREYVLKGTE  149



>ref|XP_010261234.1| PREDICTED: protein UPSTREAM OF FLC-like [Nelumbo nucifera]
Length=401

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 84/112 (75%), Gaps = 3/112 (3%)
 Frame = -3

Query  977  RDKDISPERTKVWTQPPER---RVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            R ++ SP+R +V+ QP  +   +V V+YYL  NG+L+HPHFME+   + + L L+DV+DR
Sbjct  7    RSRETSPDRARVYVQPKTKTFKKVQVLYYLCRNGQLEHPHFMEVPHLANQQLRLKDVIDR  66

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            L  LRG+GM SL+SWS KR YKNG+VW DL END IYPA G EYILKGSELI
Sbjct  67   LTVLRGKGMPSLFSWSCKRSYKNGYVWNDLGENDVIYPAEGAEYILKGSELI  118



>ref|XP_006840165.1| hypothetical protein AMTR_s00089p00083270 [Amborella trichopoda]
 gb|ERN01840.1| hypothetical protein AMTR_s00089p00083270 [Amborella trichopoda]
Length=491

 Score =   144 bits (364),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 93/125 (74%), Gaps = 10/125 (8%)
 Frame = -3

Query  1004  MELHMAKKWRDKDISPERTKVWTQ-------PPERRVAVVYYLSLNGKLQHPHFMELRLS  846
             ME+ M KK+R   +SPER + W++         +R+VAVVYYL  N  L+HPHF+E+ L+
Sbjct  1     MEIGM-KKFRQ--VSPERGRPWSENTQHQKQQQQRKVAVVYYLCRNRHLEHPHFIEVPLA  57

Query  845   SPRGLFLRDVLDRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILK  666
             SPRGL+LRD + RLN+ RG GM ++YSWS KR YK+GFVW DL E+D I+P +G+EY+LK
Sbjct  58    SPRGLYLRDFISRLNAHRGRGMPAMYSWSCKRSYKSGFVWHDLSEDDLIHPVNGNEYVLK  117

Query  665   GSELI  651
             GSEL+
Sbjct  118   GSELL  122



>ref|XP_010027838.1| PREDICTED: protein UPSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW54470.1| hypothetical protein EUGRSUZ_I00418 [Eucalyptus grandis]
Length=422

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -3

Query  977  RDKDISPERTKVWTQPPE-----RRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVL  813
            R +++SP R +   +P E     R+V VVYYL+ NG L+HPHFME+ L +   L LRDV+
Sbjct  7    RGREMSPNRARASVRPREQRPQVRKVQVVYYLTRNGLLEHPHFMEVSLLADHQLRLRDVM  66

Query  812  DRLNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELIITHSSS  633
            +RL +LRG+GM S+YSWS+KR YKNG+VW DL EN+ IYPA G EY+LKGSE+I +    
Sbjct  67   ERLTALRGKGMPSMYSWSSKRTYKNGYVWNDLSENEVIYPAEGAEYVLKGSEIIDSGGLV  126

Query  632  QETPALT  612
               P L 
Sbjct  127  GREPVLV  133



>ref|XP_008807694.1| PREDICTED: protein UPSTREAM OF FLC isoform X2 [Phoenix dactylifera]
Length=561

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 8/112 (7%)
 Frame = -3

Query  962  SPERTKVWT--------QPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            SP+R++ W         Q   R++ VVYYL  N  L+HPHF+E+ ++SP GL+LRD ++R
Sbjct  13   SPDRSRAWAEPPPPPPKQHQARKIPVVYYLCRNRHLEHPHFIEVPVASPEGLYLRDFINR  72

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            LN LRG+GMA++YSWS KR YKNGFVW DL E+D + PAHG+EY+LKGSEL+
Sbjct  73   LNVLRGKGMAAMYSWSCKRSYKNGFVWHDLSEDDLVLPAHGNEYVLKGSELL  124



>ref|XP_008807695.1| PREDICTED: protein UPSTREAM OF FLC isoform X3 [Phoenix dactylifera]
Length=538

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 8/112 (7%)
 Frame = -3

Query  962  SPERTKVWT--------QPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            SP+R++ W         Q   R++ VVYYL  N  L+HPHF+E+ ++SP GL+LRD ++R
Sbjct  13   SPDRSRAWAEPPPPPPKQHQARKIPVVYYLCRNRHLEHPHFIEVPVASPEGLYLRDFINR  72

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            LN LRG+GMA++YSWS KR YKNGFVW DL E+D + PAHG+EY+LKGSEL+
Sbjct  73   LNVLRGKGMAAMYSWSCKRSYKNGFVWHDLSEDDLVLPAHGNEYVLKGSELL  124



>ref|XP_008807693.1| PREDICTED: protein UPSTREAM OF FLC isoform X1 [Phoenix dactylifera]
Length=564

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 8/112 (7%)
 Frame = -3

Query  962  SPERTKVWT--------QPPERRVAVVYYLSLNGKLQHPHFMELRLSSPRGLFLRDVLDR  807
            SP+R++ W         Q   R++ VVYYL  N  L+HPHF+E+ ++SP GL+LRD ++R
Sbjct  13   SPDRSRAWAEPPPPPPKQHQARKIPVVYYLCRNRHLEHPHFIEVPVASPEGLYLRDFINR  72

Query  806  LNSLRGEGMASLYSWSAKRKYKNGFVWQDLEENDFIYPAHGHEYILKGSELI  651
            LN LRG+GMA++YSWS KR YKNGFVW DL E+D + PAHG+EY+LKGSEL+
Sbjct  73   LNVLRGKGMAAMYSWSCKRSYKNGFVWHDLSEDDLVLPAHGNEYVLKGSELL  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3085156226038