BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14294_g1_i1 len=1015 path=[1037:0-495 1532:496-595 23:596-1014]

Length=1015
                                                                      Score     E

ref|XP_009589702.1|  PREDICTED: protein TIFY 10B-like isoform X3      86.7    8e-17   
ref|NP_001234261.1|  Pto-responsive gene 1 protein                    87.4    8e-17   
ref|XP_009589699.1|  PREDICTED: protein TIFY 10B-like isoform X1      86.7    1e-16   
ref|XP_009589700.1|  PREDICTED: protein TIFY 10B-like isoform X2      86.3    1e-16   
ref|XP_006364615.1|  PREDICTED: protein TIFY 4A-like                  86.3    2e-16   
gb|AFL46166.1|  jasmonate ZIM domain protein b                        85.5    3e-16   
ref|XP_009770182.1|  PREDICTED: protein TIFY 10B-like                 81.3    7e-15   
ref|NP_001031264.4|  putative jasmonate signaling protein JAZ9        63.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530918.1|  PREDICTED: protein TIFY 9-like                   62.4    5e-08   
ref|XP_010551607.1|  PREDICTED: protein TIFY 7                        61.6    1e-07   
ref|XP_010415757.1|  PREDICTED: protein TIFY 7-like                   61.6    2e-07   
ref|XP_008644871.1|  PREDICTED: protein TIFY 10A-like                 59.7    4e-07   
ref|XP_008466201.1|  PREDICTED: protein TIFY 6B-like isoform X2       60.5    5e-07   
ref|XP_008466122.1|  PREDICTED: protein TIFY 6B-like isoform X1       60.5    5e-07   
ref|XP_010479276.1|  PREDICTED: protein TIFY 6A-like isoform X1       60.1    6e-07   
gb|AIT38274.1|  jasmonate ZIM domain-containing protein               59.7    9e-07   
ref|XP_010556102.1|  PREDICTED: protein TIFY 9                        58.5    1e-06   
ref|XP_010471070.1|  PREDICTED: protein TIFY 7-like                   59.3    1e-06   
emb|CDX85661.1|  BnaA02g01520D                                        58.2    1e-06   
ref|XP_007154562.1|  hypothetical protein PHAVU_003G129200g           58.2    1e-06   
ref|XP_004503370.1|  PREDICTED: protein TIFY 6B-like isoform X3       58.9    2e-06   
ref|XP_010062270.1|  PREDICTED: protein TIFY 10A-like isoform X2      58.2    2e-06   
ref|XP_010062269.1|  PREDICTED: protein TIFY 10A-like isoform X1      58.5    2e-06   
gb|KCW69384.1|  hypothetical protein EUGRSUZ_F02865                   58.5    2e-06   
ref|XP_010461670.1|  PREDICTED: protein TIFY 6A-like                  58.2    3e-06   
ref|XP_006303832.1|  hypothetical protein CARUB_v10012517mg           58.2    3e-06   
gb|AAG52332.1|AC011663_11  hypothetical protein; 49277-47786          56.6    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KCW69382.1|  hypothetical protein EUGRSUZ_F02865                   57.4    4e-06   
gb|AAG49896.1|  PnFL-2                                                55.5    9e-06   Ipomoea nil [qian niu]
ref|XP_009121786.1|  PREDICTED: protein TIFY 9 isoform X1             55.1    1e-05   
emb|CDY09775.1|  BnaC09g43860D                                        55.1    1e-05   
ref|NP_189930.1|  protein TIFY 3A                                     55.5    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KHG24904.1|  Protein TIFY 10A -like protein                        55.8    1e-05   
ref|XP_006302673.1|  hypothetical protein CARUB_v10020780mg           55.8    2e-05   
ref|XP_002465159.1|  hypothetical protein SORBIDRAFT_01g033020        55.1    2e-05   Sorghum bicolor [broomcorn]
ref|XP_010427854.1|  PREDICTED: protein TIFY 7-like                   55.5    2e-05   
dbj|BAJ34102.1|  unnamed protein product                              54.7    2e-05   
emb|CDY23487.1|  BnaC06g24560D                                        54.7    2e-05   
ref|XP_008379685.1|  PREDICTED: protein TIFY 3B-like                  54.3    2e-05   
ref|XP_009125894.1|  PREDICTED: protein TIFY 9-like isoform X1        53.9    3e-05   
ref|XP_004144046.1|  PREDICTED: protein TIFY 10A-like                 54.3    3e-05   
ref|XP_004171270.1|  PREDICTED: protein TIFY 10A-like                 54.3    3e-05   
emb|CDX68335.1|  BnaA07g23750D                                        53.9    3e-05   
emb|CDX91140.1|  BnaC02g04570D                                        53.5    4e-05   
ref|XP_010419889.1|  PREDICTED: protein TIFY 9-like isoform X1        53.5    4e-05   
ref|XP_010541672.1|  PREDICTED: protein TIFY 3B-like                  53.9    4e-05   
ref|XP_009406688.1|  PREDICTED: protein TIFY 10A-like                 53.5    4e-05   
ref|XP_002887325.1|  hypothetical protein ARALYDRAFT_476200           54.3    5e-05   
ref|NP_177227.5|  putative jasmonate signaling protein JAZ9           54.3    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003611396.1|  Protein TIFY                                     52.4    5e-05   
ref|XP_003611395.1|  Protein TIFY                                     52.4    6e-05   
ref|XP_010322626.1|  PREDICTED: protein TIFY 6B-like                  53.5    8e-05   
ref|XP_006400654.1|  hypothetical protein EUTSA_v10013955mg           53.9    8e-05   
ref|XP_010685279.1|  PREDICTED: protein TIFY 10A-like                 53.5    8e-05   
ref|XP_009359668.1|  PREDICTED: protein TIFY 3B-like                  52.8    8e-05   
ref|XP_010250564.1|  PREDICTED: protein TIFY 9-like isoform X1        52.4    9e-05   
ref|XP_010495178.1|  PREDICTED: protein TIFY 9-like                   52.0    9e-05   
ref|XP_007033445.1|  Uncharacterized protein isoform 4                52.4    1e-04   
ref|XP_010256256.1|  PREDICTED: protein TIFY 10A-like                 52.4    1e-04   
ref|XP_009104945.1|  PREDICTED: protein TIFY 7-like                   52.4    1e-04   
ref|XP_008344198.1|  PREDICTED: protein TIFY 3B-like                  51.6    1e-04   
ref|XP_010529816.1|  PREDICTED: protein TIFY 10A-like                 52.8    1e-04   
ref|XP_008664988.1|  PREDICTED: protein TIFY 10A-like                 52.0    2e-04   
gb|KFK41488.1|  hypothetical protein AALP_AA2G136900                  52.8    2e-04   
gb|KEH27479.1|  jasmonate zim-domain protein                          50.8    2e-04   
ref|XP_004287689.1|  PREDICTED: protein TIFY 3B-like                  51.6    2e-04   
gb|AAL32593.1|  Unknown protein                                       52.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004173908.1|  PREDICTED: protein TIFY 10B-like                 50.4    2e-04   
ref|XP_004511742.1|  PREDICTED: protein TIFY 10A-like                 50.8    3e-04   
ref|XP_009369743.1|  PREDICTED: protein TIFY 3B-like                  51.2    3e-04   
ref|NP_973862.1|  jasmonate-zim-domain protein 1                      50.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010318655.1|  PREDICTED: protein TIFY 6B isoform X3            52.4    3e-04   
ref|XP_006365422.1|  PREDICTED: protein TIFY 6B-like                  51.6    3e-04   
gb|AGU37272.1|  jasmonate ZIM-domain protein 3b                       50.8    3e-04   
ref|XP_010525373.1|  PREDICTED: protein TIFY 9-like                   50.8    3e-04   
ref|XP_010493203.1|  PREDICTED: protein TIFY 3B-like                  50.8    3e-04   
ref|NP_001190007.1|  protein TIFY 3A                                  50.1    3e-04   
ref|XP_009597283.1|  PREDICTED: protein TIFY 10A                      50.8    3e-04   
ref|XP_010420936.1|  PREDICTED: protein TIFY 3B-like                  50.4    4e-04   
gb|ABK96213.1|  unknown                                               51.6    4e-04   Populus trichocarpa x Populus deltoides
ref|XP_002875606.1|  hypothetical protein ARALYDRAFT_905428           51.2    4e-04   
gb|ABK25804.1|  unknown                                               51.2    4e-04   Picea sitchensis
ref|XP_010419890.1|  PREDICTED: protein TIFY 9-like isoform X2        50.4    4e-04   
ref|XP_006836554.1|  hypothetical protein AMTR_s00131p00047750        51.2    4e-04   
ref|XP_004144433.1|  PREDICTED: protein TIFY 10B-like                 50.8    4e-04   
ref|XP_004510528.1|  PREDICTED: protein TIFY 11B-like                 50.8    4e-04   
gb|KHG00833.1|  Protein TIFY 10A -like protein                        51.2    4e-04   
ref|XP_010453379.1|  PREDICTED: protein TIFY 9-like isoform X1        50.4    5e-04   
ref|XP_003561990.1|  PREDICTED: protein TIFY 10A-like                 50.4    5e-04   
gb|AFL46165.1|  jasmonate ZIM domain protein a                        50.4    5e-04   
ref|XP_006399812.1|  hypothetical protein EUTSA_v10014724mg           50.1    5e-04   
ref|XP_008392032.1|  PREDICTED: protein TIFY 3B-like                  50.4    5e-04   
ref|XP_003611394.1|  Protein TIFY 10A                                 49.7    5e-04   
ref|XP_010318654.1|  PREDICTED: protein TIFY 6B isoform X2            51.6    5e-04   
ref|XP_004235771.1|  PREDICTED: protein TIFY 6B isoform X1            51.6    5e-04   
dbj|BAG68657.1|  jasmonate ZIM-domain protein 3                       50.1    6e-04   Nicotiana tabacum [American tobacco]
ref|XP_002871554.1|  hypothetical protein ARALYDRAFT_488138           50.1    6e-04   
ref|XP_004310129.1|  PREDICTED: protein TIFY 9-like                   50.1    6e-04   
ref|XP_004243696.1|  PREDICTED: protein TIFY 10A-like                 50.1    7e-04   
ref|XP_009793297.1|  PREDICTED: protein TIFY 10A-like                 50.1    7e-04   
emb|CBI27776.3|  unnamed protein product                              50.1    7e-04   
ref|NP_001275246.1|  uncharacterized protein LOC102589610             51.2    7e-04   
ref|XP_007041242.1|  Jasmonate-zim-domain protein 12, putative is...  50.4    8e-04   
dbj|BAD04852.2|  hypothetical protein                                 50.8    8e-04   Nicotiana benthamiana
gb|KHG27959.1|  Protein TIFY 10A -like protein                        50.1    8e-04   
gb|AFK43102.1|  unknown                                               49.3    8e-04   
gb|KFK25560.1|  hypothetical protein AALP_AA8G130600                  49.7    9e-04   
gb|KFK26308.1|  hypothetical protein AALP_AA8G230800                  49.3    9e-04   



>ref|XP_009589702.1| PREDICTED: protein TIFY 10B-like isoform X3 [Nicotiana tomentosiformis]
Length=182

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 67/113 (59%), Gaps = 15/113 (13%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGS------EEIEEKRWNENPSFVYATDETTT  696
            ST+TIFY G V  F DI+PEK EL++ +A         EI EK   E        +E  +
Sbjct  60   STLTIFYMGEVHIFQDITPEKAELIMDLASKSTTLHMNEILEKANKEK------YEENKS  113

Query  697  APSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDL  855
             PS+ + S   N+A GA+AMARKATLARFLEKRKHRLI  + Y Q G+  P  
Sbjct  114  EPSTPNTS--TNYAKGALAMARKATLARFLEKRKHRLITARPY-QHGEKTPKF  163



>ref|NP_001234261.1| Pto-responsive gene 1 protein [Solanum lycopersicum]
 gb|AAF72099.1|AF146690_1 Pto-responsive gene 1 protein [Solanum lycopersicum]
Length=228

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 73/128 (57%), Gaps = 17/128 (13%)
 Frame = +1

Query  469  TLPLLPTSSWKRCEIPSHQLAP--STMTIFYSGSVSAFHDISPEKVELVLGMAGS-----  627
            T PLL  +S          L+P  ST+TIFY G V  F  ISPEK EL++ +        
Sbjct  82   TFPLLAKTSTYDSRKNYDNLSPNESTLTIFYMGEVHIFPGISPEKAELIIDLVSKSTTLH  141

Query  628  -EEIEEKRWNENPSFVYATDETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHR  804
             +EI EK  N+        +E  + PS++S     N+A GA+AMAR+ATLARFLEKRKHR
Sbjct  142  MDEILEKVMNKE-----KYEENKSDPSNAST----NYAKGALAMARRATLARFLEKRKHR  192

Query  805  LIHNKAYL  828
            LI  + YL
Sbjct  193  LIKARPYL  200



>ref|XP_009589699.1| PREDICTED: protein TIFY 10B-like isoform X1 [Nicotiana tomentosiformis]
Length=211

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 67/113 (59%), Gaps = 15/113 (13%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGS------EEIEEKRWNENPSFVYATDETTT  696
            ST+TIFY G V  F DI+PEK EL++ +A         EI EK   E        +E  +
Sbjct  89   STLTIFYMGEVHIFQDITPEKAELIMDLASKSTTLHMNEILEKANKEK------YEENKS  142

Query  697  APSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDL  855
             PS+ + S   N+A GA+AMARKATLARFLEKRKHRLI  + Y Q G+  P  
Sbjct  143  EPSTPNTS--TNYAKGALAMARKATLARFLEKRKHRLITARPY-QHGEKTPKF  192



>ref|XP_009589700.1| PREDICTED: protein TIFY 10B-like isoform X2 [Nicotiana tomentosiformis]
Length=209

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 67/113 (59%), Gaps = 15/113 (13%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGS------EEIEEKRWNENPSFVYATDETTT  696
            ST+TIFY G V  F DI+PEK EL++ +A         EI EK   E        +E  +
Sbjct  87   STLTIFYMGEVHIFQDITPEKAELIMDLASKSTTLHMNEILEKANKEK------YEENKS  140

Query  697  APSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDL  855
             PS+ + S   N+A GA+AMARKATLARFLEKRKHRLI  + Y Q G+  P  
Sbjct  141  EPSTPNTS--TNYAKGALAMARKATLARFLEKRKHRLITARPY-QHGEKTPKF  190



>ref|XP_006364615.1| PREDICTED: protein TIFY 4A-like [Solanum tuberosum]
Length=228

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 86/163 (53%), Gaps = 30/163 (18%)
 Frame = +1

Query  358  SPTTASDGTPATNDVNCFPRGFGAAIPLNYGDDSALETLPLLPTSSWKRCEIPSHQLAPS  537
            S  ++ +   +TND    P+ FG A PL        +T       ++  C  P+     S
Sbjct  62   SKNSSLNNYKSTND----PQYFGGAFPL------VAKTSTYGSRKNYDNCS-PNE----S  106

Query  538  TMTIFYSGSVSAFHDISPEKVELVLGMAGS------EEIEEKRWNENPSFVYATDETTTA  699
            T+TIFY G V  F  ISPEK EL++ +         +EI EK  N+        +E  + 
Sbjct  107  TLTIFYMGEVHIFPGISPEKAELIIDLVSKSTTLHMDEILEKVMNKE-----KYEENKSD  161

Query  700  PSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYL  828
            PS++S     N+A GA+AMAR+ATLARFLEKRKHRLI  + YL
Sbjct  162  PSNAS----TNYAKGALAMARRATLARFLEKRKHRLIKARPYL  200



>gb|AFL46166.1| jasmonate ZIM domain protein b [Nicotiana attenuata]
Length=212

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 67/113 (59%), Gaps = 15/113 (13%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSE------EIEEKRWNENPSFVYATDETTT  696
            ST+TIFY G V  F DI+PEK EL++ +A         EI EK   E        +E  +
Sbjct  90   STLTIFYMGEVHIFQDITPEKAELIMDLASKSTNLHMTEILEKANKEK------YEENKS  143

Query  697  APSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDL  855
             PS+ + S   N+A GA+AMAR+ATLARFLEKRKHRLI  + Y Q G+  P  
Sbjct  144  EPSTPNAS--TNYAKGALAMARRATLARFLEKRKHRLITARPY-QYGEKTPKF  193



>ref|XP_009770182.1| PREDICTED: protein TIFY 10B-like [Nicotiana sylvestris]
Length=183

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 67/117 (57%), Gaps = 23/117 (20%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAG----------SEEIEEKRWNENPSFVYATD  684
            ST+TI Y G V  F DI+PEK E+++ +A           SE   ++++ EN S      
Sbjct  61   STLTILYMGEVHIFQDITPEKAEVIMDLASKSTTLHMTEISEMANKEKYEENKS------  114

Query  685  ETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDL  855
                 PS+ + S   N+A GA+AMAR+ATLARFLEKRKHRLI  + Y Q G+  P  
Sbjct  115  ----EPSTPNAS--TNYAKGALAMARRATLARFLEKRKHRLITARPY-QYGEKTPKF  164



>ref|NP_001031264.4| putative jasmonate signaling protein JAZ9 [Arabidopsis thaliana]
 gb|AEE35102.1| protein TIFY 7 [Arabidopsis thaliana]
Length=243

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 77/158 (49%), Gaps = 20/158 (13%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLP-LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDI  585
            F   F  A PL  G    L T P L+P        + S   +P  +TIFY G++S F+DI
Sbjct  83   FGGAFQNATPLLLGGSVPLPTHPSLVP-------RVASSGSSPQ-LTIFYGGTISVFNDI  134

Query  586  SPEKVELVLGMAGS----EEIEEKRWNENPSFVYATDETTTAPSSSSGSFY---QNFAPG  744
            SP+K + ++  AG+    E  + K   E       T    T   S   SF    +N  P 
Sbjct  135  SPDKAQAIMLCAGNGLKGETGDSKPVREAERMCRDTPVAATNAMSMIESFNAAPRNMIP-  193

Query  745  AIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDLS  858
            ++  ARKA+LARFLEKRK RL+    Y    K+L DLS
Sbjct  194  SVPQARKASLARFLEKRKERLMSAMPY---KKMLLDLS  228



>ref|XP_010530918.1| PREDICTED: protein TIFY 9-like [Tarenaya hassleriana]
Length=211

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 54/99 (55%), Gaps = 17/99 (17%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMA----GSEEIEEKRWNENPSFVYATDETTTAPSS  708
            MTIFY+G+VS F +ISP+K E +L +A     S+ +E    N            T +PS 
Sbjct  122  MTIFYNGNVSVF-EISPDKAESILKVALEASSSKNVESTEPN-----------ATVSPSE  169

Query  709  SSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
                F QN   G + +AR+ +L RFLEKRK RL+ N  Y
Sbjct  170  KQKLFGQNLE-GDLPIARRKSLQRFLEKRKERLVPNSPY  207



>ref|XP_010551607.1| PREDICTED: protein TIFY 7 [Tarenaya hassleriana]
Length=241

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 76/142 (54%), Gaps = 25/142 (18%)
 Frame = +1

Query  475  PLLPT-SSWKRCEIPSHQLAPST--MTIFYSGSVSAFHDISPEKVELVL-----GMAGSE  630
            PLLP+ +S+     P + +A S   +T+FY+G+V+ F+DISPEK + ++     G++ S 
Sbjct  74   PLLPSLNSFAAFSDPRNNVASSAPQLTVFYAGTVNVFNDISPEKAQAIMLWAGNGLSLSS  133

Query  631  EIEEKRWNEN------------PSFVYATDETTTAPSSSSGSFYQNFAPG-----AIAMA  759
             +E ++                P+   ++   T +P+ ++ +   +F        ++  A
Sbjct  134  MVENEKGKTGDIAYGKHPPKAKPAVSASSTSGTHSPTRAAINLMGSFCSASSIIPSVPQA  193

Query  760  RKATLARFLEKRKHRLIHNKAY  825
            RKA+LARFLEKRK RL++   Y
Sbjct  194  RKASLARFLEKRKERLMNAMPY  215



>ref|XP_010415757.1| PREDICTED: protein TIFY 7-like [Camelina sativa]
Length=274

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 87/191 (46%), Gaps = 51/191 (27%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLP-LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDI  585
            F   F  A PL  G    L T P L+P        + S    P  +TIFY+G+VS F+DI
Sbjct  79   FGGAFQNATPLLLGGSVPLPTHPSLVP-------RVASSGSTPPQLTIFYAGTVSVFNDI  131

Query  586  SPEKVELVLGMAG--------------------SEEIEEKRW------------NENPSF  669
            SP+K + ++  AG                    +E++  K+             N N ++
Sbjct  132  SPDKAQAIMLCAGKGFKGETGESSLKKQQPVREAEKVYGKQIHNTAAAASSSSANHNDTY  191

Query  670  VYATDET-TTAPSSSSGSFYQNF---APG----AIAMARKATLARFLEKRKHRLIHNKAY  825
                D       ++++ S  ++F   APG    ++  ARKA+LARFLEKRK RL++   Y
Sbjct  192  SKCRDNKHVDVATTNAMSMIESFNAAAPGNMIPSVPQARKASLARFLEKRKERLMNAMPY  251

Query  826  LQDGKVLPDLS  858
                K+L DLS
Sbjct  252  ---KKMLLDLS  259



>ref|XP_008644871.1| PREDICTED: protein TIFY 10A-like [Zea mays]
 gb|AFW68834.1| putative tify domain/CCT motif transcription factor family protein 
[Zea mays]
Length=218

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 59/122 (48%), Gaps = 12/122 (10%)
 Frame = +1

Query  454  DSALETLPLLPTSSWKRCEIPS-HQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSE  630
            D+   TLPL P  +    EI    Q A +T+TIFY G V+ FH+   ++ + ++ MAGS 
Sbjct  64   DAGARTLPLFPVRNSSSTEIIRPEQEAKATLTIFYQGQVATFHNFPADRAKDLIQMAGSV  123

Query  631  EIEEKRWNENPSFVYATDETTTAPSSSSGSFYQNFAPGAIA---MARKATLARFLEKRKH  801
                    E P     T  TT  P  +  S  +  A G      +ARK TL RFL KRK 
Sbjct  124  T------GEAPGKGVTT--TTAVPEKAGTSGGEPSAAGVAGTPPIARKLTLQRFLRKRKD  175

Query  802  RL  807
            R+
Sbjct  176  RI  177



>ref|XP_008466201.1| PREDICTED: protein TIFY 6B-like isoform X2 [Cucumis melo]
Length=306

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 58/124 (47%), Gaps = 33/124 (27%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWN-----------------ENP  663
            S +TIFY+GSV  ++DISPEK + V+ +AGS  + + + N                   P
Sbjct  160  SQLTIFYAGSVCVYNDISPEKAQAVMLLAGSGGLPQTQNNILSTGQMKASFAGESFQGMP  219

Query  664  SFVYATDETTTAPSSS----------SGSFYQ------NFAPGAIAMARKATLARFLEKR  795
                 T      PS+S          +GS          F P A+  ARKA+LARFLEKR
Sbjct  220  HLELPTATKPIKPSASHPKHSEPPIDAGSVASVSPIPPTFIPAAVPQARKASLARFLEKR  279

Query  796  KHRL  807
            K R+
Sbjct  280  KERI  283



>ref|XP_008466122.1| PREDICTED: protein TIFY 6B-like isoform X1 [Cucumis melo]
Length=307

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 58/124 (47%), Gaps = 33/124 (27%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWN-----------------ENP  663
            S +TIFY+GSV  ++DISPEK + V+ +AGS  + + + N                   P
Sbjct  161  SQLTIFYAGSVCVYNDISPEKAQAVMLLAGSGGLPQTQNNILSTGQMKASFAGESFQGMP  220

Query  664  SFVYATDETTTAPSSS----------SGSFYQ------NFAPGAIAMARKATLARFLEKR  795
                 T      PS+S          +GS          F P A+  ARKA+LARFLEKR
Sbjct  221  HLELPTATKPIKPSASHPKHSEPPIDAGSVASVSPIPPTFIPAAVPQARKASLARFLEKR  280

Query  796  KHRL  807
            K R+
Sbjct  281  KERI  284



>ref|XP_010479276.1| PREDICTED: protein TIFY 6A-like isoform X1 [Camelina sativa]
Length=282

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 67/140 (48%), Gaps = 30/140 (21%)
 Frame = +1

Query  502  RCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMA----GSEEIEEKRWNENPSF  669
            RC        P  +TIFY+GSVS + DISPEK + ++ +A     ++ I   +  +NP  
Sbjct  124  RCSSNPTGSPPDQLTIFYAGSVSVYQDISPEKAQAIMLLARNGPQAKPISMPKP-QNP--  180

Query  670  VYATDETTTAPSS----------------SSGSFYQNFA-------PGAIAMARKATLAR  780
            V+ +  TT +P+S                S  S Y N         P  +   RKA+LAR
Sbjct  181  VHHSPATTYSPTSFPSNRITGLVPRQNMASLVSTYNNQTDALNMAPPVGLPQTRKASLAR  240

Query  781  FLEKRKHRLIHNKAYLQDGK  840
            FLEKRK R+I+   Y  D K
Sbjct  241  FLEKRKERVINVSPYYVDNK  260



>gb|AIT38274.1| jasmonate ZIM domain-containing protein, partial [Phaseolus lunatus]
Length=312

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 9/101 (9%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            +TIFY+GSV  ++DI+PEK + ++ MAG+     +      +   A  +T  +  S+S  
Sbjct  183  LTIFYAGSVCVYNDITPEKAKSIMSMAGNGSTPTQTM----AVSTAKFQTXVSVGSASKE  238

Query  721  FYQN-----FAPGAIAMARKATLARFLEKRKHRLIHNKAYL  828
              Q+      +P  +  ARKA+L RFLEKRK R++    Y 
Sbjct  239  NAQSGILCLVSPVYLPQARKASLTRFLEKRKERMMSTSPYF  279



>ref|XP_010556102.1| PREDICTED: protein TIFY 9 [Tarenaya hassleriana]
Length=208

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 55/106 (52%), Gaps = 17/106 (16%)
 Frame = +1

Query  520  HQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMA----GSEEIEEKRWNENPSFVYATDE  687
            H   P+ MTIFY+G+VS F  +SP+K E +L +A     ++++E  R +           
Sbjct  112  HVPEPAPMTIFYNGTVSVFK-VSPDKAENILKVALEASSTKKVESARRD-----------  159

Query  688  TTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
             + A       F QN   G + + R+ +L RFLEKRK RL+ N  Y
Sbjct  160  VSVAACKRQKLFGQNLG-GDLPIPRRRSLQRFLEKRKERLVRNMPY  204



>ref|XP_010471070.1| PREDICTED: protein TIFY 7-like [Camelina sativa]
Length=274

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 89/191 (47%), Gaps = 51/191 (27%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLP-LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDI  585
            F   F  A PL  G    L T P L+P        + S    P  +TIFY+G+VS F+DI
Sbjct  79   FGGAFQNATPLLLGGSVPLPTHPSLVP-------RMASSGSTPPQLTIFYAGTVSVFNDI  131

Query  586  SPEKVELVLGMAG--------------------SEEIEEKRWNE----------NPSFVY  675
            SP+K + ++  AG                    +E++  K+ +           N + +Y
Sbjct  132  SPDKAQAIMLCAGKGFKVETGESSLKKQQPVREAEKVYGKQIHNTAAAASSSSANHNVIY  191

Query  676  AT---DETTTAPSSSSGSFYQNF---APG----AIAMARKATLARFLEKRKHRLIHNKAY  825
            +    ++     ++++ S  ++F   APG    ++  ARKA+LARFLEKRK RL+    Y
Sbjct  192  SKCRDNKHVDVATTNAMSMIESFNAAAPGNMIPSVPQARKASLARFLEKRKERLMSALPY  251

Query  826  LQDGKVLPDLS  858
                K+L DLS
Sbjct  252  ---KKMLLDLS  259



>emb|CDX85661.1| BnaA02g01520D [Brassica napus]
Length=196

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%)
 Frame = +1

Query  514  PSHQLAPST--MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE  687
            PS +L   T  MTIFY+G+VS F  +SP K E +L +A     E+ +  E        D 
Sbjct  94   PSMELVSGTVPMTIFYNGTVSVFQ-VSPNKAEDILKVAMQTTPEKDKSVEK-------DL  145

Query  688  TTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYL  828
            +   P++     +     G + +AR+ +L RFLEKRK RL+    Y 
Sbjct  146  SVIPPTTLRSKLFGKNLEGDLPIARRKSLQRFLEKRKERLVSTCPYF  192



>ref|XP_007154562.1| hypothetical protein PHAVU_003G129200g [Phaseolus vulgaris]
 gb|ESW26556.1| hypothetical protein PHAVU_003G129200g [Phaseolus vulgaris]
Length=228

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (55%), Gaps = 14/97 (14%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSS  714
            S MTIFY+G V  F+D  PEK+E ++ +A       K  +++P++ +A   T   PSS +
Sbjct  117  SQMTIFYAGQVVVFNDFPPEKMEEIMSLA------RKGMSQSPNY-HAYAHTRNQPSSMA  169

Query  715  GSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
                       + +ARK +L RF EKRKHR+  N  Y
Sbjct  170  -------IVRGLPIARKVSLHRFFEKRKHRISANAPY  199



>ref|XP_004503370.1| PREDICTED: protein TIFY 6B-like isoform X3 [Cicer arietinum]
Length=301

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 11/108 (10%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAG-----SEEIEEKRWNENPSFVYATD-----  684
            S +TIFY+G+V+ F DIS EK + ++ +AG     +  I + +     S + A D     
Sbjct  182  SRLTIFYAGTVNVFDDISAEKAQAIMLLAGNGLSMASNIAQTKVAAPGSKLAAGDGVPVS  241

Query  685  -ETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
                T PSS   S     +  A+  ARKA+LARFLEKRK R+++   Y
Sbjct  242  QHANTPPSSGHPSPISISSHAAVPQARKASLARFLEKRKERVMNAAPY  289



>ref|XP_010062270.1| PREDICTED: protein TIFY 10A-like isoform X2 [Eucalyptus grandis]
 gb|KCW69383.1| hypothetical protein EUGRSUZ_F02865 [Eucalyptus grandis]
Length=248

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 10/93 (11%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSS  708
             P+ +TIFY   V  + DI+PEK EL++ MA           E P+ +  +       +S
Sbjct  145  GPALLTIFYGDGVYVYSDITPEKAELIMSMA----------REQPTTLSTSQAQHLEVAS  194

Query  709  SSGSFYQNFAPGAIAMARKATLARFLEKRKHRL  807
            +       +  G +  AR+ATL RFLEKRK RL
Sbjct  195  NIHRPRATYPQGTLPQARRATLVRFLEKRKDRL  227



>ref|XP_010062269.1| PREDICTED: protein TIFY 10A-like isoform X1 [Eucalyptus grandis]
Length=257

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 10/93 (11%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSS  708
             P+ +TIFY   V  + DI+PEK EL++ MA           E P+ +  +       +S
Sbjct  154  GPALLTIFYGDGVYVYSDITPEKAELIMSMA----------REQPTTLSTSQAQHLEVAS  203

Query  709  SSGSFYQNFAPGAIAMARKATLARFLEKRKHRL  807
            +       +  G +  AR+ATL RFLEKRK RL
Sbjct  204  NIHRPRATYPQGTLPQARRATLVRFLEKRKDRL  236



>gb|KCW69384.1| hypothetical protein EUGRSUZ_F02865 [Eucalyptus grandis]
Length=267

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 10/93 (11%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSS  708
             P+ +TIFY   V  + DI+PEK EL++ MA           E P+ +  +       +S
Sbjct  164  GPALLTIFYGDGVYVYSDITPEKAELIMSMA----------REQPTTLSTSQAQHLEVAS  213

Query  709  SSGSFYQNFAPGAIAMARKATLARFLEKRKHRL  807
            +       +  G +  AR+ATL RFLEKRK RL
Sbjct  214  NIHRPRATYPQGTLPQARRATLVRFLEKRKDRL  246



>ref|XP_010461670.1| PREDICTED: protein TIFY 6A-like [Camelina sativa]
Length=283

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 65/147 (44%), Gaps = 26/147 (18%)
 Frame = +1

Query  478  LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAG--------SEE  633
            + P  +  RC        P  +TIFY+GSVS + DISPEK + ++ +A         S  
Sbjct  115  VFPAPTNIRCSSNPTGSPPDQLTIFYAGSVSVYQDISPEKAQAIMLLARNGPQATPISMP  174

Query  634  IEEKRWNENPSFVYA---------------TDETTTAPSSSSGSFYQNFAPG---AIAMA  759
              + R + +P+  Y+                   +   + ++ +   N AP     +   
Sbjct  175  KPQNRVHHSPATTYSPTLFPSNGITGLLPRQKMVSLVSTCNNQTDASNMAPPQQVGLPQT  234

Query  760  RKATLARFLEKRKHRLIHNKAYLQDGK  840
            RKA+LARFLEKRK R++    Y  D K
Sbjct  235  RKASLARFLEKRKERVVKVSPYYLDNK  261



>ref|XP_006303832.1| hypothetical protein CARUB_v10012517mg [Capsella rubella]
 gb|EOA36730.1| hypothetical protein CARUB_v10012517mg [Capsella rubella]
Length=284

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 65/141 (46%), Gaps = 25/141 (18%)
 Frame = +1

Query  490  SSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPS-  666
            SS KR   PS QL     TIFY+G+VS + DISPEK   ++ +A     ++      P  
Sbjct  143  SSSKRIGSPSSQL-----TIFYAGAVSVYKDISPEKAHAIMLLARDGPQDKPVPMPRPQK  197

Query  667  -----FVYATDETTTAPSS-------------SSGSFYQNFA-PGAIAMARKATLARFLE  789
                 F   TD + T   +             S+ +   N A P  +   RKA+LARFLE
Sbjct  198  PVHHPFAVVTDHSKTGSGTTGLRVTKTMTSLASTHTDASNMASPVGLRQTRKASLARFLE  257

Query  790  KRKHRLIHNKAYLQDGKVLPD  852
            KRK R+I+   Y  + K   D
Sbjct  258  KRKERVINFSPYYVENKSSTD  278



>gb|AAG52332.1|AC011663_11 hypothetical protein; 49277-47786 [Arabidopsis thaliana]
Length=217

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 79/182 (43%), Gaps = 43/182 (24%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLP-LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDI  585
            F   F  A PL  G    L T P L+P        + S   +P  +TIFY G++S F+DI
Sbjct  32   FGGAFQNATPLLLGGSVPLPTHPSLVP-------RVASSGSSPQ-LTIFYGGTISVFNDI  83

Query  586  SPEKVELVLGMAG---------------SEEIEEKRWN-------------ENPSFVYAT  681
            SP+K + ++  AG               +E +  K+ +             +N S    T
Sbjct  84   SPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDT  143

Query  682  DETTTAPSSSSGSFY---QNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPD  852
                T   S   SF    +N  P     ARKA+LARFLEKRK RL+    Y    K+L D
Sbjct  144  PVAATNAMSMIESFNAAPRNMIPSVFPQARKASLARFLEKRKERLMSAMPY---KKMLLD  200

Query  853  LS  858
            LS
Sbjct  201  LS  202



>gb|KCW69382.1| hypothetical protein EUGRSUZ_F02865 [Eucalyptus grandis]
Length=247

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 11/93 (12%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSS  708
             P+ +TIFY   V  + DI+PEK EL++ MA           E P+ + +T +      +
Sbjct  145  GPALLTIFYGDGVYVYSDITPEKAELIMSMA----------REQPTTL-STSQAQHLEVA  193

Query  709  SSGSFYQNFAPGAIAMARKATLARFLEKRKHRL  807
            S+    +   P A+  AR+ATL RFLEKRK RL
Sbjct  194  SNIHRPRATYPQALPQARRATLVRFLEKRKDRL  226



>gb|AAG49896.1| PnFL-2 [Ipomoea nil]
Length=206

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 75/175 (43%), Gaps = 32/175 (18%)
 Frame = +1

Query  328  FGDLQPFRGASPTTASDGTPATNDVNCFPRGFGAAIPLNYGDDSALETLPLLPTSSWKRC  507
            FGDL           S GTP  N +  F +            +S L+ L L PT +    
Sbjct  36   FGDL-----------SLGTPTMNLLPTFEKP---------AQNSDLKPLNLFPTQNKIDS  75

Query  508  EIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE  687
             +       + MTIFY+G +  F++   EK + ++ MA +         + P+ +   D 
Sbjct  76   SLGKADPERAPMTIFYNGQMIMFNEFPVEKAKELIAMATN--------TQTPNILPCADV  127

Query  688  TTTAP----SSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGK  840
             +  P    S    SF    A   + +AR+++LARFLEKRK R+    A  Q GK
Sbjct  128  NSVVPRPAVSKVVPSFGNQRAYSDLPIARRSSLARFLEKRKDRITSKAAPYQKGK  182



>ref|XP_009121786.1| PREDICTED: protein TIFY 9 isoform X1 [Brassica rapa]
 emb|CDX69657.1| BnaA10g20060D [Brassica napus]
Length=196

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 54/107 (50%), Gaps = 10/107 (9%)
 Frame = +1

Query  514  PSHQLAPST--MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE  687
            PS +L   T  MTIFY+G+VS F  +SP K E ++ +A     ++ +  E        D 
Sbjct  94   PSTELVSGTVPMTIFYNGTVSVFQ-VSPNKAEDIMKVAMETSPKKDKSMEK-------DL  145

Query  688  TTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYL  828
            +   P++     +     G + +AR+ +L RFLEKRK R++    Y 
Sbjct  146  SVIPPTTLRTKLFGQNIDGDLPIARRKSLQRFLEKRKERVVSTSPYF  192



>emb|CDY09775.1| BnaC09g43860D [Brassica napus]
Length=197

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 10/107 (9%)
 Frame = +1

Query  514  PSHQLAPST--MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE  687
            PS +L   T  MTIFY+G+VS F  +SP K E ++ +A     ++ +  E        D 
Sbjct  95   PSTELVSGTVPMTIFYNGTVSVFQ-VSPNKAEDIMKVAMETSPKKDKSMEK-------DL  146

Query  688  TTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYL  828
            +   P++     +     G + +AR+ +L RFLEKRK R++ +  Y 
Sbjct  147  SVIPPTTLRTKLFGQNIDGDLPIARRKSLQRFLEKRKERVVSSSPYF  193



>ref|NP_189930.1| protein TIFY 3A [Arabidopsis thaliana]
 sp|Q9M246.1|TIF3A_ARATH RecName: Full=Protein TIFY 3A; AltName: Full=Jasmonate ZIM domain-containing 
protein 11 [Arabidopsis thaliana]
 emb|CAB81784.1| putative protein [Arabidopsis thaliana]
 gb|AAT85750.1| At3g43440 [Arabidopsis thaliana]
 gb|AAU15160.1| At3g43440 [Arabidopsis thaliana]
 gb|AEE77795.1| protein TIFY 3A [Arabidopsis thaliana]
Length=238

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 9/102 (9%)
 Frame = +1

Query  526  LAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEE--KRWNENPSFVYATDETTTA  699
            + PS +TI + GS S F  I  EKV+ +L +A + +  E     + NP+   A       
Sbjct  127  ILPSQLTIIFGGSFSVFDGIPAEKVQEILHIAAAAKATETINLTSINPALKRAI------  180

Query  700  PSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
             S S+ S     +   + +AR+ +L RF EKR+HR +H K Y
Sbjct  181  -SFSNASTVACVSTADVPIARRRSLQRFFEKRRHRFVHTKPY  221



>gb|KHG24904.1| Protein TIFY 10A -like protein [Gossypium arboreum]
Length=263

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 19/114 (17%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYA--TDETTTAPSSSS  714
            MTIFY G V  F+D   +K + ++ +AG    +   +N NP  + A  T    T+P  S 
Sbjct  124  MTIFYGGQVIVFNDFPADKAKEIMLLAGKGSSQSNSFNTNPPHINAPFTSTIATSPIESG  183

Query  715  GSF--YQNFA---------------PGAIAMARKATLARFLEKRKHRLIHNKAY  825
                   NF+               PG + +AR+A+L RFLEKRK R+     Y
Sbjct  184  IGVPPTPNFSTTVTQECIRSAQRPIPGDLPIARRASLHRFLEKRKDRMTTRAPY  237



>ref|XP_006302673.1| hypothetical protein CARUB_v10020780mg [Capsella rubella]
 gb|EOA35571.1| hypothetical protein CARUB_v10020780mg [Capsella rubella]
Length=273

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 82/187 (44%), Gaps = 47/187 (25%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLPLLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDIS  588
            F   F  A PL  G    + TLP L         + S   +P  +TIFY+G+VS F+DIS
Sbjct  82   FGGAFHNATPLLLGGSVPIPTLPSLAP------RVASPGSSPQ-LTIFYAGTVSVFNDIS  134

Query  589  PEKVELVL--------GMAGSEEIEEKRWNENPSFVYATDETTTA---------------  699
            P+K + ++        G  G   +++++       VY      TA               
Sbjct  135  PDKAQAIMLCAGNGFKGETGESSLKKQQPVREVERVYGKQIHNTAAAAASSSSGTHTDTY  194

Query  700  ------PSSSSGSFYQ----NFAPG----AIAMARKATLARFLEKRKHRLIHNKAYLQDG  837
                  P +++ +       N APG    ++  ARKA+LARFLEKRK RL+    Y    
Sbjct  195  SRCRDNPVATTNAMNMIESFNAAPGNMIPSVPQARKASLARFLEKRKERLMSAMPY---K  251

Query  838  KVLPDLS  858
            K+L DLS
Sbjct  252  KMLLDLS  258



>ref|XP_002465159.1| hypothetical protein SORBIDRAFT_01g033020 [Sorghum bicolor]
 gb|EER92157.1| hypothetical protein SORBIDRAFT_01g033020 [Sorghum bicolor]
Length=228

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 72/163 (44%), Gaps = 24/163 (15%)
 Frame = +1

Query  349  RGASPTTASDGTPATNDVNCFPRGFGAAIPLNYGDDSALETLPLLPTSSWKRCEIPSHQL  528
            R ++ T   D T  T D+  FP+  G      +G ++A++  P +     ++        
Sbjct  46   RASADTEKGDTTKETMDL--FPQNAG------FGSEAAMKEAPDVREPEKRQ--------  89

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMA--GSEEIEEKRWNENPSFVYATDET--TT  696
                +TIFY G V  F+D   EK + ++ MA  GS   +      +P+    TD T  T 
Sbjct  90   ----LTIFYGGKVLVFNDFPAEKAKDLMQMASKGSSVAQNPGMLPSPTVATVTDSTKITA  145

Query  697  APSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
             P++         +P  I  A KA+L RFLEKRK RL     Y
Sbjct  146  VPAAPIAVVNAQKSPADIPQAPKASLRRFLEKRKDRLTAKAPY  188



>ref|XP_010427854.1| PREDICTED: protein TIFY 7-like [Camelina sativa]
Length=275

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 86/194 (44%), Gaps = 56/194 (29%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLPLLPTSSWKRCEIPSHQLAPST--MTIFYSGSVSAFHD  582
            F   F  A PL  G    L T P L         +P    + ST  +TIFY G+VS F+D
Sbjct  79   FGGAFQNATPLLLGGSVPLPTHPSL---------VPRVASSGSTPQLTIFYGGTVSVFND  129

Query  583  ISPEKVELVLGMAG--------------------SEEIEEKRW-------------NENP  663
            ISP+K + ++  AG                    +E++  K+              N N 
Sbjct  130  ISPDKAQAIMLCAGKGFKGETGESSLKKQQPVREAEKVYGKQIHNTTAAAASSSSANHND  189

Query  664  SFVYATDET--TTAPSSSSGSFYQNF---APG----AIAMARKATLARFLEKRKHRLIHN  816
            ++    D        ++++ S  ++F   APG    ++  A+KA+LARFLEKRK RL++ 
Sbjct  190  TYSKCRDNNKHVDVATTNAMSMIESFNAAAPGNMIPSVPQAQKASLARFLEKRKERLMNA  249

Query  817  KAYLQDGKVLPDLS  858
              Y    K+L DLS
Sbjct  250  MPY---KKMLLDLS  260



>dbj|BAJ34102.1| unnamed protein product [Thellungiella halophila]
Length=214

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 67/129 (52%), Gaps = 27/129 (21%)
 Frame = +1

Query  508  EIPSHQ-----LAPSTMTIFYSGSVSAFHDISPEKVELVLGMAG--SEEIEEKR------  648
            E+PS +     + PS +TIF+ GSVS F  I  EK++ +L +A   ++ IE K       
Sbjct  66   EVPSSEPDASAILPSQLTIFFGGSVSVFDGIPAEKIQEILRIASATAKSIETKNSTRISP  125

Query  649  -----WNENPSFVYATDETTTAPSSSS-----GSFYQNFAPGAIAMARKATLARFLEKRK  798
                  N  PSF  ++  T  +P+  S      SF ++ A   + +AR+ +L RFLEKR+
Sbjct  126  APSPALNRAPSF--SSTSTGASPAGQSFPIHPISFCRSAAD--LPIARRHSLQRFLEKRR  181

Query  799  HRLIHNKAY  825
             RL++   Y
Sbjct  182  DRLVNRNPY  190



>emb|CDY23487.1| BnaC06g24560D [Brassica napus]
Length=212

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 68/146 (47%), Gaps = 38/146 (26%)
 Frame = +1

Query  523  QLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAG------------------SEEIEEKR  648
            Q A   +TIFY+G+VS F+DISP+K + ++  AG                  +E +  K+
Sbjct  54   QNANPQLTIFYAGTVSVFNDISPDKAQAIMLCAGNGLKIDTGESRLKKPLIETERVYGKQ  113

Query  649  WNEN-------------PSFVYATDETTTAPSSSSGSFYQNFAPG----AIAMARKATLA  777
            ++                +F    D    A ++ S     N  PG    ++  ARKA+LA
Sbjct  114  FHNAATAAASSSSATYCDNFSRCGDRPVGATNAMSMIQSFNVDPGYMMPSVPQARKASLA  173

Query  778  RFLEKRKHRLIHNKAYLQDGKVLPDL  855
            RFLEKR+ RL++   Y    K+L DL
Sbjct  174  RFLEKRRERLVNAMPY---KKMLLDL  196



>ref|XP_008379685.1| PREDICTED: protein TIFY 3B-like [Malus domestica]
Length=206

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 16/115 (14%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKV-ELVLGMAG-----SEEIEEKRWNENPSFVYATDET  690
            AP+ +TIFY+GSVS F  I+ EKV EL+L  A      + +++    +  PS +  T  +
Sbjct  49   APAQLTIFYAGSVSVFDAITAEKVRELMLIAAAAADKKTSDVKNTATSGPPSPLVRTGSS  108

Query  691  TTAPSSSSGSFYQNFAP----------GAIAMARKATLARFLEKRKHRLIHNKAY  825
            +   SS+ GS      P              +AR+ +L RFLEKR+ RL+ N  Y
Sbjct  109  SLQNSSAPGSPVVQPYPDQKSSTSKLEAGFPIARRHSLQRFLEKRRDRLVSNSPY  163



>ref|XP_009125894.1| PREDICTED: protein TIFY 9-like isoform X1 [Brassica rapa]
Length=184

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 10/99 (10%)
 Frame = +1

Query  514  PSHQLAPST--MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE  687
            PS +L   T  MTIFY+G+VS F  +SP K E +L +A     E+ +  E        D 
Sbjct  94   PSMELVSGTVPMTIFYNGTVSVFQ-VSPNKAEDILKVAMQTTPEKDKSVEK-------DL  145

Query  688  TTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHR  804
            +   P++     +     G + +AR+ +L RFLEKRK R
Sbjct  146  SVIPPTTLRSKLFGKNLEGDLPIARRKSLQRFLEKRKER  184



>ref|XP_004144046.1| PREDICTED: protein TIFY 10A-like [Cucumis sativus]
 gb|KGN66322.1| hypothetical protein Csa_1G597690 [Cucumis sativus]
Length=231

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 51/108 (47%), Gaps = 11/108 (10%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSE----EIEEKRWNENPSFV-------YAT  681
            S MTIFY+G V  F++I  ++V  V+ +A  E     I      + P  V        +T
Sbjct  99   SQMTIFYAGQVFVFNNIPADRVGDVMFLASQESSRLNIPTVAARQPPILVGTPADSLSST  158

Query  682  DETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
                T   +S         PGA+ MARKA++ RFLEKRK RL     Y
Sbjct  159  SPVPTRNQTSPPPPPPPSVPGALPMARKASIQRFLEKRKDRLTPRTPY  206



>ref|XP_004171270.1| PREDICTED: protein TIFY 10A-like [Cucumis sativus]
Length=233

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 51/108 (47%), Gaps = 11/108 (10%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSE----EIEEKRWNENPSFV-------YAT  681
            S MTIFY+G V  F++I  ++V  V+ +A  E     I      + P  V        +T
Sbjct  101  SQMTIFYAGQVFVFNNIPADRVGDVMFLASQESSRLNIPTVAARQPPILVGTPADSLSST  160

Query  682  DETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
                T   +S         PGA+ MARKA++ RFLEKRK RL     Y
Sbjct  161  SPVPTRNQTSPPPPPPPSVPGALPMARKASIQRFLEKRKDRLTPRTPY  208



>emb|CDX68335.1| BnaA07g23750D [Brassica napus]
Length=212

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 68/146 (47%), Gaps = 38/146 (26%)
 Frame = +1

Query  523  QLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAG------------------SEEIEEKR  648
            Q A   +TIFY+G+VS F+DISP+K + ++  AG                  +E +  K+
Sbjct  54   QNANPQLTIFYAGTVSVFNDISPDKAQAIMICAGNGLKIDTGESRLKKPLIETERVYGKQ  113

Query  649  WNEN-------------PSFVYATDETTTAPSSSSGSFYQNFAPG----AIAMARKATLA  777
            ++                +F    D    A ++ S     N  PG    ++  ARKA+LA
Sbjct  114  FHNAATAAASSSSATYCDNFSRCGDRPVDATNAMSMIESFNVDPGYMMPSVPQARKASLA  173

Query  778  RFLEKRKHRLIHNKAYLQDGKVLPDL  855
            RFLEKR+ RL++   Y    K+L DL
Sbjct  174  RFLEKRRERLMNAMPY---KKMLLDL  196



>emb|CDX91140.1| BnaC02g04570D [Brassica napus]
Length=196

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 10/107 (9%)
 Frame = +1

Query  514  PSHQLAPST--MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE  687
            PS +L   T  MTIFY+G+VS F  +SP K E +L +A     E+ +  E        D 
Sbjct  94   PSKELVYGTVPMTIFYNGTVSVFQ-VSPNKAEDILKVAMETTPEKNKSMEK-------DL  145

Query  688  TTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYL  828
            +    ++     +     G + +AR+ +L RFLEKRK RL+    Y 
Sbjct  146  SVIPLTTLRSKLFGKNLEGDLPIARRKSLQRFLEKRKERLVSTCPYF  192



>ref|XP_010419889.1| PREDICTED: protein TIFY 9-like isoform X1 [Camelina sativa]
Length=201

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 50/95 (53%), Gaps = 6/95 (6%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFYSG+VS +  +S  K E ++ +A    + +K  +   + +     TT  P      
Sbjct  107  MTIFYSGAVSVYQ-VSRNKAEEIMKVAKDTAVSKKDESSTETHLSVITPTTLRPKL----  161

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            F QN   G + +AR+ +L RFLEKRK R++    Y
Sbjct  162  FGQNLE-GDLPIARRKSLQRFLEKRKERVVSTSPY  195



>ref|XP_010541672.1| PREDICTED: protein TIFY 3B-like [Tarenaya hassleriana]
Length=222

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 12/114 (11%)
 Frame = +1

Query  517  SHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMA--GSEEIEEKRWNE-----NPSFVY  675
            S  + P+ +TIFY GSVS F  +  EKV  +L +A   ++  E K +       +P+ + 
Sbjct  77   SLMVLPTQLTIFYGGSVSVFDGLPTEKVHEILCIATDAAKATEMKNYISISPMPSPALMR  136

Query  676  ATDETTTAPSSSSGSFYQN----FAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
                ++T+  +S G+ + N    FA   + +AR+ +L RFLEKR+ RL++   Y
Sbjct  137  TASFSSTSTVASPGAIHPNTFCRFA-ADLPIARRYSLQRFLEKRRDRLVNKSPY  189



>ref|XP_009406688.1| PREDICTED: protein TIFY 10A-like [Musa acuminata subsp. malaccensis]
Length=213

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 70/150 (47%), Gaps = 23/150 (15%)
 Frame = +1

Query  439  LNYGDDSALETLPLLPTSSWKRCE---IPSH-QLAPSTMTIFYSGSVSAFHDISPEKVEL  606
            +N  D +A +++ L P  +    E   IPS+ +   + +TIFY G V  F D   +K E 
Sbjct  73   INNTDQNAPKSMELFPQHAGIDSESVRIPSNIKTEKAQLTIFYCGKVLVFDDFPADKAED  132

Query  607  VLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGSFYQNFAPGAIA------MARKA  768
            +L MA  E I  ++               TAPSSS+G+   +    A A      +ARK 
Sbjct  133  LLQMASKESIAAQKI------------AFTAPSSSTGADCSSQLETAHANASDMPIARKN  180

Query  769  TLARFLEKRKHRLIHNKAY-LQDGKVLPDL  855
            +L RFL KRK R+     Y +  G   PDL
Sbjct  181  SLHRFLMKRKDRISTKAPYQVHGGTEAPDL  210



>ref|XP_002887325.1| hypothetical protein ARALYDRAFT_476200 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63584.1| hypothetical protein ARALYDRAFT_476200 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 78/188 (41%), Gaps = 49/188 (26%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLP-LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDI  585
            F   F  A PL  G    L T P L+P        + S   +P  +TIFY G+VS F+DI
Sbjct  83   FSGAFQNASPLLLGGSVPLPTHPSLVP-------RVASSGSSPQ-LTIFYGGTVSVFNDI  134

Query  586  SPEKVELVLGMAGS----EEIEEKRWNENPSF----VYA-----------------TDE-  687
            SP+K + ++  AG+    E  E     + P      VY                  TD  
Sbjct  135  SPDKAQDIMLCAGNGLKGETGESSLKKQQPILEVERVYGKQIHNTSAAASSSSAIHTDTY  194

Query  688  --------TTTAPSSSSGSFYQ---NFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQD  834
                     TT   S   SF     N  P     ARKA+LARFLEKRK RL+    Y   
Sbjct  195  SRCRDNPIATTNAMSMIESFNAVPGNMIPSVFPQARKASLARFLEKRKERLMSAMPY---  251

Query  835  GKVLPDLS  858
             K+L DLS
Sbjct  252  KKMLLDLS  259



>ref|NP_177227.5| putative jasmonate signaling protein JAZ9 [Arabidopsis thaliana]
 sp|Q8W4J8.2|TIF7_ARATH RecName: Full=Protein TIFY 7; AltName: Full=Jasmonate ZIM domain-containing 
protein 9 [Arabidopsis thaliana]
 gb|AEE35101.1| protein TIFY 7 [Arabidopsis thaliana]
Length=267

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 80/181 (44%), Gaps = 42/181 (23%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLP-LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDI  585
            F   F  A PL  G    L T P L+P        + S   +P  +TIFY G++S F+DI
Sbjct  83   FGGAFQNATPLLLGGSVPLPTHPSLVP-------RVASSGSSPQ-LTIFYGGTISVFNDI  134

Query  586  SPEKVELVLGMAG---------------SEEIEEKRWN-----------ENPSFVYATDE  687
            SP+K + ++  AG               +E +  K+ +              +F    D 
Sbjct  135  SPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDT  194

Query  688  TTTAPSSSSGSFYQNFAPG----AIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDL  855
               A ++ S     N AP     ++  ARKA+LARFLEKRK RL+    Y    K+L DL
Sbjct  195  PVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPY---KKMLLDL  251

Query  856  S  858
            S
Sbjct  252  S  252



>ref|XP_003611396.1| Protein TIFY [Medicago truncatula]
Length=130

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 58/118 (49%), Gaps = 10/118 (8%)
 Frame = +1

Query  463  LETLPLLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEE  642
            L+ +P+L  SS  +  I   + + + MTIFY G V  F D+  +K + ++  + ++ I  
Sbjct  19   LQEIPILGNSSVMKANIKKEEPSCAQMTIFYDGKVIVFDDVPADKAKDIMDFS-TKGIAS  77

Query  643  KRWNENPSFVYAT----DETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHR  804
               N N ++ Y++    +     P   S     +     + M RKA+L RFLEKRK R
Sbjct  78   TSQNHNNNYAYSSFLSRNSLQDYPQVPSIPVIYD-----LPMTRKASLHRFLEKRKDR  130



>ref|XP_003611395.1| Protein TIFY [Medicago truncatula]
 gb|AES94353.1| jasmonate zim-domain protein [Medicago truncatula]
Length=173

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (50%), Gaps = 10/119 (8%)
 Frame = +1

Query  463  LETLPLLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEE  642
            L+ +P+L  SS  +  I   + + + MTIFY G V  F D+  +K + ++  + ++ I  
Sbjct  19   LQEIPILGNSSVMKANIKKEEPSCAQMTIFYDGKVIVFDDVPADKAKDIMDFS-TKGIAS  77

Query  643  KRWNENPSFVYAT----DETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRL  807
               N N ++ Y++    +     P   S     +     + M RKA+L RFLEKRK R+
Sbjct  78   TSQNHNNNYAYSSFLSRNSLQDYPQVPSIPVIYD-----LPMTRKASLHRFLEKRKDRI  131



>ref|XP_010322626.1| PREDICTED: protein TIFY 6B-like [Solanum lycopersicum]
Length=275

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 30/128 (23%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSF-------------  669
             P+ +T+FY+GSV  + +ISPEK + ++ +AG+  I     N +PS              
Sbjct  121  GPAQLTMFYAGSVCVYDNISPEKAQAIMLLAGNTPISTTIRN-SPSLDHHHHHHHNNNNN  179

Query  670  --VYATDETTTAPSSSSGSFYQ--------------NFAPGAIAMARKATLARFLEKRKH  801
                +T+ETT   S      ++              N    A+  ARKA+LARFLE+RK 
Sbjct  180  NNNNSTNETTIIRSIGVLKSHELSKIVTSQESRQPPNHNLSAVPQARKASLARFLERRKE  239

Query  802  RLIHNKAY  825
            R++    Y
Sbjct  240  RVVSASPY  247



>ref|XP_006400654.1| hypothetical protein EUTSA_v10013955mg [Eutrema salsugineum]
 gb|ESQ42107.1| hypothetical protein EUTSA_v10013955mg [Eutrema salsugineum]
Length=355

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 67/129 (52%), Gaps = 27/129 (21%)
 Frame = +1

Query  508  EIPSHQ-----LAPSTMTIFYSGSVSAFHDISPEKVELVLGMAG--SEEIEEKR------  648
            E+PS +     + PS +TIF+ GSVS F  I  EK++ +L +A   ++ IE K       
Sbjct  207  EVPSSEPDASAILPSQLTIFFGGSVSVFDGIPAEKIQEILRIASATAKSIETKNSTRISP  266

Query  649  -----WNENPSFVYATDETTTAPSSSS-----GSFYQNFAPGAIAMARKATLARFLEKRK  798
                  N  PSF  ++  T  +P+  S      SF ++ A   + +AR+ +L RFLEKR+
Sbjct  267  APSPALNRAPSF--SSTSTGASPAGQSFPIHPISFCRSAAD--LPIARRHSLQRFLEKRR  322

Query  799  HRLIHNKAY  825
             RL++   Y
Sbjct  323  DRLVNRNPY  331



>ref|XP_010685279.1| PREDICTED: protein TIFY 10A-like [Beta vulgaris subsp. vulgaris]
Length=258

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/171 (25%), Positives = 72/171 (42%), Gaps = 34/171 (20%)
 Frame = +1

Query  385  PATNDVNCFPRGFGAAIPLNYGDDSALETLPLLP----------TSSWKRC--------E  510
            P    +N FPR           +  +LE  PL+           T +   C        +
Sbjct  67   PKNTAINLFPRNLEK-------EKLSLELFPLMSSLTAAGVKETTKTMADCRELSISEND  119

Query  511  IPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDET  690
             P +   PS MTIFY G V  F+++  +K   ++ +A  + +      +N +      +T
Sbjct  120  EPKNTTTPS-MTIFYGGRVLVFNELPEDKAREIMSLARCQTMNSSSHTQNQT--ETPTQT  176

Query  691  TTAPSSSSGSFYQNFAPGAIA------MARKATLARFLEKRKHRLIHNKAY  825
              + ++ +    QN  P  ++      +AR+ +L RF+EKRKHR+  N  Y
Sbjct  177  LRSINTLTSYLAQNVVPQGVSSLSDLPIARRVSLHRFMEKRKHRIAANAPY  227



>ref|XP_009359668.1| PREDICTED: protein TIFY 3B-like [Pyrus x bretschneideri]
Length=212

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 59/122 (48%), Gaps = 24/122 (20%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPS-  705
            AP+ +TIFY+GSVS F  I+ EKV  ++ +A +        ++  S V  T  T+  PS 
Sbjct  49   APAQLTIFYAGSVSVFDAITAEKVRELMLIAAAAAAAAAAADKKTSDVKNT-ATSGPPSP  107

Query  706  ---SSSGSFYQNFAPGA-------------------IAMARKATLARFLEKRKHRLIHNK  819
               + S S   + APG+                     +AR+ +L RFLEKR+ RL+ N 
Sbjct  108  LVRTGSSSLQNSSAPGSPVVQPYPDQKSSISKLEAGFPIARRHSLQRFLEKRRDRLVSNS  167

Query  820  AY  825
             Y
Sbjct  168  PY  169



>ref|XP_010250564.1| PREDICTED: protein TIFY 9-like isoform X1 [Nelumbo nucifera]
Length=194

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 58/116 (50%), Gaps = 10/116 (9%)
 Frame = +1

Query  463  LETLPLL-PTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIE  639
            + TLP++ P S     E PS + AP  +TIFY+G+VS F D+  +K E ++ +A      
Sbjct  72   VSTLPVVNPISPRAVSESPSPETAP--LTIFYNGTVSVF-DVPRDKAEKIMKLA------  122

Query  640  EKRWNENPSFVYATDETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRL  807
            E     N +     D    A SS+          G + + RK +L RFLEKRK RL
Sbjct  123  EIGSTANCNAAVTADPKVVASSSTDEHELLESLNGELPIPRKKSLQRFLEKRKERL  178



>ref|XP_010495178.1| PREDICTED: protein TIFY 9-like [Camelina sativa]
Length=170

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 50/95 (53%), Gaps = 6/95 (6%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFY+G+VS +  +S  K E ++ +A    + +K  +   + +     TT  P      
Sbjct  76   MTIFYNGTVSVYQ-VSRNKAEEIMKVAKETTVSKKDESSTETDLSVITPTTLRPKL----  130

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            F QN   G + +AR+ +L RFLEKRK R+I    Y
Sbjct  131  FGQNLE-GDLPIARRKSLQRFLEKRKERVISTSPY  164



>ref|XP_007033445.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY04371.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=203

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 46/101 (46%), Gaps = 12/101 (12%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE--TTTAP  702
            A   +TI Y   V  F DISP K E +L +A  E           SF+ A D+      P
Sbjct  99   ADDRLTIVYDNKVHVFEDISPNKAEAILRLARDEYY---------SFLTADDDRNQVVLP  149

Query  703  SSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
              ++      +   A+  ARKATL  FLEKRK RL +   Y
Sbjct  150  EQTTMDLL-CWTSNALPQARKATLEHFLEKRKDRLTNGMFY  189



>ref|XP_010256256.1| PREDICTED: protein TIFY 10A-like [Nelumbo nucifera]
Length=199

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 52/95 (55%), Gaps = 11/95 (12%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            +TIFYSG +  F D+  +K + ++ +AG         + +P+ + A    T+A   ++  
Sbjct  83   LTIFYSGLIYVFDDVPLDKAQAIMLLAGE--------SSSPNLIKAQ---TSAKLGTAAL  131

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
               NFA   I +ARK +L +FLEKR++R+I    Y
Sbjct  132  PSSNFASIHIPIARKHSLQQFLEKRRNRIISKSPY  166



>ref|XP_009104945.1| PREDICTED: protein TIFY 7-like [Brassica rapa]
Length=212

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 67/146 (46%), Gaps = 38/146 (26%)
 Frame = +1

Query  523  QLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAG------------------SEEIEEKR  648
            Q A   +TIFY+G+V  F+DISP+K + ++  AG                  +E +  K+
Sbjct  54   QNANPQLTIFYAGTVCVFNDISPDKAQAIMLCAGNGLKIDNGESRLKKPLIETERVYGKQ  113

Query  649  WNEN-------------PSFVYATDETTTAPSSSSGSFYQNFAPG----AIAMARKATLA  777
            ++                +F    D    A ++ S     N  PG    ++  ARKA+LA
Sbjct  114  FHNAATAAASSSSATYCDNFSRCGDRPVGATNAMSMIESFNVDPGYMMPSVPQARKASLA  173

Query  778  RFLEKRKHRLIHNKAYLQDGKVLPDL  855
            RFLEKR+ RL++   Y    K+L DL
Sbjct  174  RFLEKRRERLMNAMPY---KKMLLDL  196



>ref|XP_008344198.1| PREDICTED: protein TIFY 3B-like, partial [Malus domestica]
Length=179

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 18/117 (15%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNEN-------PSFVYATDE  687
            AP+ +TIFY+GSVS F  I+ EKV  ++ +A +   ++K  +         PS +  T  
Sbjct  25   APAQLTIFYAGSVSVFDAITAEKVRELMLIAAAAAADKKTSDVKNSATSCPPSPLIRTGS  84

Query  688  TT-----TAPSSSSGSFY--QNFAPGAIA----MARKATLARFLEKRKHRLIHNKAY  825
            +T     TAP S     Y  QN +   +     +AR+ +L RFLEKR+ R++ N  Y
Sbjct  85   STLQNSSTAPGSPVVQPYPEQNSSICKLQAEFPIARRHSLQRFLEKRRDRMVSNSPY  141



>ref|XP_010529816.1| PREDICTED: protein TIFY 10A-like [Tarenaya hassleriana]
 ref|XP_010529824.1| PREDICTED: protein TIFY 10A-like [Tarenaya hassleriana]
Length=253

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 8/115 (7%)
 Frame = +1

Query  511  IPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDET  690
            +P  Q A   MTIFY G V  F+D S EK + V+ +AGS +      N+  +        
Sbjct  116  MPESQTA--QMTIFYGGQVMVFNDFSAEKAKEVMKLAGSGKSHMGFKNQTETMSAGHHCP  173

Query  691  TTAPSSSSGSFYQNFAPGA------IAMARKATLARFLEKRKHRLIHNKAYLQDG  837
               P++ +    +   P A      + +AR+A+L RFLEKRK R+     Y   G
Sbjct  174  NPVPNTGNSLTQEPCQPFATQIGCELPIARRASLHRFLEKRKDRITSKAPYQVGG  228



>ref|XP_008664988.1| PREDICTED: protein TIFY 10A-like [Zea mays]
 tpg|DAA50081.1| TPA: putative tify domain/CCT motif transcription factor family 
protein [Zea mays]
 gb|AIB05255.1| ZIM transcription factor, partial [Zea mays]
Length=216

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 53/115 (46%), Gaps = 10/115 (9%)
 Frame = +1

Query  469  TLPLLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKR  648
            TLPL P  +    EI   +   +T+TIFY G VS FH    ++ ++++ MA S       
Sbjct  67   TLPLFPVRTAGTAEITRPEEGKATLTIFYQGQVSTFHHFPADRAKVLMQMASSVT-----  121

Query  649  WNENPSFVYATDETTTAPSSSSGSFYQNFAPGAIA--MARKATLARFLEKRKHRL  807
                P    A    T  P  +  S  Q    GA    +ARK TL  FL KRK+R+
Sbjct  122  -GNTPEKGVAV--ATAVPKKAQTSDDQPSPAGAGMPPIARKLTLQNFLRKRKNRI  173



>gb|KFK41488.1| hypothetical protein AALP_AA2G136900 [Arabis alpina]
Length=270

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 65/145 (45%), Gaps = 43/145 (30%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGS------EEIEEKRWNENP-------------  663
            +TIFY G+VS F+DISP+K + ++  AG+       EI E    + P             
Sbjct  115  LTIFYGGTVSVFNDISPDKAQAIMLCAGNGLGNPKGEIGESSLKKKPVREAERVYGKQIH  174

Query  664  ----------------SFVYATDETTTAPSS----SSGSFYQNFAPGAIAMARKATLARF  783
                            SF    D +  A ++     S +   N  P ++  ARKA+LARF
Sbjct  175  NAAAAAASSSSGTNSDSFSRCRDNSVAATNAINMIESFNANGNMIP-SVPQARKASLARF  233

Query  784  LEKRKHRLIHNKAYLQDGKVLPDLS  858
            LEKRK RL+    Y    K+L DLS
Sbjct  234  LEKRKERLMSAMPY---KKMLLDLS  255



>gb|KEH27479.1| jasmonate zim-domain protein [Medicago truncatula]
Length=140

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 50/98 (51%), Gaps = 10/98 (10%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVE--LVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSS  708
            + MTIFY G +  F DI  EKVE  +V    G+      + N N +F +A    +    +
Sbjct  13   TQMTIFYDGKIIVFDDIPAEKVEDIMVFSSEGTTTSRNHK-NNNYAFRFAQSHPSFLARN  71

Query  709  SSGSFYQNFAPGA-----IAMARKATLARFLEKRKHRL  807
            S+ +  Q   P +     + M RKA+L RFLEKRK R+
Sbjct  72   SANNSVQ--VPSSPVIYDLPMTRKASLHRFLEKRKDRI  107



>ref|XP_004287689.1| PREDICTED: protein TIFY 3B-like [Fragaria vesca subsp. vesca]
Length=204

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 61/121 (50%), Gaps = 18/121 (15%)
 Frame = +1

Query  511  IPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVL---GMAGSEEIEEKRWNEN---PSFV  672
            IP+H  AP+ +TIFY+GSVS F  ++ EKV  +L     A ++++ + + + N   PS  
Sbjct  44   IPAH--APAQLTIFYAGSVSVFDAVTAEKVRELLAVAAAAAADKVIDVKSSGNSCPPSPQ  101

Query  673  YATDETTTAPSSSSGSFYQNFAP----------GAIAMARKATLARFLEKRKHRLIHNKA  822
              T   +   SS+ GS      P              +AR+ +L RFLEKR+ RL  N  
Sbjct  102  IQTGSNSLQNSSAPGSPVVQLYPDQKSSICKLQAEFPIARRHSLQRFLEKRRDRLGSNSP  161

Query  823  Y  825
            Y
Sbjct  162  Y  162



>gb|AAL32593.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10238.1| unknown protein [Arabidopsis thaliana]
Length=267

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 80/181 (44%), Gaps = 42/181 (23%)
 Frame = +1

Query  409  FPRGFGAAIPLNYGDDSALETLP-LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDI  585
            F   F  A PL  G    L T P L+P        + S   +P  +TIFY G++S F++I
Sbjct  83   FGGAFQNATPLLLGGSVPLPTHPSLVP-------RVASSGSSPQ-LTIFYGGTISVFNNI  134

Query  586  SPEKVELVLGMAG---------------SEEIEEKRWN-----------ENPSFVYATDE  687
            SP+K + ++  AG               +E +  K+ +              +F    D 
Sbjct  135  SPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDT  194

Query  688  TTTAPSSSSGSFYQNFAPG----AIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDL  855
               A ++ S     N AP     ++  ARKA+LARFLEKRK RL+    Y    K+L DL
Sbjct  195  PVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPY---KKMLLDL  251

Query  856  S  858
            S
Sbjct  252  S  252



>ref|XP_004173908.1| PREDICTED: protein TIFY 10B-like [Cucumis sativus]
Length=143

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 45/97 (46%), Gaps = 12/97 (12%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSS  714
            + MTIFY G V  F+D+  E+ E ++ MAG                 ++   TTA S + 
Sbjct  27   TQMTIFYDGKVLVFNDLPSERAEEIMAMAGK------------GIAPSSRSITTAVSDNG  74

Query  715  GSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            G          + +AR+A+L RF EKRK R+     Y
Sbjct  75   GEQPLTKVSSDLPIARRASLHRFFEKRKDRVAARGPY  111



>ref|XP_004511742.1| PREDICTED: protein TIFY 10A-like [Cicer arietinum]
Length=174

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 44/89 (49%), Gaps = 11/89 (12%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFY G V  F DI  EK + ++  +    I + + N   +FV+   +  + P      
Sbjct  51   MTIFYDGKVFVFDDIPAEKAKEIMSFSTKGIISQNQNNYTHTFVHDHPQVPSIP-----I  105

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRL  807
             Y       + M RKA+L RFLEKRK R+
Sbjct  106  IYD------LPMTRKASLHRFLEKRKDRI  128



>ref|XP_009369743.1| PREDICTED: protein TIFY 3B-like [Pyrus x bretschneideri]
Length=209

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 18/117 (15%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNEN-------PSFVYATDE  687
            AP+ +TIFY+GSVS F  I+ EKV  ++ +A +   ++K  +         PS +  T  
Sbjct  51   APAQLTIFYAGSVSVFDAITAEKVRELMLIAAAAAADKKTSDVKNSATSCPPSPLIRTGS  110

Query  688  TT-----TAPSSSSGSFY--QNFAPGAIA----MARKATLARFLEKRKHRLIHNKAY  825
            +T     TAP S     Y  QN +   +     +AR+ +L RFLEKR+ R++ N  Y
Sbjct  111  STLQNSYTAPGSPVVQPYPEQNSSICKLQAEFPIARRHSLQRFLEKRRDRMVSNSPY  167



>ref|NP_973862.1| jasmonate-zim-domain protein 1  [Arabidopsis thaliana]
 gb|AEE29815.1| protein TIFY 10A [Arabidopsis thaliana]
Length=187

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 70/163 (43%), Gaps = 15/163 (9%)
 Frame = +1

Query  361  PTTASDGTPATNDV---NCFPRGFGAAIPLNYGDDSALETLPLLPTSSWKRCEIPSHQLA  531
            P  AS+      DV   N FPR      P      S+L    +L  +   R   P  Q A
Sbjct  5    PCEASNMDSMVQDVKPTNLFPRQ-----PSFSSSSSSLPKEDVLKMTQTTRSVKPESQTA  59

Query  532  PSTMTIFYSGSVSAFHDISPEKVELVLGMA--GSEEIEEKRWNENPSFVYATDETTTAPS  705
            P  +TIFY+G V  F+D S EK + V+ +A  G+     K   +  S +         P 
Sbjct  60   P--LTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPR  117

Query  706  SSSGSFYQNFAPGAIA---MARKATLARFLEKRKHRLIHNKAY  825
             ++       +P  +    +AR+A+L RFLEKRK R+     Y
Sbjct  118  KTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPY  160



>ref|XP_010318655.1| PREDICTED: protein TIFY 6B isoform X3 [Solanum lycopersicum]
Length=326

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  703  SSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDLS  858
            +SS GSF  +  P A+  ARKA+LARFLEKRK R+I    Y  + K  P+ S
Sbjct  249  TSSVGSFPASLVPSAVPQARKASLARFLEKRKERVISASPYPLNSKQSPECS  300



>ref|XP_006365422.1| PREDICTED: protein TIFY 6B-like [Solanum tuberosum]
Length=258

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 18/116 (16%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSF-------------  669
             P+ +T+FY+GSV  + +ISPEK + ++ +AG+  I     N  PS              
Sbjct  116  GPAQLTMFYAGSVCVYDNISPEKAQAIMLLAGNAPISTTIRNF-PSHDHNNNNTNETTIT  174

Query  670  ----VYATDETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
                V  +   TT  S        +    A+  AR+A+LARFLE+RK R+++   Y
Sbjct  175  RSIRVLKSPSNTTEVSKIESRQPPSHNLSAVPQARRASLARFLERRKERVVNASPY  230



>gb|AGU37272.1| jasmonate ZIM-domain protein 3b [Nicotiana tabacum]
Length=200

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 46/95 (48%), Gaps = 10/95 (11%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFY G V  F+D   +K + ++ MA        + N N     +T +      S+S  
Sbjct  85   MTIFYGGQVIVFNDFPADKAKEIMLMASCT-----KGNNN-----STTQIQKTAESASDL  134

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
              Q    G + +AR+A+L RFLEKRK RL     Y
Sbjct  135  VPQPIISGDLPIARRASLTRFLEKRKDRLTAKAPY  169



>ref|XP_010525373.1| PREDICTED: protein TIFY 9-like [Tarenaya hassleriana]
Length=196

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 16/115 (14%)
 Frame = +1

Query  475  PLLPTSSWKRCEIPSH--QLAPST--MTIFYSGSVSAFHDISPEKVELVLGMA-GSEEIE  639
            P +P  S     +P H  + AP T  MTIFY+G+VS F ++S +K E +L  A  +  ++
Sbjct  93   PQIPVPSL-HVPVPRHSTEYAPETAPMTIFYNGTVSVF-EVSSDKAESILKAALDASPLK  150

Query  640  EKRWNENPSFVYATDETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHR  804
            E    E         + +  P      F QN   G + +AR+ +L RFLEKRK R
Sbjct  151  EAESTE--------PDVSAPPCKRQKLFGQNLG-GDLPIARRKSLQRFLEKRKER  196



>ref|XP_010493203.1| PREDICTED: protein TIFY 3B-like [Camelina sativa]
Length=196

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 62/120 (52%), Gaps = 17/120 (14%)
 Frame = +1

Query  508  EIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKR-----------WN  654
            E  +  + PS +TIF+ GSV+ F  +  EKV+ +L +A ++ +E K             N
Sbjct  55   EADASTVLPSQLTIFFGGSVTVFDGLPAEKVQEILRIA-AKAMETKNSTSISPVPSPALN  113

Query  655  ENPSFVYATDETTTAPSS---SSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
              PSF   ++  + A  S      SF ++ A   + +AR+ +L RFLEKR+ RL++   Y
Sbjct  114  RAPSFSSTSNVASPAAQSFPIQPISFCRSAAD--LPIARRHSLQRFLEKRRDRLVNKNPY  171



>ref|NP_001190007.1| protein TIFY 3A [Arabidopsis thaliana]
 gb|AEE77796.1| protein TIFY 3A [Arabidopsis thaliana]
Length=152

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 51/101 (50%), Gaps = 9/101 (9%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEE--KRWNENPSFVYATDETTTAP  702
            A + +TI + GS   F+ +  +KV+ +L +A + +  E     + NP+   A        
Sbjct  42   ASTQLTIIFGGSCRVFNGVPAQKVQEILHIAAAAKATETINLTSINPALKRAI-------  94

Query  703  SSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            S S+ S     +   + +AR+ +L RF EKR+HR +H K Y
Sbjct  95   SFSNASTVACVSTADVPIARRRSLQRFFEKRRHRFVHTKPY  135



>ref|XP_009597283.1| PREDICTED: protein TIFY 10A [Nicotiana tomentosiformis]
Length=205

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 46/95 (48%), Gaps = 10/95 (11%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFY G V  F+D   +K + ++ MA        + N N     +T +      S+S  
Sbjct  90   MTIFYGGQVIVFNDFPADKAKEIMLMASC-----TKGNNN-----STTQIQKTAESASDL  139

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
              Q    G + +AR+A+L RFLEKRK RL     Y
Sbjct  140  VPQPIISGDLPIARRASLTRFLEKRKDRLTAKAPY  174



>ref|XP_010420936.1| PREDICTED: protein TIFY 3B-like [Camelina sativa]
Length=195

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 83/174 (48%), Gaps = 24/174 (14%)
 Frame = +1

Query  364  TTASDGTPATNDVNCFPRGFGAAIPLNYGDDSALE-----TLPLLPTSSWKRCEIPSHQL  528
            T A D + A+ +  C   G  A I  N  +   L+     ++  + ++     E  +  +
Sbjct  2    TMAKDESHASVEGVCVVTGGAAEIGGNGAEQGVLDGSVEKSIHEVRSTENISSEADASTV  61

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKR-----------WNENPSFVY  675
             PS +TIF+ GSV+ F  +  +KV+ +L +A ++ +E K             N  PSF  
Sbjct  62   LPSQLTIFFGGSVTVFDGLPADKVQEILRIA-AKAMETKNSTSISPVPSPALNRAPSF-S  119

Query  676  ATDETTTAPSSS----SGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            +T    + P+ S      SF ++ A   + +AR+ +L RFLEKR+ RL++   Y
Sbjct  120  STSNVASPPAQSFPIQPISFCRSAA--DLPIARRHSLQRFLEKRRDRLVNKNPY  171



>gb|ABK96213.1| unknown [Populus trichocarpa x Populus deltoides]
Length=273

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 24/119 (20%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMA--GSEEIEEK----RWNENPSFV-----YATDE  687
            MTIFY+G V  F+D   +K + V+ +A  GS +I+        N +P+          + 
Sbjct  127  MTIFYAGRVIVFNDFPADKAKEVMLLASKGSSQIQNAFPSIPANSHPALAPNISKTPIES  186

Query  688  TTTAPSSSSG--SFYQNF-------APGAIA----MARKATLARFLEKRKHRLIHNKAY  825
            T T PSSS+   +F  N        AP  IA    +AR+A+L RFLEKRK R+I    Y
Sbjct  187  TITIPSSSNALPNFGSNLIQEGMQPAPQPIANDLPIARRASLHRFLEKRKDRIIAKAPY  245



>ref|XP_002875606.1| hypothetical protein ARALYDRAFT_905428 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51865.1| hypothetical protein ARALYDRAFT_905428 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = +1

Query  526  LAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKR--WNENPSFVYATDETTTA  699
            + PS +TI + GS S F  I  EKV+ +L +A + +  E +   + NP+       ++T+
Sbjct  125  ILPSQLTIIFGGSFSVFDGIPAEKVQEILRIAAAAKATETKNLTSINPALKRVISFSSTS  184

Query  700  PSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
              +  G++    +   + +AR+ +L RFLEKR+ R +H   Y
Sbjct  185  TIALPGAY---ISTADVPIARRRSLQRFLEKRRDRFVHTNPY  223



>gb|ABK25804.1| unknown [Picea sitchensis]
Length=229

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 73/156 (47%), Gaps = 17/156 (11%)
 Frame = +1

Query  394  NDVNCFPR--GFGAAIPLNYG-------DDSALETLPLLPTSSWKRCEIPSHQLAPSTMT  546
            N +N FP   GFG+ I +  G       DD        + +       IPS Q + + +T
Sbjct  47   NSINLFPNQSGFGSPIAVLPGSEHRTSSDDHQDGCSGFVTSFRHTASTIPSKQ-SCAQLT  105

Query  547  IFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWN--ENPSFVYATDETTTAP----SS  708
            IFY G V+ + DI  ++ + ++ +A SE          +N +    T+  T+ P    S 
Sbjct  106  IFYGGVVNVYDDIPADQAQAIMLIASSENYSGYPHTKVQNSTCRSQTELKTSLPVMKLSE  165

Query  709  SSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHN  816
             SG  +Q  A   + + RK +L RFL+KRK R+I N
Sbjct  166  ESGIHHQP-ASCKVHIGRKHSLQRFLKKRKERVIAN  200



>ref|XP_010419890.1| PREDICTED: protein TIFY 9-like isoform X2 [Camelina sativa]
Length=188

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 6/88 (7%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFYSG+VS +  +S  K E ++ +A    + +K  +   + +     TT  P      
Sbjct  107  MTIFYSGAVSVYQ-VSRNKAEEIMKVAKDTAVSKKDESSTETHLSVITPTTLRPKL----  161

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHR  804
            F QN   G + +AR+ +L RFLEKRK R
Sbjct  162  FGQNLE-GDLPIARRKSLQRFLEKRKER  188



>ref|XP_006836554.1| hypothetical protein AMTR_s00131p00047750 [Amborella trichopoda]
 gb|ERM99407.1| hypothetical protein AMTR_s00131p00047750 [Amborella trichopoda]
Length=241

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 18/112 (16%)
 Frame = +1

Query  532  PSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAP---  702
            P+ +TIFY+GSV+ F DI PEK + ++  A +     K     PS + + + ++++P   
Sbjct  75   PAQLTIFYNGSVNVFDDIPPEKAQAIMLFAAAGAASAK----TPSMLKSANVSSSSPPAL  130

Query  703  -------SSSSGSFYQNFAPGAIA----MARKATLARFLEKRKHRLIHNKAY  825
                   S++S +      P  +     +ARK +L RF EKR+ RL     Y
Sbjct  131  TRTPSFHSTTSAAPQPQIVPAKLQSELPIARKHSLQRFFEKRRDRLTSRSPY  182



>ref|XP_004144433.1| PREDICTED: protein TIFY 10B-like [Cucumis sativus]
 gb|KGN58456.1| hypothetical protein Csa_3G645940 [Cucumis sativus]
Length=209

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 44/95 (46%), Gaps = 12/95 (13%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFY G V  F+D+  E+ E ++ MAG                 ++   TTA S + G 
Sbjct  95   MTIFYDGKVLVFNDLPSERAEEIMAMAGK------------GIAPSSRSITTAVSDNGGE  142

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
                     + +AR+A+L RF EKRK R+     Y
Sbjct  143  QPLTKVSSDLPIARRASLHRFFEKRKDRVAARGPY  177



>ref|XP_004510528.1| PREDICTED: protein TIFY 11B-like [Cicer arietinum]
Length=233

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (47%), Gaps = 7/130 (5%)
 Frame = +1

Query  457  SALETLP-LLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEE  633
            SA+++LP L+     K+  I S       +TIFY+G +  F    PEK   ++ +A    
Sbjct  76   SAMDSLPQLVENPCIKKSNIRSTNSETPQLTIFYAGKMLVFDAFRPEKATEIMELATKLA  135

Query  634  IEEKRWNENPSFVYAT-----DETTTAPSSSSGSFYQNFAPGA-IAMARKATLARFLEKR  795
             E     ENP+    T     D     P ++  +  +N   G+ +   R+A+L +FLEKR
Sbjct  136  SENSSREENPTSAPITSEKLKDSKVPQPKTALETPRENQVIGSDMRYPRRASLLKFLEKR  195

Query  796  KHRLIHNKAY  825
            K R+I    Y
Sbjct  196  KERVISRGPY  205



>gb|KHG00833.1| Protein TIFY 10A -like protein [Gossypium arboreum]
Length=240

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 82/191 (43%), Gaps = 16/191 (8%)
 Frame = +1

Query  328  FGDLQPFRGASPTTASDGTPATN--DVNCFPRGFGA--AIPLNYGDDSALETLPLLPTSS  495
            FGDL    G +    ++GTP      +N FP    +      N G+   L ++ L P  +
Sbjct  38   FGDLS--LGMTCNVEANGTPVVPPPTMNLFPVNDKSDDVCGRNGGNPKNLTSMDLFPQQA  95

Query  496  WKRCEIPS-HQLAPST--MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPS  666
                +  S ++L P T  MTIFY G V  F+D    K + ++ +A +   +         
Sbjct  96   GLASKDDSPNKLEPQTSPMTIFYGGQVIVFNDFPANKAKEIMLLASNSSSQSNNSFNPIP  155

Query  667  FVYATDETT------TAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY-  825
            F  +   +         P+S      Q   PG + +AR+A+L RFLEKRK R+     Y 
Sbjct  156  FTSSIARSPIESSIGVPPTSKPVHPAQRAVPGDLPIARRASLHRFLEKRKDRITAKAPYQ  215

Query  826  LQDGKVLPDLS  858
            + +    P LS
Sbjct  216  INNSAAAPSLS  226



>ref|XP_010453379.1| PREDICTED: protein TIFY 9-like isoform X1 [Camelina sativa]
Length=198

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 50/95 (53%), Gaps = 6/95 (6%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFY+G+VS +  ++  K E ++ +A    + +K  +   + +     TT  P      
Sbjct  104  MTIFYNGTVSVYQ-VNRSKAEEIMKVAKDTAVSKKDESSTETDLSVITPTTLRPKL----  158

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            F QN   G + +AR+ +L RFLEKRK R++    Y
Sbjct  159  FGQNLE-GDLPIARRKSLLRFLEKRKERVVSTSPY  192



>ref|XP_003561990.1| PREDICTED: protein TIFY 10A-like [Brachypodium distachyon]
Length=204

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 64/158 (41%), Gaps = 31/158 (20%)
 Frame = +1

Query  358  SPTTASDGTPATNDVNCFPRGFGAAIPLNYGDDSALETLPLLPTSSWKRCEIPSHQLAP-  534
            SP    D  PA  D      GFGAA            T+ L P  +    +    ++ P 
Sbjct  38   SPAVTIDFMPAAAD------GFGAA-------PQERRTMELFPQQAGTLKDSQDLRMWPE  84

Query  535  -STMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSS  711
             + +TIFY G    F D   EK + +L +AGS E  +           A  E     +S 
Sbjct  85   KAQLTIFYGGRTMVFDDFPAEKAKELLQLAGSFEASD-----------AGSEPVNYHNSQ  133

Query  712  SGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            +  F        + MARKA+L RFLEKRK RL     Y
Sbjct  134  AEPFLSE-----MPMARKASLQRFLEKRKSRLAAADPY  166



>gb|AFL46165.1| jasmonate ZIM domain protein a [Nicotiana attenuata]
Length=205

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 56/120 (47%), Gaps = 11/120 (9%)
 Frame = +1

Query  466  ETLPLLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEK  645
            E+ P  P + + + E  S     + MTIFY G V  F+D   +K + ++ MA        
Sbjct  66   ESNPQKPMNLFPQTEAKSES-EKAQMTIFYGGQVIVFNDFPADKAKEIMLMASCA-----  119

Query  646  RWNENPSFVYATDETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            + N N     +T +      S+     Q    G + +AR+A+L RFLEKRK RLI    Y
Sbjct  120  KGNNN-----STTQIQKTAESALDLVPQPIISGDLPIARRASLTRFLEKRKDRLIAKAPY  174



>ref|XP_006399812.1| hypothetical protein EUTSA_v10014724mg [Eutrema salsugineum]
 gb|ESQ41265.1| hypothetical protein EUTSA_v10014724mg [Eutrema salsugineum]
Length=197

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 51/107 (48%), Gaps = 10/107 (9%)
 Frame = +1

Query  514  PSHQLAPST--MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE  687
            PS +L   T  MTIFY+G VS F  +S  K + +L +A     ++    E        D 
Sbjct  95   PSTELVSGTVPMTIFYNGKVSVFQ-VSRNKADDILKVAMETATKKDTSMEK-------DL  146

Query  688  TTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYL  828
            +   P++     +     G + +AR+ +L RFLEKRK RL+    Y 
Sbjct  147  SVIPPTTLRPKLFGQNLEGDLPIARRKSLQRFLEKRKERLVSTSPYF  193



>ref|XP_008392032.1| PREDICTED: protein TIFY 3B-like [Malus domestica]
Length=210

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 18/117 (15%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNEN-------PSFVYATDE  687
            AP+ +TIFY+GSVS F  I+ EKV  ++ +A +   ++K  +         PS +  T  
Sbjct  51   APAQLTIFYAGSVSVFDAITAEKVRELMLIAAAAAADKKTSDVKNSATSCPPSPLIRTGS  110

Query  688  TTTAPSSSS-GSFYQNFAP----------GAIAMARKATLARFLEKRKHRLIHNKAY  825
            +T   SS++ GS      P              +AR+ +L RFLEKR+ R++ N  Y
Sbjct  111  STLQXSSTAPGSPVVQPXPEQNSSICKLQAEFPIARRHSLQRFLEKRRDRMVSNSPY  167



>ref|XP_003611394.1| Protein TIFY 10A [Medicago truncatula]
Length=170

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 59/118 (50%), Gaps = 8/118 (7%)
 Frame = +1

Query  463  LETLPLLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEE  642
            L+ +P+L  SS  +  I   +   + MTI Y G V  F D+  +K + ++  + ++ I  
Sbjct  14   LQEIPILGNSSVMKANIKKEEPKCAQMTILYDGKVIVFDDVPADKAKDIMDFS-TKGITS  72

Query  643  KRWNENPSFVYATDETTTAPSSSSGSFYQNFAPGAI---AMARKATLARFLEKRKHRL  807
               + N ++ Y+    +    +S    YQ  +  AI    M RKA+L RFLEKRK R+
Sbjct  73   TSQHHNNNYAYS----SFLARNSLQDCYQVPSIPAIYDLPMTRKASLHRFLEKRKDRI  126



>ref|XP_010318654.1| PREDICTED: protein TIFY 6B isoform X2 [Solanum lycopersicum]
Length=378

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  703  SSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDLS  858
            +SS GSF  +  P A+  ARKA+LARFLEKRK R+I    Y  + K  P+ S
Sbjct  301  TSSVGSFPASLVPSAVPQARKASLARFLEKRKERVISASPYPLNSKQSPECS  352



>ref|XP_004235771.1| PREDICTED: protein TIFY 6B isoform X1 [Solanum lycopersicum]
Length=390

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  703  SSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDLS  858
            +SS GSF  +  P A+  ARKA+LARFLEKRK R+I    Y  + K  P+ S
Sbjct  313  TSSVGSFPASLVPSAVPQARKASLARFLEKRKERVISASPYPLNSKQSPECS  364



>dbj|BAG68657.1| jasmonate ZIM-domain protein 3 [Nicotiana tabacum]
Length=207

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 16/127 (13%)
 Frame = +1

Query  445  YGDDSALETLPLLPTSSWKRCEIPSHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGMAG  624
            +G+ +  +++ L P +  K       +   + MTIFY G V  F+D   +K + ++ MA 
Sbjct  66   FGESNPQKSMNLFPQTEAK------SEPEKAQMTIFYGGQVIVFNDFPADKAKEIMLMAS  119

Query  625  SEEIEEKRWNENPSFVYATDETTTAPSSSSGSFYQNFAPGAIAMARKATLARFLEKRKHR  804
              +      N N     AT    TA S+S     Q    G + +AR+A+L RFLEKRK R
Sbjct  120  CTQ-----GNNN----CATQIQKTAESASD-LVPQPIISGDLPIARRASLTRFLEKRKDR  169

Query  805  LIHNKAY  825
            L     Y
Sbjct  170  LTAKAPY  176



>ref|XP_002871554.1| hypothetical protein ARALYDRAFT_488138 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47813.1| hypothetical protein ARALYDRAFT_488138 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 6/95 (6%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFY+G+VS F  +S  K + ++ +A +E    K  +   + +     TT  P+     
Sbjct  105  MTIFYNGTVSVFQ-VSRNKADEIMKVA-TETASRKDESSMETDLSVIPPTTLRPTKL---  159

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            F QN   G + +AR+ +L RFLEKRK RL+    Y
Sbjct  160  FGQNLE-GDLPIARRKSLQRFLEKRKERLVSTSPY  193



>ref|XP_004310129.1| PREDICTED: protein TIFY 9-like [Fragaria vesca subsp. vesca]
Length=191

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 49/92 (53%), Gaps = 11/92 (12%)
 Frame = +1

Query  532  PSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSS  711
            P  MT+FY GSV+ F +++PEK E ++ +A  E+ +  R  + P      +       + 
Sbjct  98   PKPMTVFYGGSVAVF-EVTPEKFESIVKLAMEEKFKAARAADRPQ-----ESKQQQLVNV  151

Query  712  SGSFYQNFAPGAIAMARKATLARFLEKRKHRL  807
             G   ++     + +AR+ +L RFLEKRK RL
Sbjct  152  DGPLNED-----LPIARRKSLQRFLEKRKERL  178



>ref|XP_004243696.1| PREDICTED: protein TIFY 10A-like [Solanum lycopersicum]
Length=216

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 51/110 (46%), Gaps = 11/110 (10%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSS  714
            + MTIFY G V  F+D   +K + ++ MA + +        NP+    +      PS   
Sbjct  90   AQMTIFYGGQVIVFNDFPADKAKEIMLMASTSK------GNNPAKPLESAADLVVPSFGK  143

Query  715  GSFYQNFAPGA-----IAMARKATLARFLEKRKHRLIHNKAYLQDGKVLP  849
             S  +N  P       + +AR+A+L RFLEKRK RL     Y ++    P
Sbjct  144  TSIQENQMPNQPIVSDLPIARRASLTRFLEKRKDRLTAKVPYHREEAAAP  193



>ref|XP_009793297.1| PREDICTED: protein TIFY 10A-like [Nicotiana sylvestris]
Length=207

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 47/95 (49%), Gaps = 10/95 (11%)
 Frame = +1

Query  541  MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSSGS  720
            MTIFY G V  F+D   +K + ++ MA        + N N     AT    TA S+S   
Sbjct  92   MTIFYGGQVIVFNDFPADKAKEIMLMASCT-----KGNNN----CATQIQKTAESASD-L  141

Query  721  FYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
              Q    G + +AR+A+L RFLEKRK RL     Y
Sbjct  142  VPQPIISGDLPIARRASLTRFLEKRKDRLTAKAPY  176



>emb|CBI27776.3| unnamed protein product [Vitis vinifera]
Length=217

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 78/174 (45%), Gaps = 45/174 (26%)
 Frame = +1

Query  379  GTPATN----DVNCFPR--GFGAAIPLNYGDDSALETLPLLPTSSWKRCEIPSHQLAPST  540
            G PA N     +N FP+  GFG+++     DD+     P +  SS K+    S  + P T
Sbjct  37   GIPARNMNLKSMNLFPQQAGFGSSV---SKDDA-----PKIVNSSVKK----SGNVEPQT  84

Query  541  --MTIFYSGSVSAFHDISPEKVELVLGMA--GSEEIEEKRWNENPSFVYATDETTTAPSS  708
              MTIFY G V  F+D   +K + V+ +A  GS  +      +NP      D    APS+
Sbjct  85   AQMTIFYGGQVIVFNDFPADKAKEVMRLAGMGSSPVPSTTV-KNP-----IDAGGMAPSN  138

Query  709  SSGSFYQNFAPGAIA---------------MARKATLARFLEKRKHRLIHNKAY  825
               +   NFA   I                +ARKA+L RFLEKRK R+     Y
Sbjct  139  P--NVVPNFANSLIQERIQRPAQPVACELPIARKASLHRFLEKRKDRITARAPY  190



>ref|NP_001275246.1| uncharacterized protein LOC102589610 [Solanum tuberosum]
 dbj|BAD04851.1| hypothetical protein [Solanum tuberosum]
Length=390

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  703  SSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDLS  858
            +SS GSF  +  P A+  ARKA+LARFLEKRK R+I    Y  + K  P+ S
Sbjct  313  ASSIGSFPASLVPSAVPQARKASLARFLEKRKERVISASPYPPNSKQSPECS  364



>ref|XP_007041242.1| Jasmonate-zim-domain protein 12, putative isoform 2 [Theobroma 
cacao]
 gb|EOX97073.1| Jasmonate-zim-domain protein 12, putative isoform 2 [Theobroma 
cacao]
Length=255

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 52/97 (54%), Gaps = 5/97 (5%)
 Frame = +1

Query  535  STMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDETTTAPSSSS  714
            + +TIFY+G+++ + ++  +K + ++ +AG   + +   NE P     TD  T  P  + 
Sbjct  111  AQLTIFYAGAINVYDNVPTDKAQAIMLLAGESSLSKPIANEKPR----TDAKTPLPPPNV  166

Query  715  GSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
             S  +      + +ARK +L  FL KR+HR+ +N  Y
Sbjct  167  ESSCK-LQAADLPIARKISLQHFLAKRRHRIGNNSPY  202



>dbj|BAD04852.2| hypothetical protein [Nicotiana benthamiana]
Length=380

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  703  SSSSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYLQDGKVLPDLSL*YGN  873
            SSS GS    F P A+  ARKA+LARFLEKRK R+I    Y   G+     +L YG+
Sbjct  302  SSSIGSVPATFVPSAVPQARKASLARFLEKRKERVISASPYDNSGQSPECSTLRYGS  358



>gb|KHG27959.1| Protein TIFY 10A -like protein [Gossypium arboreum]
Length=233

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 55/117 (47%), Gaps = 17/117 (15%)
 Frame = +1

Query  529  APSTMTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYAT-DETTTAPS  705
            A + MTIFY G V  F+D   +K + ++ +A     E  + N   +FV  + +E+     
Sbjct  96   AAAPMTIFYCGQVIVFNDFPADKAKEIMALASKCSSENPKTN---TFVPGSPNESGLGVH  152

Query  706  SSSGSFYQNF-------------APGAIAMARKATLARFLEKRKHRLIHNKAYLQDG  837
            S+S     N               PG + +AR+A+L RFLEKRK R+     Y  +G
Sbjct  153  SNSNDQVPNIRTNVSTSRECVRPIPGDLPIARRASLHRFLEKRKDRITSKAPYPING  209



>gb|AFK43102.1| unknown [Lotus japonicus]
Length=165

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 56/113 (50%), Gaps = 14/113 (12%)
 Frame = +1

Query  529  APST-MTIFYSGSVSAFHDISPEKVE-LVLGMAGSEEIEEKRWNENPSFVYATDE-----  687
            APS  +TIFY+G+V+ F DIS EK + ++L  AG+          + S   +TDE     
Sbjct  41   APSAPLTIFYAGTVNVFDDISAEKAQAIMLLAAGNVLFGASSTAHSGSGSTSTDEFLAAK  100

Query  688  TTTAPSS-------SSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAY  825
            TT  P++                   A+  ARKA+ ARFLEKRK R ++   Y
Sbjct  101  TTGVPTAPVSIVEPRKAVTAATMLTSAVPQARKASSARFLEKRKERAMNAAPY  153



>gb|KFK25560.1| hypothetical protein AALP_AA8G130600 [Arabis alpina]
Length=203

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 11/109 (10%)
 Frame = +1

Query  514  PSHQLAPST--MTIFYSGSVSAFHDISPEKVELVLGMAGSEEIEEKRWNENPSFVYATDE  687
            PS ++   T  MTIFY+GSVS F  +S  K E ++ +     + E   ++    +   D 
Sbjct  97   PSTEIVTGTIPMTIFYNGSVSVFQ-VSRNKAENIMKV-----VMETASSKKEKAIMEKDL  150

Query  688  TTTAPSS--SSGSFYQNFAPGAIAMARKATLARFLEKRKHRLIHNKAYL  828
            +   P++   +  F QN   G + +AR+ +L RFLEKRK R++    Y 
Sbjct  151  SVIPPTTLRPTKLFGQNLE-GDLPIARRKSLQRFLEKRKERVVSTSPYF  198



>gb|KFK26308.1| hypothetical protein AALP_AA8G230800 [Arabis alpina]
Length=196

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 19/126 (15%)
 Frame = +1

Query  499  KRCEIP-SHQLAPSTMTIFYSGSVSAFHDISPEKVELVLGM--AGSEEIEEKR-------  648
            +  EIP +  + P+  TIF+ G+VS F  IS EK++ + G+  A ++ IE K        
Sbjct  48   RSTEIPNASTVLPTQFTIFFGGNVSVFEGISAEKIQEIFGIAAAAAKSIETKNSKNISPV  107

Query  649  ----WNENPSFVYATDETTTAPSSSS---GSFYQNFAPGAIAMARKATLARFLEKRKHRL  807
                 N  PSF   +   + A  S +    SF ++ A   + +AR+ +L RFLEKR+ RL
Sbjct  108  TSPALNRAPSFSSTSTAASPAAQSFTMQPMSFCRSAAD--LPIARRHSLQRFLEKRRDRL  165

Query  808  IHNKAY  825
            ++   Y
Sbjct  166  VNKNPY  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426