BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14306_g2_i2 len=534 path=[1:0-411 413:412-533]

Length=534
                                                                      Score     E

ref|XP_009800796.1|  PREDICTED: uncharacterized protein LOC104246635  57.4    6e-08   
ref|XP_010101583.1|  hypothetical protein L484_015412                 57.4    1e-07   
ref|XP_007204037.1|  hypothetical protein PRUPE_ppa020829mg           56.2    3e-07   
ref|XP_002528729.1|  conserved hypothetical protein                   54.3    1e-06   Ricinus communis
ref|XP_006481877.1|  PREDICTED: uncharacterized protein LOC102606784  52.8    5e-06   
ref|XP_009374770.1|  PREDICTED: uncharacterized protein LOC103963661  52.0    1e-05   
ref|XP_008355626.1|  PREDICTED: uncharacterized protein LOC103419291  51.2    1e-05   
ref|XP_008363814.1|  PREDICTED: uncharacterized protein LOC103427534  51.2    1e-05   
ref|XP_008241422.1|  PREDICTED: uncharacterized protein LOC103339845  51.6    2e-05   
ref|XP_004249451.1|  PREDICTED: uncharacterized protein LOC101261278  50.1    2e-05   
ref|XP_009366655.1|  PREDICTED: uncharacterized protein LOC103956405  50.1    4e-05   
gb|ADL62863.1|  hypothetical protein                                  50.4    5e-05   
ref|XP_006339315.1|  PREDICTED: uncharacterized protein LOC102584326  48.9    7e-05   
ref|XP_007027714.1|  Uncharacterized protein TCM_022558               49.3    7e-05   
ref|XP_006430227.1|  hypothetical protein CICLE_v10013717mg           49.3    8e-05   
gb|EYU35476.1|  hypothetical protein MIMGU_mgv1a020698mg              48.1    9e-05   
ref|XP_002313102.1|  hypothetical protein POPTR_0009s10740g           47.8    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006384428.1|  hypothetical protein POPTR_0004s14990g           47.4    2e-04   
ref|XP_002879599.1|  hypothetical protein ARALYDRAFT_482601           47.4    3e-04   
ref|XP_008442832.1|  PREDICTED: uncharacterized protein LOC103486601  47.0    5e-04   
ref|XP_006410800.1|  hypothetical protein EUTSA_v10017448mg           46.2    0.001   



>ref|XP_009800796.1| PREDICTED: uncharacterized protein LOC104246635 [Nicotiana sylvestris]
Length=90

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
 Frame = +3

Query  54   MALVTINNKADEQKESWSRKRVIYlfedeeddedelfeIDLAVVDSLPLPRYCWDDDYSR  233
            MAL  I N   +Q +   +  V  + E+ ED+E+E FEIDL +V+++P P Y W+   S 
Sbjct  1    MALAAIVNSTQDQLKEEYKILVHMVEEEGEDEEEEFFEIDLEIVNNIPPPHY-WE---SY  56

Query  234  FTAATSSALLANCLLPISQLSCAVPMAAKAG  326
            FTAATSS LLANCLLPIS +SCA+P  AKA 
Sbjct  57   FTAATSSTLLANCLLPISDVSCAIPAVAKAS  87



>ref|XP_010101583.1| hypothetical protein L484_015412 [Morus notabilis]
 gb|EXB88722.1| hypothetical protein L484_015412 [Morus notabilis]
Length=115

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKAGDAL  335
            IDL  V S+P P Y W    +    AT SALLANCLLPIS LSCAVPM ++A  AL
Sbjct  27   IDLEAVSSIPPPHY-WGSGVT----ATRSALLANCLLPISDLSCAVPMVSRACSAL  77



>ref|XP_007204037.1| hypothetical protein PRUPE_ppa020829mg [Prunus persica]
 gb|ADL62868.1| hypothetical protein [Prunus persica]
 gb|EMJ05236.1| hypothetical protein PRUPE_ppa020829mg [Prunus persica]
Length=154

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKA  323
            IDL  VDS+P P+Y W D    +  AT +ALLANCLLP++ +S AVPM +K+
Sbjct  33   IDLDAVDSIPPPQYYWGD----YFTATGNALLANCLLPVTDISRAVPMVSKS  80



>ref|XP_002528729.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33641.1| conserved hypothetical protein [Ricinus communis]
Length=106

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKAGDALLL  341
            ID+  V+S+P P Y W+   S FTAA SSALLANCLLPI+ +S AVP  +   +AL L
Sbjct  26   IDIEAVNSIPPPHY-WE---SYFTAAGSSALLANCLLPIADVSSAVPTPSTVCNALSL  79



>ref|XP_006481877.1| PREDICTED: uncharacterized protein LOC102606784 [Citrus sinensis]
Length=129

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKAGDALL  338
            I+L  V+S+P P+Y W+     +  ATS+ LLANCLLPIS +S A+P+ +K+   +L
Sbjct  40   INLEAVNSIPPPQYYWES----YVTATSNTLLANCLLPISDVSSAIPIVSKSSSDML  92



>ref|XP_009374770.1| PREDICTED: uncharacterized protein LOC103963661 [Pyrus x bretschneideri]
Length=148

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 11/71 (15%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKA-------G  326
            IDL  VD++P  +Y WD   S FT  T +ALLANCLLP++ +S A+PM +KA       G
Sbjct  32   IDLDSVDNIPQTQYYWD---SYFTE-TGNALLANCLLPVTDISRAIPMVSKALSSSEQTG  87

Query  327  DALLLQPSTPV  359
            D  ++  + P+
Sbjct  88   DVAMIPQAVPL  98



>ref|XP_008355626.1| PREDICTED: uncharacterized protein LOC103419291 [Malus domestica]
Length=117

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKA  323
            IDL ++DS+P  +Y W+    R+  AT +ALLANCLLP + +S A+P+ +KA
Sbjct  32   IDLDLIDSVPQTQYYWN----RYFTATGNALLANCLLPATDISXAIPVVSKA  79



>ref|XP_008363814.1| PREDICTED: uncharacterized protein LOC103427534 [Malus domestica]
Length=117

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKA  323
            IDL ++DS+P  +Y W+    R+  AT +ALLANCLLP + +S A+P+ +KA
Sbjct  32   IDLDLIDSVPQTQYYWN----RYFTATGNALLANCLLPATDISXAIPVVSKA  79



>ref|XP_008241422.1| PREDICTED: uncharacterized protein LOC103339845 [Prunus mume]
Length=146

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKA  323
            IDL  VDS+P P+Y W      +  AT +ALLANCLLP++ +S AVPM +++
Sbjct  34   IDLDSVDSIPPPQYYW----GNYFTATGNALLANCLLPVTDISRAVPMVSES  81



>ref|XP_004249451.1| PREDICTED: uncharacterized protein LOC101261278 [Solanum lycopersicum]
Length=104

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +3

Query  168  IDLAVVDS-LPLP-RYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKAGDALLL  341
            IDL +V++    P  Y W+  Y R T  +S  LLANCLLPI+ +SCA+P+  KA DA + 
Sbjct  34   IDLELVNNYFSTPHNYNWES-YFRATTTSSCTLLANCLLPIADVSCAIPITTKACDAFIS  92

Query  342  QP  347
             P
Sbjct  93   LP  94



>ref|XP_009366655.1| PREDICTED: uncharacterized protein LOC103956405 [Pyrus x bretschneideri]
Length=135

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKA  323
            IDL ++DS+P  +Y W+    R+  AT +ALLANCLLP + +S A+P+ +KA
Sbjct  32   IDLDLIDSVPQTQYYWN----RYFTATRNALLANCLLPATDISRAIPVVSKA  79



>gb|ADL62863.1| hypothetical protein [Prunus armeniaca]
Length=155

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 4/52 (8%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKA  323
            IDL  VDS+P P+Y +  +Y  FTA T +ALLANCLLP++ +S AVPM +K+
Sbjct  34   IDLDSVDSIPPPQY-YGGNY--FTA-TGNALLANCLLPVTDISRAVPMISKS  81



>ref|XP_006339315.1| PREDICTED: uncharacterized protein LOC102584326 [Solanum tuberosum]
Length=103

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +3

Query  204  RYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKAGDALL-LQPSTPVPVA  368
             Y W+  Y R T  ++  LLANCLLPI+ +SCA+P+  KA DA + L PS   P +
Sbjct  47   NYNWES-YFRATTTSTCTLLANCLLPIADVSCAIPITTKACDAFISLPPSGDSPFS  101



>ref|XP_007027714.1| Uncharacterized protein TCM_022558 [Theobroma cacao]
 gb|EOY08216.1| Uncharacterized protein TCM_022558 [Theobroma cacao]
Length=122

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 5/56 (9%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKAGDAL  335
            I+L  V+S+P P Y W+     F  AT SALLANCLLPIS LS A+P  + A   L
Sbjct  35   INLEAVNSIPPPHY-WEA----FFTATRSALLANCLLPISDLSSAIPTVSTACSTL  85



>ref|XP_006430227.1| hypothetical protein CICLE_v10013717mg [Citrus clementina]
 gb|ESR43467.1| hypothetical protein CICLE_v10013717mg [Citrus clementina]
Length=128

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +3

Query  183  VDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKAGDALLLQPSTPVP  362
            V+S+P P+Y W+     +  ATS+ LLANCLLPIS +S A+P+ +K+   +L        
Sbjct  44   VNSIPPPQYYWES----YVTATSNTLLANCLLPISDVSSAIPIVSKSSSDML--------  91

Query  363  VAVSGLQHHIHI-EEYKEGEGEFL  431
             A   + + I + E  K   G+FL
Sbjct  92   SAAERMANLIMVAESVKNFPGKFL  115



>gb|EYU35476.1| hypothetical protein MIMGU_mgv1a020698mg, partial [Erythranthe 
guttata]
Length=85

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVP  308
            I+L + + +P P+Y + + Y   TA +S+ALLANCLLPI+ +SCAVP
Sbjct  39   INLEIGNKIPPPQYYYWESYFNLTA-SSNALLANCLLPIADVSCAVP  84



>ref|XP_002313102.1| hypothetical protein POPTR_0009s10740g [Populus trichocarpa]
 gb|EEE87057.1| hypothetical protein POPTR_0009s10740g [Populus trichocarpa]
Length=89

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPM  311
            ID+ VV+S+P  ++ W++    +  AT SALLANCL+PI+ LS AVP+
Sbjct  37   IDIEVVNSIPPSQHNWEN----YLTATGSALLANCLVPIADLSTAVPI  80



>ref|XP_006384428.1| hypothetical protein POPTR_0004s14990g, partial [Populus trichocarpa]
 gb|ERP62225.1| hypothetical protein POPTR_0004s14990g, partial [Populus trichocarpa]
Length=81

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 4/51 (8%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAK  320
            ID+ +V+ +P P Y W+     +  AT  ALLANCLLPI+ LS AVP+ + 
Sbjct  20   IDIDIVNCIPPPHYHWE----TYLTATGCALLANCLLPIADLSTAVPIQSS  66



>ref|XP_002879599.1| hypothetical protein ARALYDRAFT_482601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55858.1| hypothetical protein ARALYDRAFT_482601 [Arabidopsis lyrata subsp. 
lyrata]
Length=110

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 4/49 (8%)
 Frame = +3

Query  177  AVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMAAKA  323
            AV D+   PRY    D+  F A T S LLANCLLP + +SCAVP  ++ 
Sbjct  43   AVSDTTTSPRY----DWQIFPARTGSVLLANCLLPAADISCAVPATSRG  87



>ref|XP_008442832.1| PREDICTED: uncharacterized protein LOC103486601 [Cucumis melo]
Length=114

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +3

Query  168  IDLAVVDSLPLPRYCWDDDYSRFTAATSSALLANCLLPISQLSCAVPMA-AKAGDALLL-  341
            IDL  V+S+  P    DD    FT A  + LLANCLLPI+ +S AVP+  +  G+  L  
Sbjct  20   IDLEAVNSITSPPNFSDDPCGFFTTAGGATLLANCLLPITDVSNAVPIGDSNEGEIFLFA  79

Query  342  QPSTPV  359
             PS P 
Sbjct  80   MPSEPT  85



>ref|XP_006410800.1| hypothetical protein EUTSA_v10017448mg [Eutrema salsugineum]
 gb|ESQ52253.1| hypothetical protein EUTSA_v10017448mg [Eutrema salsugineum]
Length=114

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  222  DYSRFTAATSSALLANCLLPISQLSCAVPMAAKA  323
            D+ RF A T S LLANCLLP + +SCAVP  ++A
Sbjct  58   DWQRFPARTGSVLLANCLLPAADISCAVPATSRA  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510262503360