BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14308_g1_i1 len=1776 path=[1754:0-1205 2960:1206-1775]

Length=1776
                                                                      Score     E

ref|XP_009770971.1|  PREDICTED: expansin-A13-like                       454   1e-153   
ref|XP_009591327.1|  PREDICTED: expansin-A13-like                       449   6e-152   
ref|XP_009612177.1|  PREDICTED: expansin-A13-like                       448   3e-151   
ref|XP_009760108.1|  PREDICTED: expansin-A13-like                       446   1e-150   
ref|XP_006348172.1|  PREDICTED: expansin-A13                            443   3e-149   
ref|XP_004232677.1|  PREDICTED: expansin-A13-like                       443   3e-149   
ref|XP_006343301.1|  PREDICTED: expansin-A13-like                       439   8e-148   
ref|NP_001234078.1|  expansin A3 precursor                              439   8e-148   
ref|XP_006430408.1|  hypothetical protein CICLE_v10012472mg             434   1e-145   
ref|XP_011087744.1|  PREDICTED: expansin-A13                            426   3e-142   
ref|XP_010062321.1|  PREDICTED: expansin-A13                            425   4e-142   
gb|EYU26535.1|  hypothetical protein MIMGU_mgv1a011992mg                422   3e-141   
ref|NP_566197.1|  expansin A13                                          421   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884363.1|  ATEXPA13                                           421   2e-140   
emb|CDP01693.1|  unnamed protein product                                420   2e-140   
gb|AAM67333.1|  Alpha-expansin 13 precursor (At-EXP13) (AtEx13) (...    419   5e-140   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37765.1|  hypothetical protein AALP_AA3G026800                    418   2e-139   
ref|XP_003544353.2|  PREDICTED: expansin-A13-like                       416   6e-139   
ref|XP_002270003.1|  PREDICTED: expansin-A13                            418   9e-139   Vitis vinifera
ref|XP_010463770.1|  PREDICTED: expansin-A13                            416   1e-138   
ref|XP_009130347.1|  PREDICTED: expansin-A13                            416   1e-138   
ref|XP_003519314.1|  PREDICTED: expansin-A13-like                       415   2e-138   
ref|XP_010101054.1|  hypothetical protein L484_007788                   414   5e-138   
ref|XP_006408328.1|  hypothetical protein EUTSA_v10021327mg             414   7e-138   
emb|CDY28747.1|  BnaCnng06330D                                          413   9e-138   
ref|XP_006296727.1|  hypothetical protein CARUB_v10014403mg             413   1e-137   
ref|XP_010485659.1|  PREDICTED: expansin-A13-like                       413   2e-137   
ref|XP_007032300.1|  Alpha-expansin 13, putative                        412   3e-137   
ref|XP_004490781.1|  PREDICTED: expansin-A13-like                       412   5e-137   
ref|XP_010507648.1|  PREDICTED: expansin-A13                            411   6e-137   
ref|XP_002526588.1|  Alpha-expansin 13 precursor, putative              411   7e-137   Ricinus communis
gb|KDP35736.1|  hypothetical protein JCGZ_10508                         410   2e-136   
emb|CDY49933.1|  BnaCnng18430D                                          410   3e-136   
ref|XP_004148906.1|  PREDICTED: expansin-A13-like                       410   3e-136   
gb|KHG09929.1|  Expansin-A13 -like protein                              411   4e-136   
emb|CDY21215.1|  BnaA01g34460D                                          409   5e-136   
ref|XP_009119148.1|  PREDICTED: expansin-A13-like                       409   8e-136   
ref|XP_008463163.1|  PREDICTED: expansin-A13                            408   1e-135   
ref|XP_007141964.1|  hypothetical protein PHAVU_008G240800g             406   6e-135   
ref|XP_010246197.1|  PREDICTED: expansin-A13-like                       406   9e-135   
gb|AAF26104.1|AC012328_7  putative expansin precursor                   405   3e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215822.1|  hypothetical protein PRUPE_ppa010067mg             404   3e-134   
ref|XP_003616175.1|  Expansin                                           404   4e-134   
ref|XP_010558665.1|  PREDICTED: expansin-A13                            403   9e-134   
ref|XP_009367104.1|  PREDICTED: expansin-A13-like                       402   2e-133   
ref|XP_010247559.1|  PREDICTED: expansin-A13-like                       400   2e-132   
ref|XP_009370570.1|  PREDICTED: expansin-A13-like                       400   2e-132   
gb|ADD14634.1|  expansin precursor                                      396   7e-132   Solanum tuberosum [potatoes]
ref|XP_011043871.1|  PREDICTED: expansin-A13-like                       398   1e-131   
ref|XP_002305908.2|  hypothetical protein POPTR_0004s07820g             397   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_008348617.1|  PREDICTED: expansin-A13-like                       395   1e-130   
ref|XP_008343138.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A13       396   2e-130   
ref|XP_011038336.1|  PREDICTED: expansin-A13-like                       392   3e-129   
gb|AGM16355.1|  alpha-expansin protein 13                               390   8e-129   
ref|XP_006372474.1|  expansin S1 precursor family protein               391   1e-128   
ref|XP_008227904.1|  PREDICTED: expansin-A13                            382   2e-125   
ref|XP_010675241.1|  PREDICTED: expansin-A13                            380   1e-124   
gb|EPS57403.1|  hypothetical protein M569_17415                         378   3e-124   
ref|XP_010549793.1|  PREDICTED: expansin-A13-like                       367   1e-119   
ref|XP_009386281.1|  PREDICTED: expansin-A10-like                       365   1e-118   
ref|XP_008775003.1|  PREDICTED: expansin-A10                            361   2e-117   
ref|NP_001130209.1|  hypothetical protein precursor                     357   7e-116   Zea mays [maize]
ref|NP_001131904.1|  alpha-expansin 13 precursor                        356   2e-115   Zea mays [maize]
ref|XP_009398000.1|  PREDICTED: expansin-A10-like                       356   5e-115   
ref|XP_002446990.1|  hypothetical protein SORBIDRAFT_06g026480          355   5e-115   Sorghum bicolor [broomcorn]
ref|XP_004976598.1|  PREDICTED: expansin-A10-like                       355   7e-115   
ref|XP_003553072.1|  PREDICTED: expansin-A13-like                       353   9e-114   
ref|XP_006652695.1|  PREDICTED: expansin-A10-like                       351   2e-113   
gb|KHN41032.1|  Expansin-A13                                            345   4e-112   
ref|XP_010908423.1|  PREDICTED: expansin-A10                            347   2e-111   
ref|XP_006855596.1|  hypothetical protein AMTR_s00044p00061510          344   9e-111   
gb|AAS48876.1|  expansin EXPA7                                          344   1e-110   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001053663.1|  Os04g0583500                                       343   2e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580384.1|  PREDICTED: expansin-A10                            343   2e-110   
ref|XP_003600633.1|  Expansin                                           344   2e-110   
ref|XP_004503092.1|  PREDICTED: expansin-A13-like                       342   1e-109   
ref|XP_007146985.1|  hypothetical protein PHAVU_006G086800g             324   7e-103   
gb|KDP47028.1|  hypothetical protein JCGZ_10755                         293   4e-91    
ref|XP_006422415.1|  hypothetical protein CICLE_v10029135mg             290   4e-90    
ref|XP_003539911.1|  PREDICTED: expansin-A16-like                       290   6e-90    
ref|XP_003527437.1|  PREDICTED: expansin-A16-like                       289   1e-89    
gb|ACU23784.1|  unknown                                                 289   2e-89    Glycine max [soybeans]
ref|XP_010913883.1|  PREDICTED: expansin-A16                            289   2e-89    
ref|XP_007132704.1|  hypothetical protein PHAVU_011G117600g             288   2e-89    
ref|XP_004293883.1|  PREDICTED: expansin-A13-like                       284   5e-89    
ref|XP_010025653.1|  PREDICTED: expansin-A20                            288   5e-89    
ref|XP_006384869.1|  alpha-expansin 20 precursor family protein         286   1e-88    
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        287   1e-88    
ref|XP_009358899.1|  PREDICTED: expansin-A20-like                       286   1e-88    
ref|XP_011040832.1|  PREDICTED: expansin-A20                            286   2e-88    
gb|AFK38509.1|  unknown                                                 286   2e-88    
ref|XP_004514456.1|  PREDICTED: expansin-A20-like                       286   2e-88    
ref|XP_008357310.1|  PREDICTED: expansin-A20-like                       285   3e-88    
ref|XP_008377830.1|  PREDICTED: expansin-A20-like                       285   4e-88    
ref|XP_007200593.1|  hypothetical protein PRUPE_ppa010203mg             285   8e-88    
ref|XP_008235916.1|  PREDICTED: expansin-A20                            284   1e-87    
gb|KEH39111.1|  expansin A1                                             284   1e-87    
ref|XP_002313572.1|  alpha-expansin 20 precursor family protein         283   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_010090720.1|  hypothetical protein L484_013742                   283   2e-87    
ref|XP_010266279.1|  PREDICTED: expansin-A20                            283   3e-87    
ref|XP_009350485.1|  PREDICTED: expansin-A20-like                       283   3e-87    
ref|XP_011016423.1|  PREDICTED: expansin-A20-like                       282   9e-87    
ref|XP_008451189.1|  PREDICTED: expansin-A16                            281   1e-86    
ref|XP_008382507.1|  PREDICTED: expansin-A20                            281   2e-86    
ref|XP_008805484.1|  PREDICTED: expansin-A16                            281   2e-86    
ref|XP_004144957.1|  PREDICTED: expansin-A16-like                       280   4e-86    
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        279   8e-86    
ref|XP_011000856.1|  PREDICTED: expansin-A20-like                       278   1e-85    
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        278   3e-85    
ref|XP_004290085.1|  PREDICTED: expansin-A20-like                       277   4e-85    
ref|XP_002514405.1|  Alpha-expansin 20 precursor, putative              277   6e-85    Ricinus communis
ref|XP_002283145.1|  PREDICTED: expansin-A20                            276   7e-85    Vitis vinifera
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        277   8e-85    
ref|XP_007043103.1|  Expansin A20, ALPHA 1.23,EXPA20 isoform 1          276   1e-84    
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        276   2e-84    
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       275   5e-84    
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        275   5e-84    
ref|XP_010690580.1|  PREDICTED: expansin-A16                            275   6e-84    
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        275   6e-84    
gb|ABN09939.1|  expansin A4                                             275   6e-84    Musa acuminata [banana]
gb|AFZ84552.1|  expansin 4                                              274   7e-84    
ref|XP_010516124.1|  PREDICTED: expansin-A16                            274   8e-84    
ref|XP_002525458.1|  Alpha-expansin 15 precursor, putative              274   9e-84    Ricinus communis
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       274   9e-84    
gb|KDO43109.1|  hypothetical protein CISIN_1g025809mg                   273   1e-83    
dbj|BAE06067.1|  expansin                                               274   1e-83    Sagittaria pygmaea
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        274   1e-83    
gb|AEX34709.2|  expansine 4                                             273   1e-83    
gb|KDP20276.1|  hypothetical protein JCGZ_06862                         273   2e-83    
gb|AEX34710.2|  expansine 4                                             272   2e-83    
ref|XP_010690765.1|  PREDICTED: expansin-A4                             273   2e-83    
gb|AEQ55270.1|  expansin                                                273   2e-83    
gb|AEX34708.2|  expansine 4                                             272   3e-83    
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        273   3e-83    
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        273   3e-83    
gb|ACM90160.1|  expansin 2                                              272   3e-83    Pyrus pyrifolia [sha li]
gb|ABN09940.1|  expansin A5                                             272   4e-83    Musa acuminata [banana]
dbj|BAC67193.1|  expansin                                               272   7e-83    Pyrus communis
gb|AIX87539.1|  EXP1                                                    272   7e-83    
gb|ABO32367.1|  expansin                                                271   7e-83    Litchi chinensis [litchi]
emb|CAH18933.1|  expansin                                               272   7e-83    Pyrus communis
ref|XP_006443365.1|  hypothetical protein CICLE_v10021887mg             271   7e-83    
ref|XP_002864447.1|  ATEXPA14                                           271   8e-83    
ref|XP_006280986.1|  hypothetical protein CARUB_v10026987mg             271   8e-83    
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        271   8e-83    
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        271   9e-83    
ref|XP_009384771.1|  PREDICTED: expansin-A2                             271   9e-83    
ref|XP_008464122.1|  PREDICTED: expansin-A4                             271   1e-82    
ref|XP_009411610.1|  PREDICTED: expansin-A16                            271   1e-82    
gb|AFB77224.1|  expansin 2                                              271   1e-82    
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        271   1e-82    
ref|XP_009380637.1|  PREDICTED: expansin-A4                             271   1e-82    
gb|KHG30766.1|  Expansin-A4 -like protein                               271   1e-82    
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        271   2e-82    
ref|XP_010450942.1|  PREDICTED: expansin-A14                            271   2e-82    
ref|XP_010483107.1|  PREDICTED: expansin-A14                            270   2e-82    
ref|NP_001284471.1|  expansin-A4 precursor                              271   2e-82    
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    271   2e-82    
ref|XP_006401349.1|  hypothetical protein EUTSA_v10014463mg             270   2e-82    
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       271   2e-82    
gb|AGF90535.1|  alpha-expansin 1                                        270   2e-82    
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          270   2e-82    
gb|ABN09942.1|  expansin A5                                             270   2e-82    Musa acuminata [banana]
dbj|BAH36862.1|  alpha expansin                                         270   2e-82    Rosa hybrid cultivar
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        270   3e-82    
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             270   4e-82    
gb|AAP48989.1|  expansin                                                270   4e-82    Sambucus nigra
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             270   4e-82    
ref|XP_002878036.1|  ATEXPA16                                           270   5e-82    
gb|AEN70881.1|  alpha-expansin 1                                        270   5e-82    
gb|KHG15821.1|  Expansin-A4 -like protein                               270   5e-82    
gb|AHZ41241.1|  EXPB1                                                   269   6e-82    
gb|ABD48785.1|  alpha-expansin 1                                        269   6e-82    Gossypium hirsutum [American cotton]
gb|ACD37706.1|  alpha expansin                                          269   6e-82    Gossypium hirsutum [American cotton]
gb|AFZ84551.1|  expansin 4                                              268   7e-82    
gb|ADY68810.1|  alpha-expansin 1                                        269   7e-82    
gb|AEN70891.1|  expansin                                                269   7e-82    
gb|AEX34711.2|  expansine 4                                             268   8e-82    
gb|ADY68817.1|  expansin                                                269   8e-82    
gb|AEN70871.1|  alpha-expansin 1                                        269   9e-82    
gb|ADY68814.1|  expansin                                                269   9e-82    
ref|XP_009399925.1|  PREDICTED: expansin-A15-like                       268   9e-82    
ref|XP_009388613.1|  PREDICTED: expansin-A7                             269   9e-82    
gb|ADY68811.1|  alpha-expansin 1                                        269   1e-81    
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        268   1e-81    
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       268   1e-81    
ref|XP_003552064.1|  PREDICTED: expansin-A4                             269   1e-81    
ref|XP_007030212.1|  Alpha-expansin 1 precursor                         271   1e-81    
ref|NP_191109.1|  expansin A16                                          268   1e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         268   1e-81    
gb|EYU28773.1|  hypothetical protein MIMGU_mgv1a012521mg                268   1e-81    
gb|ACA05164.1|  expansin 1                                              268   1e-81    Dimocarpus longan [longan]
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             268   1e-81    
gb|AEN70869.1|  alpha-expansin 1                                        268   1e-81    
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        268   2e-81    
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        268   2e-81    
ref|XP_010528418.1|  PREDICTED: expansin-A3                             268   2e-81    
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               268   2e-81    Ricinus communis
gb|ADY68818.1|  expansin                                                268   2e-81    
gb|AEN70885.1|  alpha-expansin 1                                        268   2e-81    
ref|XP_010551434.1|  PREDICTED: expansin-A10 isoform X2                 268   2e-81    
gb|AEN70907.1|  expansin                                                268   2e-81    
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        268   2e-81    
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        268   2e-81    
gb|AEN70867.1|  alpha-expansin 1                                        268   2e-81    
ref|XP_010276443.1|  PREDICTED: expansin-A15-like                       267   2e-81    
gb|AEN70887.1|  alpha-expansin 1                                        268   2e-81    
gb|AEN70914.1|  expansin                                                268   2e-81    
gb|AAY43797.1|  expansin                                                268   2e-81    Gossypium hirsutum [American cotton]
gb|AEN70868.1|  alpha-expansin 1                                        268   2e-81    
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        268   3e-81    
gb|KHG02505.1|  Expansin-A2                                             268   3e-81    
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             268   3e-81    
gb|ADY68815.1|  expansin                                                268   3e-81    
ref|XP_010256907.1|  PREDICTED: expansin-A4                             268   3e-81    
ref|NP_001289251.1|  expansin-A4-like precursor                         267   3e-81    
ref|XP_003552173.1|  PREDICTED: expansin-A4                             268   3e-81    
gb|AAR82851.1|  expansin-3                                              267   3e-81    Petunia x hybrida [garden petunia]
gb|ACJ70084.1|  expansin                                                267   3e-81    Diospyros kaki [Japanese persimmon]
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       267   3e-81    
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  267   3e-81    
gb|AEN70893.1|  expansin                                                268   3e-81    
gb|AAF32409.1|AF230276_1  alpha-expansin 3                              267   3e-81    Triphysaria versicolor
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  267   3e-81    
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        267   3e-81    
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        267   3e-81    
gb|AEN70901.1|  expansin                                                267   3e-81    
ref|XP_010093144.1|  hypothetical protein L484_005152                   268   4e-81    
ref|NP_200443.1|  expansin A14                                          267   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        267   4e-81    
gb|ACO07292.1|  expansin 10                                             267   4e-81    Cucumis sativus [cucumbers]
emb|CDP06606.1|  unnamed protein product                                267   4e-81    
gb|AEN70883.1|  alpha-expansin 1                                        267   4e-81    
ref|XP_010551433.1|  PREDICTED: expansin-A10 isoform X1                 267   4e-81    
ref|XP_010257816.1|  PREDICTED: expansin-A1                             267   4e-81    
gb|AEN70870.1|  alpha-expansin 1                                        267   4e-81    
ref|XP_002266625.1|  PREDICTED: expansin-A6                             267   4e-81    Vitis vinifera
gb|AEN70875.1|  alpha-expansin 1                                        267   5e-81    
emb|CDY07024.1|  BnaA04g22910D                                          267   5e-81    
emb|CDP09064.1|  unnamed protein product                                267   5e-81    
ref|XP_002298353.1|  alpha-expansin 1 family protein                    267   5e-81    Populus trichocarpa [western balsam poplar]
ref|XP_003543517.1|  PREDICTED: expansin-A4                             267   5e-81    
gb|AAM46997.1|AF512539_1  alpha-expansin precursor                      267   6e-81    Gossypium hirsutum [American cotton]
gb|ACK36943.1|  expansin                                                267   6e-81    Annona cherimola [cherimoya]
ref|NP_001242978.1|  expansin-A4-like precursor                         267   6e-81    
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         267   6e-81    
ref|NP_001288870.1|  expansin-A14 precursor                             266   7e-81    
emb|CDP04049.1|  unnamed protein product                                266   7e-81    
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             266   7e-81    
gb|AAM65722.1|  expansin                                                266   7e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802710.1|  PREDICTED: expansin-A4                             266   7e-81    
ref|XP_011089478.1|  PREDICTED: expansin-A6                             266   7e-81    
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       266   8e-81    
ref|XP_010264435.1|  PREDICTED: expansin-A4                             266   8e-81    
gb|ACN94264.1|  expansin                                                266   8e-81    Rehmannia glutinosa [Chinese foxglove]
ref|NP_001240136.1|  expansin-A1-like precursor                         266   8e-81    
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               266   8e-81    Ricinus communis
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        266   9e-81    
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         266   9e-81    Rumex palustris
gb|KHG12430.1|  Expansin-A4 -like protein                               266   9e-81    
ref|XP_007099524.1|  Expansin A8, ALPHA 1.11,EXPA8                      266   1e-80    
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        266   1e-80    
gb|AEN70900.1|  expansin                                                266   1e-80    
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      266   1e-80    Gossypium hirsutum [American cotton]
ref|XP_011075523.1|  PREDICTED: expansin-A10                            266   1e-80    
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       266   1e-80    
gb|AAR09170.1|  alpha-expansin 3                                        266   1e-80    Populus tremula x Populus tremuloides
emb|CDY20467.1|  BnaC04g05770D                                          266   1e-80    
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        266   1e-80    
ref|XP_003538409.1|  PREDICTED: expansin-A6                             266   1e-80    
ref|XP_002313434.1|  alpha-expansin 1 family protein                    266   1e-80    Populus trichocarpa [western balsam poplar]
ref|XP_010106493.1|  hypothetical protein L484_025251                   266   1e-80    
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       265   1e-80    
gb|AEN70895.1|  expansin                                                266   1e-80    
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             266   1e-80    
ref|XP_010678491.1|  PREDICTED: expansin-A10-like                       265   1e-80    
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             266   1e-80    
ref|XP_003563572.1|  PREDICTED: expansin-A7                             266   2e-80    
gb|KHG20113.1|  Expansin-A4 -like protein                               266   2e-80    
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        265   2e-80    
ref|XP_010043148.1|  PREDICTED: expansin-A4-like                        265   2e-80    
gb|ACT67493.1|  expansin A1                                             266   2e-80    
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        265   2e-80    
gb|ABL86681.1|  EX4                                                     266   2e-80    
ref|XP_010093601.1|  hypothetical protein L484_006489                   265   2e-80    
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         265   2e-80    
ref|XP_010937609.1|  PREDICTED: expansin-A4                             265   2e-80    
gb|ACK87022.1|  expansin                                                265   2e-80    
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             265   2e-80    
ref|XP_010111142.1|  hypothetical protein L484_010756                   265   2e-80    
gb|AAO92741.1|  expansin                                                265   2e-80    
ref|XP_006842458.1|  hypothetical protein AMTR_s00077p00063420          265   2e-80    
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        265   2e-80    
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        265   3e-80    
ref|XP_010651411.1|  PREDICTED: expansin-A10                            265   3e-80    
gb|ACM90161.1|  expansin 3                                              265   3e-80    
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        265   3e-80    
gb|AFZ78600.1|  expansin protein                                        265   3e-80    
ref|XP_011080662.1|  PREDICTED: expansin-A4-like                        265   3e-80    
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         265   3e-80    
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             265   3e-80    
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             265   3e-80    
gb|AFK38404.1|  unknown                                                 265   3e-80    
gb|ABL86680.1|  EXA1                                                    265   3e-80    
ref|NP_001265970.1|  expansin-A8-like precursor                         265   3e-80    
ref|XP_002312253.1|  expansin 4 family protein                          265   3e-80    
ref|XP_008783801.1|  PREDICTED: expansin-A10                            265   3e-80    
ref|XP_011013147.1|  PREDICTED: expansin-A1                             265   3e-80    
ref|XP_003616412.1|  Expansin                                           265   3e-80    
gb|ACK43222.1|  expansin 2                                              265   3e-80    
gb|ABO32366.1|  expansin                                                265   3e-80    
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             265   3e-80    
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         265   3e-80    
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        265   3e-80    
emb|CDY24952.1|  BnaC03g22200D                                          265   3e-80    
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        265   3e-80    
gb|AAC33529.1|  expansin                                                265   4e-80    
ref|XP_007157607.1|  hypothetical protein PHAVU_002G083600g             265   4e-80    
ref|XP_008808309.1|  PREDICTED: expansin-A2-like                        265   4e-80    
gb|ACK43884.1|  expansin                                                265   4e-80    
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        265   4e-80    
ref|XP_011035307.1|  PREDICTED: expansin-A6                             265   4e-80    
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        265   4e-80    
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        265   4e-80    
ref|XP_006398992.1|  hypothetical protein EUTSA_v10015496mg             265   4e-80    
ref|XP_008461679.1|  PREDICTED: expansin-A4                             265   4e-80    
ref|XP_010937180.1|  PREDICTED: expansin-A10-like                       264   4e-80    
ref|XP_006438715.1|  hypothetical protein CICLE_v10032548mg             264   4e-80    
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             264   4e-80    
ref|XP_002881524.1|  ATEXPA3                                            265   4e-80    
gb|KHG27586.1|  Expansin-A8 -like protein                               264   5e-80    
ref|NP_001281040.1|  expansin-A4-like precursor                         264   5e-80    
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          264   5e-80    
gb|ABR16833.1|  unknown                                                 264   5e-80    
gb|ACI02326.1|  expansion-related protein                               264   5e-80    
ref|NP_181300.1|  expansin-A3                                           264   5e-80    
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        264   6e-80    
ref|XP_007017076.1|  Expansin A8, ALPHA 1.11,EXPA8                      264   6e-80    
gb|ACA05166.1|  expansin 3                                              264   6e-80    
gb|AAF35901.1|AF230332_1  expansin 2                                    264   6e-80    
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             264   6e-80    
gb|ADN03964.1|  EXP1                                                    264   6e-80    
ref|XP_004302749.1|  PREDICTED: expansin-A4-like                        264   6e-80    
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        264   6e-80    
ref|XP_010033123.1|  PREDICTED: expansin-A4                             264   6e-80    
gb|ABQ45887.1|  expansin                                                263   6e-80    
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                264   6e-80    
ref|XP_010517036.1|  PREDICTED: expansin-A3                             264   7e-80    
gb|AAG13982.1|AF297521_1  expansin 1                                    264   7e-80    
gb|ADC35366.1|  alpha-expansin 3                                        264   7e-80    
gb|KFK36651.1|  alpha-expansin 4                                        264   7e-80    
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        264   7e-80    
gb|AEQ55272.1|  expansin                                                264   7e-80    
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        264   7e-80    
ref|XP_004297292.1|  PREDICTED: expansin-A1-like                        263   7e-80    
gb|ABB59694.1|  alpha-expansin 2                                        264   7e-80    
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        264   7e-80    
gb|AFZ78606.1|  expansin protein                                        264   7e-80    
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             264   8e-80    
gb|ABM54492.1|  expansin 2                                              264   8e-80    
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   264   8e-80    
gb|AAC39512.1|  expansin                                                264   8e-80    
gb|KHN18562.1|  Expansin-A15                                            264   8e-80    
ref|XP_008797331.1|  PREDICTED: expansin-A15-like                       263   8e-80    
ref|XP_003527088.1|  PREDICTED: expansin-A15-like                       263   8e-80    
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       263   9e-80    
ref|XP_008798561.1|  PREDICTED: expansin-A8-like                        263   9e-80    
gb|AEQ55269.1|  expansin                                                263   9e-80    
emb|CDY40233.1|  BnaA09g35150D                                          264   9e-80    
ref|NP_001051731.1|  Os03g0822000                                       264   9e-80    
gb|AAV85475.1|  expansin                                                263   9e-80    
gb|ABR18394.1|  unknown                                                 263   9e-80    
gb|AEQ55284.1|  expansin                                                263   9e-80    
ref|XP_003544930.1|  PREDICTED: expansin-A8                             263   1e-79    
ref|XP_006829796.1|  hypothetical protein AMTR_s00119p00058870          263   1e-79    
ref|NP_001288942.1|  expansin-A16 precursor                             263   1e-79    
gb|AGR44457.1|  expansin 4                                              263   1e-79    
ref|XP_002881669.1|  ATEXPA4                                            263   1e-79    
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         263   1e-79    
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        263   1e-79    
ref|XP_009387743.1|  PREDICTED: expansin-A2-like                        263   1e-79    
ref|XP_010505648.1|  PREDICTED: expansin-A4                             263   1e-79    
gb|ABI94216.1|  EXP2                                                    261   1e-79    
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        263   1e-79    
ref|NP_001288852.1|  expansin-A3 precursor                              263   1e-79    
ref|XP_009387755.1|  PREDICTED: expansin-A2                             263   1e-79    
emb|CBI15823.3|  unnamed protein product                                262   1e-79    
gb|AAF17570.1|AF202119_1  alpha-expansin                                263   1e-79    
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       263   1e-79    
gb|AAR09168.1|  alpha-expansin 1                                        263   1e-79    
emb|CDX76090.1|  BnaA04g03540D                                          263   1e-79    
gb|KHN40987.1|  Expansin-A8                                             262   2e-79    
ref|XP_006600699.1|  PREDICTED: expansin-A15-like isoform X2            263   2e-79    
gb|KEH22886.1|  expansin-A1-like protein                                263   2e-79    
gb|KHG29956.1|  Expansin-A4 -like protein                               263   2e-79    
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        263   2e-79    
ref|XP_008648280.1|  PREDICTED: alpha-expansin 5 isoform X1             262   2e-79    
ref|XP_010534508.1|  PREDICTED: expansin-A4                             263   2e-79    
ref|XP_010521846.1|  PREDICTED: expansin-A6                             263   2e-79    
emb|CDX74942.1|  BnaA05g06880D                                          263   2e-79    
gb|ACK43886.1|  expansin                                                263   2e-79    
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             263   2e-79    
ref|XP_003549683.2|  PREDICTED: expansin-A15-like isoform X1            263   2e-79    
gb|ABA62612.1|  expansin                                                262   2e-79    
gb|AAF17571.1|AF202120_1  alpha-expansin                                262   2e-79    
gb|KHG29916.1|  Expansin-A8 -like protein                               263   2e-79    
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               262   2e-79    
emb|CDP19176.1|  unnamed protein product                                262   2e-79    
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        263   2e-79    
gb|EYU22406.1|  hypothetical protein MIMGU_mgv1a012585mg                262   2e-79    
ref|XP_010525408.1|  PREDICTED: expansin-A8                             262   2e-79    
ref|XP_003519289.1|  PREDICTED: expansin-A8-like                        262   2e-79    
ref|XP_010108685.1|  hypothetical protein L484_015671                   262   2e-79    
ref|XP_002283530.1|  PREDICTED: expansin-A4                             263   2e-79    
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        263   2e-79    
ref|XP_010030057.1|  PREDICTED: expansin-A15-like                       262   2e-79    
ref|XP_008393347.1|  PREDICTED: expansin-A1-like                        262   2e-79    
ref|XP_003523015.1|  PREDICTED: expansin-A15-like                       262   2e-79    
gb|ADC35365.1|  alpha-expansin 2                                        262   3e-79    
gb|AAS48878.1|  expansin EXPA9                                          263   3e-79    
gb|AEQ55268.1|  expansin                                                262   3e-79    
ref|XP_002319704.2|  expansin S1 precursor family protein               262   3e-79    
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         262   3e-79    
gb|ABK93541.1|  unknown                                                 262   3e-79    
ref|XP_008780525.1|  PREDICTED: expansin-A15-like isoform X2            262   3e-79    
ref|XP_011048141.1|  PREDICTED: expansin-A15-like                       262   3e-79    
ref|XP_008389456.1|  PREDICTED: expansin-A10                            262   3e-79    
dbj|BAC67191.1|  expansin                                               262   3e-79    
ref|XP_002315043.1|  expansin 4 family protein                          262   3e-79    
ref|XP_002276565.3|  PREDICTED: expansin-A4                             262   3e-79    
gb|AFQ21787.1|  EXP4 protein                                            262   3e-79    
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    262   3e-79    
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             262   3e-79    
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        262   3e-79    
emb|CDP00110.1|  unnamed protein product                                262   4e-79    
gb|AGF90536.1|  expansin 2                                              261   4e-79    
ref|XP_009406842.1|  PREDICTED: expansin-A15-like                       261   4e-79    
gb|ABJ90221.1|  expansin 2                                              262   4e-79    
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        262   4e-79    
gb|AEE69072.1|  expansin-5                                              262   4e-79    
emb|CDY07642.1|  BnaA03g18690D                                          262   4e-79    
ref|NP_181500.1|  expansin A4                                           262   4e-79    
emb|CAN73252.1|  hypothetical protein VITISV_027049                     261   4e-79    
emb|CDY14120.1|  BnaC02g02370D                                          262   4e-79    
ref|XP_002522457.1|  Alpha-expansin 1 precursor, putative               261   4e-79    
ref|NP_001240113.1|  expansin precursor                                 261   4e-79    
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          262   4e-79    
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             262   4e-79    
gb|ABY65114.1|  putative expansin                                       261   4e-79    
ref|XP_011027216.1|  PREDICTED: expansin-A4                             262   4e-79    
gb|KHG18125.1|  Expansin-A10 -like protein                              261   4e-79    
gb|KEH39447.1|  expansin A10                                            262   4e-79    
dbj|BAJ10397.1|  alpha-expansin                                         261   4e-79    
ref|XP_010111457.1|  hypothetical protein L484_021280                   262   5e-79    
gb|ACJ48968.2|  expansin                                                262   5e-79    
ref|XP_003563609.1|  PREDICTED: expansin-A16                            262   5e-79    
gb|KHG01029.1|  Expansin-A15 -like protein                              261   5e-79    
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             261   5e-79    
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        262   5e-79    
emb|CDY02943.1|  BnaC04g25430D                                          262   5e-79    
ref|XP_008384848.1|  PREDICTED: expansin-A4                             262   5e-79    
ref|XP_008367551.1|  PREDICTED: expansin-A1-like                        261   5e-79    
ref|XP_002283358.1|  PREDICTED: expansin-A4                             261   5e-79    
gb|ACA05165.1|  expansin 2                                              261   5e-79    
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             261   5e-79    
ref|XP_009399910.1|  PREDICTED: expansin-A2-like                        261   6e-79    
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         261   6e-79    
ref|XP_008223717.1|  PREDICTED: expansin-A4                             261   6e-79    
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        261   6e-79    
ref|NP_001288961.1|  expansin-A4 precursor                              261   6e-79    
emb|CDY69611.1|  BnaCnng64440D                                          261   6e-79    
gb|AEQ55274.1|  expansin                                                261   6e-79    
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        261   7e-79    
ref|XP_010253098.1|  PREDICTED: expansin-A8-like                        261   7e-79    
gb|KHG24991.1|  Expansin-A4 -like protein                               261   7e-79    
ref|XP_004294733.1|  PREDICTED: expansin-A8-like                        261   7e-79    
emb|CDP13911.1|  unnamed protein product                                260   7e-79    
ref|XP_011070988.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A10...    261   7e-79    
emb|CDX70161.1|  BnaA10g25100D                                          261   7e-79    
ref|XP_004300427.1|  PREDICTED: expansin-A4-like                        261   7e-79    
ref|XP_008374554.1|  PREDICTED: expansin-A1-like                        261   8e-79    
gb|KHN26255.1|  Expansin-A15                                            260   8e-79    
ref|XP_009364387.1|  PREDICTED: expansin-A4                             261   8e-79    
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             261   8e-79    
gb|ACF84785.1|  unknown                                                 261   9e-79    
gb|ABK24904.1|  unknown                                                 261   9e-79    
gb|AEU08407.1|  expansin 2                                              261   9e-79    
ref|NP_001289209.1|  expansin precursor                                 261   9e-79    
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        261   9e-79    
ref|XP_002988909.1|  hypothetical protein SELMODRAFT_235643             261   9e-79    
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        261   9e-79    
ref|XP_010066900.1|  PREDICTED: expansin-A1                             261   9e-79    
gb|AEQ55290.1|  expansin                                                261   9e-79    
gb|AFK24457.1|  expansin 4                                              261   1e-78    
gb|AEQ55275.1|  expansin                                                261   1e-78    
ref|XP_007226005.1|  hypothetical protein PRUPE_ppa010379mg             261   1e-78    
gb|AAK48848.1|AF350939_1  expansin                                      261   1e-78    
gb|ABM66452.1|  expansin                                                261   1e-78    
emb|CAA59470.1|  orf                                                    261   1e-78    
ref|XP_009360325.1|  PREDICTED: expansin-A1                             261   1e-78    



>ref|XP_009770971.1| PREDICTED: expansin-A13-like [Nicotiana sylvestris]
Length=259

 Score =   454 bits (1167),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 214/251 (85%), Positives = 230/251 (92%), Gaps = 6/251 (2%)
 Frame = +2

Query  758   SKTSLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGK  937
             S TS   SH  WSP+S+       +EWRPARATYYA ADPRD VGGACGYGDLE++GYGK
Sbjct  14    STTSFAHSHYNWSPSSTT------TEWRPARATYYAAADPRDVVGGACGYGDLERNGYGK  67

Query  938   ATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCN  1117
             +TAGLSTVLF+RGQICGACF+VRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCN
Sbjct  68    STAGLSTVLFDRGQICGACFQVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCN  127

Query  1118  PPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGT  1297
             PPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFT+ GAGIF+SVLI NVAG 
Sbjct  128   PPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTLDGAGIFLSVLISNVAGA  187

Query  1298  GDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWN  1477
             GDI+A KIKGSRTGWL MGRNWGQNWHINA+L++QPLSFEITSSD VTLTSYNVAPKNWN
Sbjct  188   GDIVAAKIKGSRTGWLSMGRNWGQNWHINADLKNQPLSFEITSSDGVTLTSYNVAPKNWN  247

Query  1478  YGQTFEGKQFE  1510
             +GQTF+GKQFE
Sbjct  248   FGQTFQGKQFE  258



>ref|XP_009591327.1| PREDICTED: expansin-A13-like [Nicotiana tomentosiformis]
Length=259

 Score =   449 bits (1156),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 229/252 (91%), Gaps = 6/252 (2%)
 Frame = +2

Query  758   SKTSLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGK  937
             S  S   SH  WSP+S+       +EWRPARATYYA ADPRD VGGACGYGDLE++GYGK
Sbjct  14    STRSFAHSHYNWSPSSTT------TEWRPARATYYAAADPRDVVGGACGYGDLERNGYGK  67

Query  938   ATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCN  1117
             +TAGLSTVLF+RGQICGACF+VRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCN
Sbjct  68    STAGLSTVLFDRGQICGACFQVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCN  127

Query  1118  PPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGT  1297
             PPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFT+ GAGIF+SVL+ NVA  
Sbjct  128   PPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTLDGAGIFLSVLVSNVAAA  187

Query  1298  GDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWN  1477
             GDI+A KIKGSRTGWL MGRNWGQNWHINA+L++QPLSFEITSSD VTLTSYNVAPKNWN
Sbjct  188   GDIVAAKIKGSRTGWLSMGRNWGQNWHINADLKNQPLSFEITSSDGVTLTSYNVAPKNWN  247

Query  1478  YGQTFEGKQFEA  1513
             +GQTF+GKQFE+
Sbjct  248   FGQTFQGKQFES  259



>ref|XP_009612177.1| PREDICTED: expansin-A13-like [Nicotiana tomentosiformis]
Length=266

 Score =   448 bits (1152),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 235/252 (93%), Gaps = 1/252 (0%)
 Frame = +2

Query  755   FSKTSLVFSHDGWSPTSSAAAA-SLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGY  931
             +S+T LV SH  WSP+SS+++  + QSEWRPARATYYA  DPRD VGGACGYGDLE++GY
Sbjct  13    YSETPLVQSHYNWSPSSSSSSPSTFQSEWRPARATYYAATDPRDVVGGACGYGDLERTGY  72

Query  932   GKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGH  1111
             GKATAGLSTVLF++GQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFE DGGGH
Sbjct  73    GKATAGLSTVLFDKGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEVDGGGH  132

Query  1112  CNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVA  1291
             CNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFT+ GAGIF+SVL+ NVA
Sbjct  133   CNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTMGGAGIFLSVLVSNVA  192

Query  1292  GTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKN  1471
             G GDI A KIKGSRTGWLPMGRNWGQNWHINA+L++QPLSFEITSSD VTLTSYNVAPKN
Sbjct  193   GAGDIDAAKIKGSRTGWLPMGRNWGQNWHINADLKNQPLSFEITSSDGVTLTSYNVAPKN  252

Query  1472  WNYGQTFEGKQF  1507
             WN+GQTFEGKQF
Sbjct  253   WNFGQTFEGKQF  264



>ref|XP_009760108.1| PREDICTED: expansin-A13-like [Nicotiana sylvestris]
Length=266

 Score =   446 bits (1148),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = +2

Query  755   FSKTSLVFSHDGWSPTSSAAAA-SLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGY  931
             +S T LV SH  WSP+SS+++  + QSEWRPARATYYA  DPRD VGGACGYGDLE++GY
Sbjct  13    YSATPLVQSHYNWSPSSSSSSPSTFQSEWRPARATYYAATDPRDVVGGACGYGDLERTGY  72

Query  932   GKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGH  1111
             GKATAGLSTVLF++GQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFE DGGGH
Sbjct  73    GKATAGLSTVLFDKGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEVDGGGH  132

Query  1112  CNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVA  1291
             CNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFT+ GAGIF+SVL+ NVA
Sbjct  133   CNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTMGGAGIFLSVLVSNVA  192

Query  1292  GTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKN  1471
             G GDI+A KIKGSRTGWLPMGRNWGQNWHINA+L++QPLSFEITSSD VTLTSYNVAPK 
Sbjct  193   GAGDIVAAKIKGSRTGWLPMGRNWGQNWHINADLKNQPLSFEITSSDGVTLTSYNVAPKI  252

Query  1472  WNYGQTFEGKQF  1507
             WN+GQTFEGKQF
Sbjct  253   WNFGQTFEGKQF  264



>ref|XP_006348172.1| PREDICTED: expansin-A13 [Solanum tuberosum]
Length=267

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 213/253 (84%), Positives = 234/253 (92%), Gaps = 2/253 (1%)
 Frame = +2

Query  755   FSKTSLVFSHDGWSPTSSAAAA--SLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSG  928
             FS T  V SH  WSP+SS+ ++  + QSEWRPARATYYA ADPRD VGGACGYGDLE++G
Sbjct  13    FSPTPFVHSHYNWSPSSSSTSSSSNFQSEWRPARATYYAAADPRDVVGGACGYGDLERNG  72

Query  929   YGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGG  1108
             YGKATAGLSTVLF++GQICGAC+EVRCVEDLRWCIPGTSIIVTATNFCAPNYGF+ DGGG
Sbjct  73    YGKATAGLSTVLFDKGQICGACYEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFDLDGGG  132

Query  1109  HCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNV  1288
             HCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTV G+GIF+SVLI NV
Sbjct  133   HCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVGGSGIFLSVLISNV  192

Query  1289  AGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPK  1468
             AG+GDI+A K+KGSRTGWLPMGRNWGQNWHINA+L++QPLSFE+TS D  TLTSYNVAPK
Sbjct  193   AGSGDIVAAKVKGSRTGWLPMGRNWGQNWHINADLKNQPLSFEMTSGDGATLTSYNVAPK  252

Query  1469  NWNYGQTFEGKQF  1507
             NWN+GQTFEGKQF
Sbjct  253   NWNFGQTFEGKQF  265



>ref|XP_004232677.1| PREDICTED: expansin-A13-like [Solanum lycopersicum]
Length=264

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 211/251 (84%), Positives = 232/251 (92%), Gaps = 1/251 (0%)
 Frame = +2

Query  755   FSKTSLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYG  934
             FS T  V SH  WS  SS++ ++ QSEWRPARATYYA ADPRD VGGACGYGDLE++GYG
Sbjct  13    FSPTPFVHSHYNWS-PSSSSTSNFQSEWRPARATYYAAADPRDVVGGACGYGDLERNGYG  71

Query  935   KATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHC  1114
             KATAGLSTVLF++GQICGAC+EVRCVEDLRWCIPGTSIIVTATNFCAPNYGF+ DGGGHC
Sbjct  72    KATAGLSTVLFDKGQICGACYEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFDLDGGGHC  131

Query  1115  NPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAG  1294
             NPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFT+ G+GIF+SVLI NVAG
Sbjct  132   NPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTLGGSGIFLSVLISNVAG  191

Query  1295  TGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNW  1474
             +GDI+A K+KGSRTGWLPMGRNWGQNWHINA+L++QPLSFE+TS D  TLTSYNVAPKNW
Sbjct  192   SGDIVAAKVKGSRTGWLPMGRNWGQNWHINADLKNQPLSFEMTSGDGATLTSYNVAPKNW  251

Query  1475  NYGQTFEGKQF  1507
             N+GQTFEGKQF
Sbjct  252   NFGQTFEGKQF  262



>ref|XP_006343301.1| PREDICTED: expansin-A13-like [Solanum tuberosum]
Length=265

 Score =   439 bits (1130),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 235/253 (93%), Gaps = 1/253 (0%)
 Frame = +2

Query  758   SKTSLVFSHDGWSPTSSAAAASLQS-EWRPARATYYAPADPRDAVGGACGYGDLEQSGYG  934
             S  SL  SH  WSP+SS+ AA+    EWRP RATYYAPADPRD VGGACGYGDLE+SGYG
Sbjct  13    STFSLAHSHYNWSPSSSSTAAAAHPSEWRPGRATYYAPADPRDVVGGACGYGDLERSGYG  72

Query  935   KATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHC  1114
             K+TAGLSTVLFE+GQICGACFEVRCVE+LRWCIPGTSIIVTATNFCAPNYGFEPDGGGHC
Sbjct  73    KSTAGLSTVLFEKGQICGACFEVRCVEELRWCIPGTSIIVTATNFCAPNYGFEPDGGGHC  132

Query  1115  NPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAG  1294
             NPPNAHFVLPIEAFEKIAIWKASNMP+QYRRIKCRKEGGVRFT++GAGIF+SVLI NVAG
Sbjct  133   NPPNAHFVLPIEAFEKIAIWKASNMPVQYRRIKCRKEGGVRFTINGAGIFLSVLISNVAG  192

Query  1295  TGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNW  1474
             TGDI+A K+KGSRTGWLPMGR WGQNWHI+A+L++QPL+FEITSSD VTLTSYNVAPK W
Sbjct  193   TGDIVAAKVKGSRTGWLPMGRIWGQNWHISADLKNQPLAFEITSSDGVTLTSYNVAPKIW  252

Query  1475  NYGQTFEGKQFEA  1513
             N+GQTF+GKQFE+
Sbjct  253   NFGQTFQGKQFES  265



>ref|NP_001234078.1| expansin A3 precursor [Solanum lycopersicum]
 gb|AAD13631.1| expansin precursor [Solanum lycopersicum]
Length=267

 Score =   439 bits (1130),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 214/255 (84%), Positives = 234/255 (92%), Gaps = 3/255 (1%)
 Frame = +2

Query  758   SKTSLVFSHDGWSPTSSAAAASLQ---SEWRPARATYYAPADPRDAVGGACGYGDLEQSG  928
             S  SL  SH  WSP+SS+  A+     SEWRP RATYYAPADPRD VGGACGYGDLE+SG
Sbjct  13    STFSLAHSHYNWSPSSSSTVAAAAAHPSEWRPGRATYYAPADPRDVVGGACGYGDLERSG  72

Query  929   YGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGG  1108
             YGK+TAGLSTVLFE+GQICGACFEVRCVE+LRWCIPGTSIIVTATNFCAPNYGFEPDGGG
Sbjct  73    YGKSTAGLSTVLFEKGQICGACFEVRCVEELRWCIPGTSIIVTATNFCAPNYGFEPDGGG  132

Query  1109  HCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNV  1288
             HCNPPNAHFVLPIEAFEKIAIWKASNMP+QYRRIKCRKEGGVRFT++GAGIF+SVLI NV
Sbjct  133   HCNPPNAHFVLPIEAFEKIAIWKASNMPVQYRRIKCRKEGGVRFTINGAGIFLSVLISNV  192

Query  1289  AGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPK  1468
             AG GDI+A K+KGSRTGWLPMGR WGQNWHI+A+L++QPLSFEITSSD VTLTSYNVAPK
Sbjct  193   AGAGDIVAAKVKGSRTGWLPMGRIWGQNWHISADLKNQPLSFEITSSDGVTLTSYNVAPK  252

Query  1469  NWNYGQTFEGKQFEA  1513
              WN+GQTF+GKQFE+
Sbjct  253   IWNFGQTFQGKQFES  267



>ref|XP_006430408.1| hypothetical protein CICLE_v10012472mg [Citrus clementina]
 ref|XP_006481960.1| PREDICTED: expansin-A13-like [Citrus sinensis]
 gb|ESR43648.1| hypothetical protein CICLE_v10012472mg [Citrus clementina]
Length=267

 Score =   434 bits (1115),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 227/249 (91%), Gaps = 2/249 (1%)
 Frame = +2

Query  767   SLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATA  946
             + V SH  ++ TS++  +  QSEWRPARAT+YA +DPRD VGGACGYGDLE++GYG+ATA
Sbjct  21    TTVTSHYNYNFTSTSPPS--QSEWRPARATFYAASDPRDKVGGACGYGDLEKAGYGQATA  78

Query  947   GLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPN  1126
             GLS +LFERGQICGACFE+RCVED+RWCIPGTSIIVT TNFCAPNYGF PDGGGHCNPPN
Sbjct  79    GLSEILFERGQICGACFELRCVEDIRWCIPGTSIIVTVTNFCAPNYGFNPDGGGHCNPPN  138

Query  1127  AHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDI  1306
              HFVLPIEAFEKIAIWKA NMP+QYRRIKCRKEGG+RFT+ G+ IFIS LI NVAG GD+
Sbjct  139   KHFVLPIEAFEKIAIWKAGNMPVQYRRIKCRKEGGIRFTIDGSDIFISALISNVAGAGDV  198

Query  1307  IAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQ  1486
             +AVKIKGSRTGWLPMGRNWGQNWHINANL++QPLSFE+T+SD +T+TSYNVAPKNWN+GQ
Sbjct  199   VAVKIKGSRTGWLPMGRNWGQNWHINANLKNQPLSFEVTTSDGLTVTSYNVAPKNWNFGQ  258

Query  1487  TFEGKQFEA  1513
             TFEGKQFE+
Sbjct  259   TFEGKQFES  267



>ref|XP_011087744.1| PREDICTED: expansin-A13 [Sesamum indicum]
Length=302

 Score =   426 bits (1096),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 205/253 (81%), Positives = 227/253 (90%), Gaps = 11/253 (4%)
 Frame = +2

Query  773   VFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGL  952
             V SH  + P++ +AA   QS+W+ ARATYYA ADP DAVGGACGYGDLE++GYGKATA L
Sbjct  55    VRSH--YFPSTPSAA---QSDWKSARATYYAAADPIDAVGGACGYGDLEKNGYGKATAAL  109

Query  953   STVLFERGQICGACFEVRCVEDLRWCIPGTSIIVT------ATNFCAPNYGFEPDGGGHC  1114
             STVLFE+GQICGACFE+RCVEDLRWCIPGTSIIVT      ATNFCAPNYGFE DGGG C
Sbjct  110   STVLFEKGQICGACFEIRCVEDLRWCIPGTSIIVTTSITVTATNFCAPNYGFEADGGGRC  169

Query  1115  NPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAG  1294
             NPPN+HFVLPIE+FEKIAIWKASNMP+QYRRI+CRKEGGVRFT+ GAGIF+SVLI NVAG
Sbjct  170   NPPNSHFVLPIESFEKIAIWKASNMPVQYRRIRCRKEGGVRFTIGGAGIFLSVLISNVAG  229

Query  1295  TGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNW  1474
              GD+ AVKIKGSRTGWLPMGRNWGQNWHINA+L++QPLSFEITSSD VTLTSYNVAPKNW
Sbjct  230   AGDVAAVKIKGSRTGWLPMGRNWGQNWHINADLKNQPLSFEITSSDGVTLTSYNVAPKNW  289

Query  1475  NYGQTFEGKQFEA  1513
              +GQTFEGKQFE+
Sbjct  290   EFGQTFEGKQFES  302



>ref|XP_010062321.1| PREDICTED: expansin-A13 [Eucalyptus grandis]
 gb|KCW69451.1| hypothetical protein EUGRSUZ_F02908 [Eucalyptus grandis]
Length=268

 Score =   425 bits (1092),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 195/227 (86%), Positives = 211/227 (93%), Gaps = 0/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWR ARATYYA ADPRDAVGGACGYGDL ++GYG ATAGLS  LFERGQICGACFE+RCV
Sbjct  42    EWRSARATYYAAADPRDAVGGACGYGDLARAGYGMATAGLSESLFERGQICGACFELRCV  101

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
              DLRWCIPGTS+IVTATNFCAPNYGF PD GGHCNPPN HFVLPIEAFEKIA+WKA NMP
Sbjct  102   NDLRWCIPGTSLIVTATNFCAPNYGFAPDAGGHCNPPNKHFVLPIEAFEKIALWKAGNMP  161

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRIKCRKEGG+RFTV G+GIFISVLIRNVAG GDI A+KIKGS+TGWLPMGRNWGQN
Sbjct  162   VQYRRIKCRKEGGIRFTVDGSGIFISVLIRNVAGAGDIAAIKIKGSKTGWLPMGRNWGQN  221

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             WHINA+LR+QPLSFE+TSSD VT+TSYNVAPKNW +GQTFEGKQFE+
Sbjct  222   WHINADLRNQPLSFEVTSSDGVTVTSYNVAPKNWIFGQTFEGKQFES  268



>gb|EYU26535.1| hypothetical protein MIMGU_mgv1a011992mg [Erythranthe guttata]
Length=264

 Score =   422 bits (1086),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 220/235 (94%), Gaps = 0/235 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S  +A+ QS+W+ ARATYYA ADP DAVGGACGYGDL ++GYGKATAGLSTVLFE+GQIC
Sbjct  30    STPSAASQSDWKSARATYYAAADPIDAVGGACGYGDLSRNGYGKATAGLSTVLFEKGQIC  89

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             GACFE+RCVEDLRWCIPGTSIIVTATNFCAPNYGF+ DGGG CNPPN+HFVLPIE+FEKI
Sbjct  90    GACFEIRCVEDLRWCIPGTSIIVTATNFCAPNYGFDADGGGRCNPPNSHFVLPIESFEKI  149

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             AIWKASNMP+QYRRI+CRKEGGVRF++ GAGIF+SVLI NVAG GD+ AVKIKGS TGWL
Sbjct  150   AIWKASNMPVQYRRIRCRKEGGVRFSMGGAGIFLSVLISNVAGAGDVAAVKIKGSVTGWL  209

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             PMGRNWGQNWHINA+L++QPLSFEITSSD +TLTSYNVAPKNW++GQ+FEGKQF+
Sbjct  210   PMGRNWGQNWHINADLKNQPLSFEITSSDGITLTSYNVAPKNWDFGQSFEGKQFD  264



>ref|NP_566197.1| expansin A13 [Arabidopsis thaliana]
 sp|Q9M9P0.2|EXP13_ARATH RecName: Full=Expansin-A13; Short=AtEXPA13; AltName: Full=Alpha-expansin-13; 
Short=At-EXP13; Short=AtEx13; AltName: Full=Ath-ExpAlpha-1.22; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24089.1| putative expansin precursor protein [Arabidopsis thaliana]
 gb|AAM45038.1| putative expansin precursor protein [Arabidopsis thaliana]
 gb|AEE73914.1| expansin A13 [Arabidopsis thaliana]
Length=266

 Score =   421 bits (1082),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/226 (86%), Positives = 209/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRDAVGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  39    EWRPARATYYAATNPRDAVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  99    DDLRWCIPGTSIILTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  158

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CRKEG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  159   VQYRRINCRKEGSMRFTVDGGGIFISVLITNVAGSGDIAAVKIKGSRTGWLPMGRNWGQN  218

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+LR+Q LSFE+TSSDR T+TSYNV+PKNWNYGQTFEGKQFE
Sbjct  219   WHINADLRNQALSFEVTSSDRSTVTSYNVSPKNWNYGQTFEGKQFE  264



>ref|XP_002884363.1| ATEXPA13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60622.1| ATEXPA13 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   421 bits (1081),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 210/226 (93%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA ++PRDAVGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  39    EWRPARATYYAASNPRDAVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIVTATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  99    DDLRWCIPGTSIIVTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  158

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFTV G GIFISVLI NVAG+GD+ AVKIKGSRTGWLPMGRNWGQN
Sbjct  159   VQYRRINCRREGSMRFTVDGGGIFISVLITNVAGSGDVAAVKIKGSRTGWLPMGRNWGQN  218

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+TSSDR T+TSYNV+PKNWNYGQTFEGKQFE
Sbjct  219   WHINADLKNQALSFEVTSSDRSTVTSYNVSPKNWNYGQTFEGKQFE  264



>emb|CDP01693.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   420 bits (1080),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/251 (81%), Positives = 223/251 (89%), Gaps = 2/251 (1%)
 Frame = +2

Query  758   SKTSLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGK  937
             S   LV SH  +  + S++  S  +EWR ARATYYA A+P D VGGACGYGDLE+ GYGK
Sbjct  22    SLPQLVRSH--YQYSPSSSTPSSYTEWRSARATYYAAAEPGDPVGGACGYGDLEKMGYGK  79

Query  938   ATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCN  1117
             ATA LSTVLFE+GQICGACF+VRCVEDLRWCIPGTSIIVTATNFCAPNYGFE DGGGHCN
Sbjct  80    ATAALSTVLFEKGQICGACFQVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEADGGGHCN  139

Query  1118  PPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGT  1297
              PNAHFVLPIEAFEKIAIWKASNMPIQYRR+KCRKEGGVRF V+GAGIF+SVLI NVAG 
Sbjct  140   FPNAHFVLPIEAFEKIAIWKASNMPIQYRRVKCRKEGGVRFAVNGAGIFLSVLISNVAGA  199

Query  1298  GDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWN  1477
             GDI AVKIKGSRTGWLPMGRNWGQNWHINA+L++QPLSFE+T+ D VTL SY+VAPK+WN
Sbjct  200   GDIAAVKIKGSRTGWLPMGRNWGQNWHINADLKNQPLSFELTNGDGVTLASYSVAPKDWN  259

Query  1478  YGQTFEGKQFE  1510
             YGQTFEGKQF+
Sbjct  260   YGQTFEGKQFD  270



>gb|AAM67333.1| Alpha-expansin 13 precursor (At-EXP13) (AtEx13) (Ath-ExpAlpha-1.22) 
[Arabidopsis thaliana]
Length=266

 Score =   419 bits (1078),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 194/226 (86%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRDAVGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  39    EWRPARATYYAATNPRDAVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  99    DDLRWCIPGTSIILTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  158

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CRKEG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  159   VQYRRINCRKEGSMRFTVDGGGIFISVLITNVAGSGDIAAVKIKGSRTGWLPMGRNWGQN  218

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L +Q LSFE+TSSDR T+TSYNV+PKNWNYGQTFEGKQFE
Sbjct  219   WHINADLSNQALSFEVTSSDRSTVTSYNVSPKNWNYGQTFEGKQFE  264



>gb|KFK37765.1| hypothetical protein AALP_AA3G026800 [Arabis alpina]
Length=269

 Score =   418 bits (1074),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 210/226 (93%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA ++PRDAVGGACGYGDL +SGYG AT G+S  LF+RGQICGACFEVRCV
Sbjct  42    EWRPARATYYAASNPRDAVGGACGYGDLVKSGYGMATVGVSETLFDRGQICGACFEVRCV  101

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  102   DDLRWCIPGTSIILTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  161

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CRKEG +RFTV G GIF+SVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  162   VQYRRINCRKEGSIRFTVDGGGIFVSVLITNVAGSGDIAAVKIKGSRTGWLPMGRNWGQN  221

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+T+SDR T+TSYNVAP+NWN+GQTFEGKQFE
Sbjct  222   WHINADLKNQALSFEVTASDRSTVTSYNVAPRNWNFGQTFEGKQFE  267



>ref|XP_003544353.2| PREDICTED: expansin-A13-like [Glycine max]
Length=266

 Score =   416 bits (1070),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 196/252 (78%), Positives = 218/252 (87%), Gaps = 3/252 (1%)
 Frame = +2

Query  755   FSKTSLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYG  934
              S + LV SH  +S  S  A+ +  SEWR ARATYYAPADPRD VGGACGYGDL + GYG
Sbjct  17    LSSSPLVTSH--YSSPSLEASPTF-SEWRSARATYYAPADPRDVVGGACGYGDLVKGGYG  73

Query  935   KATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHC  1114
              AT GLS  LFERGQICGACFE+RCVED+RWCIPGTSIIVTATNFCAPNYGF  DGGGHC
Sbjct  74    MATVGLSEALFERGQICGACFELRCVEDMRWCIPGTSIIVTATNFCAPNYGFTSDGGGHC  133

Query  1115  NPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAG  1294
             NPPN HFVLPIEAFEKIAIWKA NMP+QYRRIKCRKEGG+RFTV+G+GIFISVLI NVAG
Sbjct  134   NPPNKHFVLPIEAFEKIAIWKAGNMPVQYRRIKCRKEGGMRFTVTGSGIFISVLISNVAG  193

Query  1295  TGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNW  1474
              GD++ VK+KGSRTGWL MGRNWGQNWH+NA L++QPLSFE+ +SD  T+TSYNVAPK+W
Sbjct  194   HGDVVEVKVKGSRTGWLSMGRNWGQNWHVNALLQNQPLSFEVKASDGKTVTSYNVAPKDW  253

Query  1475  NYGQTFEGKQFE  1510
              +GQTFEGKQFE
Sbjct  254   TFGQTFEGKQFE  265



>ref|XP_002270003.1| PREDICTED: expansin-A13 [Vitis vinifera]
Length=313

 Score =   418 bits (1074),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             SEWR  RATYYA ADPRDAVGGACGYGDL +SGYG AT GLS  LFERGQICG CFE+RC
Sbjct  86    SEWRSGRATYYAAADPRDAVGGACGYGDLVKSGYGMATVGLSEALFERGQICGGCFELRC  145

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V+DLRWCIPGTSIIVTATNFCAPNYGF  DGGGHCNPPN HFVLPIEAFEKIAIWKA+NM
Sbjct  146   VDDLRWCIPGTSIIVTATNFCAPNYGFPADGGGHCNPPNNHFVLPIEAFEKIAIWKAANM  205

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRRIKCRKEGGVRF++ G+GIF+SVLI NV G GDI+ VK+KGSRTGWLPMGRNWGQ
Sbjct  206   PVHYRRIKCRKEGGVRFSLDGSGIFLSVLISNVGGAGDIVGVKVKGSRTGWLPMGRNWGQ  265

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NWH+NA+L++QPLSFEIT+SD +TLTSYNVAPK WN+GQTFEGKQFE+
Sbjct  266   NWHLNADLKNQPLSFEITASDGITLTSYNVAPKGWNFGQTFEGKQFES  313



>ref|XP_010463770.1| PREDICTED: expansin-A13 [Camelina sativa]
Length=266

 Score =   416 bits (1069),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/226 (85%), Positives = 210/226 (93%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA ++PRDAVGGACGYGDL +SGYG AT GLS  LFERGQICGAC+E+RCV
Sbjct  39    EWRPARATYYAASNPRDAVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACYELRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIVTATNFCAPNYGF+P+GGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  99    DDLRWCIPGTSIIVTATNFCAPNYGFDPEGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  158

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  159   VQYRRINCRREGSMRFTVDGGGIFISVLITNVAGSGDIAAVKIKGSRTGWLPMGRNWGQN  218

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+TSSDR T+T+YNV+PKNWNYGQTFEGKQFE
Sbjct  219   WHINADLKNQALSFEVTSSDRSTVTAYNVSPKNWNYGQTFEGKQFE  264



>ref|XP_009130347.1| PREDICTED: expansin-A13 [Brassica rapa]
 emb|CDY43141.1| BnaA05g32450D [Brassica napus]
Length=262

 Score =   416 bits (1068),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/226 (85%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRD VGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  35    EWRPARATYYAATNPRDLVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  94

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIVTATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  95    DDLRWCIPGTSIIVTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  154

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CRKEG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  155   VQYRRINCRKEGSIRFTVDGGGIFISVLITNVAGSGDISAVKIKGSRTGWLPMGRNWGQN  214

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+TSSD+ T+T+YNVAP+NW+YGQTFEGKQFE
Sbjct  215   WHINADLKNQALSFEVTSSDKSTVTAYNVAPRNWDYGQTFEGKQFE  260



>ref|XP_003519314.1| PREDICTED: expansin-A13-like [Glycine max]
Length=270

 Score =   415 bits (1067),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/256 (77%), Positives = 216/256 (84%), Gaps = 4/256 (2%)
 Frame = +2

Query  755   FSKTSLVFSHDG----WSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQ  922
              S + LV SH       SP SS  A+   SEWR ARATYY  ADPRDAVGGACGYGDL +
Sbjct  14    LSSSPLVTSHYSSSTLESPPSSLEASPTFSEWRSARATYYVAADPRDAVGGACGYGDLVK  73

Query  923   SGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDG  1102
              GYG AT GLS  LFERGQICGACFE+RCVED+RWCIPGTSIIVTATNFCAPNYGF  DG
Sbjct  74    GGYGMATVGLSEALFERGQICGACFELRCVEDMRWCIPGTSIIVTATNFCAPNYGFTSDG  133

Query  1103  GGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIR  1282
             GGHCNPPN HFVLPIEAFEKIAIWKA NMP+QYRRIKCRKEGG+RFTV+G+GIFISVLI 
Sbjct  134   GGHCNPPNKHFVLPIEAFEKIAIWKAGNMPVQYRRIKCRKEGGMRFTVTGSGIFISVLIS  193

Query  1283  NVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVA  1462
             NVAG GDI  VK+KGSRTGWL MGRNWGQNWH+NA L++QPLSFE+ +SD  T+TSYNVA
Sbjct  194   NVAGHGDIGEVKVKGSRTGWLSMGRNWGQNWHVNALLQNQPLSFEVKASDGKTVTSYNVA  253

Query  1463  PKNWNYGQTFEGKQFE  1510
             PK+W +GQTFEGKQFE
Sbjct  254   PKDWTFGQTFEGKQFE  269



>ref|XP_010101054.1| hypothetical protein L484_007788 [Morus notabilis]
 gb|EXB86764.1| hypothetical protein L484_007788 [Morus notabilis]
Length=270

 Score =   414 bits (1065),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 188/226 (83%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             WR ARATYYA ADPRD VGGACGYGDL +SGYG AT GLS  LFERGQICGACFEVRCV+
Sbjct  45    WRSARATYYAAADPRDLVGGACGYGDLVKSGYGMATVGLSEALFERGQICGACFEVRCVQ  104

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             DLRWCIPGTSIIVTATNFC+PNYGF  +GGGHCNPPN HFVLPIEAFEKIAIWKA NMP+
Sbjct  105   DLRWCIPGTSIIVTATNFCSPNYGFTAEGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMPV  164

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
             QYRRIKCRKEGG+RFT+ G GIFISVLI NVAG GD+ AVK+KGSRTGWLPMGRNWGQNW
Sbjct  165   QYRRIKCRKEGGIRFTIDGEGIFISVLISNVAGVGDVTAVKVKGSRTGWLPMGRNWGQNW  224

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             H+NA+L+ QPLSFE+TSSD VT+TS+NVAPKNWN+GQ+FEGKQF++
Sbjct  225   HVNADLKHQPLSFEVTSSDDVTVTSFNVAPKNWNFGQSFEGKQFDS  270



>ref|XP_006408328.1| hypothetical protein EUTSA_v10021327mg [Eutrema salsugineum]
 gb|ESQ49781.1| hypothetical protein EUTSA_v10021327mg [Eutrema salsugineum]
Length=268

 Score =   414 bits (1064),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 189/226 (84%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA ++PRDAVGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  41    EWRPARATYYAASNPRDAVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  100

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIVTATNFC PNYGF+PDGGGHCNPPN HFVLPIEAFE +AIWKA NMP
Sbjct  101   DDLRWCIPGTSIIVTATNFCPPNYGFDPDGGGHCNPPNKHFVLPIEAFEMVAIWKAGNMP  160

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  161   VQYRRINCRREGSIRFTVDGGGIFISVLITNVAGSGDIAAVKIKGSRTGWLPMGRNWGQN  220

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+T+SDR T+T+YNVAP+NWNYGQTFEGKQFE
Sbjct  221   WHINADLKNQALSFEVTASDRSTVTAYNVAPRNWNYGQTFEGKQFE  266



>emb|CDY28747.1| BnaCnng06330D [Brassica napus]
Length=262

 Score =   413 bits (1062),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 189/226 (84%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRD VGGACGYGDL +SGYG +T GLS  LFERGQICGACFE+RCV
Sbjct  35    EWRPARATYYAATNPRDLVGGACGYGDLVKSGYGMSTVGLSETLFERGQICGACFELRCV  94

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIVTATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  95    DDLRWCIPGTSIIVTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  154

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CRKEG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  155   VQYRRINCRKEGSIRFTVDGGGIFISVLITNVAGSGDISAVKIKGSRTGWLPMGRNWGQN  214

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+TSSD+ T+T+YNVAP+NW+YGQTFEGKQ+E
Sbjct  215   WHINADLKNQALSFEVTSSDKSTVTAYNVAPRNWDYGQTFEGKQYE  260



>ref|XP_006296727.1| hypothetical protein CARUB_v10014403mg [Capsella rubella]
 gb|EOA29625.1| hypothetical protein CARUB_v10014403mg [Capsella rubella]
Length=266

 Score =   413 bits (1062),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/226 (84%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRDAVGGACGYGDL +SGYG AT G+S  LFERGQICGAC+E+RCV
Sbjct  39    EWRPARATYYAATNPRDAVGGACGYGDLVKSGYGMATVGVSETLFERGQICGACYELRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+P+ GGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  99    DDLRWCIPGTSIILTATNFCAPNYGFDPEAGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  158

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  159   VQYRRINCRREGSMRFTVDGGGIFISVLITNVAGSGDIAAVKIKGSRTGWLPMGRNWGQN  218

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+TSSDR T+TSYNV+PKNWNYGQTFEGKQFE
Sbjct  219   WHINADLKNQALSFEVTSSDRSTVTSYNVSPKNWNYGQTFEGKQFE  264



>ref|XP_010485659.1| PREDICTED: expansin-A13-like [Camelina sativa]
Length=267

 Score =   413 bits (1061),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/227 (84%), Positives = 210/227 (93%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA ++PRDAVGGACGYGDL +SGYG AT GLS  LFERGQICGAC+E+RCV
Sbjct  39    EWRPARATYYAASNPRDAVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACYELRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIVTATNFCAPNYGF+P+GGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  99    DDLRWCIPGTSIIVTATNFCAPNYGFDPEGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  158

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  159   VQYRRINCRREGSMRFTVDGGGIFISVLITNVAGSGDIAAVKIKGSRTGWLPMGRNWGQN  218

Query  1373  WHINANLRSQPLSFEITSSDR-VTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+TSSDR  T+T+YNV+PKNWNYGQTFEGKQFE
Sbjct  219   WHINADLKNQALSFEVTSSDRSTTVTAYNVSPKNWNYGQTFEGKQFE  265



>ref|XP_007032300.1| Alpha-expansin 13, putative [Theobroma cacao]
 gb|EOY03226.1| Alpha-expansin 13, putative [Theobroma cacao]
Length=265

 Score =   412 bits (1060),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 187/226 (83%), Positives = 210/226 (93%), Gaps = 0/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W PARATYYA +DPRDAVGGACGYGDL ++GYG AT GLS  LFERGQICGACFE+RCV+
Sbjct  40    WHPARATYYAASDPRDAVGGACGYGDLVKAGYGMATVGLSESLFERGQICGACFELRCVD  99

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             DLRWCIPGTSIIVTATNFCAPNYGF  +GGGHCNPPN HFVLPIEAFEKIAIWKA NMP+
Sbjct  100   DLRWCIPGTSIIVTATNFCAPNYGFTAEGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMPV  159

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
             QYRRIKCRKEGGVRFTV G+GIF+SVLI NVAG GD++AVKIKGS+TGWL MGRNWGQNW
Sbjct  160   QYRRIKCRKEGGVRFTVDGSGIFVSVLISNVAGAGDVVAVKIKGSKTGWLQMGRNWGQNW  219

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             HIN++L++QPLSFE+T+SD +TLTSYNVAPK+WN+GQTFEGKQF++
Sbjct  220   HINSDLKNQPLSFEVTTSDGLTLTSYNVAPKDWNFGQTFEGKQFQS  265



>ref|XP_004490781.1| PREDICTED: expansin-A13-like [Cicer arietinum]
Length=272

 Score =   412 bits (1059),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 186/227 (82%), Positives = 210/227 (93%), Gaps = 0/227 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             +EWR ARATYYA ADPRD VGGACGYGDL ++GYG AT GLS  LFERGQICGACFE+RC
Sbjct  45    TEWRSARATYYAAADPRDTVGGACGYGDLTKAGYGMATVGLSESLFERGQICGACFELRC  104

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             VED+RWC+PGTSIIVTATNFCAPNYGF  +GGGHCNPPN HFVLPI+AFEKIAIWKA NM
Sbjct  105   VEDMRWCLPGTSIIVTATNFCAPNYGFTSEGGGHCNPPNKHFVLPIDAFEKIAIWKAGNM  164

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRRIKCR+EGG+RFTV+G+GIF+SVLI NVAG GDIIAVK+KGSRTGWLPMGRNWGQ
Sbjct  165   PLQYRRIKCRREGGIRFTVTGSGIFVSVLISNVAGHGDIIAVKVKGSRTGWLPMGRNWGQ  224

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWHI+A L++QPLSFE+TSSD  T+TSYNVAPK+W++GQTFEGKQF+
Sbjct  225   NWHISALLQNQPLSFEVTSSDGKTVTSYNVAPKDWSFGQTFEGKQFD  271



>ref|XP_010507648.1| PREDICTED: expansin-A13 [Camelina sativa]
Length=267

 Score =   411 bits (1057),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 210/227 (93%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA ++PRDAVGGACGYGDL +SGYG AT GLS  LFERGQICGAC+++RCV
Sbjct  39    EWRPARATYYAASNPRDAVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACYQLRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIVTATNFCAPNYGF+P+GGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  99    DDLRWCIPGTSIIVTATNFCAPNYGFDPEGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  158

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFTV G GIFISVLI NVAG+GDI AVKIKGSRTGWLPMGRNWGQN
Sbjct  159   VQYRRINCRREGSMRFTVDGGGIFISVLITNVAGSGDIAAVKIKGSRTGWLPMGRNWGQN  218

Query  1373  WHINANLRSQPLSFEITSSDR-VTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+TSSDR  T+T+YNV+PKNWNYGQTFEGKQFE
Sbjct  219   WHINADLKNQALSFEVTSSDRSTTVTAYNVSPKNWNYGQTFEGKQFE  265



>ref|XP_002526588.1| Alpha-expansin 13 precursor, putative [Ricinus communis]
 gb|EEF35800.1| Alpha-expansin 13 precursor, putative [Ricinus communis]
Length=269

 Score =   411 bits (1057),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWR A A YYA +DPRD+VGGACGYGDL+Q+GYG AT GLS  +FERGQICGACFE+RCV
Sbjct  43    EWRSAHAMYYAASDPRDSVGGACGYGDLKQAGYGLATVGLSEAMFERGQICGACFELRCV  102

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             EDLRWCIPGTS+IVT TNFCAPNYGF  DGGGHCNPPN HFVLPIE++EKIAIWKA NMP
Sbjct  103   EDLRWCIPGTSVIVTVTNFCAPNYGFPSDGGGHCNPPNLHFVLPIESYEKIAIWKAGNMP  162

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRIKCRKEGG+RFTVSG+ IFISVLI NVAG GD++AVKIKGSRTGWLPMGRNWGQN
Sbjct  163   VQYRRIKCRKEGGIRFTVSGSTIFISVLISNVAGAGDVVAVKIKGSRTGWLPMGRNWGQN  222

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             WHINA+L++QPLSFE+TSSD +T+TSYNVAPK+WN+GQTFEGKQF
Sbjct  223   WHINADLKNQPLSFEVTSSDGLTVTSYNVAPKDWNFGQTFEGKQF  267



>gb|KDP35736.1| hypothetical protein JCGZ_10508 [Jatropha curcas]
Length=281

 Score =   410 bits (1055),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/227 (83%), Positives = 208/227 (92%), Gaps = 0/227 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             SEWR A ATYYA +DPRD+VGGACGYGDL +SGYG AT GLS  +FERGQICGACFE+RC
Sbjct  54    SEWRSAHATYYAASDPRDSVGGACGYGDLGKSGYGLATVGLSEAMFERGQICGACFELRC  113

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             VEDLRWCIPGTS+IVT TNFCAPNYGF  DGGGHCNPPN HFVLPIE++EKIAIWKA NM
Sbjct  114   VEDLRWCIPGTSVIVTVTNFCAPNYGFTADGGGHCNPPNKHFVLPIESYEKIAIWKAGNM  173

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRRIKCRKEGG+RFTVSG+G FISVLI NVAG GD+ AVKIKGSRTGWL MGRNWGQ
Sbjct  174   PVQYRRIKCRKEGGMRFTVSGSGNFISVLISNVAGAGDVTAVKIKGSRTGWLQMGRNWGQ  233

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWHINA+L++QPLSFE+TSSD +T+TSYNVAPK+WN+GQTFEGKQFE
Sbjct  234   NWHINADLKNQPLSFEVTSSDGLTITSYNVAPKDWNFGQTFEGKQFE  280



>emb|CDY49933.1| BnaCnng18430D [Brassica napus]
Length=268

 Score =   410 bits (1053),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRD VGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  41    EWRPARATYYAATNPRDEVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  100

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAF KIAIWKA NMP
Sbjct  101   DDLRWCIPGTSIILTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFGKIAIWKAGNMP  160

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFT+ G GIFISVLI NVAG+GDI AVK+KGSRTGWLPMGRNWGQN
Sbjct  161   VQYRRINCRREGSIRFTIDGGGIFISVLITNVAGSGDISAVKVKGSRTGWLPMGRNWGQN  220

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+T+SDR T+T+YNVAP+NW+YGQTFEGKQFE
Sbjct  221   WHINADLKNQALSFEVTASDRSTVTAYNVAPRNWDYGQTFEGKQFE  266



>ref|XP_004148906.1| PREDICTED: expansin-A13-like [Cucumis sativus]
 ref|XP_004157021.1| PREDICTED: expansin-A13-like [Cucumis sativus]
Length=268

 Score =   410 bits (1053),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 187/227 (82%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +WR ARATYYA +DPRDAVGGACGYGDL ++GYG AT GLS  LFERGQICGACF++RCV
Sbjct  42    DWRSARATYYAASDPRDAVGGACGYGDLVKAGYGMATVGLSESLFERGQICGACFQLRCV  101

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             EDLRWCIPGTSIIVT TNFCAPNYGF  +GGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  102   EDLRWCIPGTSIIVTVTNFCAPNYGFTAEGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  161

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRIKCRKEGG+R+TVSG GI++SVLI NVAG GD+ AVKIKG+RTGWLPMGRNWGQN
Sbjct  162   VQYRRIKCRKEGGIRYTVSGYGIYLSVLISNVAGAGDVSAVKIKGTRTGWLPMGRNWGQN  221

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             WHINA+L  Q LSFE+TSSD VT+TSYNVAPK+WN+GQTFEGKQFE+
Sbjct  222   WHINADLNHQALSFEVTSSDGVTITSYNVAPKDWNFGQTFEGKQFES  268



>gb|KHG09929.1| Expansin-A13 -like protein [Gossypium arboreum]
Length=314

 Score =   411 bits (1057),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  ARATYYA +DPRDAVGGACGYGDL ++GYG AT GLS  LF+RGQICGACFE+RCV+
Sbjct  89    WHSARATYYAASDPRDAVGGACGYGDLVKAGYGMATVGLSEALFQRGQICGACFELRCVD  148

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             DLRWCIPGTS IVTATNFCAPNYGF  +GGG CNPPN HFVLPIEAFEKIAIWKA NMP+
Sbjct  149   DLRWCIPGTSYIVTATNFCAPNYGFTAEGGGRCNPPNKHFVLPIEAFEKIAIWKAGNMPV  208

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
             QYRRIKCR+EGGVRFT+ G+GIF+SVLI NV G GDI+AVKIKGSRTGWLPMGRNWGQNW
Sbjct  209   QYRRIKCRREGGVRFTIDGSGIFVSVLISNVGGAGDIVAVKIKGSRTGWLPMGRNWGQNW  268

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             HIN++LR+QPLSFE+T+SD +TLTSYNVAPKNWN+GQTFEGKQFE
Sbjct  269   HINSDLRNQPLSFEVTNSDGLTLTSYNVAPKNWNFGQTFEGKQFE  313



>emb|CDY21215.1| BnaA01g34460D [Brassica napus]
Length=269

 Score =   409 bits (1051),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRD VGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  42    EWRPARATYYAATNPRDEVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  101

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAF KIAIWKA NMP
Sbjct  102   DDLRWCIPGTSIILTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFGKIAIWKAGNMP  161

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFT+ G GIFISVLI NVAG+GDI AVK+KGSRTGWLPMGRNWGQN
Sbjct  162   VQYRRINCRREGSIRFTIDGGGIFISVLITNVAGSGDIFAVKVKGSRTGWLPMGRNWGQN  221

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+T+SD+ T+T+YNVAP+NW+YGQTFEGKQFE
Sbjct  222   WHINADLKNQALSFEVTASDKSTVTAYNVAPRNWDYGQTFEGKQFE  267



>ref|XP_009119148.1| PREDICTED: expansin-A13-like [Brassica rapa]
Length=269

 Score =   409 bits (1050),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRD VGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  42    EWRPARATYYAATNPRDEVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  101

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAF KIAIWKA NMP
Sbjct  102   DDLRWCIPGTSIILTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFGKIAIWKAGNMP  161

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFT+ G GIFISVLI NVAG+GDI AVK+KGSRTGWLPMGRNWGQN
Sbjct  162   VQYRRINCRREGSIRFTIDGGGIFISVLITNVAGSGDISAVKVKGSRTGWLPMGRNWGQN  221

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+L++Q LSFE+T+SD+ T+T+YNVAP+NW+YGQTFEGKQFE
Sbjct  222   WHINADLKNQALSFEVTASDKSTVTAYNVAPRNWDYGQTFEGKQFE  267



>ref|XP_008463163.1| PREDICTED: expansin-A13 [Cucumis melo]
Length=268

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 186/227 (82%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +WR ARATYYA +DPRDAVGGACGYGDL ++GYG AT GLS  LFERGQICGACF++RCV
Sbjct  42    DWRSARATYYAASDPRDAVGGACGYGDLVKAGYGMATVGLSESLFERGQICGACFQLRCV  101

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             EDLRWCIPGTSIIVT TNFCAPNYGF  +GGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  102   EDLRWCIPGTSIIVTVTNFCAPNYGFTAEGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  161

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRIKCRKEGG+R+TVSG GI++SVLI NVAG GD+ AVKIKG+RTGWLPMGRNWGQN
Sbjct  162   VQYRRIKCRKEGGIRYTVSGYGIYLSVLISNVAGAGDVSAVKIKGTRTGWLPMGRNWGQN  221

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             WHINA+L  Q LSFE+TSSD VT++SYNVAPK+WN+GQTFEGKQFE+
Sbjct  222   WHINADLNHQALSFEVTSSDGVTISSYNVAPKDWNFGQTFEGKQFES  268



>ref|XP_007141964.1| hypothetical protein PHAVU_008G240800g [Phaseolus vulgaris]
 gb|ESW13958.1| hypothetical protein PHAVU_008G240800g [Phaseolus vulgaris]
Length=269

 Score =   406 bits (1044),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 186/227 (82%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             +EWR A ATYYA ADPRDAVGGACGYGDL + GYG AT GLS  LFERGQICGACFE+RC
Sbjct  42    AEWRSAHATYYAAADPRDAVGGACGYGDLVKGGYGMATVGLSETLFERGQICGACFELRC  101

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V+D RWCIPGTSIIVTATNFCAPN+GF  DGGGHCNPPN HFVLPIEAFEKIAIWKA NM
Sbjct  102   VDDNRWCIPGTSIIVTATNFCAPNHGFTSDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNM  161

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRRIKCRKEGG+RFTV+G+GIFISVLI NVAG GDI+AVK+KGSRTGWL MGRNWGQ
Sbjct  162   PVQYRRIKCRKEGGMRFTVTGSGIFISVLISNVAGHGDILAVKVKGSRTGWLSMGRNWGQ  221

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWH+NA L++QPL+FE+TSSD   +TSYNVAPK+W +GQTFEGKQFE
Sbjct  222   NWHVNALLQNQPLAFEVTSSDEKIVTSYNVAPKDWTFGQTFEGKQFE  268



>ref|XP_010246197.1| PREDICTED: expansin-A13-like [Nelumbo nucifera]
Length=269

 Score =   406 bits (1043),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = +2

Query  827   QSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVR  1006
              +EWR ARATYYA +DPRD VGGACGYGDL +SGYG AT GLST LFERGQICGACFE+R
Sbjct  41    MTEWRSARATYYAASDPRDDVGGACGYGDLVKSGYGMATVGLSTALFERGQICGACFELR  100

Query  1007  CVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             CV+DLRWCIPGTSIIVT TNFCAPNYG   DGGGHCNPPN HFVLPIEAFEKIAIWKA+N
Sbjct  101   CVDDLRWCIPGTSIIVTVTNFCAPNYGLPSDGGGHCNPPNKHFVLPIEAFEKIAIWKAAN  160

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             MPIQYRR+KCRKEGG+RF + G+G F SVLI NVAG GD++AVKIK SRTGWLPMGRNWG
Sbjct  161   MPIQYRRMKCRKEGGIRFRIDGSGYFYSVLISNVAGAGDVVAVKIKASRTGWLPMGRNWG  220

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             QNWH+ A+L++QPLSFE+T+SD VT+ SYNVAPK+W+ GQTFEGKQFE+
Sbjct  221   QNWHVTADLKNQPLSFEVTTSDGVTVVSYNVAPKDWSLGQTFEGKQFES  269



>gb|AAF26104.1|AC012328_7 putative expansin precursor [Arabidopsis thaliana]
Length=295

 Score =   405 bits (1042),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/255 (76%), Positives = 209/255 (82%), Gaps = 29/255 (11%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRDAVGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+RCV
Sbjct  39    EWRPARATYYAATNPRDAVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  99    DDLRWCIPGTSIILTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  158

Query  1193  IQYR-----------------------------RIKCRKEGGVRFTVSGAGIFISVLIRN  1285
             +QYR                             RI CRKEG +RFTV G GIFISVLI N
Sbjct  159   VQYRRCVSLRFFPICFAHERTEIDCFCEVLGTMRINCRKEGSMRFTVDGGGIFISVLITN  218

Query  1286  VAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAP  1465
             VAG+GDI AVKIKGSRTGWLPMGRNWGQNWHINA+LR+Q LSFE+TSSDR T+TSYNV+P
Sbjct  219   VAGSGDIAAVKIKGSRTGWLPMGRNWGQNWHINADLRNQALSFEVTSSDRSTVTSYNVSP  278

Query  1466  KNWNYGQTFEGKQFE  1510
             KNWNYGQTFEGKQFE
Sbjct  279   KNWNYGQTFEGKQFE  293



>ref|XP_007215822.1| hypothetical protein PRUPE_ppa010067mg [Prunus persica]
 gb|EMJ17021.1| hypothetical protein PRUPE_ppa010067mg [Prunus persica]
Length=265

 Score =   404 bits (1039),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ ARATYYA +DPRDAVGGACGYGDL ++GYG AT GLS  LFERGQICGACF +RCV
Sbjct  40    DWQSARATYYAASDPRDAVGGACGYGDLVKAGYGMATVGLSEPLFERGQICGACFVLRCV  99

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +D+RWCIPGTSIIVTATNFCAPNYGF  DGGGHCNPPN H VLPIEAFEKIAIWKA NMP
Sbjct  100   DDMRWCIPGTSIIVTATNFCAPNYGFTADGGGHCNPPNKHLVLPIEAFEKIAIWKAGNMP  159

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRIKCRKEGG+RFT+ G+ IFISVLI NVAG GDI++VKIKGSRTGWLPMGRNWGQN
Sbjct  160   VQYRRIKCRKEGGIRFTIDGSNIFISVLITNVAGVGDIVSVKIKGSRTGWLPMGRNWGQN  219

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             WH++A+L++QPLSFE+TSSD +T+TSYNVAPK WN+GQTFEGKQF
Sbjct  220   WHVSADLKNQPLSFEVTSSDGLTVTSYNVAPKAWNFGQTFEGKQF  264



>ref|XP_003616175.1| Expansin [Medicago truncatula]
 gb|AES99133.1| expansin A1 [Medicago truncatula]
Length=266

 Score =   404 bits (1039),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 208/227 (92%), Gaps = 0/227 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             +EWR ARAT+YA  DPRD VGGACGYGDL ++GYG +T GLS  LFERGQICGACFE+RC
Sbjct  39    TEWRSARATFYAQVDPRDTVGGACGYGDLTKAGYGMSTVGLSEALFERGQICGACFELRC  98

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V+DLRWCIPGTSIIVTATNFCAPNYGF  +GGGHCNPPN HFVLPI+AFEKIAIWKA NM
Sbjct  99    VDDLRWCIPGTSIIVTATNFCAPNYGFTVEGGGHCNPPNKHFVLPIDAFEKIAIWKAGNM  158

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRRIKCR+EGGVRFTV+G+GIFISVLI NVAG GDI+AVK+KGSRTGWL MGRNWGQ
Sbjct  159   PLQYRRIKCRREGGVRFTVTGSGIFISVLISNVAGHGDIVAVKVKGSRTGWLSMGRNWGQ  218

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWHINA L++QPLSFE+TSSD  T+T+YNVAPK+W++GQTFEGKQF+
Sbjct  219   NWHINALLQNQPLSFEVTSSDGKTVTAYNVAPKDWSFGQTFEGKQFD  265



>ref|XP_010558665.1| PREDICTED: expansin-A13 [Tarenaya hassleriana]
Length=262

 Score =   403 bits (1036),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +WR ARATYYA +DPRD+VGGACG+GDL ++GYG AT GLS  LFERGQICGACFE+RCV
Sbjct  35    DWRSARATYYAASDPRDSVGGACGFGDLVKAGYGMATVGLSESLFERGQICGACFELRCV  94

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIVTATNFCAPNYGF P+GGGHCNPPN HFVLPIEAFEKIAIWKA NMP
Sbjct  95    DDLRWCIPGTSIIVTATNFCAPNYGFTPEGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMP  154

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             IQYRRI CR+EG +RF + G GIF+SVLI NVAG GDI  VKIKGSRTGWLPMGRNWGQN
Sbjct  155   IQYRRINCRREGNMRFLIDGGGIFVSVLITNVAGAGDITGVKIKGSRTGWLPMGRNWGQN  214

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WHINA+LR+QPLSFE+T+SD  T+TSYNVAPKNWN+ QTFEGKQFE
Sbjct  215   WHINADLRNQPLSFEVTASDGSTVTSYNVAPKNWNFRQTFEGKQFE  260



>ref|XP_009367104.1| PREDICTED: expansin-A13-like [Pyrus x bretschneideri]
 ref|XP_009367120.1| PREDICTED: expansin-A13-like [Pyrus x bretschneideri]
Length=264

 Score =   402 bits (1034),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 211/249 (85%), Gaps = 1/249 (0%)
 Frame = +2

Query  767   SLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATA  946
             S   SH   S     A+ SL  +W  ARATYYA ADPRD VGGACGYGDLE++GYG AT 
Sbjct  17    STALSHFHSSSPFPTASPSLY-DWTSARATYYAAADPRDKVGGACGYGDLEKAGYGLATV  75

Query  947   GLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPN  1126
             GLS  LFERGQICGACFEVRCV+D+RWCIPGTSIIVTATNFC PNYGF  +GGGHCN PN
Sbjct  76    GLSEALFERGQICGACFEVRCVDDMRWCIPGTSIIVTATNFCPPNYGFTAEGGGHCNAPN  135

Query  1127  AHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDI  1306
              H VLPIEAFEKIAIWKA NMP+QYRRIKCRKEGG+RFT+ G+ IFISVLI NVAG GDI
Sbjct  136   KHLVLPIEAFEKIAIWKAGNMPVQYRRIKCRKEGGIRFTIDGSNIFISVLISNVAGAGDI  195

Query  1307  IAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQ  1486
             +AVKIKGSRTGWLPMGRNWGQNWH +A+L +QPLSFE+TSSD  T+TSYNVAPK WN+GQ
Sbjct  196   VAVKIKGSRTGWLPMGRNWGQNWHASADLLNQPLSFEVTSSDGRTVTSYNVAPKAWNFGQ  255

Query  1487  TFEGKQFEA  1513
             TFEGKQF++
Sbjct  256   TFEGKQFDS  264



>ref|XP_010247559.1| PREDICTED: expansin-A13-like [Nelumbo nucifera]
Length=267

 Score =   400 bits (1028),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = +2

Query  827   QSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVR  1006
              +EWR ARATYYA +DPRD  GGACGYGDL ++GYG AT GLST LF+RGQICGACFE+R
Sbjct  40    MTEWRSARATYYAASDPRDDAGGACGYGDLAKNGYGMATVGLSTALFDRGQICGACFELR  99

Query  1007  CVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             CVEDLRWCIPGTSIIVT TNFCAPNYG   DGGGHCNPPN HFVLPIEAFEKIA+WKA++
Sbjct  100   CVEDLRWCIPGTSIIVTVTNFCAPNYGLPSDGGGHCNPPNKHFVLPIEAFEKIAVWKAAS  159

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             MP+QYRR+KC KEGG+RF + G+G F SVLI NVAG GD++AVKIKGSRTGWLPMGRNWG
Sbjct  160   MPVQYRRMKCIKEGGIRFRIDGSGFFCSVLISNVAGAGDVVAVKIKGSRTGWLPMGRNWG  219

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNWH+ A+L++QPLSFE+T+SDRVT+ SYNVAPK+W++GQTF GKQFE
Sbjct  220   QNWHVTADLKNQPLSFEVTTSDRVTVVSYNVAPKDWSFGQTFVGKQFE  267



>ref|XP_009370570.1| PREDICTED: expansin-A13-like [Pyrus x bretschneideri]
Length=268

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 202/227 (89%), Gaps = 0/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W  ARATYYA +DPRD VGGACGYGDLE++GYG AT GLS  LFERGQICGACFEVRCV
Sbjct  42    DWSSARATYYAASDPRDKVGGACGYGDLEKAGYGLATVGLSEALFERGQICGACFEVRCV  101

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             ED RWCIPGTSIIVTATNFCAPNYG   +GGGHCN PN H VLPIEAFEKIA+WKA NM 
Sbjct  102   EDTRWCIPGTSIIVTATNFCAPNYGLMAEGGGHCNSPNKHLVLPIEAFEKIAVWKAGNMA  161

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRIKCRKEGG+RFT+ G+ IFISVLI NVAG GDI+AVK+KGSRTGWLPMGRNWGQN
Sbjct  162   VQYRRIKCRKEGGIRFTIDGSNIFISVLISNVAGAGDIVAVKVKGSRTGWLPMGRNWGQN  221

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             WH++A+L +QPLSFE+TSSD  T+TSYNVAPK WN+GQTFEGKQFE+
Sbjct  222   WHVSADLLNQPLSFEVTSSDGHTVTSYNVAPKAWNFGQTFEGKQFES  268



>gb|ADD14634.1| expansin precursor, partial [Solanum tuberosum]
Length=209

 Score =   396 bits (1018),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = +2

Query  887   VGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATN  1066
             +GGACGYGDLE++GYGKATAGLSTVLF++GQICGAC+EVRCVEDLRWCIPGTSIIVTATN
Sbjct  1     MGGACGYGDLERNGYGKATAGLSTVLFDKGQICGACYEVRCVEDLRWCIPGTSIIVTATN  60

Query  1067  FCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTV  1246
             FCAPNYGF+ DGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTV
Sbjct  61    FCAPNYGFDLDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTV  120

Query  1247  SGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITS  1426
              G+GIF+SVLI NVAG+GDI+A K+KGSRTGWLPMGRNWGQNWHINA+L++QPLSFE+TS
Sbjct  121   GGSGIFLSVLISNVAGSGDIVAAKVKGSRTGWLPMGRNWGQNWHINADLKNQPLSFEMTS  180

Query  1427  SDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              D  TLTSYNVAPKNWN+GQTFEGKQF
Sbjct  181   GDGATLTSYNVAPKNWNFGQTFEGKQF  207



>ref|XP_011043871.1| PREDICTED: expansin-A13-like [Populus euphratica]
Length=273

 Score =   398 bits (1023),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S+W+ ARATYYA +DPRD VGG CGYGDL ++GYG AT GLS  +FERGQICGACFE++C
Sbjct  46    SQWQSARATYYAASDPRDTVGGGCGYGDLVKAGYGMATVGLSESMFERGQICGACFELKC  105

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V+DLRWCIPGTSIIV+ TNFCAPNYGF  DGGG CNPPN HFVLPIEAFEKIAIW+A+NM
Sbjct  106   VDDLRWCIPGTSIIVSVTNFCAPNYGFTSDGGGKCNPPNKHFVLPIEAFEKIAIWRAANM  165

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRRIKCRKEGG+RFT+SG+GIF+SVLI NVAG GD+ AVKIKGSRTGWL MGRNWGQ
Sbjct  166   PVQYRRIKCRKEGGIRFTISGSGIFLSVLISNVAGAGDVTAVKIKGSRTGWLDMGRNWGQ  225

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWH+NANL++Q LSFE+TSSDR+T+ SYNVAPK+W +GQ FEGKQFE
Sbjct  226   NWHVNANLQNQALSFEVTSSDRMTVISYNVAPKDWRFGQAFEGKQFE  272



>ref|XP_002305908.2| hypothetical protein POPTR_0004s07820g [Populus trichocarpa]
 gb|EEE86419.2| hypothetical protein POPTR_0004s07820g [Populus trichocarpa]
Length=273

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ ARATYYA +DPRD VGGACGYGDL ++GYG AT GLS  +FERGQICGACFE++CV
Sbjct  47    QWQSARATYYAASDPRDTVGGACGYGDLVKAGYGMATVGLSESMFERGQICGACFELKCV  106

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSIIV+ TNFCAPNYGF  DGGG CNPPN HFVLPIEAFEKIAIWKA+NMP
Sbjct  107   DDLRWCIPGTSIIVSVTNFCAPNYGFTSDGGGKCNPPNKHFVLPIEAFEKIAIWKAANMP  166

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRIKCRKEGG+RF +SG+GIF+SVLI NVAG GD+ AVKIKGSRTGWL MGRNWGQN
Sbjct  167   VQYRRIKCRKEGGIRFNISGSGIFLSVLISNVAGAGDVTAVKIKGSRTGWLDMGRNWGQN  226

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WH+NANL++Q LSFE+TSSDR+T+ SYNVAPK+W +GQ FEGKQFE
Sbjct  227   WHVNANLQNQALSFEVTSSDRMTVISYNVAPKDWRFGQAFEGKQFE  272



>ref|XP_008348617.1| PREDICTED: expansin-A13-like [Malus domestica]
 ref|XP_008358178.1| PREDICTED: expansin-A13-like [Malus domestica]
Length=265

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 200/227 (88%), Gaps = 0/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W  ARATYYA  DPRD VGGACGYGDLE++GYG AT GLS  LFERGQICGACFEVRCV
Sbjct  39    DWTSARATYYAAVDPRDKVGGACGYGDLEKAGYGLATVGLSEALFERGQICGACFEVRCV  98

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             ED+RWCIPGTSIIVTATNFC PNYGF  +GGGHCN PN H VLPIEAFEKIAIWKA NM 
Sbjct  99    EDMRWCIPGTSIIVTATNFCPPNYGFTAEGGGHCNXPNKHLVLPIEAFEKIAIWKAGNMA  158

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRIKCRKEGG+RFT+ G+ IFISVLI NV G GDI+AVKIKGSRTGWLPMGRNWGQN
Sbjct  159   VQYRRIKCRKEGGIRFTIDGSNIFISVLISNVGGAGDIVAVKIKGSRTGWLPMGRNWGQN  218

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             WH +A+L +QPLSFE+TSSD  T+TSYNVAPK WN+GQTFEGKQF++
Sbjct  219   WHASADLLNQPLSFEVTSSDGRTVTSYNVAPKAWNFGQTFEGKQFDS  265



>ref|XP_008343138.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A13, partial [Malus 
domestica]
Length=290

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W  ARATYYA +DPRD VGGACGYGDLE++GYG AT GLS  LFERGQICGACF+VRCV
Sbjct  64    DWSSARATYYAASDPRDKVGGACGYGDLEKAGYGLATVGLSEALFERGQICGACFQVRCV  123

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             ED RWCI GTSIIVTATNFCAPNYG  P+GGGHCN PN H VLPIEAFEKIA+WKA N  
Sbjct  124   EDTRWCISGTSIIVTATNFCAPNYGLRPEGGGHCNSPNKHLVLPIEAFEKIAVWKAGNTA  183

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             ++YRRIKCRKEGG+RFT+ G+ IFISVLI NVAG GDI+AVK+KGSRTGWLPMGRNWGQN
Sbjct  184   VEYRRIKCRKEGGIRFTIDGSNIFISVLISNVAGAGDIVAVKVKGSRTGWLPMGRNWGQN  243

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             WH++A+L +QPLSFE+TSSD  T+TSYNVAPK WN+GQTFEGKQFE+
Sbjct  244   WHVSADLLNQPLSFEVTSSDGHTVTSYNVAPKAWNFGQTFEGKQFES  290



>ref|XP_011038336.1| PREDICTED: expansin-A13-like [Populus euphratica]
Length=274

 Score =   392 bits (1007),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S+W+PARATYYA +DPRD VGGACGYGDL ++GYG AT  LS  +FERGQICGACFE++C
Sbjct  47    SQWQPARATYYAASDPRDTVGGACGYGDLVKAGYGMATVALSESMFERGQICGACFEIKC  106

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V+DLRWCIPGTSIIV+ TNFCAPNYGF  D GG CN PN HFVLPIE+FEKIAIWKA+NM
Sbjct  107   VDDLRWCIPGTSIIVSVTNFCAPNYGFPSDAGGKCNIPNKHFVLPIESFEKIAIWKAANM  166

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRRIKCRKEGG+RFT+SG+GIF+SVLI NVAG GD+ +V+IKGSRTGWL MGRNWGQ
Sbjct  167   PVQYRRIKCRKEGGIRFTISGSGIFLSVLISNVAGAGDVTSVRIKGSRTGWLDMGRNWGQ  226

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWH+NANL++Q LSFE+TSSD++T+ SY VAPK+W +GQTFEGKQFE
Sbjct  227   NWHVNANLQNQALSFEVTSSDKMTVLSYAVAPKDWRFGQTFEGKQFE  273



>gb|AGM16355.1| alpha-expansin protein 13, partial [Brassica rapa]
Length=261

 Score =   390 bits (1003),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EWRPARATYYA  +PRD VGGACGYGDL +SGYG AT GLS  LFERGQICGACFE+R V
Sbjct  42    EWRPARATYYAATNPRDEVGGACGYGDLVKSGYGMATVGLSETLFERGQICGACFELRRV  101

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +DLRWCIPGTSII+TATNFCAPNYGF+PDGGGHCNPPN HFVLPIEAF KIAIWKA NMP
Sbjct  102   DDLRWCIPGTSIILTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFGKIAIWKAGNMP  161

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             +QYRRI CR+EG +RFT+ G GIFISVLI NVAG+GDI AVK+KGSRTGWLPMGRNWGQN
Sbjct  162   VQYRRINCRREGSIRFTIDGGGIFISVLIANVAGSGDISAVKVKGSRTGWLPMGRNWGQN  221

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTF  1492
             WHINA+L++Q LSFE+T+SD+ T+T+YNVAP+NW+YGQTF
Sbjct  222   WHINADLKNQALSFEVTASDKSTVTAYNVAPRNWDYGQTF  261



>ref|XP_006372474.1| expansin S1 precursor family protein [Populus trichocarpa]
 gb|ERP50271.1| expansin S1 precursor family protein [Populus trichocarpa]
Length=284

 Score =   391 bits (1004),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S+W+PARATYYA +DPRD VGGACGYGDL ++GYG AT  LS  +FERGQICGACFE++C
Sbjct  57    SQWQPARATYYAASDPRDTVGGACGYGDLVKAGYGMATVALSESMFERGQICGACFEIKC  116

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V+DLRWCIPGTSIIV+ TNFCAPNYGF  D GG CN PN HFVLPIE+FEKIAIWKA+NM
Sbjct  117   VDDLRWCIPGTSIIVSVTNFCAPNYGFPSDAGGKCNTPNKHFVLPIESFEKIAIWKAANM  176

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRRIKCRKEGG+RFT+SG+GIF+SVLI NVAG GD+ +V+IKGSRTGWL MGRNWGQ
Sbjct  177   PVQYRRIKCRKEGGIRFTISGSGIFLSVLISNVAGAGDVTSVRIKGSRTGWLDMGRNWGQ  236

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWH+NANL++Q LSFE+TSS ++T+ SY VAPK+W +GQTFEGKQFE
Sbjct  237   NWHVNANLQNQALSFEVTSSHKMTVLSYTVAPKDWRFGQTFEGKQFE  283



>ref|XP_008227904.1| PREDICTED: expansin-A13 [Prunus mume]
Length=266

 Score =   382 bits (981),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/222 (79%), Positives = 197/222 (89%), Gaps = 0/222 (0%)
 Frame = +2

Query  842   PARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDL  1021
             P  +TY     P  AVGGACGYGDL ++GYG AT GLS  LFERGQICGACFE+RCV+D+
Sbjct  44    PTPSTYNDAPAPWGAVGGACGYGDLVKAGYGMATVGLSEPLFERGQICGACFELRCVDDM  103

Query  1022  RWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQY  1201
             RWCIPGTSIIVTATNFCAPNYGF  DGGGHCNPPN H VLPIEAFEKIAIWKA NMP+QY
Sbjct  104   RWCIPGTSIIVTATNFCAPNYGFTADGGGHCNPPNKHLVLPIEAFEKIAIWKAGNMPVQY  163

Query  1202  RRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHI  1381
             RRIKCRKEGG+RFT+ G+ IFISVLI NVAG GDI++VKIKGSRTGWLPMGRNWGQNWH+
Sbjct  164   RRIKCRKEGGIRFTIDGSNIFISVLITNVAGVGDIVSVKIKGSRTGWLPMGRNWGQNWHV  223

Query  1382  NANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             +A+L++QPLSFE+TSSD +T+TSYNVAPK WN+GQTFEGKQF
Sbjct  224   SADLKNQPLSFEVTSSDGLTVTSYNVAPKAWNFGQTFEGKQF  265



>ref|XP_010675241.1| PREDICTED: expansin-A13 [Beta vulgaris subsp. vulgaris]
Length=267

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 213/248 (86%), Gaps = 2/248 (1%)
 Frame = +2

Query  767   SLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATA  946
             SL+ +   ++P  S++A  L S+W  ARATYYA  DPRD VGGACG+GDLE++GYGKAT 
Sbjct  22    SLLTTSGHYTPPPSSSA--LLSDWHSARATYYAATDPRDIVGGACGFGDLEKAGYGKATV  79

Query  947   GLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPN  1126
             GLST LF +GQICGACFEVRCVEDLR CIPGTSI+VTATNFCAPNYGF  DGGG CNPPN
Sbjct  80    GLSTALFSKGQICGACFEVRCVEDLRNCIPGTSILVTATNFCAPNYGFTADGGGKCNPPN  139

Query  1127  AHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDI  1306
              HFVLPIEAFEKIA+WKA NM +QYRRIKCRKEGG+RF + G+G+F+SVL+ NVAG GD+
Sbjct  140   KHFVLPIEAFEKIALWKAGNMAVQYRRIKCRKEGGIRFAIDGSGVFVSVLVSNVAGVGDV  199

Query  1307  IAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQ  1486
             +AVK+KGS+TGWLPM RNWGQNW +NA+L++QPLSFE+T+SD   LTSYNVAPKNW  GQ
Sbjct  200   VAVKVKGSQTGWLPMSRNWGQNWILNADLKNQPLSFEVTTSDGAILTSYNVAPKNWTIGQ  259

Query  1487  TFEGKQFE  1510
             TFEGKQF+
Sbjct  260   TFEGKQFD  267



>gb|EPS57403.1| hypothetical protein M569_17415, partial [Genlisea aurea]
Length=246

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 210/229 (92%), Gaps = 2/229 (1%)
 Frame = +2

Query  797   PTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERG  976
             PT+S+ A    S+W+ ARAT+YA ADP DAVGGACGYGDLE++GYGKATA LS+VLF+RG
Sbjct  20    PTASSGA--WHSDWKSARATFYAAADPIDAVGGACGYGDLEKNGYGKATAALSSVLFQRG  77

Query  977   QICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAF  1156
             QICGACFE+RCV+DLRWCIPGTSIIVTATNFCAPNYGF  +GGG CNPPN+HFVLPIE+F
Sbjct  78    QICGACFEIRCVDDLRWCIPGTSIIVTATNFCAPNYGFGGEGGGRCNPPNSHFVLPIESF  137

Query  1157  EKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRT  1336
             EKIAIWKASNMP+QYRRI+CR+EGGVRFTV+GAGIF+SV+I NV G+GD+ AVKIKGSRT
Sbjct  138   EKIAIWKASNMPVQYRRIRCRREGGVRFTVNGAGIFLSVMISNVGGSGDVTAVKIKGSRT  197

Query  1337  GWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYG  1483
             GWLPMGRNWGQNWH+NA+L++QPLSFE+T+ D  T+TSYNVAPK+W +G
Sbjct  198   GWLPMGRNWGQNWHVNADLKNQPLSFEVTAGDGATVTSYNVAPKDWEFG  246



>ref|XP_010549793.1| PREDICTED: expansin-A13-like [Tarenaya hassleriana]
Length=265

 Score =   367 bits (942),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/221 (80%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = +2

Query  848   RATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRW  1027
             RATYY  +DP    GG  GYG L ++GYG AT GLS  LFERGQICGACFE+RCV+DLRW
Sbjct  43    RATYYDASDPXXXXGGPGGYGALVKAGYGFATVGLSESLFERGQICGACFELRCVDDLRW  102

Query  1028  CIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRR  1207
             CIPGTSIIVTATNFCAPNYGF P+GGGHCNPPN HFVLPIEAFEKIAIWKA NMPIQYRR
Sbjct  103   CIPGTSIIVTATNFCAPNYGFTPEGGGHCNPPNNHFVLPIEAFEKIAIWKAGNMPIQYRR  162

Query  1208  IKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINA  1387
             I CR+EG +RF++ G GIF+SVLI NVAG GDI  VKIKGSRTGWLPMGRNWGQNWHINA
Sbjct  163   INCRREGSMRFSIDGGGIFMSVLITNVAGAGDITGVKIKGSRTGWLPMGRNWGQNWHINA  222

Query  1388  NLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             +LRSQPLSFE+T+SD  T+TSYN+APKNW++GQTFEGKQFE
Sbjct  223   DLRSQPLSFEVTASDGSTVTSYNIAPKNWSFGQTFEGKQFE  263



>ref|XP_009386281.1| PREDICTED: expansin-A10-like [Musa acuminata subsp. malaccensis]
Length=275

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 203/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  761   KTSLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKA  940
             ++ L  +H G   +SS AAA+L +EWR A A+YYA +DPRD  GGACGYGDL +SGYG A
Sbjct  29    RSRLAAAHQG---SSSYAAAAL-TEWRSAHASYYAASDPRDTFGGACGYGDLGKSGYGMA  84

Query  941   TAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNP  1120
             TAGLS  LFE+G  CG C+EVRCVE+LR+C+PGTSI++TATNFCAPNYG   D GG CN 
Sbjct  85    TAGLSDALFEKGAACGGCYEVRCVEELRYCLPGTSIVLTATNFCAPNYGLPADAGGICNH  144

Query  1121  PNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTG  1300
             PN H ++PI+AFEKIAIWKA  MPIQYRR+KC +E GVRFT+ G G F +VLI NVAG G
Sbjct  145   PNHHLLMPIQAFEKIAIWKAGVMPIQYRRVKCIREDGVRFTIDGKGFFYTVLISNVAGAG  204

Query  1301  DIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNY  1480
             D+ AVKIKGS TGWLPMGR WGQNWHI+A+L+ Q LSFE+TSSD VTLTSYNVAPK+W++
Sbjct  205   DVTAVKIKGSVTGWLPMGRTWGQNWHISADLKGQALSFEVTSSDGVTLTSYNVAPKDWDF  264

Query  1481  GQTFEGKQF  1507
             G+T+ GKQF
Sbjct  265   GKTYVGKQF  273



>ref|XP_008775003.1| PREDICTED: expansin-A10 [Phoenix dactylifera]
Length=272

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 197/238 (83%), Gaps = 2/238 (1%)
 Frame = +2

Query  794   SPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFER  973
             SP+S A++A   +EWR A A+YYA  DPRD VGGACGYGDL +SGYG ATAGL   LF +
Sbjct  35    SPSSYASSA--LTEWRSAHASYYAAFDPRDTVGGACGYGDLGKSGYGMATAGLGEALFAK  92

Query  974   GQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEA  1153
             G+ CG C+EVRCVE+LR+C+PGTSI+VTATNFCAPNYG   D GG CNPPN HF++PIEA
Sbjct  93    GEACGGCYEVRCVEELRYCLPGTSIVVTATNFCAPNYGLPSDAGGICNPPNHHFLMPIEA  152

Query  1154  FEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSR  1333
             FEKIAIWKA  MPIQYRR+KC +EGGVRF + G G FI+VLI NVAG GD+ AVK+KG+ 
Sbjct  153   FEKIAIWKAGVMPIQYRRVKCIREGGVRFAMEGRGFFINVLISNVAGAGDVTAVKVKGTM  212

Query  1334  TGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              GWLPM RNWGQNWHI+A+L+ Q LSFE+T+SD VTLTSYNVAPK+W +GQT+ GKQF
Sbjct  213   IGWLPMFRNWGQNWHISADLKGQALSFELTTSDSVTLTSYNVAPKDWAFGQTYVGKQF  270



>ref|NP_001130209.1| hypothetical protein precursor [Zea mays]
 gb|ACF78359.1| unknown [Zea mays]
 gb|AFW59073.1| hypothetical protein ZEAMMB73_548248 [Zea mays]
Length=260

 Score =   357 bits (917),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/241 (67%), Positives = 198/241 (82%), Gaps = 2/241 (1%)
 Frame = +2

Query  785   DGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVL  964
             DG    SS  +++L S+WRPA+A+YYA ADP DA+GGACG+GDL + GYG AT GLST L
Sbjct  20    DGHQHLSSYGSSAL-SDWRPAKASYYA-ADPEDAIGGACGFGDLGKHGYGMATVGLSTAL  77

Query  965   FERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLP  1144
             FERG  CG C+EV+CVEDL++C+PGTSI+VTATNFCAPNYG   D GGHCNPPN HF+LP
Sbjct  78    FERGAACGGCYEVKCVEDLKYCLPGTSIVVTATNFCAPNYGLPADAGGHCNPPNHHFLLP  137

Query  1145  IEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIK  1324
             I++FEKIA+WKA  MPIQYRR+KC +EGGVRF+V+G   F +VLI NV G GD+ +VKIK
Sbjct  138   IQSFEKIALWKAGIMPIQYRRVKCLREGGVRFSVNGRHFFFTVLISNVGGAGDVRSVKIK  197

Query  1325  GSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQ  1504
             G+  GWLPMGRNWGQ WHIN ++R QPLSFE++SSD  TLTS+NV PK+W +G+T+ GKQ
Sbjct  198   GTELGWLPMGRNWGQVWHINCDMRGQPLSFELSSSDSKTLTSFNVVPKDWEFGKTYTGKQ  257

Query  1505  F  1507
             F
Sbjct  258   F  258



>ref|NP_001131904.1| alpha-expansin 13 precursor [Zea mays]
 gb|ACF80519.1| unknown [Zea mays]
 gb|ACG32326.1| alpha-expansin 13 precursor [Zea mays]
 tpg|DAA36318.1| TPA: alpha-expansin 13 [Zea mays]
Length=258

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 193/234 (82%), Gaps = 1/234 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S+  +S  SEWRPA+A+YYA ADP DA+GGACG+GDL + GYG AT GLST LFERG  C
Sbjct  24    SSYGSSALSEWRPAKASYYA-ADPEDAIGGACGFGDLGKHGYGMATVGLSTALFERGAAC  82

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             G C+EV+CVEDL++C+PGTSI+VTATNFCAPNYG   D GGHCNPPN HF+LPI++FEKI
Sbjct  83    GGCYEVKCVEDLKYCLPGTSIVVTATNFCAPNYGLPADAGGHCNPPNHHFLLPIQSFEKI  142

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             A+WKA  MPIQYRR+KC +EGGVRF+V+G   F +VLI NV G GD+ +VKIKG+  GWL
Sbjct  143   ALWKAGIMPIQYRRVKCLREGGVRFSVNGRHFFFTVLISNVGGAGDVRSVKIKGTELGWL  202

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             PMGRNWGQ WHIN ++R QPLSFE++SSD   LTS+NV PK+W YG+T+ GKQF
Sbjct  203   PMGRNWGQVWHINCDMRGQPLSFELSSSDGKALTSFNVVPKDWEYGKTYTGKQF  256



>ref|XP_009398000.1| PREDICTED: expansin-A10-like [Musa acuminata subsp. malaccensis]
Length=287

 Score =   356 bits (914),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/236 (69%), Positives = 193/236 (82%), Gaps = 0/236 (0%)
 Frame = +2

Query  800   TSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQ  979
             +SS+  A+  +EWR A A+YYA  DPRD VGGACGYGDL + GYG ATAGLS  LFE+G 
Sbjct  50    SSSSYGAAALTEWRSAHASYYAVFDPRDTVGGACGYGDLGKRGYGMATAGLSEALFEKGA  109

Query  980   ICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFE  1159
              CG C+EVRCVE+LR+C+PGTSI++TATNFC PNYG   D GG CN PN HF++PI+AFE
Sbjct  110   ACGGCYEVRCVEELRYCLPGTSIVLTATNFCPPNYGLPADAGGICNTPNHHFLMPIQAFE  169

Query  1160  KIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTG  1339
             KIAIWKA  MPI+YRR+KC +E GVRFT+ G G F +VLI NVAG GDI AVKIKGS TG
Sbjct  170   KIAIWKAGVMPIKYRRVKCIREDGVRFTIDGKGFFYTVLISNVAGAGDITAVKIKGSTTG  229

Query  1340  WLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             WLPMGRNWGQNWHI+A+L+ Q LSFE+T+SD VTLTSYNVAPK+W +G+ + GKQF
Sbjct  230   WLPMGRNWGQNWHISADLKGQALSFEVTASDGVTLTSYNVAPKDWTFGKIYVGKQF  285



>ref|XP_002446990.1| hypothetical protein SORBIDRAFT_06g026480 [Sorghum bicolor]
 gb|EES11318.1| hypothetical protein SORBIDRAFT_06g026480 [Sorghum bicolor]
Length=257

 Score =   355 bits (910),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 193/234 (82%), Gaps = 1/234 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S+  +S  SEWRPA+A+YYA ADP DA+GGACG+GDL + GYG AT GLST LFERG  C
Sbjct  23    SSYGSSALSEWRPAKASYYA-ADPEDAIGGACGFGDLGKHGYGMATVGLSTALFERGAAC  81

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             G C+EV+CVEDL++C+PGTSI+VTATNFCAPNYG   D GGHCNPPN HF+LPI++FEKI
Sbjct  82    GGCYEVKCVEDLKYCLPGTSIVVTATNFCAPNYGLPADAGGHCNPPNHHFLLPIQSFEKI  141

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             A+WKA  MPIQYRR+KC +EGGVRF+V+G   F +VLI NV G GD+ +VKIKG+  GWL
Sbjct  142   ALWKAGIMPIQYRRVKCLREGGVRFSVNGRHFFFTVLISNVGGAGDVRSVKIKGTELGWL  201

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              MGRNWGQ WHIN ++R QPLSFE++SSD  TLTS+NV PK+W YG+T+ GKQF
Sbjct  202   SMGRNWGQVWHINCDMRGQPLSFELSSSDGKTLTSFNVVPKDWEYGKTYTGKQF  255



>ref|XP_004976598.1| PREDICTED: expansin-A10-like [Setaria italica]
Length=257

 Score =   355 bits (910),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 194/234 (83%), Gaps = 1/234 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S+  +S  SEWRPA+A+YYA ADP DA+GGACG+GDL + GYG AT GLST LF+RG  C
Sbjct  23    SSFGSSALSEWRPAKASYYA-ADPEDAIGGACGFGDLGKHGYGMATVGLSTALFDRGAAC  81

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             G C+EVRCVE+L++C+PGTSI+VTATNFCAPNYG   D GGHCNPPN HF+LPI+AFEKI
Sbjct  82    GGCYEVRCVENLKYCLPGTSIVVTATNFCAPNYGLPADAGGHCNPPNHHFLLPIQAFEKI  141

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             A+WKA  MPIQYRR+KC +EGGVRF+V+G   F +VLI NV G GD+ +VKIKG+ +GWL
Sbjct  142   ALWKAGVMPIQYRRVKCLREGGVRFSVNGRHFFFTVLISNVGGAGDVRSVKIKGTESGWL  201

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              MGRNWGQ WHIN ++R QPLSFE++SSD  TLTS+NV PK+W YG+T+ GKQF
Sbjct  202   SMGRNWGQVWHINCDMRGQPLSFELSSSDGKTLTSFNVVPKDWEYGKTYTGKQF  255



>ref|XP_003553072.1| PREDICTED: expansin-A13-like [Glycine max]
Length=281

 Score =   353 bits (905),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 193/235 (82%), Gaps = 11/235 (5%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EW PA AT+YA  D   AVGGACGYGDL   GYG ATA LS  LF RGQICGACFEVRC 
Sbjct  50    EWLPAHATHYAATD---AVGGACGYGDLLNGGYGMATAALSEALFGRGQICGACFEVRCR  106

Query  1013  E-----DLRWCIPGTSIIVTATNFCAPNYGFEPDG-GGHCNPPNAHFVLPIEAFEKIAIW  1174
             E     D RWCI GT++ VTATNFCAPNYG + +   GHCNPP  H VLPIEAFEKIAIW
Sbjct  107   EEDSDFDRRWCISGTTVAVTATNFCAPNYGSDAESVAGHCNPPKQHLVLPIEAFEKIAIW  166

Query  1175  KAS--NMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLP  1348
             K    NMP++YRRIKC +EGG+RFT++G+GIFISVLI NVAG GDI AVK+KGSRTGWLP
Sbjct  167   KTGTGNMPVEYRRIKCAREGGIRFTITGSGIFISVLISNVAGIGDIAAVKVKGSRTGWLP  226

Query  1349  MGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             MGRNWGQNWHINA L++QPLSFE+TSSD +TLTSYNVAPK+W++GQ+FEGKQFE+
Sbjct  227   MGRNWGQNWHINALLQNQPLSFEVTSSDGITLTSYNVAPKDWSFGQSFEGKQFES  281



>ref|XP_006652695.1| PREDICTED: expansin-A10-like [Oryza brachyantha]
Length=266

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/234 (68%), Positives = 193/234 (82%), Gaps = 1/234 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S+  +S  SEWR A+A+YYA ADP DA+GGACG+GDL + GYG AT GLST LFERG  C
Sbjct  32    SSYGSSALSEWRSAKASYYA-ADPEDAIGGACGFGDLGKHGYGMATVGLSTALFERGAAC  90

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             G C+EV+CVEDL++C+PGTSI+VTATNFCAPN+G   D GG CNPPN HF+LPI+AFEKI
Sbjct  91    GGCYEVKCVEDLKYCLPGTSIVVTATNFCAPNFGLPADAGGVCNPPNHHFLLPIQAFEKI  150

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             A+WKA  MPIQYRR+KC +EGGVRF+V+G   F++VLI NV G GD+ +VKIKG+ +GWL
Sbjct  151   ALWKAGIMPIQYRRVKCLREGGVRFSVAGRSFFLTVLISNVGGAGDVRSVKIKGTESGWL  210

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              MGRNWGQ WHIN++ R QPLSFE+TSSD  TLTSYNV PK W++G+T+ GKQF
Sbjct  211   SMGRNWGQIWHINSDFRGQPLSFELTSSDGNTLTSYNVVPKEWDFGKTYTGKQF  264



>gb|KHN41032.1| Expansin-A13 [Glycine soja]
Length=193

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +2

Query  938   ATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCN  1117
             AT GLS  LFERGQICGACFE+RCVED+RWCIPGTSIIVTATNFCAPNYGF  DGGGHCN
Sbjct  2     ATVGLSEALFERGQICGACFELRCVEDMRWCIPGTSIIVTATNFCAPNYGFTSDGGGHCN  61

Query  1118  PPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGT  1297
             PPN HFVLPIEAFEKIAIWKA NMP+QYRRIKCRKEGG+RFTV+G+GIFISVLI NVAG 
Sbjct  62    PPNKHFVLPIEAFEKIAIWKAGNMPVQYRRIKCRKEGGMRFTVTGSGIFISVLISNVAGH  121

Query  1298  GDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWN  1477
             GDI  VK+KGSRTGWL MGRNWGQNWH+NA L++QPLSFE+ +SD  T+TSYNVAPK+W 
Sbjct  122   GDIGEVKVKGSRTGWLSMGRNWGQNWHVNALLQNQPLSFEVKASDGKTVTSYNVAPKDWT  181

Query  1478  YGQTFEGKQFE  1510
             +GQTFEGKQFE
Sbjct  182   FGQTFEGKQFE  192



>ref|XP_010908423.1| PREDICTED: expansin-A10 [Elaeis guineensis]
Length=296

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 197/239 (82%), Gaps = 3/239 (1%)
 Frame = +2

Query  794   SPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFER  973
             SP+S A++A   +EWR A A+YYA  +PRD VGGACGYGDL +SGYG ATAGLS  LF +
Sbjct  58    SPSSYASSA--LTEWRSAHASYYATFEPRDTVGGACGYGDLGKSGYGMATAGLSEALFAK  115

Query  974   GQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEA  1153
             G+ CG C+EVRCVE+LR+C+PGTSI+VTATNFCAPNYG   D GG CN PN HF++PIEA
Sbjct  116   GEACGGCYEVRCVEELRYCLPGTSIVVTATNFCAPNYGLPSDAGGICNRPNNHFLMPIEA  175

Query  1154  FEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSR  1333
             FEKIAIWKA  MPIQYRR+KC ++GG+RFT+ G G FI+VLI NVAG GD+ AVK+KG+ 
Sbjct  176   FEKIAIWKAGVMPIQYRRVKCVRQGGIRFTMEGRGFFINVLISNVAGAGDVTAVKVKGTM  235

Query  1334  T-GWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               GWLPM R+WGQNWHI+A+L+ Q LSFE+T+SD VTLTSYNVA K+W +G+T+ GKQF
Sbjct  236   IGGWLPMARSWGQNWHISADLKGQALSFELTNSDGVTLTSYNVAQKDWEFGRTYIGKQF  294



>ref|XP_006855596.1| hypothetical protein AMTR_s00044p00061510 [Amborella trichopoda]
 gb|ERN17063.1| hypothetical protein AMTR_s00044p00061510 [Amborella trichopoda]
Length=253

 Score =   344 bits (882),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 186/230 (81%), Gaps = 0/230 (0%)
 Frame = +2

Query  818   ASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACF  997
             ++  + W PARA+YYA  DP +A  GACGYG+L + GYG +T  LS  LF +G  CG C+
Sbjct  22    SAFDNSWHPARASYYALKDPTEATAGACGYGNLMKRGYGMSTVALSDALFNKGASCGGCY  81

Query  998   EVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWK  1177
             EVRCVE+LR+CIPGTSIIVTATN+CA NYG   D GG CNPPN HFV+PI AFEKI IWK
Sbjct  82    EVRCVEELRYCIPGTSIIVTATNYCAANYGLPGDAGGLCNPPNKHFVMPIAAFEKIGIWK  141

Query  1178  ASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGR  1357
             A  MP+QYRRIKC +EGG+RFTV+G GIF SVLI N AG G++ AVK+KGSRTGWLPMGR
Sbjct  142   AGVMPVQYRRIKCIREGGIRFTVTGLGIFHSVLISNAAGPGEVSAVKMKGSRTGWLPMGR  201

Query  1358  NWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NWG  WHI+A+ ++QPLSFE+T SD +T+TSYNVAP+NW +GQTFEGKQF
Sbjct  202   NWGSIWHISADFKNQPLSFEVTGSDGITVTSYNVAPQNWQFGQTFEGKQF  251



>gb|AAS48876.1| expansin EXPA7 [Triticum aestivum]
Length=258

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 191/234 (82%), Gaps = 1/234 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S+  +S  SEWR A+++Y+A ADP DA+GGACG+GDL + GYG AT GLST LFERG  C
Sbjct  24    SSYGSSALSEWRNAKSSYFA-ADPGDAIGGACGFGDLGKHGYGMATVGLSTALFERGAAC  82

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             G C+EV+CVEDL++C+PGTSI+VTATNFC PNYGF  D GG CNPPN HF+LPI+AFEKI
Sbjct  83    GGCYEVKCVEDLKYCLPGTSIVVTATNFCPPNYGFPADAGGVCNPPNHHFLLPIQAFEKI  142

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             A+WKA  MPIQYRR+KC +EGGVRF+VSG   F +VLI NV G GD+ +VKIKG+ +GWL
Sbjct  143   ALWKAGVMPIQYRRVKCLREGGVRFSVSGKSFFFTVLISNVGGAGDVRSVKIKGTESGWL  202

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              MGRNWGQ WHIN +L  QP+SFE+TSSD  T+T++NV PK+W +G+T+ GKQF
Sbjct  203   DMGRNWGQIWHINLDLTGQPVSFELTSSDGTTMTNFNVVPKDWEFGKTYTGKQF  256



>ref|NP_001053663.1| Os04g0583500 [Oryza sativa Japonica Group]
 sp|Q7XUD0.2|EXP10_ORYSJ RecName: Full=Expansin-A10; AltName: Full=Alpha-expansin-10; 
AltName: Full=OsEXP10; AltName: Full=OsEXPA10; AltName: Full=OsaEXPa1.28; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAF62183.1|AF247165_1 alpha-expansin OsEXPA10 [Oryza sativa]
 emb|CAD41376.2| OSJNBa0088A01.16 [Oryza sativa Japonica Group]
 dbj|BAF15577.1| Os04g0583500 [Oryza sativa Japonica Group]
 gb|EAY95297.1| hypothetical protein OsI_17122 [Oryza sativa Indica Group]
 gb|EAZ31762.1| hypothetical protein OsJ_15914 [Oryza sativa Japonica Group]
Length=257

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 190/234 (81%), Gaps = 1/234 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S   +S  SEWR A+A+YYA ADP DA+GGACG+GDL + GYG AT GLST LFERG  C
Sbjct  23    STLGSSALSEWRSAKASYYA-ADPEDAIGGACGFGDLGKHGYGMATVGLSTALFERGAAC  81

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             G C+EV+CV+DL++C+PGTSI+VTATNFCAPN+G   D GG CNPPN HF+LPI++FEKI
Sbjct  82    GGCYEVKCVDDLKYCLPGTSIVVTATNFCAPNFGLPADAGGVCNPPNHHFLLPIQSFEKI  141

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             A+WKA  MPIQYRR+ C ++GGVRF V+G   F++VLI NV G GD+ +VKIKG+ +GWL
Sbjct  142   ALWKAGVMPIQYRRVNCLRDGGVRFAVAGRSFFLTVLISNVGGAGDVRSVKIKGTESGWL  201

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              MGRNWGQ WHIN++ R QPLSFE+TSSD  TLT+YNV PK W++G+T+ GKQF
Sbjct  202   SMGRNWGQIWHINSDFRGQPLSFELTSSDGKTLTNYNVVPKEWDFGKTYTGKQF  255



>ref|XP_003580384.1| PREDICTED: expansin-A10 [Brachypodium distachyon]
Length=257

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 188/234 (80%), Gaps = 1/234 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S+  +S  SEWR A+A+YYA ADP DA+GGACG+GDL + GYG AT GLST LF+RG  C
Sbjct  23    SSYGSSALSEWRHAKASYYA-ADPEDAIGGACGFGDLGKHGYGMATVGLSTALFDRGASC  81

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             G C+EV+CVEDL++C+PGTSIIVTATNFC PNYGF  D GG CNPPN HF+LPI+AFEKI
Sbjct  82    GGCYEVKCVEDLKYCLPGTSIIVTATNFCPPNYGFPADAGGVCNPPNHHFLLPIQAFEKI  141

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             A+WKA  MPIQYRR+KC ++GGVRF+VSG   F +VLI NV G GD+ +VKIKG+ +GWL
Sbjct  142   ALWKAGVMPIQYRRVKCLRDGGVRFSVSGRSFFFTVLISNVGGAGDVSSVKIKGTDSGWL  201

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              MGRNWGQ WHIN +LR QP+SFE+TSSD   LT +   PKNW +G+T+ GKQF
Sbjct  202   SMGRNWGQIWHINLDLRGQPVSFELTSSDGTALTDFTAVPKNWEFGKTYTGKQF  255



>ref|XP_003600633.1| Expansin [Medicago truncatula]
 gb|AES70884.1| expansin A1 [Medicago truncatula]
Length=286

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 195/243 (80%), Gaps = 8/243 (3%)
 Frame = +2

Query  809   AAAASLQSEWRPARATYYAPADP-RDAVGGACGYGDLEQSGYG-KATAGLSTVLFERGQI  982
              + +S  SEW  A ATYY+ +D  RD V GACGYGD  + GYG    A LS  LF RGQI
Sbjct  44    TSPSSTYSEWLSAHATYYSVSDDTRDGVDGACGYGDTHRDGYGITGAAALSETLFVRGQI  103

Query  983   CGACFEVRCVE-----DLRWCIPGTSIIVTATNFCAPNYGFEPDG-GGHCNPPNAHFVLP  1144
             CG CFE+RC+E     D RWC+ G+S++VTAT+FCAPNYGF+ +  GG+CNPP  HFVLP
Sbjct  104   CGGCFELRCLEEDVPFDKRWCVSGSSVVVTATSFCAPNYGFDAESDGGYCNPPKQHFVLP  163

Query  1145  IEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIK  1324
             +EAFEKIAIWK  NMP+ YRRIKC +EGG+RFT++G+GIF SVLI NVAG GDI+ VK+K
Sbjct  164   VEAFEKIAIWKGGNMPVHYRRIKCIREGGMRFTITGSGIFNSVLISNVAGIGDIVGVKVK  223

Query  1325  GSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQ  1504
             GSRTGW+PMGRNWGQ WH+NA L++QPLSFE+TSSD VT+TSYNVAPKNW +GQTFEGKQ
Sbjct  224   GSRTGWIPMGRNWGQIWHVNALLQNQPLSFEVTSSDGVTITSYNVAPKNWTFGQTFEGKQ  283

Query  1505  FEA  1513
             F++
Sbjct  284   FKS  286



>ref|XP_004503092.1| PREDICTED: expansin-A13-like [Cicer arietinum]
Length=283

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 193/244 (79%), Gaps = 7/244 (3%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPA-DPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQ  979
             SS    SL +EW  A ATYY+ A DP DA+ GACGYG   + GYG A   +S  LF RGQ
Sbjct  40    SSPEPPSLAAEWLSAHATYYSDANDPMDALDGACGYGATIKDGYGLAATAVSETLFVRGQ  99

Query  980   ICGACFEVRCVE-----DLRWCIPGTSIIVTATNFCAPNYGFEPD-GGGHCNPPNAHFVL  1141
             ICGACFE+RC E     D R C  G+SI+VTATNFCAPNYGF+ + GGG CNPP  HFV+
Sbjct  100   ICGACFELRCFEEEVPFDRRRCGSGSSIVVTATNFCAPNYGFDAESGGGECNPPKQHFVV  159

Query  1142  PIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKI  1321
             P+EAFEKI I K   +P+QYRRIKCR+EGG+RFT++G+GIF SVLI NVAG GDI+ VK+
Sbjct  160   PVEAFEKIGIRKGGKLPVQYRRIKCRREGGMRFTITGSGIFNSVLISNVAGIGDIVGVKV  219

Query  1322  KGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGK  1501
             KGSRTGW+PMGRNWGQNWH+NA L++QPLSFE+TSSD VT+TSYNVAPKNW +GQTF GK
Sbjct  220   KGSRTGWIPMGRNWGQNWHVNALLQNQPLSFEVTSSDGVTITSYNVAPKNWTFGQTFAGK  279

Query  1502  QFEA  1513
             QFE+
Sbjct  280   QFES  283



>ref|XP_007146985.1| hypothetical protein PHAVU_006G086800g [Phaseolus vulgaris]
 gb|ESW18979.1| hypothetical protein PHAVU_006G086800g [Phaseolus vulgaris]
Length=278

 Score =   324 bits (831),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 191/239 (80%), Gaps = 14/239 (6%)
 Frame = +2

Query  818   ASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACF  997
             +S ++EW  A AT+YA A+   A+GGACGY D+     G ATA LS  LF+RGQICGACF
Sbjct  42    SSPRAEWLFAHATHYAAAE---ALGGACGYADIPN---GMATAALSEALFDRGQICGACF  95

Query  998   EVRCVE-----DLRWCIPGTSIIVTATNFCAPNYGFEPDG-GGHCNPPNAHFVLPIEAFE  1159
             E+RC+E     D RWCI G S++VTATNFCAPNYG + +   GHCNPP  HFVLPIE FE
Sbjct  96    ELRCLEEDSDFDRRWCISGASVVVTATNFCAPNYGSDAESLSGHCNPPKQHFVLPIEVFE  155

Query  1160  KIAIWKAS--NMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSR  1333
             KIAIWK+   NMP+QYRRI+CR+EGG+RFT+SG+GIFISVLI NV G G+I+ VK+KGS+
Sbjct  156   KIAIWKSGSGNMPVQYRRIECRREGGIRFTISGSGIFISVLISNVGGMGNIVGVKVKGSK  215

Query  1334  TGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             TGWL MGRNWGQNWH+NA L++QPLSFE+T+SD  T+ SY+VAPK+W +GQ+F+GKQF 
Sbjct  216   TGWLSMGRNWGQNWHVNALLQNQPLSFELTASDGRTVKSYSVAPKDWTFGQSFQGKQFH  274



>gb|KDP47028.1| hypothetical protein JCGZ_10755 [Jatropha curcas]
Length=253

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 166/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EW+ A ATY    D    + GACGYGDL ++ YGK +AGLST LF +G  CGACFEVRCV
Sbjct  28    EWKTATATYTKEKDGSITIEGACGYGDLHKASYGKFSAGLSTTLFNKGSTCGACFEVRCV  87

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+ G+ SII+TAT+FC PNYG   D GG CN P  HF +   AF +IA  KA  +
Sbjct  88    DHILWCLQGSPSIILTATDFCPPNYGLSSDYGGWCNFPKEHFEMSEAAFAEIAERKADII  147

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRRIKC ++GG+RFTVSG+  F  VLI NV   G+++AVK+KGS+TGW+PM RNWGQ
Sbjct  148   PVQYRRIKCERKGGLRFTVSGSSHFYQVLITNVGLDGEVVAVKVKGSKTGWIPMARNWGQ  207

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NW  N NL  QPLSFE+T+S   TLTSYNVAP NW +GQTFEGKQF
Sbjct  208   NWQSNVNLSGQPLSFEVTTSSGRTLTSYNVAPANWQFGQTFEGKQF  253



>ref|XP_006422415.1| hypothetical protein CICLE_v10029135mg [Citrus clementina]
 ref|XP_006486587.1| PREDICTED: expansin-A20-like [Citrus sinensis]
 gb|ESR35655.1| hypothetical protein CICLE_v10029135mg [Citrus clementina]
 gb|KDO68367.1| hypothetical protein CISIN_1g025617mg [Citrus sinensis]
Length=250

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 170/235 (72%), Gaps = 1/235 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             +   A+   EW  A ATY    +    + GACGYGDL ++ YGK +AGLST+LF RG  C
Sbjct  16    TCKTAAQHEEWNSATATYTKETNGSIIIEGACGYGDLHRATYGKYSAGLSTMLFNRGSTC  75

Query  986   GACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             GACFE+RCV+ + WC PG+ S+I+TAT+FC PNYG   D GG CN P  HF +   AF +
Sbjct  76    GACFELRCVDHILWCRPGSPSVILTATDFCPPNYGLSSDYGGWCNFPKEHFEMSEAAFVE  135

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA  +A  +P+QYRR+KC + GG+RFTVSG+  F  VL+ NV   G++IAVK+KGS+TGW
Sbjct  136   IAERRADIVPVQYRRVKCERRGGLRFTVSGSSHFYQVLVTNVGLDGEVIAVKVKGSKTGW  195

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             +PM RNWGQNW  N NL  QPLSFE+T+S+R TLTSYNVAP NW +GQT+EGKQF
Sbjct  196   IPMARNWGQNWQSNVNLTGQPLSFEVTTSNRKTLTSYNVAPANWQFGQTYEGKQF  250



>ref|XP_003539911.1| PREDICTED: expansin-A16-like [Glycine max]
 gb|KHN31967.1| Expansin-A16 [Glycine soja]
Length=254

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQI  982
             S    A    EW+ A ATY    +      GACGYGDL ++ YGK +AGLST+LF RG  
Sbjct  16    SCKIVAYKDQEWKKATATYANDTEGSLITEGACGYGDLHRASYGKHSAGLSTILFNRGST  75

Query  983   CGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFE  1159
             CGAC+E+RCV+ + WC+ G+ S++VT T+FCAPNYG   D GG CN P  HF +   AF 
Sbjct  76    CGACYEIRCVDHILWCVMGSPSVVVTVTDFCAPNYGLSVDYGGWCNFPREHFEMSRAAFA  135

Query  1160  KIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTG  1339
             +IA  KA  +P+QYRR+KC + GG+RFT+ G+  F  VLI NV   G++ AVK+KGSRTG
Sbjct  136   EIAKNKADIVPVQYRRVKCARSGGMRFTMCGSSHFYQVLISNVGLDGEVFAVKVKGSRTG  195

Query  1340  WLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W+PM RNWGQNWH N N ++QPLSFE+TSS   TLTSYNVAP NW +GQTFEGKQFE
Sbjct  196   WIPMARNWGQNWHCNFNFQNQPLSFEVTSSSGKTLTSYNVAPTNWMFGQTFEGKQFE  252



>ref|XP_003527437.1| PREDICTED: expansin-A16-like [Glycine max]
 gb|KHN41127.1| Expansin-A16 [Glycine soja]
Length=254

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 167/227 (74%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EW+ A AT+    +      GACGYGDL ++ YGK +AGLST+LF RG  CGAC+E+RCV
Sbjct  26    EWKKATATHANDTEGSLITEGACGYGDLHRASYGKHSAGLSTILFNRGSTCGACYEIRCV  85

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+ G+ S++VT T+FCAPNYG   D GG CN P  HF +   AF +IA  KA  +
Sbjct  86    DHILWCVMGSPSVVVTVTDFCAPNYGLSVDYGGWCNFPREHFEMSRAAFAEIAKNKADIV  145

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+KC + GG+RFT+SG+  F  VLI NV   G++ AVK+KGSR+GW+PM RNWGQ
Sbjct  146   PVQYRRVKCERSGGMRFTMSGSSHFYQVLISNVGLDGEVFAVKVKGSRSGWIPMARNWGQ  205

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWH N N ++QPLSFE+TSS   TLTSYNVAP NW +GQTFEGKQFE
Sbjct  206   NWHCNFNFQNQPLSFEVTSSSGKTLTSYNVAPANWMFGQTFEGKQFE  252



>gb|ACU23784.1| unknown [Glycine max]
Length=254

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQI  982
             S    A    EW+ A ATY    +      GACGYGDL ++ YG+ +AGLST+LF RG  
Sbjct  16    SCKIVAYKDQEWKKATATYANDTEGSLITEGACGYGDLHRASYGRHSAGLSTILFNRGST  75

Query  983   CGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFE  1159
             CGAC+E+RCV+ + WC+ G+ S++VT T+FCAPNYG   D GG CN P  HF +   AF 
Sbjct  76    CGACYEIRCVDHILWCVMGSPSVVVTVTDFCAPNYGLSVDYGGWCNFPREHFEMSRAAFA  135

Query  1160  KIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTG  1339
             +IA  KA  +P+QYRR+KC + GG+RFT+ G+  F  VLI NV   G++ AVK+KGSRTG
Sbjct  136   EIAKNKADIVPVQYRRVKCARSGGMRFTMCGSSHFYQVLISNVGLDGEVFAVKVKGSRTG  195

Query  1340  WLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W+PM RNWGQNWH N N ++QPLSFE+TSS   TLTSYNVAP NW +GQTFEGKQFE
Sbjct  196   WIPMARNWGQNWHCNFNFQNQPLSFEVTSSSGKTLTSYNVAPTNWMFGQTFEGKQFE  252



>ref|XP_010913883.1| PREDICTED: expansin-A16 [Elaeis guineensis]
Length=262

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 169/236 (72%), Gaps = 1/236 (0%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQI  982
             ++A  +S   EWR A ATY          GGACGYGDL+ SGYGK++AGLS+ LF+RG  
Sbjct  25    AAAGISSTAEEWRSATATYSKETQSPTIAGGACGYGDLDTSGYGKSSAGLSSALFDRGSA  84

Query  983   CGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFE  1159
             CGACFE+RCV+ + WC+ G+ S++VTAT+FCAPNYG   D GG CN P  HF +   AF 
Sbjct  85    CGACFELRCVDHILWCLKGSPSVVVTATDFCAPNYGLPDDYGGWCNYPREHFEMSEAAFI  144

Query  1160  KIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTG  1339
             +IA   A  +P+Q+RR+ C + GG+RFTV+G   F  VLI NV   G++IAVK+KGSRTG
Sbjct  145   QIAKRNADIIPVQFRRVNCDRYGGMRFTVTGCSYFYQVLITNVGSNGEVIAVKVKGSRTG  204

Query  1340  WLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             W+PM RNWGQNW  NA+LR QPLSFE+T S   T+TSYNVA  NW + QTFEGKQF
Sbjct  205   WIPMARNWGQNWQCNADLRGQPLSFEVTDSSGRTVTSYNVASLNWRFDQTFEGKQF  260



>ref|XP_007132704.1| hypothetical protein PHAVU_011G117600g [Phaseolus vulgaris]
 gb|ESW04698.1| hypothetical protein PHAVU_011G117600g [Phaseolus vulgaris]
Length=254

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 164/227 (72%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EW+ A ATY   ++      GACGYGDL +  YGK +AGLST+LF RG  CGAC+E+RCV
Sbjct  26    EWKKATATYAKDSEGSLVTEGACGYGDLHKESYGKHSAGLSTMLFNRGSTCGACYEIRCV  85

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+ G+ S++VT T+FCAPNYG   D GG CN P  HF +   AF +IA  KA  +
Sbjct  86    DHILWCVMGSPSVVVTVTDFCAPNYGLSVDYGGWCNFPREHFEMSKTAFAEIAKNKADIV  145

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+KC + GGVRFT+SG   F  VLI NV   G++IAVK+KGSRTGW+PM RNWGQ
Sbjct  146   PVQYRRVKCERSGGVRFTMSGGSHFYQVLISNVGVDGEVIAVKVKGSRTGWIPMARNWGQ  205

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWH N N ++QPLSFE+T S   TLTSYNVAP  W  GQTFEGKQF+
Sbjct  206   NWHCNVNFQNQPLSFEVTISGGKTLTSYNVAPAKWMLGQTFEGKQFQ  252



>ref|XP_004293883.1| PREDICTED: expansin-A13-like, partial [Fragaria vesca subsp. 
vesca]
Length=154

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1052  VTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGG  1231
             +T TNFCAPNYGF  DGGGHCNPPN H VLPIEAFEKIAIWKA NMP+QYRRIKCRKEGG
Sbjct  1     ITITNFCAPNYGFTADGGGHCNPPNKHLVLPIEAFEKIAIWKAGNMPVQYRRIKCRKEGG  60

Query  1232  VRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLS  1411
             VRFT+ G+ IFISVLI NVAG GDI AVKIKGS TGWLPMGRNWGQNWHINA+L++QPLS
Sbjct  61    VRFTIDGSSIFISVLISNVAGAGDIAAVKIKGSTTGWLPMGRNWGQNWHINADLKNQPLS  120

Query  1412  FEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             FE+TSSD +TLTSYNVAPKNWN+GQTFEGKQFE+
Sbjct  121   FEVTSSDGLTLTSYNVAPKNWNFGQTFEGKQFES  154



>ref|XP_010025653.1| PREDICTED: expansin-A20 [Eucalyptus grandis]
 gb|KCW62362.1| hypothetical protein EUGRSUZ_H05003 [Eucalyptus grandis]
Length=283

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 168/226 (74%), Gaps = 1/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EW+ A ATY    D      GACGYGDL ++ YGK +AGLS++LF RG  CGACFE+RCV
Sbjct  58    EWKTATATYSVETDGSLITEGACGYGDLHRATYGKYSAGLSSMLFNRGSTCGACFELRCV  117

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+PG+ S+I+TAT+FC PNYG   D GG CN P  HF +   AF +IA+ +A  +
Sbjct  118   DHILWCLPGSPSVILTATDFCPPNYGLAADYGGWCNFPQEHFEMSEAAFAEIAVRRADVV  177

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             PIQYRR+ C + GG+RFT+SG   F  VL+ NV   G++IA+K+KGS+TGW+PM RNWGQ
Sbjct  178   PIQYRRVNCLRSGGLRFTLSGNSHFFQVLVTNVGLDGEVIAMKMKGSKTGWIPMARNWGQ  237

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             +W  N +LR QPLSFE+T+SDR TLTSYNVAP +W +GQTFEGKQF
Sbjct  238   SWQSNVDLRGQPLSFEVTTSDRRTLTSYNVAPPSWQFGQTFEGKQF  283



>ref|XP_006384869.1| alpha-expansin 20 precursor family protein [Populus trichocarpa]
 gb|ERP62666.1| alpha-expansin 20 precursor family protein [Populus trichocarpa]
Length=250

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 168/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  782   HDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTV  961
             H  W  T+         EW+ A ATY    +    V GACGY DL ++ YGK +AGLS++
Sbjct  14    HQTWKITAD------DEEWKSATATYVKETNGSIVVEGACGYADLHKATYGKYSAGLSSM  67

Query  962   LFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFV  1138
             LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+FC PNYG   D GG CN P  HF 
Sbjct  68    LFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDFCPPNYGLSADYGGWCNFPKEHFD  127

Query  1139  LPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVK  1318
             +   AF +IA  KA  +P+Q+RR+KC + GG+RFTVSG   F  VLI NV   G++IAVK
Sbjct  128   MSEAAFTEIAEKKADIVPVQHRRVKCERRGGLRFTVSGNFHFYQVLISNVGLDGEVIAVK  187

Query  1319  IKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEG  1498
             +KGS+T W+PM RNWGQNW  N NL  QPLSFE+T+S R TLTSYNVAP NW +GQTFEG
Sbjct  188   VKGSKTAWIPMARNWGQNWQSNVNLIGQPLSFEVTTSSRKTLTSYNVAPANWQFGQTFEG  247

Query  1499  KQF  1507
             KQF
Sbjct  248   KQF  250



>ref|XP_009381075.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 162/228 (71%), Gaps = 1/228 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF+ GQ CGACFE++C 
Sbjct  31    QWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFDEGQSCGACFEIKCA  90

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             +D RWC PG+ SI +TATNFC PNY   PD GG CNPP  HF L +  F KIA ++A  +
Sbjct  91    DDPRWCHPGSPSIFITATNFCPPNYALAPDNGGWCNPPRPHFDLSMPMFLKIAEYRAGIV  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRR+ CR+ GG+RFT++G   F  VLI NVAG GDI+   +KGSRTGW+PM RNWGQ
Sbjct  151   PVSYRRVPCRRSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQ  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NW  NA L  QPLSF +T SDR T TS+N+ P NW +GQTFEGK + A
Sbjct  211   NWQSNAVLVGQPLSFRVTGSDRRTSTSWNIVPSNWQFGQTFEGKNYRA  258



>ref|XP_009358899.1| PREDICTED: expansin-A20-like [Pyrus x bretschneideri]
Length=255

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 167/235 (71%), Gaps = 1/235 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S AAA  + EW+ A ATY    D      GACGYGDL +  YGK +AGLS +LF +G  C
Sbjct  21    SIAAAQDEEEWKTATATYSNETDGSIITEGACGYGDLHRISYGKHSAGLSGILFNKGSTC  80

Query  986   GACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             GAC+E+RCV+ + WC+ G+ S+I+TAT+FC PN+G   D GG CN PN HF +   AF +
Sbjct  81    GACYELRCVDHILWCLQGSPSVILTATDFCPPNFGLSKDYGGWCNFPNEHFEMSEAAFGE  140

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA  KA  +P+QYRR+KC + GG+RF V G+  F  VLI NV   G+++AVK+KGSRTGW
Sbjct  141   IAKKKADIVPVQYRRVKCERIGGIRFLVGGSSHFYQVLITNVGSDGEVLAVKVKGSRTGW  200

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             +PM RNWGQNW  N NL+ QPLSFE+T S   TLTSYNVAP NW +GQTFEGKQF
Sbjct  201   IPMARNWGQNWQSNVNLKGQPLSFEVTVSSGRTLTSYNVAPANWQFGQTFEGKQF  255



>ref|XP_011040832.1| PREDICTED: expansin-A20 [Populus euphratica]
Length=256

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 168/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  782   HDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTV  961
             H  W  T+         EW+ A ATY    +    V GACGY DL ++ YGK +AGLS++
Sbjct  20    HQTWKITAD------DEEWKSATATYVKETNGSIVVEGACGYADLHKATYGKYSAGLSSM  73

Query  962   LFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFV  1138
             LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+FC PNYG   D GG CN P  HF 
Sbjct  74    LFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDFCPPNYGLSADYGGWCNFPKEHFE  133

Query  1139  LPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVK  1318
             +   AF +IA  KA  +P+Q+RR+KC + GG+RFTVSG   F  VLI NV   G++IAVK
Sbjct  134   MSEAAFTEIAERKADIVPVQHRRVKCVRRGGLRFTVSGNFHFYQVLISNVGLDGEVIAVK  193

Query  1319  IKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEG  1498
             +KGS+T W+PM RNWGQNW  N NL  QPLSFE+T+S R TLTSYNVAP NW +GQTFEG
Sbjct  194   VKGSKTAWIPMARNWGQNWQSNVNLIGQPLSFEVTTSSRKTLTSYNVAPANWQFGQTFEG  253

Query  1499  KQF  1507
             KQF
Sbjct  254   KQF  256



>gb|AFK38509.1| unknown [Medicago truncatula]
 gb|KEH17139.1| expansin A20 [Medicago truncatula]
Length=256

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EW+ A ATY    +      GACGYGDL ++ YGK + GLST+LF RG  CGAC+E+RCV
Sbjct  31    EWKKATATYAKDTEGSLITEGACGYGDLHKASYGKHSVGLSTILFNRGSTCGACYEIRCV  90

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+ G+ S+IVTAT+FC PN+G   D GG CN P  HF L   AF +IA  KA  +
Sbjct  91    DHILWCMLGSPSVIVTATDFCPPNFGLSVDYGGWCNFPREHFELSQAAFAEIAKGKADII  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             PIQYRR+KC + GG++FT+SG+  F  VLI NV   G++ AVK+KGSRTGW+PM RNWG 
Sbjct  151   PIQYRRVKCERSGGLKFTMSGSSHFYQVLITNVGLDGEVFAVKVKGSRTGWIPMARNWGM  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NWH N NL+ QPLSFE+TSS   TLTSYNVAP NW +GQTF+GKQF
Sbjct  211   NWHCNVNLQHQPLSFEVTSSTGKTLTSYNVAPPNWQFGQTFQGKQF  256



>ref|XP_004514456.1| PREDICTED: expansin-A20-like [Cicer arietinum]
Length=257

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 163/226 (72%), Gaps = 1/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W  A ATY    +      GACGYGDL ++ YGK + GLST+LF RG  CGACFE+RCV
Sbjct  32    QWMKATATYAKDTEGSLITEGACGYGDLHKASYGKHSVGLSTILFNRGSTCGACFEIRCV  91

Query  1013  EDLRWCIPGTS-IIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+ G+  +IVTAT+FC PNYG   D GG CN P  HF L   AF +IA  KA  +
Sbjct  92    DHILWCVLGSPPVIVTATDFCPPNYGLSVDYGGWCNFPRQHFELSQAAFAEIAKGKADIV  151

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+KC + GG++FT+SG+  F  VLI NV   G++ AVK+KGSRTGW+PM RNWG 
Sbjct  152   PVQYRRVKCERSGGLKFTMSGSSHFYQVLITNVGLDGEVFAVKVKGSRTGWIPMARNWGM  211

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NWH N NL+ QPLSFE+TSS   TLTSYNVAP+NW +GQTFEGKQF
Sbjct  212   NWHCNVNLQHQPLSFEVTSSTGKTLTSYNVAPQNWQFGQTFEGKQF  257



>ref|XP_008357310.1| PREDICTED: expansin-A20-like [Malus domestica]
Length=255

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 169/235 (72%), Gaps = 1/235 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S AAA  + EW+ A ATY   +D      GACGYGDL +  YGK +AG+S +LF +G+ C
Sbjct  21    SIAAAQNEEEWKTATATYSNESDGSIITEGACGYGDLHRISYGKHSAGVSGILFNKGRTC  80

Query  986   GACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             GAC+E+RCV+ + WC+ G+ S+I+TAT+FC PN+G   D GG CN PN HF +   AF +
Sbjct  81    GACYELRCVDHILWCLQGSPSVILTATDFCPPNFGLSKDYGGWCNFPNEHFEMSEAAFGE  140

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA  KA  +P+QYRR+KC + GG+RF V G+  F  VLI NV   G+++AVK+KGSRTGW
Sbjct  141   IAKKKADIVPVQYRRVKCERIGGIRFMVGGSSHFYQVLITNVGSDGEVLAVKVKGSRTGW  200

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             +PM RNWGQNW  N NL+ QPLSFE+T S   TLTSYNVAP NW +GQTFEGKQF
Sbjct  201   IPMARNWGQNWQSNVNLKGQPLSFEVTVSSGRTLTSYNVAPANWQFGQTFEGKQF  255



>ref|XP_008377830.1| PREDICTED: expansin-A20-like [Malus domestica]
Length=255

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 169/235 (72%), Gaps = 1/235 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S AAA  + EW+ A ATY   +D      GACGYGDL +  YGK +AG+S +LF +G+ C
Sbjct  21    SIAAAQNEEEWKTATATYSNESDGSIITEGACGYGDLHRISYGKHSAGVSGILFNKGRTC  80

Query  986   GACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             GAC+E+RCV+ + WC+ G+ S+I+TAT+FC PN+G   D GG CN PN HF +   AF +
Sbjct  81    GACYELRCVDHILWCLQGSPSVILTATDFCPPNFGLSKDYGGWCNFPNEHFEMSEAAFGE  140

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA  KA  +P+QYRR+KC + GG+RF V G+  F  VLI NV   G+++AVK+KGSRTGW
Sbjct  141   IAKKKADIVPVQYRRVKCERIGGIRFMVGGSSHFYQVLITNVGSDGEVLAVKVKGSRTGW  200

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             +PM RNWGQNW  N NL+ QPLSFE+T S   TLTSYNVAP NW +GQTFEGKQF
Sbjct  201   IPMARNWGQNWQSNVNLKGQPLSFEVTVSSGRTLTSYNVAPANWQFGQTFEGKQF  255



>ref|XP_007200593.1| hypothetical protein PRUPE_ppa010203mg [Prunus persica]
 gb|EMJ01792.1| hypothetical protein PRUPE_ppa010203mg [Prunus persica]
Length=259

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 164/235 (70%), Gaps = 1/235 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S    S   EW+ A ATY    D      GACGYGDL +  YGK +AGLS +LF +G IC
Sbjct  25    SNIVVSQDEEWKTATATYSKETDGSIITEGACGYGDLHKISYGKHSAGLSGILFNKGSIC  84

Query  986   GACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             GAC+E+RCV+ + WC+ G+ S+ +TAT+FC PNYG   D GG CN P  HF +   AF +
Sbjct  85    GACYELRCVDHILWCLLGSPSVTLTATDFCPPNYGLSKDYGGWCNFPKEHFEMSEAAFAE  144

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA  KA  +P+QYRR+KC + GG+RF +SG+  F  VLI NV   G+I+AVK+KGSRTGW
Sbjct  145   IAKRKADIVPVQYRRVKCERSGGLRFMMSGSSHFYQVLITNVGSDGEILAVKVKGSRTGW  204

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             +PM RNWGQNW  N NL+ QPLSFE+T S   TLTSYNVAP NW +GQTFEGKQF
Sbjct  205   IPMARNWGQNWQSNVNLKGQPLSFEVTISSGRTLTSYNVAPANWQFGQTFEGKQF  259



>ref|XP_008235916.1| PREDICTED: expansin-A20 [Prunus mume]
Length=259

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 164/235 (70%), Gaps = 1/235 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S  A S   EW+ A ATY    D      GACGYGDL +  YGK +AGLS +LF +G  C
Sbjct  25    SNIAVSQDEEWKTATATYSKETDGSIITEGACGYGDLHKISYGKHSAGLSGILFNKGSTC  84

Query  986   GACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             GAC+E+RCV+ + WC+ G+ S+ +TAT+FC PNYG   D GG CN P  HF +   AF +
Sbjct  85    GACYELRCVDHILWCLQGSPSVTLTATDFCPPNYGLSKDYGGWCNFPKEHFEMSEAAFAE  144

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA  KA  +P+QYRR+KC + GG+RF +SG+  F  VLI NV   G+I+AVK+KGSRTGW
Sbjct  145   IARRKADIVPVQYRRVKCERSGGLRFMMSGSSHFYQVLITNVGSDGEILAVKVKGSRTGW  204

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             +PM RNWGQNW  N NL+ QPLSFE+T S   TLTSYNVAP NW +GQTFEGKQF
Sbjct  205   IPMARNWGQNWQSNVNLKGQPLSFEVTISSGRTLTSYNVAPANWQFGQTFEGKQF  259



>gb|KEH39111.1| expansin A1 [Medicago truncatula]
Length=252

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 166/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EW+ A ATY    D      GACGYGD+ +  YGK + GLST+LF +G  CGAC+E+RCV
Sbjct  27    EWKSATATYIQDKDGSLITEGACGYGDIHKVDYGKYSTGLSTILFNKGSTCGACYEIRCV  86

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+ G+ S++VT T+FCAPNYG   D GG CN P+ HF +   AF +IA  K+  +
Sbjct  87    DHILWCLIGSPSVVVTVTDFCAPNYGLSSDYGGWCNFPSEHFEMSEAAFAEIAKRKSDIV  146

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             PIQYRR+KC++ GG++FT+SG+  F  VLI NV   G+++AVK+KG++TGW+PM RNWGQ
Sbjct  147   PIQYRRVKCKRTGGLKFTMSGSYNFYQVLITNVGLDGEVVAVKVKGTKTGWIPMARNWGQ  206

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NWH N NL+ QPLSFE+T +   T+TSYNVAP NW +GQTFEGKQF
Sbjct  207   NWHCNVNLQKQPLSFEVTITSGKTITSYNVAPANWQFGQTFEGKQF  252



>ref|XP_002313572.1| alpha-expansin 20 precursor family protein [Populus trichocarpa]
 gb|ABK93538.1| unknown [Populus trichocarpa]
 gb|EEE87527.1| alpha-expansin 20 precursor family protein [Populus trichocarpa]
Length=250

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 167/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  782   HDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTV  961
             H  W  T+         EW+ A ATY         V GACGYGDL ++ YGK +AGLS++
Sbjct  14    HQTWKITAD------DEEWKSATATYVKETSGSIIVEGACGYGDLHRATYGKYSAGLSSM  67

Query  962   LFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFV  1138
             LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+FC PNYG   D GG CN P  HF 
Sbjct  68    LFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDFCPPNYGLSSDYGGWCNFPKEHFD  127

Query  1139  LPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVK  1318
             +   AF +IA  KA  +P+Q+RR+KC + GG+RFT+SG   F  VLI NV   G++IAVK
Sbjct  128   MSEAAFAEIAEKKADVVPVQHRRVKCDRRGGLRFTMSGNFHFYQVLISNVGLDGEVIAVK  187

Query  1319  IKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEG  1498
             +KGSRT W+PM RNWGQNW  N NL  QPLSFE+T+S R TLTSYNVAP NW +GQ FEG
Sbjct  188   VKGSRTAWIPMARNWGQNWQSNINLIGQPLSFEVTTSSRRTLTSYNVAPANWQFGQIFEG  247

Query  1499  KQF  1507
             KQF
Sbjct  248   KQF  250



>ref|XP_010090720.1| hypothetical protein L484_013742 [Morus notabilis]
 gb|EXB40439.1| hypothetical protein L484_013742 [Morus notabilis]
Length=250

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 168/232 (72%), Gaps = 1/232 (0%)
 Frame = +2

Query  815   AASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGAC  994
             AA+   EW+ A ATY    D      GACGYGDL++  YGK +AGLS++LF RG  CGAC
Sbjct  19    AAANTEEWKTATATYTKETDGSIINEGACGYGDLQRITYGKYSAGLSSILFNRGSTCGAC  78

Query  995   FEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAI  1171
             +E+RCV+ + WC+ G+ SI++TA +FC PN+G   D GG CN P  HF +   AF +IA 
Sbjct  79    YELRCVDHILWCLQGSPSIVLTAADFCPPNFGLSADYGGWCNFPKEHFEMSEAAFAEIAE  138

Query  1172  WKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPM  1351
              KA  +P+QYRR+KC + GGVRFTVSG+  F  VLI NV   G+++AVK+KGS+TGW+PM
Sbjct  139   RKADIVPVQYRRVKCARRGGVRFTVSGSSHFYQVLITNVGLDGEVVAVKVKGSKTGWIPM  198

Query  1352  GRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              RNWGQNW  N NL+ QPLSFE+TSS   TLTSYNVAP +W +GQTFEGKQF
Sbjct  199   ARNWGQNWQSNLNLKRQPLSFEVTSSGGRTLTSYNVAPVDWQFGQTFEGKQF  250



>ref|XP_010266279.1| PREDICTED: expansin-A20 [Nelumbo nucifera]
Length=250

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 166/228 (73%), Gaps = 1/228 (0%)
 Frame = +2

Query  827   QSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVR  1006
             ++EW+ A ATY    D      GACGYGDL ++ YGK +AGLS++LF RG+ CG CFE+R
Sbjct  23    EAEWKSATATYSTETDGSIITEGACGYGDLHKATYGKYSAGLSSLLFNRGRTCGGCFELR  82

Query  1007  CVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKAS  1183
             CV+ + WC+ G+ S+I+TAT+FC PNYG   D GG CN P  HF L   AF KIA  +A 
Sbjct  83    CVDHILWCLQGSPSVIITATDFCPPNYGLPADYGGWCNFPREHFELSEAAFAKIAERRAD  142

Query  1184  NMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNW  1363
              +P+QYRR+KC + GG+RFT+SG+  F  VLI NV   G+++AVK+KGS+TGW+PMGRNW
Sbjct  143   IVPVQYRRVKCTRNGGLRFTLSGSSYFYQVLIANVGLDGEVVAVKVKGSKTGWIPMGRNW  202

Query  1364  GQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             GQ W  N NL+ QPLSFE+TSS   T+ SYNVAP NW +GQTFEGKQ 
Sbjct  203   GQIWQCNINLKGQPLSFEVTSSSGKTVASYNVAPPNWQFGQTFEGKQL  250



>ref|XP_009350485.1| PREDICTED: expansin-A20-like [Pyrus x bretschneideri]
 ref|XP_009350488.1| PREDICTED: expansin-A20-like [Pyrus x bretschneideri]
Length=255

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 166/236 (70%), Gaps = 1/236 (0%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQI  982
             S+ AAA    EW+ A ATY    D      GACGYGDL +  YGK +AGLS +LF RG  
Sbjct  20    SNIAAARDVEEWKTATATYSKETDGSIITEGACGYGDLHRISYGKHSAGLSGILFNRGST  79

Query  983   CGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFE  1159
             CGAC+E+RCV+ + WC+ G+ S+I+TAT+FC PN+G   D GG CN P  HF +   AF 
Sbjct  80    CGACYELRCVDHILWCLQGSPSVILTATDFCPPNFGLSADYGGWCNFPKEHFEMSEAAFG  139

Query  1160  KIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTG  1339
             +IA  KA  +P+QYRR+KC + GG+RF V G+  F  VLI NV   G+++AVK+KGSRTG
Sbjct  140   EIAKKKADIVPVQYRRVKCERNGGIRFMVGGSSHFYQVLITNVGLDGEVLAVKVKGSRTG  199

Query  1340  WLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             W+P+ RNWGQNW  N NL+ QPLSFE+T S   TLTSYNVAP NW +GQTFEGKQF
Sbjct  200   WIPLARNWGQNWQSNVNLKGQPLSFEVTVSSGRTLTSYNVAPANWQFGQTFEGKQF  255



>ref|XP_011016423.1| PREDICTED: expansin-A20-like [Populus euphratica]
Length=256

 Score =   282 bits (721),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 167/243 (69%), Gaps = 7/243 (3%)
 Frame = +2

Query  782   HDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTV  961
             H  W  T+         EW+ A ATY    +    V GACGY DL ++ YGK +AGLS++
Sbjct  20    HQTWKITAD------DEEWKSATATYVKETNGSIVVEGACGYADLHKATYGKYSAGLSSM  73

Query  962   LFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFV  1138
             LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+FC PNYG   D GG CN P  HF 
Sbjct  74    LFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDFCPPNYGLSADYGGWCNFPKEHFE  133

Query  1139  LPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVK  1318
             +   AF +IA  KA  +P+Q+RR+K  + GG+RFTVSG   F  VLI NV   G++IAVK
Sbjct  134   MSEAAFTEIAERKADIVPVQHRRVKGVRRGGLRFTVSGNFHFYQVLISNVGLDGEVIAVK  193

Query  1319  IKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEG  1498
             +KGS+T W+PM RNWGQNW  N NL  QPLSFE+T+S R TLTSYNVAP NW +GQTFEG
Sbjct  194   VKGSKTAWIPMARNWGQNWQSNVNLIGQPLSFEVTTSSRKTLTSYNVAPANWQFGQTFEG  253

Query  1499  KQF  1507
             KQF
Sbjct  254   KQF  256



>ref|XP_008451189.1| PREDICTED: expansin-A16 [Cucumis melo]
Length=252

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 163/231 (71%), Gaps = 1/231 (0%)
 Frame = +2

Query  818   ASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACF  997
             A+   EW+   ATY    D      GACGYGDL +  YGK +AGLS++LF RG  CGAC+
Sbjct  22    AAKDEEWKSGTATYSKETDGSIVTEGACGYGDLHKINYGKYSAGLSSMLFNRGSTCGACY  81

Query  998   EVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIW  1174
             E+RCV+ + WC+ G+ ++I+TAT+FC PNYG   D GG CN P  HF +   AF +IA  
Sbjct  82    ELRCVDHILWCLQGSPTVILTATDFCPPNYGLSSDYGGWCNFPKEHFEMSEAAFAEIAEK  141

Query  1175  KASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMG  1354
             KA  +P+QYRR++C + GG+RFTVSG   F  VLI NV   G+++AVK+KGSRTGW+P+ 
Sbjct  142   KADIVPVQYRRVRCDRSGGMRFTVSGNSRFFQVLITNVGMDGELVAVKVKGSRTGWIPLA  201

Query  1355  RNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             RNWGQNW  N NL  QPLSFE+TSS    LTSY+VAP NW YGQTFEGKQF
Sbjct  202   RNWGQNWQSNVNLHGQPLSFEVTSSSGRALTSYSVAPVNWQYGQTFEGKQF  252



>ref|XP_008382507.1| PREDICTED: expansin-A20 [Malus domestica]
Length=255

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 167/236 (71%), Gaps = 1/236 (0%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQI  982
             S+ AAA    EW+ A ATY    D    + GACGYGDL +  YGK +AGLS +LF +G  
Sbjct  20    SNIAAARDVEEWKTATATYSKETDGSIIIEGACGYGDLHRISYGKXSAGLSGILFNKGST  79

Query  983   CGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFE  1159
             CGAC+E+RCV+ + WC+ G+ S+I+TAT+FC PN+G   D GG CN P  HF +   AF 
Sbjct  80    CGACYELRCVDHILWCLQGSPSVILTATDFCPPNFGLSADYGGWCNFPKEHFEMSEAAFG  139

Query  1160  KIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTG  1339
             +IA  KA  +P+QYRR+KC + GG+RF V G+  F  VLI NV   G+++AVK+KGSRTG
Sbjct  140   EIAKKKADIVPVQYRRVKCXRNGGIRFMVGGSSHFYQVLITNVGLDGEVLAVKVKGSRTG  199

Query  1340  WLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             W+P+ RNWGQNW  N NL+ QPLSFE+T S   T+TSYNVAP NW +GQTFEGKQF
Sbjct  200   WIPLARNWGQNWQSNVNLKGQPLSFEVTVSSGRTVTSYNVAPANWQFGQTFEGKQF  255



>ref|XP_008805484.1| PREDICTED: expansin-A16 [Phoenix dactylifera]
Length=257

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 163/211 (77%), Gaps = 1/211 (0%)
 Frame = +2

Query  878   RDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIV  1054
             R A GGACGYGDLE+SGYGK++AGLS+ LFERG  CGACFE+RCV+ + WC+ G+ S++V
Sbjct  45    RCAEGGACGYGDLEKSGYGKSSAGLSSALFERGSACGACFELRCVDHILWCLQGSPSVVV  104

Query  1055  TATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGV  1234
             TA +FCAPNYG   D GG CN P  HF +   AF +IA  KA  +P+Q+RR+ C + GG+
Sbjct  105   TAADFCAPNYGLPGDYGGWCNYPREHFEMSEAAFVQIARRKADIIPVQFRRVNCDRYGGM  164

Query  1235  RFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSF  1414
             RFTV+G   F  VLI NV   G++IAVK+KGSRTGW+PM RNWGQNW  +A+LR QPLSF
Sbjct  165   RFTVTGGSYFYQVLIANVGSDGEVIAVKVKGSRTGWIPMARNWGQNWQCSADLRGQPLSF  224

Query  1415  EITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             E+T+S   T+TSYNVA  NW++GQTFEGKQF
Sbjct  225   EVTASSGRTVTSYNVASSNWSFGQTFEGKQF  255



>ref|XP_004144957.1| PREDICTED: expansin-A16-like [Cucumis sativus]
 ref|XP_004153758.1| PREDICTED: expansin-A16-like [Cucumis sativus]
 ref|XP_004165610.1| PREDICTED: expansin-A16-like [Cucumis sativus]
 gb|KGN43369.1| hypothetical protein Csa_7G027840 [Cucumis sativus]
Length=252

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 163/231 (71%), Gaps = 1/231 (0%)
 Frame = +2

Query  818   ASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACF  997
             A+   EW  A ATY    D      GACGYGDL +  YGK +AGLS++LF RG  CGAC+
Sbjct  22    AAKDEEWISATATYSKETDGSIVTEGACGYGDLHKISYGKYSAGLSSMLFNRGSTCGACY  81

Query  998   EVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIW  1174
             E+RCV+ + WC+ G+ ++I+TAT+FC PNYG   D GG CN P  HF +   AF +IA  
Sbjct  82    ELRCVDHILWCLQGSPTVILTATDFCPPNYGLSSDYGGWCNFPKEHFEMSEAAFAEIAEK  141

Query  1175  KASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMG  1354
             KA  +P+QYRR++C + GG+RFTVSG   F  VLI NV   G+++AVK+KGSRTGW+P+ 
Sbjct  142   KADIVPVQYRRVRCDRSGGMRFTVSGNYRFFQVLITNVGMDGELVAVKVKGSRTGWIPLA  201

Query  1355  RNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             RNWGQNW  N NL  QPLSFE+TSS    LTSY+VAP NW YGQTFEGKQF
Sbjct  202   RNWGQNWQSNVNLHGQPLSFEVTSSSGRALTSYSVAPGNWQYGQTFEGKQF  252



>ref|XP_009419260.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   279 bits (714),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 158/228 (69%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++C
Sbjct  30    SPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSCGACFEIKC  89

Query  1010  VEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
              +DLRWC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  
Sbjct  90    ADDLRWCHGGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLSMPMFLKIAEYRAGI  149

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +P+ YRR+ CRK GG+RFT++G   F  VLI NVAG GDII   +KGSRTGW+PM RNWG
Sbjct  150   VPVSYRRVPCRKSGGIRFTINGFNYFNLVLITNVAGAGDIIRASVKGSRTGWMPMSRNWG  209

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNW  NA L  Q LSF +T SDR T TS+N+ P NW +GQTF+GK F 
Sbjct  210   QNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFQGKNFR  257



>ref|XP_011000856.1| PREDICTED: expansin-A20-like [Populus euphratica]
 ref|XP_011000857.1| PREDICTED: expansin-A20-like [Populus euphratica]
Length=250

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 165/243 (68%), Gaps = 7/243 (3%)
 Frame = +2

Query  782   HDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTV  961
             H  W  T+         EW+ A ATY         V GACGYGDL ++ YGK +AG+S++
Sbjct  14    HQTWKITAD------DEEWKSATATYVKETSGSIIVEGACGYGDLHRATYGKYSAGVSSM  67

Query  962   LFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFV  1138
             LF RG  CG+CFEVRCV+ + WC+ G+ S+I+TAT+FC PNYG   D GG CN P  HF 
Sbjct  68    LFNRGSTCGSCFEVRCVDHILWCLQGSPSVILTATDFCPPNYGLSSDYGGWCNFPKEHFE  127

Query  1139  LPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVK  1318
             +   AF +IA  KA  +P+Q+RR+KC + GG+RFT+SG   F  VLI NV   G++IAVK
Sbjct  128   MSEAAFAEIAEKKADVVPVQHRRVKCDRRGGLRFTMSGNFHFYQVLISNVGLDGEVIAVK  187

Query  1319  IKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEG  1498
             +KGSRT W+PM RNW QNW  N NL  QPLSFE+T+S R TL SYNVAP NW YGQ FEG
Sbjct  188   VKGSRTAWIPMARNWRQNWQSNINLIGQPLSFEVTTSSRKTLASYNVAPANWQYGQIFEG  247

Query  1499  KQF  1507
             KQF
Sbjct  248   KQF  250



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 159/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++CV+
Sbjct  32    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGQSCGACFEIKCVD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             + +WC PG+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  92    EPQWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+PM RNWGQN
Sbjct  152   VSYRRVPCRKPGGIRFTINGFQYFNLVLITNVAGAGDIVRVSVKGSRTGWMPMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P NW +GQTF GK F+
Sbjct  212   WQSNAVLVGQSLSFRVTGSDRRTTTSWNIVPANWQFGQTFAGKNFQ  257



>ref|XP_004290085.1| PREDICTED: expansin-A20-like [Fragaria vesca subsp. vesca]
Length=252

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 1/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A ATY    D      GACGYGDL +  YGK +AGLS +LF RG  CGAC+E+RCV
Sbjct  27    DWKTATATYSKETDGSIITEGACGYGDLHKISYGKYSAGLSRILFNRGSTCGACYELRCV  86

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+ G+ SII+TAT+FC PN+G   D GG CN P  HF +   AF +IA  KA  +
Sbjct  87    DHILWCLQGSPSIILTATDFCPPNFGLSADYGGWCNFPKEHFEMSEAAFAEIAKKKADIV  146

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+KC + GG+RFT+SG+  F  VLI NV   G+++AVK+KGS+TGW+PM RNWGQ
Sbjct  147   PVQYRRVKCDRTGGLRFTMSGSSHFYEVLITNVGSDGEVVAVKVKGSKTGWIPMTRNWGQ  206

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              W  NANL+ QPLSFE+T S   TL SYNVAP  W +GQTFEGKQF
Sbjct  207   IWQSNANLQGQPLSFEVTVSSGKTLASYNVAPSKWQFGQTFEGKQF  252



>ref|XP_002514405.1| Alpha-expansin 20 precursor, putative [Ricinus communis]
 gb|EEF48001.1| Alpha-expansin 20 precursor, putative [Ricinus communis]
Length=251

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 163/228 (71%), Gaps = 1/228 (0%)
 Frame = +2

Query  827   QSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVR  1006
             + EW+ A AT     D    + GACGYGDL ++ YGK +AGLS +LF RG  CGACFE+R
Sbjct  24    EEEWKTATATCTKQKDGSIIIEGACGYGDLHKASYGKYSAGLSRMLFNRGSTCGACFELR  83

Query  1007  CVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKAS  1183
             CV+ + WC+ G+ S+I+TATNFC PNYG   D GG CN P  HF +   AF +IA  KA 
Sbjct  84    CVDHILWCLQGSPSVILTATNFCPPNYGLSADYGGWCNFPKEHFEMSEAAFAEIAERKAD  143

Query  1184  NMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNW  1363
              +P+QYRR+ C ++GG+RFTVSG   F  VL+ NV   G+++AVK+KGSRTGW+PM RNW
Sbjct  144   VVPVQYRRVNCDRKGGLRFTVSGNFHFYQVLVTNVGLDGEVVAVKVKGSRTGWIPMARNW  203

Query  1364  GQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             GQ W  N +L  QPLSFE+T+S   TLTSYNVAP NW +GQ+FEGKQF
Sbjct  204   GQIWQTNVDLIGQPLSFEVTTSSGRTLTSYNVAPVNWKFGQSFEGKQF  251



>ref|XP_002283145.1| PREDICTED: expansin-A20 [Vitis vinifera]
 ref|XP_010645656.1| PREDICTED: expansin-A20 [Vitis vinifera]
 emb|CBI37721.3| unnamed protein product [Vitis vinifera]
Length=250

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 160/226 (71%), Gaps = 1/226 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A ATY    D      GACGYGDL ++ YGK +AGLST+LF RG  CG CFE+RCV
Sbjct  25    QWKSATATYSKETDASIITEGACGYGDLHKTSYGKYSAGLSTMLFNRGSTCGGCFELRCV  84

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             + + WC+ G+ S+I+TAT+FC PN+G   D GG CN P  HF +   AF +IA   A  +
Sbjct  85    DHILWCLQGSPSVILTATDFCPPNFGLPTDYGGWCNFPQEHFEMSEAAFAEIAGLHADIV  144

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+KC + GG+RFTVSG   +  VLI NV   G+++AVK+KGSRTGW+PM RNWGQ
Sbjct  145   PVQYRRVKCHRNGGMRFTVSGNSHYYQVLITNVGLDGEVVAVKVKGSRTGWIPMARNWGQ  204

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              W  N NL  QPLSFE+T+S   TLTSYNVA  NW +GQTFEGKQF
Sbjct  205   IWQCNINLEGQPLSFEVTTSSGKTLTSYNVASGNWRFGQTFEGKQF  250



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 157/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  33    QWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGLSCGACFEIKCA  92

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             +D RWC PG+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  93    DDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIV  152

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRR+ CRK GG+RFT++G   F  VLI NVA  GDI+ V +KGSRTGW+PM RNWGQ
Sbjct  153   PVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVASAGDIVRVSVKGSRTGWMPMSRNWGQ  212

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T+SDR T TS+N+ P NW +GQTF GK F 
Sbjct  213   NWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPANWQFGQTFAGKNFR  259



>ref|XP_007043103.1| Expansin A20, ALPHA 1.23,EXPA20 isoform 1 [Theobroma cacao]
 ref|XP_007043104.1| Expansin A20, ALPHA 1.23,EXPA20 isoform 1 [Theobroma cacao]
 gb|EOX98934.1| Expansin A20, ALPHA 1.23,EXPA20 isoform 1 [Theobroma cacao]
 gb|EOX98935.1| Expansin A20, ALPHA 1.23,EXPA20 isoform 1 [Theobroma cacao]
Length=251

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 164/231 (71%), Gaps = 1/231 (0%)
 Frame = +2

Query  821   SLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFE  1000
             S + EW+ A ATY    D     GGACGYGD+ ++ YGK +AGLST LF +G  CG CFE
Sbjct  21    SKEEEWKSATATYTKETDGSIIRGGACGYGDIHKATYGKYSAGLSTKLFNKGSTCGGCFE  80

Query  1001  VRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWK  1177
             +RCV+ + WC+ G+ S+I+TAT+FC PNYG   D GG CN P  HF +   AF +IA  K
Sbjct  81    LRCVDHILWCLQGSPSVILTATDFCPPNYGLSADYGGWCNFPKEHFEMSEAAFAEIAERK  140

Query  1178  ASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGR  1357
             A  +P+QY+R+KC + GG+RFT+SG+  F  VLI NV   G+++ VK+KG +TGW+PM R
Sbjct  141   ADIVPVQYKRVKCERRGGIRFTMSGSSHFCQVLITNVGLDGEVVGVKVKGPKTGWIPMAR  200

Query  1358  NWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NWGQNW  N NL  QPLSFE+T+S   TL SY+VAP NW +GQT+EGKQF+
Sbjct  201   NWGQNWQCNINLIGQPLSFEVTASSGRTLASYSVAPANWQFGQTYEGKQFK  251



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C E
Sbjct  34    WQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGLSCGACFEIKCGE  93

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             + RWC PG+ SI++TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  94    EPRWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVP  153

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+PM RNWGQN
Sbjct  154   VSYRRVPCRKAGGIRFTINGFEYFNLVLITNVAGAGDIVRVSVKGSRTGWMPMSRNWGQN  213

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T+SDR T TS+N+ P NW +GQTF GK F 
Sbjct  214   WQSNAVLVGQSLSFRVTASDRRTSTSWNIVPANWQFGQTFAGKNFR  259



>ref|XP_010504408.1| PREDICTED: expansin-A16-like [Camelina sativa]
Length=260

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 156/228 (68%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W+ A AT+Y   D    +GGACGYGDL   GYG  TA LST LF  GQ CGACFEV+C
Sbjct  32    SSWQTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAALSTALFNSGQSCGACFEVKC  91

Query  1010  VEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             V D +WC PG+ S+ VTATNFC PN     D GG CNPP AHF L +  F KIA ++A  
Sbjct  92    VNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVFLKIAAYRAGI  151

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +PI YRR+ C+K GG+RFT++G   F  VLI NVAG GDI+   +KGS+TGW+ + RNWG
Sbjct  152   VPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIVKASVKGSKTGWMSLTRNWG  211

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNW  N  L  Q LSF +TSSDR T TS+N+AP NW +GQTF GK F 
Sbjct  212   QNWQSNDVLVGQTLSFRVTSSDRRTSTSWNIAPSNWQFGQTFVGKNFR  259



>ref|XP_010938009.1| PREDICTED: expansin-A2-like [Elaeis guineensis]
Length=256

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 157/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W+ A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CG+C+E+RC
Sbjct  32    SGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRC  91

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              +D +WC+PG SIIVTATN+C PNY    D GG CNPP  HF L   AF +IA ++A  +
Sbjct  92    ADDPQWCLPG-SIIVTATNYCPPNYALPNDNGGWCNPPREHFDLAEPAFLQIAQYRAGIV  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             PI YRR+ C K+GGVRFT++G   F  VLI NVAG GD+ AV IKGS TGW  M RNWGQ
Sbjct  151   PISYRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSNTGWQAMSRNWGQ  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NW  N  L  Q LSF++TSSD  T+TSYNV P NW +GQTFEG+QF
Sbjct  211   NWQSNGYLNGQSLSFQVTSSDGKTVTSYNVVPANWQFGQTFEGEQF  256



>ref|XP_010690580.1| PREDICTED: expansin-A16 [Beta vulgaris subsp. vulgaris]
Length=264

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 168/244 (69%), Gaps = 9/244 (4%)
 Frame = +2

Query  776   FSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLS  955
              S+D + P+        + EW  A ATY   A+      GACGYGDL ++ YG+   GLS
Sbjct  25    LSYDDFDPS--------EDEWESATATYIKEANGSIITEGACGYGDLHKATYGRYGTGLS  76

Query  956   TVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAH  1132
             T+LF +G  CGAC+EVRCV+ ++WC PG+ S++VT T+FCAPNYG   D GG CN P  H
Sbjct  77    TILFNKGSSCGACYEVRCVDHVKWCQPGSLSVVVTVTDFCAPNYGLSSDYGGWCNFPRQH  136

Query  1133  FVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIA  1312
             F +   +F +IA+  A  +PIQYRR++C ++GG+RFTV+G   F  VLI NV   G+++ 
Sbjct  137   FEMSEASFTEIAVKSADIVPIQYRRVECERDGGMRFTVTGNANFYQVLITNVGLDGEVMG  196

Query  1313  VKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTF  1492
             +KIKGSRTGW+PM RNWGQ W  N NL+ Q LSFE+++S   ++TSYNVAP NW +GQTF
Sbjct  197   IKIKGSRTGWIPMARNWGQLWQCNINLKGQSLSFEVSTSSGKSVTSYNVAPANWQFGQTF  256

Query  1493  EGKQ  1504
             EGKQ
Sbjct  257   EGKQ  260



>ref|XP_009398502.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 157/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++C 
Sbjct  31    QWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSCGACFEIKCA  90

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             ED +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L + AF KIA ++A  +
Sbjct  91    EDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFLKIAEYRAGIV  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ +RR+ CRK GG+RFT+ G   F  VLI NVAG GDI+ V +KGSRTGW+PM RNWGQ
Sbjct  151   PVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRVSVKGSRTGWMPMSRNWGQ  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  + LSF +T SDR T TS+N+ P  W +GQTFEGK F 
Sbjct  211   NWQSNAVLVGESLSFRVTGSDRRTSTSWNIVPSTWQFGQTFEGKNFR  257



>gb|ABN09939.1| expansin A4 [Musa acuminata AAA Group]
Length=258

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 156/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++C 
Sbjct  31    QWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSCGACFEIKCA  90

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             ED +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L + AF KIA ++A  +
Sbjct  91    EDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFLKIAEYRAGIV  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ +RR+ CRK GG+RFT+ G   F  VLI NVAG GDI+   +KGSRTGW+PM RNWGQ
Sbjct  151   PVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQ  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SDR T TS+N+ P  W +GQTFEGK F 
Sbjct  211   NWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSTWQFGQTFEGKNFR  257



>gb|AFZ84552.1| expansin 4, partial [Populus tremula]
Length=240

 Score =   274 bits (700),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 155/206 (75%), Gaps = 1/206 (0%)
 Frame = +2

Query  893   GACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNF  1069
             GACGYGDL ++ YGK +AGLS++LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+F
Sbjct  35    GACGYGDLHRATYGKYSAGLSSMLFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDF  94

Query  1070  CAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVS  1249
             C PNYG   D GG CN P  HF +   AF +IA  KA  +P+Q+RR+KC + GG+RFTVS
Sbjct  95    CPPNYGLSSDYGGWCNFPKEHFEMSEAAFAEIAEKKADIVPVQHRRVKCDRRGGLRFTVS  154

Query  1250  GAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSS  1429
             G   F  VLI NV   G++IAVK+KGSRT W+PM RNWGQNW  N NL  QPLSFE+T+S
Sbjct  155   GNFHFYQVLISNVGLDGEVIAVKVKGSRTAWIPMARNWGQNWQSNTNLIGQPLSFEVTTS  214

Query  1430  DRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              R TLTSYNVAP NW +GQ FEGKQF
Sbjct  215   SRRTLTSYNVAPANWQFGQIFEGKQF  240



>ref|XP_010516124.1| PREDICTED: expansin-A16 [Camelina sativa]
Length=260

 Score =   274 bits (701),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 156/228 (68%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W+ A AT+Y   D    +GGACGYGDL   GYG  TA LST LF  GQ CGACFEV+C
Sbjct  32    SSWQTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAALSTALFNSGQSCGACFEVKC  91

Query  1010  VEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             V D +WC PG+ S+ VTATNFC PN     D GG CNPP AHF L +  F KIA ++A  
Sbjct  92    VNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVFLKIAAYRAGI  151

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +PI YRR+ C+K GG+RFT++G   F  VLI NVAG GDI+   +KGS+TGW+ + RNWG
Sbjct  152   VPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIVKASVKGSKTGWMSLTRNWG  211

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNW  N  L  Q LSF +TSSDR T TS+N+AP NW +GQTF GK F 
Sbjct  212   QNWQSNDVLVGQTLSFRVTSSDRRTSTSWNIAPSNWQFGQTFVGKNFR  259



>ref|XP_002525458.1| Alpha-expansin 15 precursor, putative [Ricinus communis]
 gb|EEF36948.1| Alpha-expansin 15 precursor, putative [Ricinus communis]
Length=247

 Score =   274 bits (700),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 158/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  A AT+Y   D    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C
Sbjct  23    SGWSRAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLTCGACFEIKC  82

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V D RWC+PG SIIVTATNFC PN     + GG CNPP  HF L    F+ IA +KA  +
Sbjct  83    VNDARWCLPG-SIIVTATNFCPPNNVLPSNAGGWCNPPLKHFDLSRPVFQHIANFKAGIV  141

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ CRK GG+RFT++G   F  VL+ NV G GD++++ IKGSRTGW PM RNWGQ
Sbjct  142   PVQYRRVACRKTGGIRFTINGHSYFNLVLVTNVGGAGDVVSISIKGSRTGWQPMSRNWGQ  201

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NW  N+ L  Q LSF++T+SD  T+ S NVAP NW++GQTF G+QF
Sbjct  202   NWQSNSYLNGQALSFKVTTSDGHTVISNNVAPPNWSFGQTFTGRQF  247



>ref|XP_010427324.1| PREDICTED: expansin-A16-like [Camelina sativa]
Length=260

 Score =   274 bits (701),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 156/228 (68%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W+ A AT+Y   D    +GGACGYGDL   GYG  TA LST LF  GQ CGACFEV+C
Sbjct  32    SSWQTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAALSTALFNSGQSCGACFEVKC  91

Query  1010  VEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             V D +WC PG+ S+ VTATNFC PN     D GG CNPP AHF L + +F KIA ++A  
Sbjct  92    VNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPSFLKIAAYRAGI  151

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +PI YRR+ C+K GG+RFT++G   F  VLI NVAG GDI+   +KGS+TGW+ + RNWG
Sbjct  152   VPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSKTGWMSLTRNWG  211

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNW  N  L  Q LSF +TSSDR T TS N+AP NW +GQTF GK F 
Sbjct  212   QNWQSNDVLVGQTLSFRVTSSDRRTSTSLNIAPSNWQFGQTFVGKNFR  259



>gb|KDO43109.1| hypothetical protein CISIN_1g025809mg [Citrus sinensis]
Length=247

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 158/224 (71%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y   D    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++CV 
Sbjct  25    WSSAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGVTCGACFEIKCVN  84

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D RWC+PG SIIVTATNFC PN+    + GG CNPP  HF L    F+ IA +KA  +P+
Sbjct  85    DNRWCLPG-SIIVTATNFCPPNHALPNNAGGWCNPPLQHFDLSQPIFQHIAHYKAGIVPV  143

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
             QYRR+ CRK GG+RFT++G   F  VLI NV G GD+++V IKGSRTGW PM RNWGQNW
Sbjct  144   QYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVSVSIKGSRTGWQPMSRNWGQNW  203

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               N+ L  Q LSF++T+SD  ++ S NVAP NW++G+T+ G+QF
Sbjct  204   QSNSYLNGQALSFQVTTSDGRSVISINVAPPNWSFGRTYNGRQF  247



>dbj|BAE06067.1| expansin [Sagittaria pygmaea]
Length=266

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 157/228 (69%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             SEW+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF +G  CGACFE++C
Sbjct  38    SEWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNQGLSCGACFEIKC  97

Query  1010  VEDLRWCIPG-TSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
               D +WC  G  SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  
Sbjct  98    ANDPQWCHGGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGI  157

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +P+QYRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KG++TGW+PM RNWG
Sbjct  158   VPVQYRRVPCRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRVSVKGTKTGWMPMSRNWG  217

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNW  NA L  Q LSF +T SD  T TS+NV P NWN+GQTF GK F 
Sbjct  218   QNWQSNAVLVGQALSFRVTGSDHRTSTSWNVVPANWNFGQTFSGKNFR  265



>ref|XP_008799850.1| PREDICTED: expansin-A6-like [Phoenix dactylifera]
Length=260

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 158/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++C E
Sbjct  34    WQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGQSCGACFEIKCGE  93

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             DL+WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  94    DLKWCHHGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  153

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VL+ NVAG GDI+ + +KGSRTGW+PM RNWGQN
Sbjct  154   VSYRRVPCRKPGGIRFTINGFKYFNLVLVTNVAGAGDIVRLSVKGSRTGWMPMSRNWGQN  213

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T+SDR T TS+N+ P +W +GQTF GK F 
Sbjct  214   WQSNAVLVGQSLSFRLTASDRRTSTSWNIVPAHWQFGQTFAGKNFR  259



>gb|AEX34709.2| expansine 4, partial [Populus deltoides]
Length=236

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 155/206 (75%), Gaps = 1/206 (0%)
 Frame = +2

Query  893   GACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNF  1069
             GACGYGDL ++ YGK +AGLS++LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+F
Sbjct  31    GACGYGDLHRATYGKYSAGLSSMLFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDF  90

Query  1070  CAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVS  1249
             C PNYG   D GG CN P  HF +   AF +IA  KA  +P+Q+RR+KC + GG+RFT+S
Sbjct  91    CPPNYGLSSDYGGWCNFPKEHFEMSEAAFAEIAEKKADVVPVQHRRVKCDRRGGLRFTMS  150

Query  1250  GAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSS  1429
             G   F  VLI NV   G++IAVK+KGSRT W+PM RNWGQNW  N NL  QPLSFE+T+S
Sbjct  151   GNFHFYQVLISNVGLDGEVIAVKVKGSRTAWIPMARNWGQNWQSNINLXGQPLSFEVTTS  210

Query  1430  DRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              R TLTSYNVAP NW +GQ FEGKQF
Sbjct  211   SRRTLTSYNVAPANWQFGQIFEGKQF  236



>gb|KDP20276.1| hypothetical protein JCGZ_06862 [Jatropha curcas]
Length=247

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y   D    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++CV 
Sbjct  25    WSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLTCGACFEIKCVN  84

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D RWC+PG SIIVTATNFC PN     D GG CNPP  HF L    F+ IA +KA  +P+
Sbjct  85    DARWCLPG-SIIVTATNFCPPNNALPSDAGGWCNPPLQHFDLSQPVFQHIAHYKAGIIPV  143

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
             QYRR+ CRK GG+RFT++G   F  VLI NV G GD+++V +KG+RTGW PM RNWGQNW
Sbjct  144   QYRRVACRKTGGIRFTINGHSYFNLVLITNVGGAGDVVSVSVKGTRTGWQPMSRNWGQNW  203

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               N+ L  Q LSF++T SD  ++ S NVAP NW +GQTF G QF
Sbjct  204   QSNSYLNGQALSFKVTISDGHSIISNNVAPPNWGFGQTFTGTQF  247



>gb|AEX34710.2| expansine 4, partial [Populus laurifolia]
 gb|AFZ84550.1| expansin 4, partial [Populus maximowiczii]
Length=240

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 155/206 (75%), Gaps = 1/206 (0%)
 Frame = +2

Query  893   GACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNF  1069
             GACGYGDL ++ YGK +AGLS++LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+F
Sbjct  35    GACGYGDLHRATYGKYSAGLSSMLFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDF  94

Query  1070  CAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVS  1249
             C PNYG   D GG CN P  HF +   AF +IA  KA  +P+Q+RR+KC + GG+RFT+S
Sbjct  95    CPPNYGLSSDYGGWCNFPKEHFEMSEAAFAEIAEKKADVVPVQHRRVKCDRRGGLRFTMS  154

Query  1250  GAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSS  1429
             G   F  VLI NV   G++IAVK+KGSRT W+PM RNWGQNW  N NL  QPLSFE+T+S
Sbjct  155   GNFHFYQVLISNVGLDGEVIAVKVKGSRTAWIPMARNWGQNWQSNINLIGQPLSFEVTTS  214

Query  1430  DRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              R TLTSYNVAP NW +GQ FEGKQF
Sbjct  215   SRRTLTSYNVAPANWQFGQIFEGKQF  240



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 159/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++C +
Sbjct  32    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGQSCGACFELKCAD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  92    DPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ CRK+GG+RFT++G   F  VLI NVAG GD+++V +KGSRTGW+ + RNWGQN
Sbjct  152   VAFRRVPCRKKGGIRFTINGFRYFNLVLISNVAGAGDLVSVSVKGSRTGWMSLSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T+SDR T TS N+AP NW +GQTF G+ F 
Sbjct  212   WQSNAVLVGQSLSFRVTASDRRTSTSLNIAPSNWQFGQTFIGRNFR  257



>gb|AEQ55270.1| expansin [Breonia chinensis]
 gb|AEQ55285.1| expansin [Breonia chinensis]
Length=252

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 157/224 (70%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CG+C+E+RC  
Sbjct  30    WQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRCDS  89

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WC+PGT I VTATNFC PN     D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  90    DPKWCLPGT-ITVTATNFCPPNPALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIVPV  148

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              ++R+ CRK+GGVRFT++G   F  VL+ NVAG GD+ +V IKGSRTGW PM RNWGQNW
Sbjct  149   AFQRVPCRKKGGVRFTINGHSYFNLVLVTNVAGAGDVHSVSIKGSRTGWQPMSRNWGQNW  208

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               N+ L  Q LSF+ITSSD  TLTSYNVAP NW +GQTFEG QF
Sbjct  209   QSNSYLNGQSLSFQITSSDGRTLTSYNVAPANWQFGQTFEGGQF  252



>gb|AEX34708.2| expansine 4, partial [Populus balsamifera]
 gb|AFZ84549.1| expansin 4, partial [Populus trichocarpa]
Length=240

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 155/206 (75%), Gaps = 1/206 (0%)
 Frame = +2

Query  893   GACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNF  1069
             GACGYGDL ++ YGK +AGLS++LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+F
Sbjct  35    GACGYGDLHRATYGKYSAGLSSMLFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDF  94

Query  1070  CAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVS  1249
             C PNYG   D GG CN P  HF +   AF +IA  KA  +P+Q+RR+KC + GG+RFT+S
Sbjct  95    CPPNYGLSSDYGGWCNFPKEHFDMSEAAFAEIAEKKADVVPVQHRRVKCDRRGGLRFTMS  154

Query  1250  GAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSS  1429
             G   F  VLI NV   G++IAVK+KGSRT W+PM RNWGQNW  N NL  QPLSFE+T+S
Sbjct  155   GNFHFYQVLISNVGLDGEVIAVKVKGSRTAWIPMARNWGQNWQSNINLIGQPLSFEVTTS  214

Query  1430  DRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              R TLTSYNVAP NW +GQ FEGKQF
Sbjct  215   SRRTLTSYNVAPANWQFGQIFEGKQF  240



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 156/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++C 
Sbjct  30    QWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSCGACFEIKCA  89

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  90    GDPQWCHGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLSMPMFLKIAEYRAGIV  149

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRR+ CR+ GG+RFT++G   F  VLI NVAG GDI+   +KGSRTGW+PM RNWGQ
Sbjct  150   PVSYRRVPCRRSGGIRFTINGFKYFNLVLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQ  209

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SDR T TS+N+ P NW +GQTFEGK F 
Sbjct  210   NWQSNAVLVGQSLSFRLTGSDRRTSTSWNIVPSNWQFGQTFEGKNFR  256



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++C +
Sbjct  32    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSCGACFEIKCAD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D  WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  92    DPSWCHRGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+P+ RNWGQN
Sbjct  152   VSYRRVPCRKPGGIRFTINGFQYFNLVLITNVAGAGDIVRVSVKGSRTGWMPLSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+NV P NW +GQTF GK F 
Sbjct  212   WQSNAVLVGQSLSFRVTGSDRRTATSWNVVPANWQFGQTFAGKNFR  257



>gb|ACM90160.1| expansin 2 [Pyrus pyrifolia]
Length=251

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 159/233 (68%), Gaps = 1/233 (0%)
 Frame = +2

Query  809   AAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICG  988
             A+A +    W  ARAT+Y   D    +GGACGYG+L   GYG  TA L T LF  G  CG
Sbjct  20    ASAHAYGGGWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALDTALFNNGLGCG  79

Query  989   ACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIA  1168
             +C+E+RCV D +WC+PG SI+VTATNFC PN     + GG CNPP  HF L    F+ IA
Sbjct  80    SCYEIRCVNDPKWCLPG-SIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPIFQHIA  138

Query  1169  IWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLP  1348
              +KA  +P+ YRR+ CR+ GG+RFT++G   F  VLI NVAG GD+ +V IKGSRTGW P
Sbjct  139   QYKAGVVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQP  198

Query  1349  MGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             M RNWGQNW  N+ L  Q LSF++T+SD  T+TSYNVAP NW +GQTF G QF
Sbjct  199   MSRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  251



>gb|ABN09940.1| expansin A5 [Musa acuminata AAA Group]
Length=257

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 157/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFEV+C 
Sbjct  30    QWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSCGACFEVKCA  89

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  90    GDPQWCHGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLSMPMFLKIAEYRAGIV  149

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ +RR+ CR+ GG+RFT++G   F  VLI NVAG GDI+   +KGSRTGW+PM RNWGQ
Sbjct  150   PVSHRRVPCRRSGGIRFTINGFEYFNLVLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQ  209

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA+L  Q LSF +T SDR T TS+N+ P NW +GQTFEGK F 
Sbjct  210   NWQSNADLVGQSLSFRLTGSDRRTSTSWNIVPSNWQFGQTFEGKNFR  256



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
              W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  31    SWEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCG  90

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             +D RWC PG  SI+VTATNFC PN+    D GG CNPP  HF L +  F KIA +KA  +
Sbjct  91    DDPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPMFLKIAEYKAGIV  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRR+ CRK+GGVRFT++G   F  VLI NVAG GDI+ V +KG  TGW+PM RNWGQ
Sbjct  151   PVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGGNTGWMPMSRNWGQ  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA+L  Q LSF +T SDR T TS+NVAP +W +GQTF GK F 
Sbjct  211   NWQSNADLVGQTLSFRVTGSDRRTSTSHNVAPADWQFGQTFTGKNFR  257



>gb|AIX87539.1| EXP1 [Picea wilsonii]
Length=259

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 157/227 (69%), Gaps = 2/227 (1%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC-  1009
             EW+ A AT+Y  AD     GGACGYG+L   GYG  TA LST LF  G  CG C+E++C 
Sbjct  33    EWKHAHATFYGGADASGTFGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGGCYEIQCR  92

Query  1010  -VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
                D +WC+PG S+IVTATNFC PNY    D GG CNPP +HF + + AFE+IA  K   
Sbjct  93    AKADPQWCLPGASVIVTATNFCPPNYAKPNDNGGWCNPPLSHFDMAVPAFEQIAQIKGGI  152

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +P+++RR++C K GG+RFT++G   FI V++ NV G GD+ AV IKGSRTGW PM RNWG
Sbjct  153   VPVRFRRVECTKSGGIRFTINGQRYFIMVMVSNVGGAGDVHAVSIKGSRTGWQPMSRNWG  212

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             QNW  N+ L  Q LSF++T+SD  T+ SYN AP NW +GQTFEG Q 
Sbjct  213   QNWQSNSYLNGQSLSFQVTTSDGRTVVSYNAAPSNWQFGQTFEGGQL  259



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   271 bits (694),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 156/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++CV 
Sbjct  30    WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCVA  89

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC+PG  SI+VTATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  90    DPRWCLPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPMFLKIAQYRAGIVP  149

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VL+ NVAG GDI+ V +KGS+TGWL M RNWGQN
Sbjct  150   VSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGSKTGWLTMSRNWGQN  209

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+NVA  NW +GQTF GK F 
Sbjct  210   WQSNAVLVGQALSFRVTGSDRRTSTSWNVAKSNWQFGQTFVGKNFR  255



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 156/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCGD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG  SI+VTATNFC PN+    D GG CNPP  HF L +  F KIA +KA  +P
Sbjct  92    DPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPMFLKIAEYKAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GGVRFT++G   F  VLI NVAG GDI+ V +KG+ TGW+PM RNWGQN
Sbjct  152   VSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGANTGWMPMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA+L  Q LSF +T SDR T TS+NVAP +W +GQTF GK F 
Sbjct  212   WQSNADLVGQTLSFRVTGSDRRTSTSHNVAPADWQFGQTFTGKNFR  257



>ref|XP_006443365.1| hypothetical protein CICLE_v10021887mg [Citrus clementina]
 ref|XP_006479065.1| PREDICTED: expansin-A15-like isoform X1 [Citrus sinensis]
 ref|XP_006479066.1| PREDICTED: expansin-A15-like isoform X2 [Citrus sinensis]
 ref|XP_006479067.1| PREDICTED: expansin-A15-like isoform X3 [Citrus sinensis]
 ref|XP_006479068.1| PREDICTED: expansin-A15-like isoform X4 [Citrus sinensis]
 gb|ESR56605.1| hypothetical protein CICLE_v10021887mg [Citrus clementina]
Length=247

 Score =   271 bits (693),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 157/224 (70%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y   D    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++CV 
Sbjct  25    WSSAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGVTCGACFEIKCVN  84

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D RWC+PG SIIVTATNFC PN+    + GG CNPP  HF L    F+ IA +KA  +P+
Sbjct  85    DNRWCLPG-SIIVTATNFCPPNHALPNNAGGWCNPPLQHFDLSQPIFQHIAHYKAGIVPV  143

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
             QYRRI C K GG+RFT++G   F  VLI NV G GD+++V IKGSRTGW PM RNWGQNW
Sbjct  144   QYRRIACSKRGGIRFTINGHSYFNLVLITNVGGAGDVVSVSIKGSRTGWQPMSRNWGQNW  203

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               N+ L  Q LSF++T+SD  ++ S NVAP NW++G+T+ G+QF
Sbjct  204   QSNSYLNGQALSFKVTTSDGRSVISINVAPPNWSFGRTYNGRQF  247



>ref|XP_002864447.1| ATEXPA14 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40706.1| ATEXPA14 [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 160/228 (70%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  ARAT+Y  AD    +GGACGYG+L   GYG  TA LST LF  GQ CGACF+++C
Sbjct  27    SGWVNARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQSCGACFQIKC  86

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V D +WC+ GT I VT TNFC PN+    + GG CNPP  HF L    F +IA +KA  +
Sbjct  87    VNDPKWCLRGT-ITVTGTNFCPPNFAQANNAGGWCNPPQHHFDLAQPIFLRIAQYKAGVV  145

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ CR++GG+RFT++G   F  VLI NVAG GD+++V IKG+RTGW  M RNWGQ
Sbjct  146   PVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVVSVSIKGTRTGWQSMSRNWGQ  205

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NW  NANL  Q LSF++T+SD  T+ S N  P+NW++GQT+ GKQF A
Sbjct  206   NWQSNANLDGQALSFKVTTSDGRTVVSNNATPRNWSFGQTYTGKQFGA  253



>ref|XP_006280986.1| hypothetical protein CARUB_v10026987mg [Capsella rubella]
 gb|EOA13884.1| hypothetical protein CARUB_v10026987mg [Capsella rubella]
Length=255

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 159/228 (70%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  ARAT+Y  AD    +GGACGYG+L   GYG  TA LST LF  GQ CGACF+++C
Sbjct  27    SGWVNARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQTCGACFQIKC  86

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V D +WC+ GT I VT TNFC PN+    D GG CNPP  HF L    F +IA +KA  +
Sbjct  87    VNDPKWCLGGT-ITVTGTNFCPPNFAQANDAGGWCNPPQHHFDLAQPIFLRIAKYKAGVV  145

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ CR++GG+RFT++G   F  VLI NVAG GD+ +V +KG+RTGW  M RNWGQ
Sbjct  146   PVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVTSVSVKGTRTGWQSMSRNWGQ  205

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NW  NANL  Q LSF++T+SD  T+ S N  P+NW++GQT+ G+QF A
Sbjct  206   NWQSNANLDGQALSFKVTTSDGRTVVSNNATPRNWSFGQTYTGRQFRA  253



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 159/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF +GQ CGACFE++C  
Sbjct  32    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNKGQSCGACFEIKCAN  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC  G+ SI++TATNFC PNY    D GG CNPP +HF L +  F KIA ++A  +P
Sbjct  92    DPRWCHSGSPSILITATNFCPPNYALPNDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VLI NVAG GDI+ V +KG+RTGW+ + RNWGQN
Sbjct  152   VSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGTRTGWMSLTRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+AP +W +GQTF GK F 
Sbjct  212   WQSNAVLVGQALSFRVTGSDRRTSTSWNIAPAHWQFGQTFTGKNFR  257



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   271 bits (694),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 156/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG  SI+VTATNFC PN+    D GG CNPP  HF L +  F KIA +KA  +P
Sbjct  92    DPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPMFLKIAEYKAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GGVRFT++G   F  VLI NVAG GDI+ V +KG+ TGW+PM RNWGQN
Sbjct  152   VSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGANTGWMPMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA+L  Q LSF +T SDR T TS+NVAP +W +GQTF GK F 
Sbjct  212   WQSNADLVGQTLSFRVTGSDRRTSTSHNVAPADWQFGQTFTGKNFR  257



>ref|XP_009384771.1| PREDICTED: expansin-A2 [Musa acuminata subsp. malaccensis]
Length=255

 Score =   271 bits (693),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 158/225 (70%), Gaps = 1/225 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y   D    +GGACGYGDL   GYG  TA LST LF  G  CG+C+E++C 
Sbjct  32    DWQSAHATFYGGGDASGTMGGACGYGDLYSQGYGTNTAALSTALFNDGLSCGSCYELKCD  91

Query  1013  EDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             +D RWC+PG SI++TATNFC PNY    D GG CNPP  HF +   AF +IA ++A  +P
Sbjct  92    DDPRWCLPG-SIVITATNFCPPNYALPSDDGGWCNPPRPHFDMAEPAFLQIAQYRAGIVP  150

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ C K+GGVRFT++G   F  VLI NVAG GD+ AV IKGSRTGW  M RNWGQN
Sbjct  151   VAFRRVPCAKKGGVRFTINGHSYFNLVLITNVAGAGDVCAVSIKGSRTGWQVMSRNWGQN  210

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             W  NA L  Q LSF++T+SD  T+TSY+V P +W +GQTFEG QF
Sbjct  211   WQSNAYLDGQSLSFQVTTSDGRTITSYDVVPTDWQFGQTFEGGQF  255



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 158/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG  TA LST LF +GQ CGACFE++C  
Sbjct  32    WQSAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNKGQSCGACFEIKCAN  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC  G+ SI++TATNFC PNY    D GG CNPP +HF L +  F KIA ++A  +P
Sbjct  92    DPRWCHSGSPSILITATNFCPPNYALPNDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VLI NVAG GDI+ V +KG+RTGW+ + RNWGQN
Sbjct  152   VSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGTRTGWMSLTRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  212   WQSNAVLVGQALSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  257



>ref|XP_009411610.1| PREDICTED: expansin-A16 [Musa acuminata subsp. malaccensis]
Length=265

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 170/254 (67%), Gaps = 8/254 (3%)
 Frame = +2

Query  755   FSKTSLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVG--GACGYGDLEQSG  928
             F + S V +  G S T +        EWR A ATY          G  GACG+G+L +SG
Sbjct  15    FFRYSTVVAAAGISSTRNG-----DQEWRSATATYTRGTATATGAGQAGACGFGELSESG  69

Query  929   YGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGG  1105
             YG  + G+S+ LFERG  CG CFE+RCV+ + WC+ G+ S++VTAT+FCAPNYG   D G
Sbjct  70    YGFNSVGVSSALFERGSACGGCFELRCVDHILWCLNGSPSLVVTATDFCAPNYGLPGDYG  129

Query  1106  GHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRN  1285
             G CN P  HF +   AF  IA   A  +P+QYRR++C ++GG+RFT++G   F  VLI N
Sbjct  130   GWCNYPREHFEMSESAFLHIAKTTADVIPVQYRRVECHRKGGMRFTMTGKSYFYQVLITN  189

Query  1286  VAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAP  1465
             V   G++ AVK+KGSRTGW+PMGRNWGQNW  +A+LR QPLSFE+TS      TSYNVAP
Sbjct  190   VGSDGEVAAVKVKGSRTGWIPMGRNWGQNWQCDADLRGQPLSFEVTSGRGRATTSYNVAP  249

Query  1466  KNWNYGQTFEGKQF  1507
              NW +GQTFEGKQF
Sbjct  250   WNWQFGQTFEGKQF  263



>gb|AFB77224.1| expansin 2 [Betula platyphylla]
Length=249

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 156/234 (67%), Gaps = 1/234 (0%)
 Frame = +2

Query  806   SAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQIC  985
             S++A      W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  C
Sbjct  17    SSSANGYGGGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  76

Query  986   GACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKI  1165
             GACFEVRCV D +WC+PG S++VTATNFC PN     + GG CNPP  HF L    F+ I
Sbjct  77    GACFEVRCVNDPKWCLPG-SVVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHI  135

Query  1166  AIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWL  1345
             A +KA  +P+ YRR  CRK GG+RFT++G   F  VLI NV G GD+ AV IKGSRTGW 
Sbjct  136   AQYKAGIVPVAYRRTPCRKRGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSRTGWQ  195

Query  1346  PMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             PM RNWGQNW  NA L  Q LSF++T+ D  T+ SYNVAP  W++GQTF G+QF
Sbjct  196   PMSRNWGQNWQSNAYLNGQGLSFKVTAGDGRTVVSYNVAPAAWSFGQTFSGRQF  249



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WEGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCGD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG  SI VTATNFC PN+    D GG CNPP  HF L +  F KIA +KA  +P
Sbjct  92    DPRWCHPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPRTHFDLAMPMFLKIAEYKAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GGVRFT++G   F  VLI NVAG GDI+ V +KG+ TGW+PM RNWGQN
Sbjct  152   VSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGANTGWMPMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA+L  Q LSF +T SDR T TS NVAP +W +GQTF GK F 
Sbjct  212   WQSNADLVGQTLSFRVTGSDRRTSTSLNVAPAHWQFGQTFTGKNFR  257



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 154/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  35    QWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGLSCGACFEIKCA  94

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             +D RWC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  95    DDPRWCKGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMFLKIAEYRAGIV  154

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRR+ CRK GG+RFT++G   F  VLI NVAG GDII   +KGSRTGW+PM RNWGQ
Sbjct  155   PVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDIIRATVKGSRTGWMPMSRNWGQ  214

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SD  T TS+N+AP  W +GQTF GK F 
Sbjct  215   NWQSNAALVGQSLSFRVTGSDHRTSTSWNIAPATWQFGQTFSGKNFR  261



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
              W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  35    SWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCA  94

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D RWC PG+ SI VTATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  95    SDPRWCHPGSPSIFVTATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIV  154

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ +RR+ CRK+GG+RFTV+G   F  VLI NVAG GDI+ V IKG++TGW+ M RNWGQ
Sbjct  155   PVSFRRVPCRKQGGIRFTVNGFRYFNLVLITNVAGAGDIVKVSIKGTKTGWMSMSRNWGQ  214

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SD+ T TS+NVAP NW +GQTF GK F 
Sbjct  215   NWQSNAVLIGQALSFRVTGSDKRTSTSWNVAPSNWQFGQTFTGKNFR  261



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  33    WQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCAN  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG+ SI +TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VLI NVAG GDI+ V +KGS TGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKGSNTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+NVAP NW +GQTF GK F 
Sbjct  213   WQSNAVLVGQTLSFRLTGSDRRTSTSWNVAPSNWQFGQTFTGKNFR  258



>ref|XP_010450942.1| PREDICTED: expansin-A14 [Camelina sativa]
Length=254

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 159/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  ARAT+Y  AD    +GGACGYG+L   GYG  TA LST LF  GQ CGACF+++CV 
Sbjct  28    WVNARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQTCGACFQIKCVN  87

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WC+ GT I VT TNFC PN+    + GG CNPP  HF L    F +IA +KA  +P+
Sbjct  88    DPKWCLGGT-ITVTGTNFCPPNFAQANNAGGWCNPPQHHFDLAQPIFLRIAKYKAGVVPV  146

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
             QYRR+ CR++GG+RFT++G   F  VL+ NVAG GD+I+V +KG++TGW  M RNWGQNW
Sbjct  147   QYRRVACRRKGGIRFTINGHSYFNLVLVTNVAGAGDVISVSVKGTKTGWQSMSRNWGQNW  206

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
               NANL  Q LSF++T+SD  T+ S N  P+NWN+GQT+ G+QF A
Sbjct  207   QSNANLDGQALSFKVTTSDGRTVVSNNATPRNWNFGQTYTGRQFRA  252



>ref|XP_010483107.1| PREDICTED: expansin-A14 [Camelina sativa]
Length=254

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 159/226 (70%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  ARAT+Y  AD    +GGACGYG+L   GYG  TA LST LF  GQ CGACF+++CV 
Sbjct  28    WVNARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQTCGACFQIKCVN  87

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WC+ GT I VT TNFC PN+    D GG CNPP  HF L    F +IA +KA  +P+
Sbjct  88    DPKWCLGGT-ITVTGTNFCPPNFAQANDAGGWCNPPQHHFDLAQPIFLRIAQYKAGVVPV  146

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
             QYRR+ CR++GG+RFT++G   F  VL+ NVAG GD+I+V +KG++TGW  M RNWGQNW
Sbjct  147   QYRRVACRRKGGIRFTINGHSYFNLVLVTNVAGAGDVISVSVKGTKTGWQSMSRNWGQNW  206

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
               NANL  Q LSF++T+SD  T+ S N  P+NW++GQT+ G+QF A
Sbjct  207   QSNANLDGQALSFKVTTSDGRTVVSNNATPRNWSFGQTYTGRQFRA  252



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  33    WQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCAN  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG+ SI +TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VLI NVAG GDI+ V +KGS TGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGSNTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+NVAP NW +GQTF GK F 
Sbjct  213   WQSNAVLVGQTLSFRVTGSDRRTSTSWNVAPSNWQFGQTFTGKNFR  258



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGMSCGACFEIKCAD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  92    DPQWCHSGSPSIFITATNFCPPNYALPSDDGGWCNPPXPHFDLAMPMFLKIAEYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+   +KGSRTGW+PM RNWGQN
Sbjct  152   VSYRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P NW +GQTF GK F 
Sbjct  212   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFAGKNFR  257



>ref|XP_006401349.1| hypothetical protein EUTSA_v10014463mg [Eutrema salsugineum]
 gb|ESQ42802.1| hypothetical protein EUTSA_v10014463mg [Eutrema salsugineum]
Length=255

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 160/228 (70%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  ARAT+Y  AD    +GGACGYG+L   GYG  TA LST LF  GQ CGACF+++C
Sbjct  27    SGWVSARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQSCGACFQIKC  86

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V D +WC+ GT I VT TNFC PN+    + GG CNPP  HF L    F +IA +KA  +
Sbjct  87    VNDPKWCLGGT-ITVTGTNFCPPNFAQANNAGGWCNPPQHHFDLAQPIFLRIAKYKAGVV  145

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ CR++GG+RFT++G   F  VL+ NVAG GD+++V IKG+RTGW  M RNWGQ
Sbjct  146   PVQYRRVACRRKGGMRFTINGHSYFNLVLVTNVAGAGDVVSVSIKGTRTGWQSMSRNWGQ  205

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NW  NANL  Q LSF++T+SD  T+ S N  P+NW++GQT+ GKQF +
Sbjct  206   NWQSNANLDGQALSFKVTTSDGRTVVSNNATPRNWSFGQTYTGKQFRS  253



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
              W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  36    SWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCA  95

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D RWC PG+ SI VTATNFC PNY    D GG CNPP +HF L +  F KIA ++A  +
Sbjct  96    NDPRWCHPGSPSIFVTATNFCPPNYALPSDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIV  155

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ +RR+ CRK+GG+RFT++G   F  VL+ NVAG GDI+ V +KG++TGWL M RNWGQ
Sbjct  156   PVSFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGTKTGWLSMSRNWGQ  215

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SD+ T TS+NVA  NW +GQTF GK F 
Sbjct  216   NWQSNAVLVGQALSFRVTGSDKRTSTSWNVASANWQFGQTFTGKNFR  262



>gb|AGF90535.1| alpha-expansin 1 [Ammopiptanthus nanus]
Length=248

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 160/236 (68%), Gaps = 1/236 (0%)
 Frame = +2

Query  800   TSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQ  979
             T  ++A +    W  A AT+Y   D    +GGACGYG+L   GYG  TA +ST LF  G 
Sbjct  13    TMFSSAHAYAEGWTNAHATFYGGGDASGTMGGACGYGNLYGQGYGTNTAAVSTALFNNGL  72

Query  980   ICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFE  1159
              CG+C+E+RCV D +WC+PG SI+VTATNFC PN G   + GG CNPP  HF L    F 
Sbjct  73    SCGSCYEIRCVNDNKWCLPG-SIVVTATNFCPPNNGLPNNAGGWCNPPQQHFDLSQPVFL  131

Query  1160  KIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTG  1339
             +IA +KA  +P+ YRR+ CR++GG+RFT++G   F  VLI NV G GD+ AV +KGSRTG
Sbjct  132   RIAQYKAGIVPVSYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVAVKGSRTG  191

Query  1340  WLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             W+PM RNWGQNW  N  L  Q LSF++T+SD  T+ SYNVAP  WN+GQT+ G QF
Sbjct  192   WMPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGHTVVSYNVAPAGWNFGQTYTGAQF  247



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 155/228 (68%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S+W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C
Sbjct  30    SDWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNSGLSCGACFEIKC  89

Query  1010  VEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
               D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  
Sbjct  90    ASDPKWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGI  149

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +P+ YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWG
Sbjct  150   VPVSYRRVSCRKPGGIRFTINGFRYFNLVLISNVAGAGDIVKVWVKGSRTGWMSMSRNWG  209

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNW  N+ L  Q LSF +TSSDR T TS+NV P NW +GQTF GK F 
Sbjct  210   QNWQSNSILVGQALSFRVTSSDRRTSTSWNVVPANWQFGQTFTGKNFR  257



>gb|ABN09942.1| expansin A5 [Musa acuminata AAA Group]
Length=239

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++C 
Sbjct  12    QWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSCGACFEIKCA  71

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  72    GDPQWCHGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLSMPMFLKIAEYRAGIV  131

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRR+ CR+ GG+RFT++G   F  VLI NVAG  DI+   +KGSRTGW+PM RNWGQ
Sbjct  132   PVSYRRVPCRRSGGIRFTINGFKYFNLVLITNVAGASDIVHASVKGSRTGWMPMSRNWGQ  191

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SDR T TS+N+ P NW +GQTFEGK F 
Sbjct  192   NWQSNAVLVGQSLSFRLTGSDRRTSTSWNIVPSNWQFGQTFEGKNFR  238



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE+RC +
Sbjct  32    WQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIRCGD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG  SI VTATNFC PN+    D GG CNPP  HF L +  F KIA +KA  +P
Sbjct  92    DPRWCTPGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMFLKIAEYKAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GD+++V +KG+ TGW+PM RNWGQN
Sbjct  152   VSYRRVPCRKRGGIRFTINGHKYFNLVLITNVAGAGDVVSVSVKGTNTGWMPMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  N+ L  Q LSF +  SDR + T+YNVAP NW +GQT+ GK F 
Sbjct  212   WQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQFGQTYSGKNFR  257



>ref|XP_010931357.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=253

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 157/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query  827   QSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVR  1006
              S W+ A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGAC+E++
Sbjct  28    DSSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEMK  87

Query  1007  CVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             C +D RWC+PGT I+VTATNFC PNY    D GG CNPP  HF L   +F +IA ++A  
Sbjct  88    CTDDARWCLPGT-IVVTATNFCPPNYALANDNGGWCNPPLRHFDLAEPSFLQIARYRAGI  146

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +P+ +RR+ C K+GGVRFT++G   F  VLI NVAG GD+ AV IKGS+TGW  M +NWG
Sbjct  147   VPVSFRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSKTGWQAMSQNWG  206

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             QNW  NA L  Q LSF++T+SD  T+TSYNV P  W +GQTFEG QF
Sbjct  207   QNWQSNAYLDGQSLSFQVTASDGRTITSYNVVPAGWQFGQTFEGVQF  253



>ref|XP_006291698.1| hypothetical protein CARUB_v10017862mg [Capsella rubella]
 gb|EOA24596.1| hypothetical protein CARUB_v10017862mg [Capsella rubella]
Length=260

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 154/228 (68%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  A AT+Y   D    +GGACGYGDL   GYG  TA LST LF  GQ CGACFEV+C
Sbjct  32    SSWLTAHATFYGGNDASGTMGGACGYGDLYSQGYGTNTAALSTALFNSGQSCGACFEVKC  91

Query  1010  VEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             V D +WC PG+ S+ VTATNFC PN     D GG CNPP AHF L +  F KIA ++A  
Sbjct  92    VNDPKWCHPGSPSVFVTATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVFLKIAQYRAGI  151

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +PI YRR+ C+K GG+RFT++G   F  VLI NVAG GDI+   +K S++GW+ + RNWG
Sbjct  152   VPISYRRVACKKSGGIRFTINGHRYFNLVLITNVAGAGDIVKASVKSSKSGWMGLTRNWG  211

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNW  NA L  Q LSF +TSSDR T TS+N+ P NW +GQTF GK F 
Sbjct  212   QNWQSNAVLVGQSLSFRVTSSDRRTSTSWNIVPSNWQFGQTFVGKNFR  259



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   270 bits (689),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF +G+ CGACFE++C  
Sbjct  30    WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNKGESCGACFEIKCAN  89

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D  WC  G+ SI+VTATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  90    DPNWCHSGSPSIMVTATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  149

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GGVRFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  150   VAYRRVPCRKQGGVRFTINGFRYFNLVLISNVAGAGDIVRVSVKGSRTGWMSMSRNWGQN  209

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  N  L  Q LSF +T SDR T TS+N+ P NW +GQTF GK F 
Sbjct  210   WQSNTVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFR  255



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   270 bits (689),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
              W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  31    SWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCD  90

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             +D RWC PG  SI++TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  91    QDPRWCNPGNPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIV  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ +RR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGS+T WL M RNWGQ
Sbjct  151   PVAFRRVACRKTGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGSKTAWLSMSRNWGQ  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF IT SDR T TS+NVAP NW +GQTF GK F 
Sbjct  211   NWQSNAVLVGQTLSFRITGSDRRTSTSWNVAPPNWQFGQTFTGKNFR  257



>ref|XP_002878036.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54295.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 155/228 (68%), Gaps = 1/228 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
              W+ A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++CV
Sbjct  33    SWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGQSCGACFEIKCV  92

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D +WC PG  S+ VTATNFC PN     D GG CNPP +HF L +  F KIA ++A  +
Sbjct  93    NDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFDLAMPVFLKIAEYRAGIV  152

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             PI YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+   +KGS+TGW+ + RNWGQ
Sbjct  153   PISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDILRTSVKGSKTGWMSLTRNWGQ  212

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NW  NA L  Q LSF +T+SDR T TS+N+AP NW +GQTF GK F  
Sbjct  213   NWQSNAVLVGQSLSFRVTTSDRRTSTSWNIAPSNWQFGQTFVGKNFRV  260



>gb|AEN70881.1| alpha-expansin 1 [Gossypium hirsutum subsp. latifolium]
Length=258

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGSRTGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEGGQF  258



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 153/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  38    WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCAN  97

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC  G+ SII+TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  98    DPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  157

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VL+ NVAG GDI+ VK+KG+ T W+ M RNWGQN
Sbjct  158   VSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVKVKGTNTNWMSMSRNWGQN  217

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS NVAP NW +GQTF GK F 
Sbjct  218   WQSNAVLVGQALSFRVTGSDRRTSTSLNVAPANWQFGQTFTGKNFR  263



>gb|AHZ41241.1| EXPB1 [Picea wilsonii]
Length=259

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 157/227 (69%), Gaps = 2/227 (1%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             EW+ A AT+Y  AD     GGACGYG+L   GYG  TA LST LF  G  CGAC+E+RC 
Sbjct  33    EWKHAHATFYGGADASGTFGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACYEIRCR  92

Query  1013  E--DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
                D +WC PG S+IVTATNFC PN     D GG CNPP +HF + + AF +IA  K   
Sbjct  93    AKCDPQWCKPGASVIVTATNFCPPNNALPNDNGGWCNPPLSHFDMAVPAFLQIAQIKGGI  152

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +P+++RR++C K+GG+RFT++G   FI V++ NVAG GD+ AV IKGSRT W PM RNWG
Sbjct  153   VPVRFRRVECTKKGGIRFTINGQRYFIMVMVSNVAGAGDVHAVSIKGSRTDWQPMSRNWG  212

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             QNW  N+ L  Q LSF++T+SD  T+ SYNV P NW +GQTFEG QF
Sbjct  213   QNWQSNSYLNGQSLSFQVTTSDGRTVVSYNVVPSNWQFGQTFEGAQF  259



>gb|ABD48785.1| alpha-expansin 1 [Gossypium hirsutum]
 gb|ACD37707.1| alpha expansin [Gossypium hirsutum]
 gb|ADY68812.1| alpha-expansin 1 [Gossypium hirsutum]
Length=258

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGSRTGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEGGQF  258



>gb|ACD37706.1| alpha expansin [Gossypium hirsutum]
 gb|ADY68813.1| alpha-expansin 1 [Gossypium hirsutum]
 gb|AEN70882.1| alpha-expansin 1 [Gossypium hirsutum subsp. latifolium]
Length=258

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDSRTITNYNVVPAGWQFGQTFEGGQF  258



>gb|AFZ84551.1| expansin 4, partial [Populus alba]
Length=240

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 153/206 (74%), Gaps = 1/206 (0%)
 Frame = +2

Query  893   GACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNF  1069
             GACGYGDL ++ YGK +AGLS++LF RG  CGACFEVRCV+ + WC+ G+ S+ +TAT+F
Sbjct  35    GACGYGDLHRATYGKYSAGLSSMLFNRGSTCGACFEVRCVDHILWCLQGSPSVFLTATDF  94

Query  1070  CAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVS  1249
             C PNYG   D GG CN P  HF +   AF +IA  KA  +P+Q+RR+KC + GG+RFTVS
Sbjct  95    CPPNYGLSSDYGGWCNFPKEHFEMSEAAFAEIAEKKADIVPVQHRRVKCDRRGGLRFTVS  154

Query  1250  GAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSS  1429
             G   F  VLI NV   G++IAVK+KGSRT W+PM RNWGQNW  N NL  QPLSFE+T+S
Sbjct  155   GNFHFYQVLISNVGLDGEVIAVKVKGSRTAWIPMARNWGQNWQSNTNLIGQPLSFEVTTS  214

Query  1430  DRVTLTSYNVAPKNWNYGQTFEGKQF  1507
                TLTSYNVAP NW +GQ FEGKQF
Sbjct  215   SGRTLTSYNVAPANWQFGQIFEGKQF  240



>gb|ADY68810.1| alpha-expansin 1 [Gossypium herbaceum subsp. africanum]
Length=258

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCDN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGSRTGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEGGQF  258



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCAS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTFTGKNFR  258



>gb|AEX34711.2| expansine 4, partial [Populus nigra]
Length=240

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 153/206 (74%), Gaps = 1/206 (0%)
 Frame = +2

Query  893   GACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNF  1069
             GACGYGDL ++ YGK +AGLS++LF RG  CGACFEVRCV+ + WC+ G+ S+I+TAT+F
Sbjct  35    GACGYGDLHRATYGKYSAGLSSMLFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDF  94

Query  1070  CAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVS  1249
             C PNYG   D GG CN P  HF +   AF +IA   A  +P+Q+RR+KC + GG+RFT+S
Sbjct  95    CPPNYGLSSDYGGWCNFPKEHFEMSEAAFAEIAEKNADVVPVQHRRVKCDRRGGLRFTMS  154

Query  1250  GAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSS  1429
             G   F  VLI NV   G++IAVK+KGSRT W+PM RNWGQNW  N NL  QPLSFE+ +S
Sbjct  155   GNFHFYQVLISNVGLDGEVIAVKVKGSRTAWIPMARNWGQNWQSNINLIGQPLSFEVITS  214

Query  1430  DRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              R TLTSYNVAP NW +GQ FEGKQF
Sbjct  215   SRRTLTSYNVAPANWQFGQIFEGKQF  240



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCAS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFDLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>gb|AEN70871.1| alpha-expansin 1 [Gossypium mustelinum]
Length=258

 Score =   269 bits (687),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGSRTGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNVVLITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEGGQF  258



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
Length=259

 Score =   269 bits (687),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCAS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_009399925.1| PREDICTED: expansin-A15-like [Musa acuminata subsp. malaccensis]
Length=247

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 156/232 (67%), Gaps = 1/232 (0%)
 Frame = +2

Query  812   AAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGA  991
             AA      W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CGA
Sbjct  17    AARGYSGGWSSAHATFYGGSDASGTMGGACGYGNLYSQGYGTDTAALSTALFNNGQSCGA  76

Query  992   CFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAI  1171
             CFE+ C  D  WC+ G SIIVTATNFC PN     D GG CNPP  HF L    F++IA 
Sbjct  77    CFEIMCGSDNGWCLQG-SIIVTATNFCPPNNALPSDNGGWCNPPRQHFDLSQPVFQRIAQ  135

Query  1172  WKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPM  1351
             +KA  +P+QYRR+ C K+GG+RFT++G   F  VLI NV G GD++AV IKGSRTGW PM
Sbjct  136   YKAGIVPVQYRRVPCAKKGGIRFTINGHSYFNLVLITNVGGAGDVVAVSIKGSRTGWQPM  195

Query  1352  GRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              RNWGQNW  N+ L  Q LSF +T+SD  ++TS NVAP NW++GQT+ G QF
Sbjct  196   SRNWGQNWQSNSCLDGQSLSFTVTTSDGHSVTSANVAPPNWSFGQTYSGAQF  247



>ref|XP_009388613.1| PREDICTED: expansin-A7 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   269 bits (687),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  GQ CG+CFE++C 
Sbjct  31    QWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSCGSCFEIKCA  90

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             +D RWC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  91    DDPRWCHGGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLSMPMFLKIAEYRAGIV  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ +RR+ CRK GG+RFT++G   F  VLI NVAG GD++   +KGSRT W+PM RNWGQ
Sbjct  151   PVSFRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDLVRASVKGSRTEWMPMSRNWGQ  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SDR T TS+N+ P  W +GQTFEGK F 
Sbjct  211   NWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSTWEFGQTFEGKNFR  257



>gb|ADY68811.1| alpha-expansin 1 [Gossypium raimondii]
Length=258

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDSRTMTNYNVVPPGWQFGQTFEGGQF  258



>ref|XP_011089527.1| PREDICTED: expansin-A4-like [Sesamum indicum]
Length=249

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 159/232 (69%), Gaps = 1/232 (0%)
 Frame = +2

Query  812   AAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGA  991
             AA +    W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGA
Sbjct  19    AAVADYGAWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGA  78

Query  992   CFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAI  1171
             C++VRC  D +WC+PGT I VTATNFC PNY    + GG CNPP  HF +   AF +IA 
Sbjct  79    CYQVRCDNDPQWCLPGT-ITVTATNFCPPNYALPNNNGGWCNPPLQHFDMAQPAFLQIAR  137

Query  1172  WKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPM  1351
             ++A  +P+ +RR+ C K+GG+RFT++G   F  VLI NVAG GD+ AV IKGSRTGW  M
Sbjct  138   YRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTGWQRM  197

Query  1352  GRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              RNWGQNW  N+ L +Q LSF++T+SD  T+T+YNVAP NW +GQTFEG QF
Sbjct  198   SRNWGQNWQSNSYLNAQSLSFQVTTSDGRTVTNYNVAPSNWQFGQTFEGGQF  249



>ref|XP_010257730.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257731.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257732.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
 ref|XP_010257733.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
Length=247

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 153/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  A  T+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGAC+E++C
Sbjct  23    SGWTDAHVTFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEIKC  82

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V D RWC+PG SIIVTATNFC PN     + GG CNPP  HF L    F+ IA +KA  +
Sbjct  83    VNDPRWCLPG-SIIVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYKAGIV  141

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ CRK GG+RFT++G   F  VLI NV G GD++AV IKGSRTGW  M RNWGQ
Sbjct  142   PVQYRRVACRKTGGIRFTINGHSYFNLVLITNVGGAGDVVAVSIKGSRTGWQAMSRNWGQ  201

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NW  N+ L  Q LSF++T+SD  T+ S NVAP NW +GQT+ G QF
Sbjct  202   NWQSNSYLNGQALSFKVTTSDGRTVVSNNVAPANWAFGQTYSGGQF  247



>ref|XP_003552064.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WQGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCDQ  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG+ SI++TATNFC PN+    D GG CNPP  HF L +  F KIA +KA  +P
Sbjct  92    DPRWCNPGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLKIAQYKAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI  V +KGS+TGW  M RNWGQN
Sbjct  152   VSYRRVPCRKVGGIRFTINGFRYFNLVLITNVAGAGDIARVSVKGSKTGWNSMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NANL  Q LSF +T SDR T TS+NVAP +W +GQTF GK F 
Sbjct  212   WQSNANLVGQALSFRVTGSDRRTSTSWNVAPSHWKFGQTFTGKNFR  257



>ref|XP_007030212.1| Alpha-expansin 1 precursor [Theobroma cacao]
 gb|EOY10714.1| Alpha-expansin 1 precursor [Theobroma cacao]
Length=316

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 168/257 (65%), Gaps = 7/257 (3%)
 Frame = +2

Query  755   FSKTSLVFSHDGWSPTSSAAAASLQS------EWRPARATYYAPADPRDAVGGACGYGDL  916
             FSK +L F  D       ++ A+L++       W  A AT+Y   D    +GGACGYG+L
Sbjct  61    FSKLTLAFKMDFLGIFLVSSLATLKTIHGYGGGWSNAHATFYGGGDASGTMGGACGYGNL  120

Query  917   EQSGYGKATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEP  1096
                GYG +TA LST LF +G  CGACFE++C+ D RWC+PG SIIVTATNFC PN     
Sbjct  121   YSQGYGTSTAALSTALFNKGLTCGACFEIKCINDNRWCLPG-SIIVTATNFCPPNNALPN  179

Query  1097  DGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVL  1276
             + GG CNPP  HF L    F+ IA +KA  +P+QYRR+ CRK G +RFT++G   F  VL
Sbjct  180   NAGGWCNPPLRHFDLSQPVFQHIAQYKAGIVPVQYRRVACRKSGALRFTINGHSYFNLVL  239

Query  1277  IRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYN  1456
             I NV G GD+++V IKGSRTGW  M RNWGQNW  N+ L  Q LSF++T+SD  ++ S N
Sbjct  240   ITNVGGAGDVVSVSIKGSRTGWQVMSRNWGQNWQSNSYLNGQALSFKVTTSDGSSVISNN  299

Query  1457  VAPKNWNYGQTFEGKQF  1507
              AP NW++GQTF G QF
Sbjct  300   AAPPNWSFGQTFTGGQF  316



>ref|NP_191109.1| expansin A16 [Arabidopsis thaliana]
 sp|Q9M2S9.1|EXP16_ARATH RecName: Full=Expansin-A16; Short=AtEXPA16; AltName: Full=Alpha-expansin-16; 
Short=At-EXP16; Short=AtEx16; AltName: Full=Ath-ExpAlpha-1.7; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB75908.1| expansin-like protein [Arabidopsis thaliana]
 dbj|BAD43638.1| expansin-like protein [Arabidopsis thaliana]
 gb|AEE79393.1| expansin A16 [Arabidopsis thaliana]
Length=260

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 154/228 (68%), Gaps = 1/228 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
              W+ A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  GQ CGACFE++CV
Sbjct  33    SWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTSLFNSGQSCGACFEIKCV  92

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D +WC PG  S+ VTATNFC PN     D GG CNPP +HF L +  F KIA ++A  +
Sbjct  93    NDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFDLAMPVFLKIAEYRAGIV  152

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             PI YRR+ CRK GG+RFT++G   F  VLI NVAG GDI    +KGS+TGW+ + RNWGQ
Sbjct  153   PISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIARTSVKGSKTGWMSLTRNWGQ  212

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NW  NA L  Q LSF +TSSDR T TS+N+AP NW +GQTF GK F  
Sbjct  213   NWQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPSNWQFGQTFVGKNFRV  260



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
              W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  31    SWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCA  90

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             +D +WC PG+ SI +TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  91    DDPKWCNPGSPSIFITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIV  150

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ +RRI CRK+GG+RFT++G   F  VL+ NVAG GDI+ V IKGS+T WL M RNWGQ
Sbjct  151   PVNFRRIPCRKQGGIRFTINGFRYFNLVLVSNVAGAGDIVKVSIKGSKTDWLSMSRNWGQ  210

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SDR T TS+N+AP NW +GQTF GK F 
Sbjct  211   NWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPANWQFGQTFTGKNFR  257



>gb|EYU28773.1| hypothetical protein MIMGU_mgv1a012521mg [Erythranthe guttata]
Length=248

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 155/225 (69%), Gaps = 1/225 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGAC+++RC  
Sbjct  25    WVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYQIRCAN  84

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             + RWC+PG SI+VTATNFC PN     + GG CNPP  HF L    F++IA ++A  +P+
Sbjct  85    ERRWCLPG-SILVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYRAGIVPV  143

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              YRR+ CR+ GG+RFT++G   F  VLI NV G GD+ AV +KGSRTGW PM RNWGQNW
Sbjct  144   AYRRVACRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSVKGSRTGWQPMSRNWGQNW  203

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
               N+NL  Q LSF++T+SD  T+ SYN AP +WN+GQTF G QF 
Sbjct  204   QSNSNLNGQSLSFKVTTSDGRTVVSYNAAPASWNFGQTFAGAQFR  248



>gb|ACA05164.1| expansin 1 [Dimocarpus longan]
Length=256

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 154/228 (68%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W    AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C
Sbjct  28    SPWESGHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGLSCGACFELKC  87

Query  1010  VEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             V D RWC+PG  SI+VTATNFC PN+    D GG CNPP  HF L +  F  IA ++A  
Sbjct  88    VADPRWCLPGNPSILVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMFFAIAQYRAGI  147

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +P+ YRR+ CRK+GG+RFT++G   F  VL+ NVAG GDI+ V +KGS TGWL M RNWG
Sbjct  148   VPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGSNTGWLTMSRNWG  207

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             QNW  NA L  Q LSF +T SDR T TS+NVA  NW +GQTF GK F 
Sbjct  208   QNWQSNAVLLGQALSFRVTGSDRRTSTSWNVAKSNWQFGQTFIGKNFR  255



>ref|XP_006445551.1| hypothetical protein CICLE_v10017738mg [Citrus clementina]
 ref|XP_006488964.1| PREDICTED: expansin-A10-like [Citrus sinensis]
 gb|ESR58791.1| hypothetical protein CICLE_v10017738mg [Citrus clementina]
 gb|KDO54531.1| hypothetical protein CISIN_1g025827mg [Citrus sinensis]
Length=247

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +2

Query  812   AAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGA  991
             AA    + W  A AT+Y   D    +GGACGYG+L   GYG  TA +ST LF  G  CGA
Sbjct  17    AAVGKGAGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAAVSTALFNNGLNCGA  76

Query  992   CFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAI  1171
             C+ ++CV D RWC+PG SIIVTATNFC PN+      GG CNPP  HF L    F KIA 
Sbjct  77    CYAIKCVNDNRWCLPG-SIIVTATNFCPPNFALSNTNGGWCNPPLHHFDLSQPVFLKIAQ  135

Query  1172  WKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPM  1351
             +KA  +P+QYRR+ C+K GG+RFT++G   F  VLI NV G GD++AV IKGS+TGW  +
Sbjct  136   YKAGIVPVQYRRVACKKSGGIRFTINGHSYFNLVLITNVGGAGDVVAVSIKGSKTGWQAL  195

Query  1352  GRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              RNWGQNW  N+ L  Q LSF++T+SD  T+ S NVAP NWN+GQT+ G+QF
Sbjct  196   SRNWGQNWQSNSYLNGQALSFKVTTSDGRTVISNNVAPANWNFGQTYTGRQF  247



>gb|AEN70869.1| alpha-expansin 1 [Gossypium schwendimanii]
Length=258

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISQT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEGGQF  258



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  36    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCTD  95

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC PG  SI+VTATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  96    DPKWCNPGNPSILVTATNFCPPNYALPTDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVP  155

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VLI NVAG GDI+   +KGS+T W+ M RNWGQN
Sbjct  156   VSYRRVACRKQGGMRFTINGFRYFNLVLITNVAGAGDIMRASVKGSKTEWMSMSRNWGQN  215

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P+NW +GQTF GK F 
Sbjct  216   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPRNWQFGQTFAGKNFR  261



>ref|XP_008354429.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=254

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 158/231 (68%), Gaps = 1/231 (0%)
 Frame = +2

Query  815   AASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGAC  994
             A ++   W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CG+C
Sbjct  25    AFAVYGSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSC  84

Query  995   FEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIW  1174
             +E+RC  D RWC PG SIIVTATNFC PN+    D GG CNPP  HF L   AF +IA +
Sbjct  85    YEMRCDNDPRWCRPG-SIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQY  143

Query  1175  KASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMG  1354
             +A  +P+ +RR+ C K+GG+RFT++G   F  VLI NVAG GD+ +V IKGSRTGW PM 
Sbjct  144   RAGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQPMS  203

Query  1355  RNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             RNWGQNW  N+ L  Q LSF++T+SD  T+TSYNVAP NW +GQTF G QF
Sbjct  204   RNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  254



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C E
Sbjct  38    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCTE  97

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC PG  SI VTATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  98    DPKWCNPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPRQHFDLAMPMFLKIAQYRAGIVP  157

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ CRK+GG+RFT++G   F  VLI NVAG GD++   IKGS+T W+ M RNWGQN
Sbjct  158   VSFRRVPCRKKGGIRFTINGFRYFNLVLITNVAGAGDVVRASIKGSKTAWMSMSRNWGQN  217

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA    Q LSF +T+SDR T TS+NVAP NW +GQTF GK F 
Sbjct  218   WQSNAVFVGQSLSFRVTASDRRTSTSFNVAPANWQFGQTFSGKNFR  263



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 154/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
              W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  32    SWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCA  91

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D +WC  G+ SI++TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  92    NDPKWCHSGSPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIV  151

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQ
Sbjct  152   PVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQ  211

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NA L  Q LSF +T SDR T TS+N+ P NW +GQTF GK F 
Sbjct  212   NWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFR  258



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYGQGYGVSTAALSTALFNNGLSCGACFEIKCAS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>gb|AEN70885.1| alpha-expansin 1 [Gossypium davidsonii]
 gb|AEN70886.1| alpha-expansin 1 [Gossypium klotzschianum]
Length=258

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSHGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEGGQF  258



>ref|XP_010551434.1| PREDICTED: expansin-A10 isoform X2 [Tarenaya hassleriana]
Length=250

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 155/236 (66%), Gaps = 1/236 (0%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQI  982
             SS         W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  
Sbjct  16    SSGVNGYGGGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  75

Query  983   CGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             CGACFE+RCV D +WC+PG SI+VTATNFC PN G   + GG CNPP  HF L    F++
Sbjct  76    CGACFEIRCVSDPKWCLPG-SIVVTATNFCPPNNGLPNNAGGWCNPPQQHFDLSQPVFQR  134

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA ++A  +P+ YRRI CR+ GG+RFT++G   F  VLI NV G GD+ +  IKGSRTGW
Sbjct  135   IAQYRAGIVPVSYRRIPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGW  194

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
               M RNWGQNW  N+ L  Q LSF++T+SD  T+ SYNVAP  W++GQTF G QF 
Sbjct  195   QAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNVAPSGWSFGQTFAGSQFR  250



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCGS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTFTGKNFR  258



>ref|XP_010031088.1| PREDICTED: expansin-A8-like [Eucalyptus grandis]
 gb|KCW50355.1| hypothetical protein EUGRSUZ_J00120 [Eucalyptus grandis]
Length=249

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 153/224 (68%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W    AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGAC+E+RC +
Sbjct  27    WEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEMRCND  86

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D RWC+PGT I+VTATNFC PN     D GG CNPP  HF +   AF +IA +KA  +P+
Sbjct  87    DPRWCLPGT-IMVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYKAGIVPV  145

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GGVRFT++G   F  VLI NV G GD+ +V IKGSRTGW  M RNWGQNW
Sbjct  146   SFRRVPCVKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQAMSRNWGQNW  205

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA +  Q LSF++T+SD  T+TSYN AP NW +GQTFEG QF
Sbjct  206   QSNAYMNGQALSFQVTTSDGRTVTSYNAAPANWQFGQTFEGSQF  249



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 154/227 (68%), Gaps = 1/227 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF +G  CGACFE++C  
Sbjct  31    WETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNKGLSCGACFEIKCAN  90

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D  WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  91    DKEWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  150

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ CRK+GG+RFTV+G   F  VLI NVAG GDI+   +KG+RT W+PM RNWGQN
Sbjct  151   VAFRRVPCRKQGGIRFTVNGFRYFNLVLISNVAGAGDIVRTYVKGTRTRWMPMSRNWGQN  210

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             W  NA L  Q LSF +TSSDR T TS+N+AP NW +GQTF GK F  
Sbjct  211   WQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPHNWQFGQTFTGKNFRV  257



>gb|AEN70867.1| alpha-expansin 1 [Gossypium thurberi]
Length=258

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEGGQF  258



>ref|XP_010276443.1| PREDICTED: expansin-A15-like [Nelumbo nucifera]
Length=247

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGAC+E++C
Sbjct  23    SGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEIKC  82

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V D +WC+PG SII+TATNFC PN     + GG CNPP  HF L    F++IA +KA  +
Sbjct  83    VNDPKWCLPG-SIIITATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQRIAQYKAGIV  141

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ C K GG+RFT++G   F  VLI NV G GD++AV IKGSRTGW  M RNWGQ
Sbjct  142   PVQYRRVACEKTGGIRFTINGHSYFNLVLITNVGGAGDVVAVSIKGSRTGWQAMSRNWGQ  201

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             NW  N+ L  Q LSF++T+SD  T+ S NVAP NW +GQT+ G QF
Sbjct  202   NWQSNSYLNGQALSFKVTTSDGQTVVSNNVAPANWAFGQTYSGGQF  247



>gb|AEN70887.1| alpha-expansin 1 [Gossypium aridum]
Length=258

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEGGQF  258



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCAS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSHWQFGQTFTGKNFR  258



>gb|AAY43797.1| expansin [Gossypium hirsutum]
Length=258

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA    Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYFNGQSLSFKVTASDSRTITNYNVVPAGWQFGQTFEGGQF  258



>gb|AEN70868.1| alpha-expansin 1 [Gossypium laxum]
 gb|AEN70888.1| alpha-expansin 1 [Gossypium gossypioides]
 gb|AEN70889.1| alpha-expansin 1 [Gossypium lobatum]
 gb|AEN70890.1| alpha-expansin 1 [Gossypium trilobum]
Length=258

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEGGQF  258



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAALSTALFNNGLSCGACFEIKCGD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC PG  SI +TATNFC PNY    D GG CNPP  HF L +  F +IA +KA  +P
Sbjct  92    DPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPRTHFDLAMPMFLQIAEYKAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ CRKEGGVRFT++G   F  VLI NVAG GDI+ V +KG+ T W+PM RNWGQN
Sbjct  152   VSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGANTEWMPMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA+L  Q LSF +T SDR T TS+NVAP +W +GQTF GK F 
Sbjct  212   WQSNADLVGQTLSFRVTGSDRRTSTSWNVAPGHWQFGQTFSGKNFR  257



>gb|KHG02505.1| Expansin-A2 [Gossypium arboreum]
Length=257

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  35    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  94

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  95    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  153

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F   LI NV G GDI +V IKGSRTGWLPM RNWGQNW
Sbjct  154   MFRRVSCVKKGGIRYTMNGHSYFNMALITNVGGAGDITSVSIKGSRTGWLPMSRNWGQNW  213

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  214   QSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEGGQF  257



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAALSTALFNNGLSCGACFEIKCGD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC PG  SI +TATNFC PNY    D GG CNPP  HF L +  F +IA +KA  +P
Sbjct  92    DPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPRTHFDLAMPMFLQIAEYKAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ CRKEGGVRFT++G   F  VLI NVAG GDI+ V +KG+ T W+PM RNWGQN
Sbjct  152   VSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGANTEWMPMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA+L  Q LSF +T SDR T TS+NVAP +W +GQTF GK F 
Sbjct  212   WQSNADLVGQTLSFRVTGSDRRTSTSWNVAPGHWQFGQTFSGKNFR  257



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCGS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  34    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNAGLSCGACFEIKCAN  93

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  94    DPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  153

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VLI NVAG GDI+ V +KGS+TGW+ M RNWGQN
Sbjct  154   VAYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKGSQTGWMSMSRNWGQN  213

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF IT SDR T TS+NV P NW +GQTF GK F 
Sbjct  214   WQSNAVLVGQSLSFRITGSDRRTSTSWNVVPSNWQFGQTFTGKNFR  259



>ref|NP_001289251.1| expansin-A4-like precursor [Pyrus x bretschneideri]
 dbj|BAC67190.1| expansin [Pyrus communis]
 gb|AGR44456.1| expansin 3 [Pyrus x bretschneideri]
Length=254

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 157/229 (69%), Gaps = 1/229 (0%)
 Frame = +2

Query  821   SLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFE  1000
             ++   W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CG+C+E
Sbjct  27    AVYGSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYE  86

Query  1001  VRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKA  1180
             +RC  D RWC PG SIIVTATNFC PN+    D GG CNPP  HF L   AF +IA ++A
Sbjct  87    MRCDNDPRWCRPG-SIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRA  145

Query  1181  SNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRN  1360
               +P+ +RR+ C K+GG+RFT++G   F  VLI NVAG GD+ +V IKGSRTGW PM RN
Sbjct  146   GIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQPMSRN  205

Query  1361  WGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             WGQNW  N+ L  Q LSF++T+SD  T+TSYNVAP NW +GQTF G QF
Sbjct  206   WGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  254



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 156/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCDQ  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG+ SI++TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  92    DPRWCNPGSPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGS+T W+ M RNWGQN
Sbjct  152   VAYRRVPCRKTGGIRFTINGFRYFNLVLITNVAGAGDIVRVSMKGSKTAWMSMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SD+ T TS+NVAP NW +GQTF GK F 
Sbjct  212   WQSNAVLVGQALSFRVTGSDQRTSTSWNVAPPNWQFGQTFTGKNFR  257



>gb|AAR82851.1| expansin-3 [Petunia x hybrida]
Length=251

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+    D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE+RC  
Sbjct  29    WQTAHATFCGGGDASGTMGGACGYGNLYSQGYGTKTAALSTALFNDGLSCGACFELRCAG  88

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             + RWC+PGT I VTATNFC PN+    D GG CNPP  HF +   AF +IA ++A  +PI
Sbjct  89    EPRWCLPGT-ITVTATNFCPPNFALPSDNGGWCNPPRPHFDMAEPAFLQIAQYRAGIVPI  147

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+RFT++G   F  VL+ NVAG GDI +V IKGSRTGW PM RNWGQNW
Sbjct  148   AFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDIHSVSIKGSRTGWQPMSRNWGQNW  207

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               N+ L  Q LSF +TS D  TLTSYNVAP NW +GQTFEG QF
Sbjct  208   QSNSYLNGQTLSFRVTSGDGRTLTSYNVAPTNWQFGQTFEGGQF  251



>gb|ACJ70084.1| expansin [Diospyros kaki]
Length=254

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+   AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGAC+E++C +
Sbjct  32    WQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYELKCND  91

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D RWC+PGT I VTATNFC PN     D GG CNPP  HF L   AF KIA ++A  +P+
Sbjct  92    DARWCLPGT-ITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIVPV  150

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              ++R+ C K+GG+RFT++G   F  VLI NV G GD+ AV +KGSRTGW PM RNWGQNW
Sbjct  151   SFQRVPCVKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSVKGSRTGWQPMSRNWGQNW  210

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               N  L  Q LSF++T+SD  T+TSYNVAP NW +GQTFEG QF
Sbjct  211   QSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNWQFGQTFEGSQF  254



>ref|XP_010917068.1| PREDICTED: expansin-A10-like [Elaeis guineensis]
Length=248

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 154/233 (66%), Gaps = 1/233 (0%)
 Frame = +2

Query  812   AAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGA  991
             AA      W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGA
Sbjct  17    AAHGYGGGWSSAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGA  76

Query  992   CFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAI  1171
             C+E+RCV D +WC+PG SI+VTATNFC PN     D GG CNPP  HF L    F+ IA 
Sbjct  77    CYEIRCVNDRQWCLPG-SIVVTATNFCPPNSALPNDAGGWCNPPLQHFDLSQPVFQHIAQ  135

Query  1172  WKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPM  1351
             ++A  +P+ YRR+ CRK GG+RFT++G   F  VLI NV G GD+ AV IKGSRTGW PM
Sbjct  136   YRAGIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM  195

Query  1352  GRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
              RNWGQNW  NA L  Q LSF++T+SD  ++ SYNV P  W++GQTF G  F 
Sbjct  196   SRNWGQNWQSNAYLNGQALSFKVTTSDGRSVVSYNVVPAGWSFGQTFSGGHFR  248



>ref|XP_010258311.1| PREDICTED: expansin-A1 isoform X2 [Nelumbo nucifera]
Length=250

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 152/225 (68%), Gaps = 1/225 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE+RCV 
Sbjct  27    WINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIRCVN  86

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WC+PG SI+VTATNFC PN     + GG CNPP  HF L    F+ IA ++A  +P+
Sbjct  87    DPKWCLPG-SIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQYRAGIVPV  145

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              YRR+ CRK GG+RFT++G   F  VLI NV G GD+ AV IKGSRTGW PM RNWGQNW
Sbjct  146   AYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNW  205

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
               N  L  Q LSF++T+SD  ++ SYNVAP  W++GQTF G QF 
Sbjct  206   QSNTYLNGQSLSFKVTTSDGRSVVSYNVAPAGWSFGQTFSGAQFR  250



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCGS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>gb|AAF32409.1|AF230276_1 alpha-expansin 3 [Triphysaria versicolor]
Length=247

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 155/225 (69%), Gaps = 1/225 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST +F  G  CG+C+E+RCV 
Sbjct  24    WINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTAMFNTGLSCGSCYEIRCVN  83

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WC+PG SI+VTATNFC PN     + GG CNPP  HF L    F+ IA +KA  +P+
Sbjct  84    DGKWCLPG-SILVTATNFCPPNSALPNNAGGWCNPPLHHFDLAQPVFQHIAQYKAGIVPV  142

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              YRR+ CR+ GG+RFT++G   F  VL+ NV G GD+ AV IKGSRTGW PM RNWGQNW
Sbjct  143   AYRRVACRRRGGIRFTINGHSYFNLVLVTNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNW  202

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
               N+NL  Q LSF++T+SD  T+ SYNVAP  W++GQTF G QF 
Sbjct  203   QSNSNLNGQSLSFKVTTSDGRTVLSYNVAPARWSFGQTFAGGQFR  247



>ref|XP_010258310.1| PREDICTED: expansin-A1 isoform X1 [Nelumbo nucifera]
Length=252

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 152/225 (68%), Gaps = 1/225 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE+RCV 
Sbjct  29    WINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIRCVN  88

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WC+PG SI+VTATNFC PN     + GG CNPP  HF L    F+ IA ++A  +P+
Sbjct  89    DPKWCLPG-SIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQYRAGIVPV  147

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              YRR+ CRK GG+RFT++G   F  VLI NV G GD+ AV IKGSRTGW PM RNWGQNW
Sbjct  148   AYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNW  207

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
               N  L  Q LSF++T+SD  ++ SYNVAP  W++GQTF G QF 
Sbjct  208   QSNTYLNGQSLSFKVTTSDGRSVVSYNVAPAGWSFGQTFSGAQFR  252



>ref|XP_003518007.1| PREDICTED: expansin-A1-like [Glycine max]
 gb|KHN01248.1| Expansin-A1 [Glycine soja]
Length=250

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 156/236 (66%), Gaps = 1/236 (0%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQI  982
             SSA        W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  
Sbjct  16    SSAYGYGYGGGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  75

Query  983   CGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             CG+C+E+RCV D RWC+PG SI+VTATNFC PN     + GG CNPP  HF L    F +
Sbjct  76    CGSCYEIRCVNDHRWCLPG-SIMVTATNFCPPNNALPNNAGGWCNPPMHHFDLSQPVFLR  134

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA ++A  +P+ YRR+ CR+ GG+RFT++G   F  VLI NV G GD+  V IKGSRTGW
Sbjct  135   IAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHGVAIKGSRTGW  194

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             +PM RNWGQNW  N  L  Q LSF++T+SD  T+ SYNVAP  W++GQT+ G QF 
Sbjct  195   MPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPAGWSFGQTYTGAQFR  250



>ref|XP_010922733.1| PREDICTED: expansin-A2-like [Elaeis guineensis]
Length=254

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 158/227 (70%), Gaps = 1/227 (0%)
 Frame = +2

Query  827   QSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVR  1006
              S+W  A AT+Y   D    +GGACGYG+L   GYG ++A LST LF  G  CG+C+E+R
Sbjct  29    DSDWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTSSAALSTALFNNGLSCGSCYELR  88

Query  1007  CVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASN  1186
             C +D +WC+PGT I+VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  
Sbjct  89    CDDDPKWCLPGT-IVVTATNFCPPNYALANDNGGWCNPPRQHFDLAEPAFLRIAQYRAGI  147

Query  1187  MPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWG  1366
             +P+ +RR+ C K+GG+RFT++G   F  VL+ NVAG GD+ AV IKGS+TGW  M +NWG
Sbjct  148   VPVSFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVHAVSIKGSKTGWQAMSQNWG  207

Query  1367  QNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             QNW  NA L  Q LSF +T+SD  T+TSY+V P  W++GQTFEG QF
Sbjct  208   QNWQSNAYLDGQSLSFRVTTSDGRTVTSYDVVPAGWHFGQTFEGDQF  254



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 153/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGACFE++C  
Sbjct  33    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCAS  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+   +KGSRTGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKASVKGSRTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P +W +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAHWQFGQTFTGKNFR  258



>ref|XP_010093144.1| hypothetical protein L484_005152 [Morus notabilis]
 gb|EXB53603.1| hypothetical protein L484_005152 [Morus notabilis]
Length=271

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 155/229 (68%), Gaps = 2/229 (1%)
 Frame = +2

Query  824   LQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEV  1003
              QS W  A AT+Y   D    +G ACGYG+L   GYG  TA LST LF +G  CGACFE+
Sbjct  44    FQSGWTSAHATFYGGGDASGTMGEACGYGNLYSQGYGTNTAALSTALFNKGSTCGACFEI  103

Query  1004  RCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKAS  1183
             +CV D +WC+PG SI VTATNFC PNY    D GG CNPP  HF L    F++IA++KA 
Sbjct  104   KCVNDNKWCLPG-SITVTATNFCPPNYALSGDAGGWCNPPLHHFDLSQPVFQRIALYKAG  162

Query  1184  NMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRT-GWLPMGRN  1360
              +P+QYRR+ CRK+GGVRFT++G   F  VLI NV G GD++AV IKG ++ GW  M RN
Sbjct  163   IVPVQYRRVSCRKKGGVRFTINGHSYFNIVLITNVGGAGDVVAVSIKGFKSGGWQAMSRN  222

Query  1361  WGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
             WGQNW  N+ L  Q LSF++T+SD   L S NV P NW +GQT+ G QF
Sbjct  223   WGQNWQSNSFLNGQALSFKVTTSDGRALVSDNVTPPNWAFGQTYTGTQF  271



>ref|NP_200443.1| expansin A14 [Arabidopsis thaliana]
 sp|Q9FMA0.1|EXP14_ARATH RecName: Full=Expansin-A14; Short=AtEXPA14; AltName: Full=Alpha-expansin-14; 
Short=At-EXP14; Short=AtEx14; AltName: Full=Ath-ExpAlpha-1.5; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11259.1| expansin [Arabidopsis thaliana]
 dbj|BAF02076.1| Expansin [Arabidopsis thaliana]
 gb|AED96748.1| expansin A14 [Arabidopsis thaliana]
Length=255

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 158/228 (69%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  ARAT+Y  AD    +GGACGYG+L   GYG  TA LST LF  GQ CGACF+++C
Sbjct  27    SGWVNARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQSCGACFQIKC  86

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V+D +WCI GT I VT TNFC PN+    + GG CNPP  HF L    F +IA +KA  +
Sbjct  87    VDDPKWCIGGT-ITVTGTNFCPPNFAQANNAGGWCNPPQHHFDLAQPIFLRIAQYKAGVV  145

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ CR++GG+RFT++G   F  VLI NVAG GD+I+V IKG+ T W  M RNWGQ
Sbjct  146   PVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVISVSIKGTNTRWQSMSRNWGQ  205

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NW  NA L  Q LSF++T+SD  T+ S N  P+NW++GQT+ GKQF A
Sbjct  206   NWQSNAKLDGQALSFKVTTSDGRTVISNNATPRNWSFGQTYTGKQFRA  253



>ref|XP_006654542.1| PREDICTED: expansin-A4-like [Oryza brachyantha]
Length=246

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +2

Query  812   AAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGA  991
             A+A+    W+ A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CG+
Sbjct  16    ASAAGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGS  75

Query  992   CFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAI  1171
             C+E+RC  D RWC+PG SI VTATNFC PNYG   D GG CNPP  HF +   AF  IA 
Sbjct  76    CYELRCDNDGRWCLPG-SITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQ  134

Query  1172  WKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPM  1351
             ++A  +P+ YRR+ C K GG+RFTV+G   F  VL+ NVAG GD+ +V IKGSRTGW PM
Sbjct  135   YRAGIVPVSYRRVPCVKRGGIRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPM  194

Query  1352  GRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
              RNWGQNW  NA L  Q LSF++T+SD  T+TS NVA   W +GQTFEG QF
Sbjct  195   SRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF  246



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 153/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  33    WQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCAN  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC PG+ SI +TATNFC PN+    D GG C PP  HF   +  F KIA ++A  +P
Sbjct  93    DPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCTPPRTHFDFAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFT++G   F  VLI NVAG GDI+ V +KGS TGW+ M RNWGQN
Sbjct  153   VSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKGSNTGWMSMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+NVAP NW +GQTF GK F 
Sbjct  213   WQSNAVLVGQTLSFRLTGSDRRTSTSWNVAPSNWQFGQTFTGKNFR  258



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 156/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C +
Sbjct  32    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNDGLSCGACFELKCAD  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC+PG+ SI +TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  92    DPKWCLPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ CRK GG+RFTV G   F  VLI NVAG G+++   +KG+RT WLP+ RNWGQN
Sbjct  152   VNFRRVPCRKRGGIRFTVDGFRYFNLVLITNVAGAGNVMRASVKGTRTQWLPLSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T+SDR T TS+NVAP NW +GQTF GK F 
Sbjct  212   WQSNAQLAGQALSFRVTTSDRRTSTSWNVAPPNWQFGQTFVGKNFR  257



>gb|AEN70883.1| alpha-expansin 1 [Gossypium armourianum]
 gb|AEN70884.1| alpha-expansin 1 [Gossypium harknessii]
Length=258

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V +KGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSVKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEGGQF  258



>ref|XP_010551433.1| PREDICTED: expansin-A10 isoform X1 [Tarenaya hassleriana]
Length=259

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 155/236 (66%), Gaps = 1/236 (0%)
 Frame = +2

Query  803   SSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQI  982
             SS         W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  
Sbjct  25    SSGVNGYGGGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  84

Query  983   CGACFEVRCVEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEK  1162
             CGACFE+RCV D +WC+PG SI+VTATNFC PN G   + GG CNPP  HF L    F++
Sbjct  85    CGACFEIRCVSDPKWCLPG-SIVVTATNFCPPNNGLPNNAGGWCNPPQQHFDLSQPVFQR  143

Query  1163  IAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGW  1342
             IA ++A  +P+ YRRI CR+ GG+RFT++G   F  VLI NV G GD+ +  IKGSRTGW
Sbjct  144   IAQYRAGIVPVSYRRIPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGW  203

Query  1343  LPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
               M RNWGQNW  N+ L  Q LSF++T+SD  T+ SYNVAP  W++GQTF G QF 
Sbjct  204   QAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNVAPSGWSFGQTFAGSQFR  259



>ref|XP_010257816.1| PREDICTED: expansin-A1 [Nelumbo nucifera]
Length=252

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 152/225 (68%), Gaps = 1/225 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE+RCV 
Sbjct  29    WINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIRCVN  88

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WC+PG SI+VTATNFC PN     + GG CNPP  HF L    F+ IA ++A  +P+
Sbjct  89    DRKWCLPG-SIVVTATNFCPPNSALPNNAGGWCNPPQHHFDLSQPVFQHIAQYRAGIVPV  147

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              YRR+ CRK GG+RFT++G   F  VLI NV G GD+ AV IKGSRTGW PM RNWGQNW
Sbjct  148   AYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNW  207

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
               N  L  Q LSF++T+SD  ++ SYNVAP  W++GQTF G QF 
Sbjct  208   QSNNYLNGQSLSFKVTTSDGRSVVSYNVAPAGWSFGQTFSGGQFR  252



>gb|AEN70870.1| alpha-expansin 1 [Gossypium turneri]
Length=258

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQNAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +V +KGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSVSVKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEGGQF  258



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 153/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W  A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  32    WESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGLSCGACFEIKCAN  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI VTATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  92    DPKWCHSGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ CRK GG+RFTV+G   F  VL+ NVAG GDI+ V IKGS+TGW+ M RNWGQN
Sbjct  152   VAFRRVSCRKSGGIRFTVNGFRYFNLVLVTNVAGAGDIVRVSIKGSKTGWMSMSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+NVAP NW +GQTF G+ F 
Sbjct  212   WQSNAVLVGQSLSFRVTGSDRRTSTSWNVAPANWQFGQTFSGRNFR  257



>gb|AEN70875.1| alpha-expansin 1 [Gossypium tomentosum]
 gb|AEN70876.1| alpha-expansin 1 [Gossypium tomentosum]
Length=258

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 155/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLQIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  +LI NV G GDI +V IKGS+TGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMLLITNVGGAGDITSVSIKGSKTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITNYNVVPAGWQFGQTFEGGQF  258



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  32    WQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGMSCGACFELKCAN  91

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI++TATNFC PN+    D GG CNPP AHF L +  F KIA ++A  +P
Sbjct  92    DPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVP  151

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+   +KGSRTGW+ + RNWGQN
Sbjct  152   VSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSRTGWMSLSRNWGQN  211

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P NW +GQTF GK F 
Sbjct  212   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSNWQFGQTFVGKNFR  257



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 156/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query  833   EWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCV  1012
             +W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C 
Sbjct  33    DWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFSSGLSCGACFEIKCA  92

Query  1013  EDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
              D  WC PG+ SI VTATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +
Sbjct  93    SDPGWCHPGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIV  152

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+ YRR+ CRK+GG+RFT++G   F  VL+ NVAG G+I+ V +KGSRTGW+ M RNWGQ
Sbjct  153   PVTYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGNIVRVSVKGSRTGWISMSRNWGQ  212

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  N NL  Q LSF + +SDR + TS+N+AP +W +GQTF GK F 
Sbjct  213   NWQTNGNLVGQSLSFRVAASDRRSSTSWNIAPAHWQFGQTFVGKNFR  259



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CG+CFE++C  
Sbjct  36    WQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLTCGSCFEIKCAS  95

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D RWC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  96    DPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  155

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KGS+TGW+ M RNWGQN
Sbjct  156   VAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQVSVKGSKTGWMSMSRNWGQN  215

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF + +SDR + TS+N+AP +W +GQTF GK F 
Sbjct  216   WQSNAVLVGQSLSFRVRASDRRSSTSWNIAPAHWQFGQTFTGKNFR  261



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 159/253 (63%), Gaps = 1/253 (0%)
 Frame = +2

Query  755   FSKTSLVFSHDGWSPTSSAAAASLQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYG  934
             FS   L      W   +          W+ A AT+Y  +D    +GGACGYG+L   GYG
Sbjct  4     FSTVLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  935   KATAGLSTVLFERGQICGACFEVRCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGH  1111
               TA LST LF  G  CGACFE++C  D +WC  G+ SI +TATNFC PNY    D GG 
Sbjct  64    VNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGW  123

Query  1112  CNPPNAHFVLPIEAFEKIAIWKASNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVA  1291
             CNPP  HF L +  F KIA ++A  +P+ +RR+ CRK GG+RFT++G   F  VLI NVA
Sbjct  124   CNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVACRKHGGIRFTINGFRYFNLVLISNVA  183

Query  1292  GTGDIIAVKIKGSRTGWLPMGRNWGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKN  1471
             G GDI+   +KGSRTGW+PM RNWGQNW  NA L  Q LSF +T+SDR + TS+N+ P N
Sbjct  184   GAGDIVHAYVKGSRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSWNIVPSN  243

Query  1472  WNYGQTFEGKQFE  1510
             W +GQTF GK F 
Sbjct  244   WQFGQTFTGKNFR  256



>gb|AAM46997.1|AF512539_1 alpha-expansin precursor [Gossypium hirsutum]
Length=258

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  AD    +GGACGYG+L   GYG +TA LST LF  G  CGAC+E+RC  
Sbjct  36    WQTAHATFYGGADATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCNN  95

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WCI  T I VTATNFC PNY    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  96    DPQWCISRT-ITVTATNFCPPNYALSSDNGGWCNPPREHFDLAEPAFLRIAEYRAGIVPV  154

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              +RR+ C K+GG+R+T++G   F  VLI NV G GDI +  IKGSRTGWLPM RNWGQNW
Sbjct  155   MFRRVSCVKKGGIRYTMNGHSYFNMVLITNVGGAGDITSESIKGSRTGWLPMSRNWGQNW  214

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               NA L  Q LSF++T+SD  T+T+YNV P  W +GQTFEG QF
Sbjct  215   QSNAYLNGQSLSFKVTASDGRTITAYNVVPAGWQFGQTFEGGQF  258



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 155/226 (69%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST  F  G  CGACFE++C +
Sbjct  33    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAVLSTAFFNNGLSCGACFEIKCAD  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI++TATNFC PNY    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DPKWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + +RR+ CRK+GG+RFT++G   F  VLI NVAG GDI+ V +KGSRTGW+ M RNWGQN
Sbjct  153   VSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGSRTGWMAMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P NW +GQTF GK F 
Sbjct  213   WQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFSGKNFR  258



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  33    WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGLSCGACFEIKCAN  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
             D +WC  G+ SI +TATNFC PN+    D GG CNPP  HF L +  F KIA ++A  +P
Sbjct  93    DRQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+   +KG+RTGW+PM RNWGQN
Sbjct  153   VAYRRVPCRKHGGIRFTINGFRYFNLVLISNVAGAGDIVRTYVKGTRTGWMPMSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+AP NW +GQTF GK F 
Sbjct  213   WQSNAVLVGQALSFRVTGSDRRTSTSWNIAPPNWQFGQTFTGKNFR  258



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 154/230 (67%), Gaps = 1/230 (0%)
 Frame = +2

Query  824   LQSEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEV  1003
             +   W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE+
Sbjct  30    MGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEI  89

Query  1004  RCVEDLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKA  1180
             +C  D +WC  G+ SI +TATNFC PNY    D GG CNPP  HF L +  F KIA ++A
Sbjct  90    KCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRA  149

Query  1181  SNMPIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRN  1360
               +P+ YRR+ CRK GG+RFT++G   F  VLI NVAG GDI+ V +KG+RTGW+ M RN
Sbjct  150   GIVPVSYRRVPCRKSGGIRFTINGFRYFNLVLISNVAGAGDIVKVSVKGTRTGWMSMSRN  209

Query  1361  WGQNWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             WGQNW  NA L  Q LSF +T SDR + TS+N+ P NW +GQTF GK F 
Sbjct  210   WGQNWQSNAVLVGQSLSFRVTGSDRRSSTSWNIVPSNWQFGQTFSGKNFR  259



>ref|NP_001288870.1| expansin-A14 precursor [Brassica rapa]
 ref|XP_009126950.1| PREDICTED: expansin-A14 [Brassica rapa]
 ref|XP_009126951.1| PREDICTED: expansin-A14 [Brassica rapa]
 gb|AGM16356.1| alpha-expansin protein 14 [Brassica rapa]
Length=253

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 156/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  ARAT+Y  AD    +GGACGYG+L   GY   TA LST LF  GQ CGACF+++C
Sbjct  27    SGWVNARATFYGGADASGTMGGACGYGNLYSQGYNTNTAALSTALFNGGQSCGACFQIKC  86

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V D +WC  GT I VT TNFC PN+    D GG CNPP  HF L    F +IA +KA  +
Sbjct  87    VNDPKWCRRGT-ITVTGTNFCPPNFAQANDAGGWCNPPQHHFDLAQPIFLRIAQYKAGVV  145

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ CR+ GG+RFT++G   F  VLI NVAG GD+++V +KG+RTGW  M RNWGQ
Sbjct  146   PVQYRRVACRRRGGMRFTINGHSYFNLVLITNVAGAGDVVSVSVKGTRTGWQSMSRNWGQ  205

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             NW  NANL  Q LSF++T+SD  T+ S N  P+NW++GQT+ GKQF 
Sbjct  206   NWQSNANLDGQALSFKVTTSDGRTVVSNNATPRNWSFGQTYTGKQFR  252



>emb|CDP04049.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 154/224 (69%), Gaps = 1/224 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y   D    +GGACGYG+L   GYG  TA LST LF  G  CGAC+E+RC  
Sbjct  32    WQGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMRCDG  91

Query  1016  DLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMPI  1195
             D +WC+ GT I VTATNFC PN+    D GG CNPP  HF L   AF +IA ++A  +P+
Sbjct  92    DPKWCLGGT-ITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGIVPV  150

Query  1196  QYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQNW  1375
              YRR+ C K+GG+RFTV+G   F  VL+ NVAG GDI AV IKGSRTGW  M RNWGQNW
Sbjct  151   AYRRVPCAKKGGIRFTVNGHSFFNLVLVTNVAGAGDIHAVSIKGSRTGWQTMSRNWGQNW  210

Query  1376  HINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQF  1507
               N++L  Q LS  +T+SD  T+TSYNVAP NW +GQTFEG QF
Sbjct  211   QSNSHLNGQSLSITVTASDGRTVTSYNVAPANWQFGQTFEGGQF  254



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 154/226 (68%), Gaps = 1/226 (0%)
 Frame = +2

Query  836   WRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRCVE  1015
             W+ A AT+Y  +D    +GGACGYG+L   GYG  TA LST LF  G  CGACFE++C  
Sbjct  33    WQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCAN  92

Query  1016  DLRWCIPGT-SIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNMP  1192
               +WC  G+ SI VTATNFC PNY    D GG CNPP +HF L +  F KIA ++A  +P
Sbjct  93    QPQWCHSGSPSIFVTATNFCPPNYALPNDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVP  152

Query  1193  IQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQN  1372
             + YRR+ CRK+GG+RFTV+G   F  VLI NVAG GDI+ V +KGS+TGW+ + RNWGQN
Sbjct  153   VSYRRVPCRKQGGIRFTVNGFKYFNLVLITNVAGAGDIVKVSVKGSKTGWMSLSRNWGQN  212

Query  1373  WHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFE  1510
             W  NA L  Q LSF +T SDR T TS+N+ P NW +GQTF GK F 
Sbjct  213   WQSNAVLAGQSLSFRVTGSDRRTSTSWNIVPANWQFGQTFTGKNFR  258



>gb|AAM65722.1| expansin [Arabidopsis thaliana]
Length=249

 Score =   266 bits (680),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 157/228 (69%), Gaps = 1/228 (0%)
 Frame = +2

Query  830   SEWRPARATYYAPADPRDAVGGACGYGDLEQSGYGKATAGLSTVLFERGQICGACFEVRC  1009
             S W  ARAT+Y  AD    +GGACGYG+L   GYG  TA LST LF  GQ CGACF+++C
Sbjct  21    SGWVNARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQSCGACFQIKC  80

Query  1010  VEDLRWCIPGTSIIVTATNFCAPNYGFEPDGGGHCNPPNAHFVLPIEAFEKIAIWKASNM  1189
             V D +WCI GT I VT TNFC PN+    + GG CNPP  HF L    F +IA +KA  +
Sbjct  81    VNDPKWCIGGT-ITVTGTNFCPPNFAQANNAGGWCNPPQHHFDLAQPIFLRIAQYKAGVV  139

Query  1190  PIQYRRIKCRKEGGVRFTVSGAGIFISVLIRNVAGTGDIIAVKIKGSRTGWLPMGRNWGQ  1369
             P+QYRR+ CR++GG+RFT++G   F  VLI NVAG GD+I+V IKG+ T W  M RNWGQ
Sbjct  140   PVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVISVSIKGTNTRWQSMSRNWGQ  199

Query  1370  NWHINANLRSQPLSFEITSSDRVTLTSYNVAPKNWNYGQTFEGKQFEA  1513
             NW  NA L  Q LSF++T+SD  T+ S N  P+NW++GQT+ GKQF A
Sbjct  200   NWQSNAKLDGQALSFKVTTSDGRTVISNNATPRNWSFGQTYTGKQFRA  247



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5144842398758