BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14292_g2_i1 len=745 path=[667:0-744]

Length=745
                                                                      Score     E

ref|XP_004252000.2|  PREDICTED: serine carboxypeptidase-like 7          189   7e-53   
ref|XP_006343161.1|  PREDICTED: serine carboxypeptidase-like 18-l...    188   8e-53   
ref|XP_006343160.1|  PREDICTED: serine carboxypeptidase-like 18-l...    188   1e-52   
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               187   4e-52   
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          183   1e-50   Vitis vinifera
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    183   1e-50   
emb|CBI19380.3|  unnamed protein product                                183   2e-50   
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    181   4e-50   
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    181   7e-50   
dbj|BAF99698.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    181   1e-49   Gentiana triflora
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         180   1e-49   
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         177   1e-48   
gb|KHN47358.1|  ABC transporter B family member 9                       182   3e-48   
ref|XP_010556476.1|  PREDICTED: serine carboxypeptidase-like 18 i...    176   4e-48   
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    176   5e-48   
ref|XP_010556475.1|  PREDICTED: serine carboxypeptidase-like 18 i...    175   5e-48   
ref|XP_010556472.1|  PREDICTED: serine carboxypeptidase-like 18 i...    176   6e-48   
ref|XP_010556474.1|  PREDICTED: serine carboxypeptidase-like 18 i...    175   6e-48   
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          175   7e-48   
ref|XP_010556473.1|  PREDICTED: serine carboxypeptidase-like 18 i...    175   8e-48   
ref|XP_003604928.1|  Serine carboxypeptidase                            175   8e-48   
gb|KFK25883.1|  hypothetical protein AALP_AA8G174700                    174   1e-47   
ref|XP_007138067.1|  hypothetical protein PHAVU_009G177800g             175   2e-47   
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    174   2e-47   
emb|CDP21040.1|  unnamed protein product                                174   3e-47   
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    178   4e-47   
ref|XP_010321496.1|  PREDICTED: serine carboxypeptidase-like 13 i...    173   5e-47   
ref|XP_003604932.1|  Serine carboxypeptidase                            172   6e-47   
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               172   9e-47   
dbj|BAF99697.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    172   1e-46   Gentiana triflora
ref|XP_003604931.1|  Serine carboxypeptidase                            172   1e-46   
gb|AFK49380.1|  unknown                                                 172   1e-46   
ref|XP_009126133.1|  PREDICTED: serine carboxypeptidase-like 3 is...    169   2e-46   
ref|XP_004292764.1|  PREDICTED: serine carboxypeptidase-like 18-like    172   2e-46   
gb|KHN06942.1|  Serine carboxypeptidase-like 19                         172   2e-46   
ref|XP_009126131.1|  PREDICTED: serine carboxypeptidase-like 3 is...    169   2e-46   
ref|NP_001242803.1|  uncharacterized protein LOC100794342               172   2e-46   
gb|AES73172.2|  1-O-acylglucose:anthocyanin acyltransferase             172   3e-46   
dbj|BAO04182.1|  hypothetical protein                                   171   6e-46   
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          171   6e-46   Clitoria ternatea
ref|XP_009768014.1|  PREDICTED: serine carboxypeptidase-like 17         170   7e-46   
gb|AES87127.2|  1-O-acylglucose:anthocyanin acyltransferase             169   1e-45   
emb|CDX85493.1|  BnaA02g03200D                                          169   1e-45   
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    169   1e-45   
dbj|BAF99695.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          169   1e-45   Clitoria ternatea
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             169   1e-45   
gb|KEH36682.1|  1-O-acylglucose:anthocyanin acyltransferase             167   2e-45   
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           169   2e-45   
ref|XP_006356867.1|  PREDICTED: serine carboxypeptidase-like 19-like    172   3e-45   
ref|XP_007136774.1|  hypothetical protein PHAVU_009G072900g             168   3e-45   
ref|XP_009131551.1|  PREDICTED: serine carboxypeptidase-like 7 is...    168   3e-45   
emb|CDP01265.1|  unnamed protein product                                168   4e-45   
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    168   4e-45   
ref|XP_010321495.1|  PREDICTED: serine carboxypeptidase-like 13 i...    167   5e-45   
ref|XP_006356850.1|  PREDICTED: serine carboxypeptidase-like 18-like    168   6e-45   
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   167   7e-45   
gb|AES87126.2|  1-O-acylglucose:anthocyanin acyltransferase             171   7e-45   
gb|KEH29042.1|  1-O-acylglucose:anthocyanin acyltransferase             171   7e-45   
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             167   8e-45   
emb|CBI22424.3|  unnamed protein product                                168   9e-45   
emb|CDY38096.1|  BnaC02g06770D                                          167   9e-45   
ref|XP_003604929.1|  Serine carboxypeptidase                            171   9e-45   
ref|XP_002265842.1|  PREDICTED: serine carboxypeptidase-like 18         167   9e-45   Vitis vinifera
ref|XP_010472296.1|  PREDICTED: serine carboxypeptidase-like 11 i...    166   2e-44   
ref|XP_003593861.1|  Serine carboxypeptidase family protein             166   2e-44   
emb|CDX78700.1|  BnaA03g06120D                                          166   2e-44   
ref|XP_003604930.1|  Serine carboxypeptidase family protein             170   3e-44   
gb|KHG16860.1|  Serine carboxypeptidase-like 19                         163   3e-44   
emb|CDX70702.1|  BnaC03g07860D                                          165   4e-44   
ref|XP_010461188.1|  PREDICTED: serine carboxypeptidase-like 18         165   5e-44   
ref|XP_010320344.1|  PREDICTED: serine carboxypeptidase-like 10 i...    163   5e-44   
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    165   6e-44   
gb|KCW68631.1|  hypothetical protein EUGRSUZ_F02236                     164   7e-44   
ref|XP_010320343.1|  PREDICTED: serine carboxypeptidase-like 10 i...    164   7e-44   
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          164   9e-44   
ref|XP_010320338.1|  PREDICTED: serine carboxypeptidase-like 17 i...    164   9e-44   
ref|XP_006415267.1|  hypothetical protein EUTSA_v10007571mg             164   1e-43   
ref|NP_850033.1|  serine carboxypeptidase-like 12                       163   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520964.1|  PREDICTED: serine carboxypeptidase-like 11-like    164   1e-43   
emb|CDP01267.1|  unnamed protein product                                164   1e-43   
ref|NP_179876.1|  serine carboxypeptidase-like 12                       163   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077945.1|  serine carboxypeptidase-like 11                    163   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179880.1|  serine carboxypeptidase-like 11                       163   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010320342.1|  PREDICTED: serine carboxypeptidase-like 10 i...    163   2e-43   
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    164   2e-43   
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             164   2e-43   
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   164   2e-43   
ref|XP_010320337.1|  PREDICTED: serine carboxypeptidase-like 13 i...    163   2e-43   
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    167   2e-43   
emb|CDP21038.1|  unnamed protein product                                164   2e-43   
ref|XP_010429230.1|  PREDICTED: serine carboxypeptidase-like 11 i...    162   2e-43   
ref|XP_010429241.1|  PREDICTED: serine carboxypeptidase-like 10 i...    160   3e-43   
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    162   3e-43   
gb|AES87130.2|  1-O-acylglucose:anthocyanin acyltransferase             163   3e-43   
ref|XP_003604927.1|  Serine carboxypeptidase                            164   5e-43   
ref|XP_003604933.1|  Serine carboxypeptidase                            161   1e-42   
ref|XP_010556471.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    160   1e-42   
gb|KHN45135.1|  Serine carboxypeptidase-like 19                         161   1e-42   
ref|XP_010429242.1|  PREDICTED: serine carboxypeptidase-like 10 i...    160   2e-42   
ref|XP_006581276.1|  PREDICTED: serine carboxypeptidase-like 19-l...    161   2e-42   
ref|XP_010429239.1|  PREDICTED: serine carboxypeptidase-like 10 i...    160   2e-42   
ref|NP_565546.3|  sinapoylglucose:malate sinapoyltransferase            157   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KEH29044.1|  1-O-acylglucose:anthocyanin acyltransferase             160   2e-42   
emb|CAN74923.1|  hypothetical protein VITISV_038590                     161   2e-42   Vitis vinifera
ref|NP_001154529.1|  sinapoylglucose:malate sinapoyltransferase         157   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342727.1|  PREDICTED: uncharacterized protein LOC102585123    164   3e-42   
emb|CDP06925.1|  unnamed protein product                                160   3e-42   
ref|XP_010472298.1|  PREDICTED: serine carboxypeptidase-like 10 i...    160   3e-42   
ref|XP_009393004.1|  PREDICTED: serine carboxypeptidase-like 2          160   3e-42   
ref|XP_006403280.1|  hypothetical protein EUTSA_v10003211mg             159   6e-42   
ref|XP_010108032.1|  Serine carboxypeptidase-like 7                     162   7e-42   
ref|XP_006303239.1|  hypothetical protein CARUB_v10012575mg             159   8e-42   
ref|XP_006403281.1|  hypothetical protein EUTSA_v10003211mg             158   9e-42   
ref|XP_009395245.1|  PREDICTED: serine carboxypeptidase-like 12         159   1e-41   
ref|XP_006415266.1|  hypothetical protein EUTSA_v10007559mg             159   1e-41   
ref|XP_010429236.1|  PREDICTED: serine carboxypeptidase-like 12 i...    155   1e-41   
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         158   1e-41   Vitis vinifera
ref|XP_002510077.1|  serine carboxypeptidase, putative                  158   2e-41   Ricinus communis
ref|NP_850036.1|  sinapoylglucose:malate sinapoyltransferase            157   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973516.2|  sinapoylglucose:malate sinapoyltransferase            157   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KHN45449.1|  Serine carboxypeptidase-like 11                         157   2e-41   
gb|AAC17816.2|  putative serine carboxypeptidase I                      157   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850035.1|  sinapoylglucose:malate sinapoyltransferase            157   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415268.1|  hypothetical protein EUTSA_v10007570mg             157   3e-41   
ref|XP_010499905.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    157   3e-41   
ref|NP_850034.1|  sinapoylglucose:malate sinapoyltransferase            157   4e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CDP06924.1|  unnamed protein product                                157   4e-41   
emb|CDP01266.1|  unnamed protein product                                157   5e-41   
ref|XP_006295774.1|  hypothetical protein CARUB_v10024896mg             156   5e-41   
ref|XP_010320339.1|  PREDICTED: serine carboxypeptidase-like 10 i...    156   6e-41   
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    157   6e-41   
ref|XP_006342726.1|  PREDICTED: serine carboxypeptidase-like 11-like    156   7e-41   
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    156   8e-41   
ref|XP_006472315.1|  PREDICTED: serine carboxypeptidase-like 18-l...    156   9e-41   
ref|XP_009133996.1|  PREDICTED: serine carboxypeptidase-like 10 i...    153   9e-41   
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    160   9e-41   
ref|XP_006855958.1|  hypothetical protein AMTR_s00037p00227730          157   9e-41   
gb|KFK38585.1|  hypothetical protein AALP_AA3G132800                    155   9e-41   
ref|XP_010556480.1|  PREDICTED: serine carboxypeptidase-like 1          155   1e-40   
ref|XP_008337031.1|  PREDICTED: serine carboxypeptidase-like 18         155   1e-40   
ref|XP_002510076.1|  serine carboxypeptidase, putative                  155   1e-40   Ricinus communis
ref|XP_009103431.1|  PREDICTED: serine carboxypeptidase-like 10         155   1e-40   
ref|XP_010429234.1|  PREDICTED: serine carboxypeptidase-like 12 i...    155   1e-40   
ref|XP_006354895.1|  PREDICTED: serine carboxypeptidase-like 18-like    155   2e-40   
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    155   2e-40   
ref|XP_010429235.1|  PREDICTED: serine carboxypeptidase-like 12 i...    155   2e-40   
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         155   2e-40   
ref|XP_010320340.1|  PREDICTED: serine carboxypeptidase-like 13 i...    155   2e-40   
ref|XP_002878651.1|  hypothetical protein ARALYDRAFT_900758             154   2e-40   
ref|XP_002878650.1|  hypothetical protein ARALYDRAFT_481168             154   3e-40   
emb|CDX73832.1|  BnaA03g32150D                                          154   3e-40   
ref|XP_004486284.1|  PREDICTED: serine carboxypeptidase-like 12-like    155   3e-40   
ref|XP_011006023.1|  PREDICTED: serine carboxypeptidase-like 3 is...    155   3e-40   
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             154   4e-40   
ref|XP_002878643.1|  SCPL12                                             153   5e-40   
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   154   5e-40   
ref|XP_009135216.1|  PREDICTED: serine carboxypeptidase-like 15         154   6e-40   
ref|XP_008644916.1|  PREDICTED: serine carboxypeptidase-like 18 i...    154   7e-40   
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         154   8e-40   
ref|NP_174619.1|  serine carboxypeptidase-like 18                       153   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486654.1|  PREDICTED: serine carboxypeptidase-like 7 is...    151   8e-40   
emb|CDY21472.1|  BnaC03g27250D                                          153   9e-40   
sp|Q9C7Z9.2|SCP18_ARATH  RecName: Full=Serine carboxypeptidase-li...    153   9e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133997.1|  PREDICTED: serine carboxypeptidase-like 10 i...    153   1e-39   
ref|XP_008644915.1|  PREDICTED: serine carboxypeptidase-like 2 is...    154   1e-39   
ref|XP_009133994.1|  PREDICTED: serine carboxypeptidase-like 10 i...    153   1e-39   
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    153   1e-39   
ref|XP_006840208.1|  hypothetical protein AMTR_s00089p00130140          150   2e-39   
ref|XP_002878648.1|  SCPL11                                             152   2e-39   
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                152   3e-39   
ref|XP_003525944.2|  PREDICTED: serine carboxypeptidase-like 19-l...    152   3e-39   
ref|XP_011030310.1|  PREDICTED: serine carboxypeptidase-like 18 i...    152   4e-39   
ref|XP_004960851.1|  PREDICTED: serine carboxypeptidase-like 19-like    151   5e-39   
ref|XP_006399444.1|  hypothetical protein EUTSA_v10016050mg             151   5e-39   
ref|XP_010417054.1|  PREDICTED: serine carboxypeptidase-like 9          151   5e-39   
emb|CDX76889.1|  BnaC08g34750D                                          151   5e-39   
ref|NP_179883.1|  sinapoylglucose:anthocyanin sinapoyltransferase       151   5e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CBI22420.3|  unnamed protein product                                152   5e-39   
ref|XP_010486652.1|  PREDICTED: serine carboxypeptidase-like 7 is...    151   6e-39   
ref|XP_010472297.1|  PREDICTED: serine carboxypeptidase-like 11 i...    150   7e-39   
ref|XP_010486651.1|  PREDICTED: serine carboxypeptidase-like 7 is...    151   7e-39   
ref|XP_010314652.1|  PREDICTED: serine carboxypeptidase-like 11         152   8e-39   
emb|CDY52618.1|  BnaCnng22970D                                          150   1e-38   
emb|CDP17360.1|  unnamed protein product                                151   1e-38   
ref|XP_009117321.1|  PREDICTED: serine carboxypeptidase-like 10 i...    150   1e-38   
ref|XP_011030307.1|  PREDICTED: serine carboxypeptidase-like 18 i...    150   1e-38   
ref|XP_003560245.1|  PREDICTED: serine carboxypeptidase-like 18         150   2e-38   
ref|XP_006418601.1|  hypothetical protein EUTSA_v10002783mg             149   2e-38   
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         150   2e-38   
ref|XP_009140442.1|  PREDICTED: serine carboxypeptidase-like 13 i...    150   2e-38   
ref|XP_009140440.1|  PREDICTED: serine carboxypeptidase-like 13 i...    149   2e-38   
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          150   2e-38   
ref|NP_177471.1|  serine carboxypeptidase-like 3                        149   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009612206.1|  PREDICTED: serine carboxypeptidase-like 18 i...    148   2e-38   
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    153   2e-38   
ref|XP_006663388.1|  PREDICTED: serine carboxypeptidase-like 18-like    150   3e-38   
ref|XP_006294243.1|  hypothetical protein CARUB_v10023242mg             149   3e-38   
ref|XP_010474419.1|  PREDICTED: serine carboxypeptidase-like 9          149   3e-38   
ref|XP_010065879.1|  PREDICTED: serine carboxypeptidase-like 13         149   3e-38   
emb|CDY50564.1|  BnaA01g30780D                                          149   3e-38   
ref|XP_006597032.1|  PREDICTED: uncharacterized protein LOC100794...    149   3e-38   
ref|NP_001030669.1|  serine carboxypeptidase-like 7                     148   4e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KDP44531.1|  hypothetical protein JCGZ_16364                         150   4e-38   
ref|XP_010936156.1|  PREDICTED: serine carboxypeptidase-like 18         147   4e-38   
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    149   4e-38   
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                149   5e-38   
ref|XP_010429238.1|  PREDICTED: serine carboxypeptidase-like 9          148   5e-38   
emb|CDY49438.1|  BnaA09g42290D                                          148   5e-38   
ref|XP_002298786.2|  hypothetical protein POPTR_0001s29870g             149   5e-38   Populus trichocarpa [western balsam poplar]
ref|NP_187656.1|  serine carboxypeptidase-like 7                        148   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146839.1|  PREDICTED: serine carboxypeptidase-like 7 is...    146   6e-38   
ref|XP_003576949.1|  PREDICTED: serine carboxypeptidase-like 18 i...    149   6e-38   
ref|XP_002882669.1|  hypothetical protein ARALYDRAFT_478377             148   7e-38   
ref|XP_006472317.1|  PREDICTED: serine carboxypeptidase-like 18-l...    148   7e-38   
ref|XP_009122528.1|  PREDICTED: serine carboxypeptidase-like 19         148   7e-38   
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   147   8e-38   
ref|XP_010429231.1|  PREDICTED: serine carboxypeptidase-like 11 i...    147   8e-38   
ref|XP_010464719.1|  PREDICTED: serine carboxypeptidase-like 7 is...    147   8e-38   
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    148   8e-38   
ref|XP_009388678.1|  PREDICTED: serine carboxypeptidase-like 18         148   9e-38   
emb|CDY08603.1|  BnaA05g28390D                                          147   1e-37   
ref|XP_006369725.1|  hypothetical protein POPTR_0001s29900g             147   1e-37   
ref|XP_010939017.1|  PREDICTED: serine carboxypeptidase-like 12 i...    148   1e-37   
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         148   1e-37   
ref|XP_009104819.1|  PREDICTED: serine carboxypeptidase-like 2 is...    147   1e-37   
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    148   1e-37   
ref|XP_010464717.1|  PREDICTED: serine carboxypeptidase-like 7 is...    147   1e-37   
ref|XP_006296372.1|  hypothetical protein CARUB_v10025545mg             147   1e-37   
ref|XP_009135217.1|  PREDICTED: serine carboxypeptidase-like 14         147   1e-37   
ref|XP_006415429.1|  hypothetical protein EUTSA_v10007675mg             147   2e-37   
ref|XP_009784017.1|  PREDICTED: serine carboxypeptidase-like 7 is...    147   2e-37   
emb|CDX89533.1|  BnaC04g35520D                                          147   2e-37   
ref|XP_006301868.1|  hypothetical protein CARUB_v10022339mg             147   2e-37   
ref|XP_009104821.1|  PREDICTED: serine carboxypeptidase-like 2 is...    147   2e-37   
emb|CDY59210.1|  BnaA09g54030D                                          147   2e-37   
ref|XP_002459781.1|  hypothetical protein SORBIDRAFT_02g010510          147   2e-37   Sorghum bicolor [broomcorn]
ref|XP_010936146.1|  PREDICTED: serine carboxypeptidase-like 18 i...    146   2e-37   
ref|XP_010464978.1|  PREDICTED: serine carboxypeptidase-like 14         146   2e-37   
gb|AAQ91191.1|  1-O-sinapoylglucose:choline sinapoyltransferase         147   2e-37   Brassica napus [oilseed rape]
ref|NP_001067796.1|  Os11g0432900                                       147   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008236287.1|  PREDICTED: serine carboxypeptidase-like 13         147   2e-37   
ref|XP_009104820.1|  PREDICTED: serine carboxypeptidase-like 2 is...    146   2e-37   
emb|CDY00943.1|  BnaC05g42570D                                          146   2e-37   
ref|XP_010936154.1|  PREDICTED: serine carboxypeptidase-like 18         147   3e-37   
gb|ABR16352.1|  unknown                                                 147   3e-37   Picea sitchensis
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    147   3e-37   
ref|XP_010509542.1|  PREDICTED: serine carboxypeptidase-like 9 is...    146   3e-37   
gb|EEE52047.1|  hypothetical protein OsJ_33777                          147   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010556479.1|  PREDICTED: serine carboxypeptidase-like 19         146   3e-37   
ref|XP_010238599.1|  PREDICTED: serine carboxypeptidase-like 3          147   3e-37   
ref|XP_010472301.1|  PREDICTED: serine carboxypeptidase-like 9 is...    147   3e-37   
ref|XP_010472300.1|  PREDICTED: serine carboxypeptidase-like 9 is...    146   3e-37   
ref|XP_004956082.1|  PREDICTED: serine carboxypeptidase-like 19-like    146   4e-37   
gb|EEC68090.1|  hypothetical protein OsI_35963                          147   4e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_001149249.1|  serine carboxypeptidase 1 precursor                147   4e-37   Zea mays [maize]
gb|ACF84666.1|  unknown                                                 147   4e-37   Zea mays [maize]
ref|NP_001067860.1|  Os11g0460800                                       146   4e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CDY22581.1|  BnaC05g24190D                                          146   4e-37   
ref|XP_009120822.1|  PREDICTED: serine carboxypeptidase-like 15 i...    145   5e-37   
emb|CAM91989.1|  sinapoylglucose:choline sinapoyltransferase            146   5e-37   
ref|XP_009146838.1|  PREDICTED: serine carboxypeptidase-like 7 is...    145   5e-37   
ref|XP_007199818.1|  hypothetical protein PRUPE_ppa005264mg             145   5e-37   
dbj|BAJ85413.1|  predicted protein                                      146   5e-37   
ref|XP_007134008.1|  hypothetical protein PHAVU_010G011400g             146   5e-37   
ref|XP_006399445.1|  hypothetical protein EUTSA_v10015495mg             145   6e-37   
ref|XP_010509548.1|  PREDICTED: serine carboxypeptidase-like 9 is...    145   6e-37   
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             145   6e-37   
ref|XP_006294239.1|  hypothetical protein CARUB_v10023237mg             145   6e-37   
emb|CAM91988.1|  sinapoylglucose:choline sinapoyltransferase            145   7e-37   Brassica oleracea var. medullosa [marrow-stem kale]
ref|XP_009125363.1|  PREDICTED: serine carboxypeptidase-like 19         145   7e-37   
ref|XP_010509547.1|  PREDICTED: serine carboxypeptidase-like 9 is...    145   8e-37   
ref|XP_007199819.1|  hypothetical protein PRUPE_ppa005264mg             145   8e-37   
ref|XP_010936145.1|  PREDICTED: serine carboxypeptidase-like 18 i...    144   8e-37   
ref|XP_009139973.1|  PREDICTED: serine carboxypeptidase-like 13 i...    144   8e-37   
gb|AFW69058.1|  hypothetical protein ZEAMMB73_415108                    144   9e-37   
gb|KFK38434.1|  hypothetical protein AALP_AA3G112800                    144   9e-37   
ref|XP_004983497.1|  PREDICTED: serine carboxypeptidase-like 18-like    145   1e-36   
ref|XP_011030308.1|  PREDICTED: serine carboxypeptidase-like 18 i...    145   1e-36   
ref|XP_009122530.1|  PREDICTED: serine carboxypeptidase-like 19         145   1e-36   
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         145   1e-36   
ref|XP_006297708.1|  hypothetical protein CARUB_v10013737mg             144   1e-36   
ref|XP_004292112.1|  PREDICTED: serine carboxypeptidase-like 18-like    145   1e-36   
ref|NP_973517.1|  serine carboxypeptidase-like 9                        144   1e-36   
ref|XP_009121469.1|  PREDICTED: serine carboxypeptidase-like 7          144   1e-36   
ref|NP_179884.1|  serine carboxypeptidase-like 9                        144   2e-36   
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         144   2e-36   
ref|XP_010509543.1|  PREDICTED: serine carboxypeptidase-like 9 is...    144   2e-36   
gb|KFK38584.1|  hypothetical protein AALP_AA3G132700                    148   2e-36   
emb|CDX69437.1|  BnaA10g17860D                                          144   2e-36   
ref|XP_006407354.1|  hypothetical protein EUTSA_v10022069mg             144   2e-36   
ref|XP_010106920.1|  Serine carboxypeptidase-like 18                    145   2e-36   
ref|XP_006399443.1|  hypothetical protein EUTSA_v10015958mg             144   2e-36   
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    144   2e-36   
emb|CDY44586.1|  BnaA04g10040D                                          144   2e-36   
ref|XP_007047576.1|  Serine carboxypeptidase-like 18, putative is...    142   2e-36   
dbj|BAJ97596.1|  predicted protein                                      144   2e-36   
ref|XP_004163543.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    144   2e-36   
ref|XP_006297701.1|  hypothetical protein CARUB_v10013730mg             144   3e-36   
ref|XP_002878652.1|  hypothetical protein ARALYDRAFT_481172             143   3e-36   
gb|AAL73565.1|AC079632_9  Putative acyltransferase                      143   3e-36   
ref|XP_006294237.1|  hypothetical protein CARUB_v10023234mg             144   3e-36   
dbj|BAJ90865.1|  predicted protein                                      144   3e-36   
ref|XP_007047575.1|  Serine carboxypeptidase-like 18, putative is...    142   4e-36   
gb|ABG22467.1|  Serine carboxypeptidase family protein, expressed       143   4e-36   
ref|NP_177472.1|  serine carboxypeptidase-like 5                        143   4e-36   
ref|XP_008452656.1|  PREDICTED: serine carboxypeptidase-like 13 i...    143   4e-36   
gb|KFK38432.1|  hypothetical protein AALP_AA3G112600                    143   4e-36   
ref|XP_010106919.1|  Serine carboxypeptidase-like 18                    143   4e-36   
sp|Q9CAU2.2|SCP5_ARATH  RecName: Full=Serine carboxypeptidase-lik...    143   4e-36   
ref|XP_007047577.1|  Serine carboxypeptidase-like 18, putative is...    142   5e-36   
ref|XP_008452655.1|  PREDICTED: serine carboxypeptidase-like 13 i...    143   5e-36   
dbj|BAB03131.1|  serine carboxypeptidase                                143   5e-36   
ref|XP_008236286.1|  PREDICTED: serine carboxypeptidase-like 2 is...    143   6e-36   
ref|XP_006296383.1|  hypothetical protein CARUB_v10025556mg             142   6e-36   
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    146   6e-36   
ref|NP_177473.1|  serine carboxypeptidase-like 2                        142   6e-36   
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         145   7e-36   
ref|XP_008452664.1|  PREDICTED: serine carboxypeptidase-like 2          143   7e-36   
gb|KFK25893.1|  hypothetical protein AALP_AA8G176200                    142   7e-36   
ref|XP_009120840.1|  PREDICTED: serine carboxypeptidase-like 15         142   7e-36   
ref|XP_010527656.1|  PREDICTED: serine carboxypeptidase-like 2          142   7e-36   
ref|XP_010428244.1|  PREDICTED: serine carboxypeptidase-like 2 is...    142   7e-36   
ref|XP_010238598.1|  PREDICTED: serine carboxypeptidase-like 3 is...    143   7e-36   
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         142   8e-36   
emb|CDX68234.1|  BnaA07g22740D                                          142   9e-36   
emb|CDY53115.1|  BnaCnng24430D                                          142   9e-36   
ref|NP_001064015.1|  Os10g0101200                                       142   1e-35   
gb|EEE50445.1|  hypothetical protein OsJ_30452                          142   1e-35   
ref|XP_010471386.1|  PREDICTED: serine carboxypeptidase-like 2          142   1e-35   
emb|CDY67053.1|  BnaA04g27850D                                          140   1e-35   
ref|XP_009104816.1|  PREDICTED: serine carboxypeptidase-like 2          142   1e-35   
ref|XP_008794935.1|  PREDICTED: serine carboxypeptidase 1-like          142   1e-35   
ref|XP_006486897.1|  PREDICTED: serine carboxypeptidase-like 17-like    142   1e-35   
gb|KFK41348.1|  hypothetical protein AALP_AA2G118800                    142   1e-35   
ref|XP_006662864.1|  PREDICTED: serine carboxypeptidase-like 18-like    142   1e-35   
gb|EMS58156.1|  Serine carboxypeptidase-like 18                         142   1e-35   
ref|XP_009114926.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    142   1e-35   
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         141   1e-35   
ref|XP_010556477.1|  PREDICTED: serine carboxypeptidase-like 18         141   2e-35   
ref|XP_009120791.1|  PREDICTED: serine carboxypeptidase-like 15 i...    141   2e-35   
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    142   2e-35   
dbj|BAJ94430.1|  predicted protein                                      142   2e-35   
ref|XP_010435332.1|  PREDICTED: serine carboxypeptidase-like 20         142   2e-35   
ref|XP_006354954.1|  PREDICTED: serine carboxypeptidase-like 2-like     142   2e-35   
ref|XP_009120828.1|  PREDICTED: serine carboxypeptidase-like 15 i...    140   2e-35   
ref|XP_006290031.1|  hypothetical protein CARUB_v10003665mg             141   2e-35   
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    141   2e-35   
dbj|BAJ85895.1|  predicted protein                                      141   2e-35   
ref|XP_009139654.1|  PREDICTED: serine carboxypeptidase-like 20         141   2e-35   
ref|NP_001031402.1|  serine carboxypeptidase-like 13                    140   2e-35   
ref|XP_008669340.1|  PREDICTED: serine carboxypeptidase-like 7          141   2e-35   
ref|XP_006294236.1|  hypothetical protein CARUB_v10023233mg             141   2e-35   
ref|XP_010939012.1|  PREDICTED: serine carboxypeptidase-like 17 i...    141   3e-35   
ref|NP_001077946.1|  serine carboxypeptidase-like 13                    140   3e-35   
ref|NP_001077947.1|  serine carboxypeptidase-like 13                    140   3e-35   
gb|KFK41349.1|  hypothetical protein AALP_AA2G118800                    141   3e-35   
ref|XP_010649230.1|  PREDICTED: serine carboxypeptidase-like 20         141   3e-35   
ref|NP_179881.3|  serine carboxypeptidase-like 13                       140   3e-35   
emb|CBI17613.3|  unnamed protein product                                141   3e-35   
emb|CDY39716.1|  BnaA04g07190D                                          141   3e-35   
ref|XP_008236291.1|  PREDICTED: serine carboxypeptidase-like 13 i...    141   3e-35   
dbj|BAB03129.1|  serine carboxypeptidase                                140   3e-35   
emb|CDY52617.1|  BnaCnng22960D                                          144   3e-35   
gb|EAY83664.1|  hypothetical protein OsI_38889                          141   3e-35   
ref|XP_009125362.1|  PREDICTED: serine carboxypeptidase-like 19         141   3e-35   
gb|ABA99132.1|  Serine carboxypeptidase family protein                  140   3e-35   
gb|AAN60354.1|  unknown                                                 140   3e-35   
emb|CDX77573.1|  BnaA07g07110D                                          140   3e-35   
ref|XP_010320345.1|  PREDICTED: serine carboxypeptidase-like 10 i...    139   4e-35   
gb|EAZ21010.1|  hypothetical protein OsJ_36660                          140   4e-35   
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         140   4e-35   
ref|XP_006422775.1|  hypothetical protein CICLE_v10028360mg             138   4e-35   
ref|XP_004141409.1|  PREDICTED: serine carboxypeptidase-like 1-like     140   5e-35   
ref|XP_006299183.1|  hypothetical protein CARUB_v10015328mg             140   5e-35   
emb|CDY50563.1|  BnaA01g30770D                                          143   6e-35   
emb|CDY30277.1|  BnaC04g31880D                                          140   6e-35   
emb|CDP17658.1|  unnamed protein product                                140   6e-35   
ref|XP_010416123.1|  PREDICTED: serine carboxypeptidase-like 2          140   6e-35   
gb|ACF84441.1|  unknown                                                 139   6e-35   
ref|XP_002522137.1|  serine carboxypeptidase, putative                  140   6e-35   
dbj|BAB03132.1|  serine carboxypeptidase                                140   7e-35   
ref|XP_006407566.1|  hypothetical protein EUTSA_v10020743mg             140   7e-35   
ref|NP_187828.1|  serine carboxypeptidase-like 17                       139   7e-35   
gb|KCW55062.1|  hypothetical protein EUGRSUZ_I01038                     138   8e-35   
dbj|BAD93788.1|  serine carboxypeptidase                                137   8e-35   
ref|NP_187832.2|  serine carboxypeptidase-like 15                       139   8e-35   
ref|XP_006376415.1|  serine carboxypeptidase S10 family protein         139   9e-35   
ref|XP_010491604.1|  PREDICTED: serine carboxypeptidase-like 19         140   9e-35   
ref|XP_004165535.1|  PREDICTED: serine carboxypeptidase-like 1-like     139   9e-35   
ref|XP_010505112.1|  PREDICTED: serine carboxypeptidase-like 9 is...    139   9e-35   
dbj|BAJ99095.1|  predicted protein                                      140   9e-35   
emb|CDY33713.1|  BnaC04g29380D                                          140   9e-35   
gb|KFK44963.1|  hypothetical protein AALP_AA1G326300                    139   1e-34   
gb|KCW55070.1|  hypothetical protein EUGRSUZ_I010391                    137   1e-34   
ref|XP_009102688.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    139   1e-34   
emb|CDY09545.1|  BnaC05g23740D                                          139   1e-34   
ref|NP_187831.1|  serine carboxypeptidase-like 14                       139   1e-34   
gb|AAG51076.1|AC069472_16  serine carboxypeptidase, putative; 295...    139   1e-34   
ref|XP_009139928.1|  PREDICTED: serine carboxypeptidase-like 7 is...    139   1e-34   
ref|XP_009139927.1|  PREDICTED: serine carboxypeptidase-like 7 is...    139   1e-34   
ref|XP_009104817.1|  PREDICTED: serine carboxypeptidase-like 2 is...    139   1e-34   
gb|KGN55284.1|  hypothetical protein Csa_4G644120                       139   1e-34   
emb|CDY68040.1|  BnaAnng25990D                                          139   1e-34   
emb|CDX85809.1|  BnaA02g00040D                                          139   1e-34   
ref|XP_008236346.1|  PREDICTED: serine carboxypeptidase-like 18         139   2e-34   
gb|EEC68084.1|  hypothetical protein OsI_35952                          139   2e-34   
ref|XP_010428248.1|  PREDICTED: serine carboxypeptidase-like 2 is...    138   2e-34   
ref|XP_009139930.1|  PREDICTED: serine carboxypeptidase-like 7 is...    139   2e-34   
ref|XP_009104818.1|  PREDICTED: serine carboxypeptidase-like 2 is...    138   2e-34   
gb|EMS46782.1|  Serine carboxypeptidase-like 18                         137   2e-34   
gb|KCW55068.1|  hypothetical protein EUGRSUZ_I010391                    137   2e-34   
gb|ACF79685.1|  unknown                                                 139   2e-34   
ref|NP_198467.2|  serine carboxypeptidase-like 1                        138   2e-34   
ref|XP_006422773.1|  hypothetical protein CICLE_v10028648mg             137   2e-34   
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    139   2e-34   
ref|XP_002446557.1|  hypothetical protein SORBIDRAFT_06g018070          139   2e-34   
emb|CDY49647.1|  BnaC09g41250D                                          138   2e-34   
ref|XP_010429240.1|  PREDICTED: serine carboxypeptidase-like 10 i...    138   2e-34   
ref|NP_001130406.1|  uncharacterized protein LOC100191502 precursor     139   2e-34   
ref|XP_009115052.1|  PREDICTED: serine carboxypeptidase-like 14         138   2e-34   
ref|XP_006422770.1|  hypothetical protein CICLE_v10028371mg             138   2e-34   
ref|XP_009343182.1|  PREDICTED: serine carboxypeptidase-like 18 i...    137   3e-34   
ref|XP_007201135.1|  hypothetical protein PRUPE_ppa016992mg             138   3e-34   
dbj|BAA96893.1|  serine carboxypeptidase                                139   3e-34   
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         138   3e-34   
emb|CDM84698.1|  unnamed protein product                                138   3e-34   
ref|XP_004290128.1|  PREDICTED: serine carboxypeptidase-like 20-like    138   3e-34   
gb|ACN25790.1|  unknown                                                 137   3e-34   
ref|XP_002884894.1|  hypothetical protein ARALYDRAFT_897434             138   3e-34   
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          138   3e-34   
ref|XP_008236285.1|  PREDICTED: serine carboxypeptidase-like 2 is...    138   3e-34   
ref|XP_006663397.1|  PREDICTED: serine carboxypeptidase-like 18-like    138   3e-34   
gb|ACN27602.1|  unknown                                                 138   3e-34   
emb|CDY02322.1|  BnaA09g25800D                                          137   3e-34   
ref|XP_008236293.1|  PREDICTED: serine carboxypeptidase-like 18 i...    137   4e-34   
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         138   4e-34   
ref|XP_010472299.1|  PREDICTED: serine carboxypeptidase-like 10 i...    137   4e-34   
ref|NP_566414.3|  serine carboxypeptidase-like 16                       137   4e-34   
ref|XP_006422777.1|  hypothetical protein CICLE_v10028360mg             138   4e-34   
ref|XP_009343181.1|  PREDICTED: serine carboxypeptidase-like 1 is...    137   4e-34   
ref|XP_006664470.1|  PREDICTED: serine carboxypeptidase 1-like          137   5e-34   
ref|XP_008236292.1|  PREDICTED: serine carboxypeptidase-like 13 i...    137   5e-34   
emb|CDP03970.1|  unnamed protein product                                137   6e-34   
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          137   6e-34   
ref|XP_010486655.1|  PREDICTED: serine carboxypeptidase-like 7 is...    137   6e-34   
emb|CDY11116.1|  BnaC06g23680D                                          140   7e-34   
ref|XP_009375674.1|  PREDICTED: serine carboxypeptidase-like 7          137   7e-34   
ref|XP_006376417.1|  serine carboxypeptidase S10 family protein         137   7e-34   
ref|XP_010028341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    137   7e-34   
ref|XP_006486896.1|  PREDICTED: serine carboxypeptidase-like 18-like    137   7e-34   
ref|XP_010065873.1|  PREDICTED: serine carboxypeptidase-like 2          137   7e-34   
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          137   7e-34   
ref|XP_010515304.1|  PREDICTED: serine carboxypeptidase-like 7          137   7e-34   
ref|XP_010028339.1|  PREDICTED: serine carboxypeptidase-like 18         137   8e-34   
ref|XP_007200784.1|  hypothetical protein PRUPE_ppa024053mg             137   8e-34   
ref|XP_010505114.1|  PREDICTED: serine carboxypeptidase-like 9 is...    137   9e-34   
ref|XP_010505113.1|  PREDICTED: serine carboxypeptidase-like 9 is...    136   1e-33   
gb|AAG52139.1|AC010556_21  putative serine carboxypeptidase; 1519...    136   1e-33   
gb|EMT03311.1|  Serine carboxypeptidase-like 19                         136   1e-33   
ref|XP_010465794.1|  PREDICTED: serine carboxypeptidase-like 16         136   1e-33   
ref|NP_177470.4|  serine carboxypeptidase-like 6                        136   1e-33   
emb|CDY38920.1|  BnaA04g13410D                                          137   1e-33   
dbj|BAJ96525.1|  predicted protein                                      137   1e-33   
ref|NP_177474.1|  serine carboxypeptidase-like 4                        136   1e-33   
dbj|BAJ86585.1|  predicted protein                                      136   1e-33   
gb|EAZ18289.1|  hypothetical protein OsJ_33827                          136   1e-33   
ref|XP_009343180.1|  PREDICTED: serine carboxypeptidase-like 1          136   1e-33   
ref|XP_010323102.1|  PREDICTED: serine carboxypeptidase-like 20         136   1e-33   
ref|XP_002878649.1|  hypothetical protein ARALYDRAFT_481165             135   1e-33   
ref|NP_001149348.1|  serine carboxypeptidase 1 precursor                136   1e-33   
ref|NP_568215.2|  serine carboxypeptidase-like 19                       136   1e-33   
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          136   1e-33   
sp|Q9LSV8.2|SCP21_ARATH  RecName: Full=Serine carboxypeptidase-li...    136   2e-33   
ref|XP_010417053.1|  PREDICTED: serine carboxypeptidase-like 9          136   2e-33   
ref|XP_009343914.1|  PREDICTED: serine carboxypeptidase-like 7          136   2e-33   
ref|XP_008236347.1|  PREDICTED: serine carboxypeptidase-like 13         136   2e-33   
ref|XP_002522136.1|  serine carboxypeptidase, putative                  135   2e-33   
ref|XP_008236344.1|  PREDICTED: serine carboxypeptidase-like 13         136   2e-33   
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         136   2e-33   
emb|CDX69895.1|  BnaA10g22440D                                          136   2e-33   
ref|XP_006663394.1|  PREDICTED: serine carboxypeptidase-like 18-like    135   2e-33   
gb|EMT02053.1|  Serine carboxypeptidase-like 18                         136   2e-33   
ref|XP_007201000.1|  hypothetical protein PRUPE_ppa005249mg             135   2e-33   
emb|CDP18838.1|  unnamed protein product                                135   2e-33   
ref|XP_010678976.1|  PREDICTED: serine carboxypeptidase-like 20         136   2e-33   
ref|XP_009102414.1|  PREDICTED: serine carboxypeptidase-like 21         136   2e-33   
ref|XP_007199854.1|  hypothetical protein PRUPE_ppa005665mg             135   3e-33   
dbj|BAJ93955.1|  predicted protein                                      135   3e-33   
emb|CDY11114.1|  BnaC06g23660D                                          135   3e-33   
ref|XP_002888921.1|  hypothetical protein ARALYDRAFT_476459             135   3e-33   
ref|XP_007201001.1|  hypothetical protein PRUPE_ppa005249mg             135   3e-33   
ref|XP_011009329.1|  PREDICTED: serine carboxypeptidase-like 20         135   3e-33   
ref|XP_006297707.1|  hypothetical protein CARUB_v10013735mg             135   3e-33   
ref|XP_010277008.1|  PREDICTED: serine carboxypeptidase-like 18 i...    135   4e-33   
ref|XP_006663395.1|  PREDICTED: serine carboxypeptidase-like 18-like    135   4e-33   
ref|XP_006283616.1|  hypothetical protein CARUB_v10004672mg             135   4e-33   
ref|XP_002321240.1|  serine carboxypeptidase S10 family protein         135   4e-33   
emb|CDY21592.1|  BnaC09g47000D                                          135   4e-33   
gb|KCW63570.1|  hypothetical protein EUGRSUZ_G01197                     134   5e-33   
gb|KDO81473.1|  hypothetical protein CISIN_1g012205mg                   134   5e-33   



>ref|XP_004252000.2| PREDICTED: serine carboxypeptidase-like 7 [Solanum lycopersicum]
 ref|XP_010314007.1| PREDICTED: serine carboxypeptidase-like 7 [Solanum lycopersicum]
Length=499

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 108/264 (41%), Positives = 158/264 (60%), Gaps = 30/264 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL ++ E+  N +Y+GGDSYSGT +P++ Q ISNGNDA+ KP IN KGY++GN +
Sbjct  190  QFLQKWLANHSEFLQNPIYIGGDSYSGTTVPIVVQTISNGNDAKTKPMINLKGYILGNPL  249

Query  184  T-HFSEHDYTYQFALGYGLISEEF-------ARKSYDDCITNPDKKPFFTKCQLDILRFV  339
            T +  E +Y   FA G GL+S++         +  Y +  TN       + C  ++  F 
Sbjct  250  TINPDELNYRIPFARGMGLLSDDLYKALVSNCKGEYQNIATNN------SACSNNVRTFN  303

Query  340  MLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIY---NRYLL----CKS  498
             L    N  +IL+ +C       D +S K +  + R   + AK++   N  +L    C  
Sbjct  304  KLCEGINKEHILEPLC-------DSVSLKRYRSVGRRTSLYAKLHKLENSMVLPGVKCLE  356

Query  499  D--SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSL  672
            D   +   + N +SVQEALHV+KG+I+NW +CR +L +  NV + + YHANLS KG+RSL
Sbjct  357  DWRKLCVHWANDDSVQEALHVRKGTIENWTRCRGDLSFTYNVYNVVPYHANLSAKGYRSL  416

Query  673  IYNGDRDLFIPSLSAEAWTKSLNY  744
            IY+GD DL IP +S EAW +SLNY
Sbjct  417  IYSGDHDLTIPFISTEAWIESLNY  440



>ref|XP_006343161.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=449

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 156/258 (60%), Gaps = 18/258 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL ++ ++  N +Y+GGDSYSGT +P++ Q ISNGNDA+ KP IN KGY++GN +
Sbjct  171  QFLQKWLANHSKFLQNPIYIGGDSYSGTTVPIVVQTISNGNDAKTKPMINLKGYILGNPL  230

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T +  E +Y   FA G GL+S++  +    +C     +  P  + C   +  F  L    
Sbjct  231  TINPDELNYRIPFAHGMGLLSDDLYKALVSNCGGEYQNIAPNNSACSNSVQTFNKLCEGI  290

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIY---NRYLL----CKSD--SIA  510
            N  +IL+ +C       D +S K +  + R   + AK++   N  +L    C  D   ++
Sbjct  291  NKEHILEPLC-------DSVSLKRYRSVGRRTSLYAKLHKLENSMVLPGVKCLEDWRKLS  343

Query  511  AQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDR  690
              + N +SVQEALHV+KG+I NW +CR +L +  NV + + YHANLS KG+RSLIY+GD 
Sbjct  344  VHWANDDSVQEALHVRKGTIQNWTRCRGDLSFTYNVYNVVPYHANLSAKGYRSLIYSGDH  403

Query  691  DLFIPSLSAEAWTKSLNY  744
            DL IP +S EAW  SLNY
Sbjct  404  DLTIPFISTEAWIGSLNY  421



>ref|XP_006343160.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=480

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 156/258 (60%), Gaps = 18/258 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL ++ ++  N +Y+GGDSYSGT +P++ Q ISNGNDA+ KP IN KGY++GN +
Sbjct  171  QFLQKWLANHSKFLQNPIYIGGDSYSGTTVPIVVQTISNGNDAKTKPMINLKGYILGNPL  230

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T +  E +Y   FA G GL+S++  +    +C     +  P  + C   +  F  L    
Sbjct  231  TINPDELNYRIPFAHGMGLLSDDLYKALVSNCGGEYQNIAPNNSACSNSVQTFNKLCEGI  290

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIY---NRYLL----CKSD--SIA  510
            N  +IL+ +C       D +S K +  + R   + AK++   N  +L    C  D   ++
Sbjct  291  NKEHILEPLC-------DSVSLKRYRSVGRRTSLYAKLHKLENSMVLPGVKCLEDWRKLS  343

Query  511  AQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDR  690
              + N +SVQEALHV+KG+I NW +CR +L +  NV + + YHANLS KG+RSLIY+GD 
Sbjct  344  VHWANDDSVQEALHVRKGTIQNWTRCRGDLSFTYNVYNVVPYHANLSAKGYRSLIYSGDH  403

Query  691  DLFIPSLSAEAWTKSLNY  744
            DL IP +S EAW  SLNY
Sbjct  404  DLTIPFISTEAWIGSLNY  421



>ref|XP_003593858.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES64109.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 155/254 (61%), Gaps = 12/254 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+P++QSN +Y+ GDSYSG  IP++ Q I+ GN+  ++P IN +GY++GNGV
Sbjct  162  QFLRKWLVDHPKFQSNEVYIAGDSYSGIPIPVVVQEIAQGNEKGVQPWINLQGYILGNGV  221

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTK---CQLDILRFVMLTFV  354
            T   E +Y   FA G GLIS+E       +C  N D     T+   C  DI  F  LT  
Sbjct  222  TTRKERNYAIPFAHGMGLISDELYESLQKNC--NGDYVNAETRNVLCSKDINSFSELTSG  279

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVP--IKRFNGVNAKIYNRYLLCKSDS--IAAQYV  522
             N A+ILD +C   +  E     ++ +     +F  +N K+    L C+S S  +   + 
Sbjct  280  LNTAHILDPLCEWRDDNEK-SPRRSLIKNYFSKFLHINLKL--PPLSCRSYSYFLMGFWA  336

Query  523  NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            N ++V++ALH++KGSI  W +C  N+ +N ++ +S  YH NLS KG RSLIYNGD D+ +
Sbjct  337  NDDNVRKALHIRKGSIGKWHRCTYNIRHNADIPNSYDYHVNLSRKGIRSLIYNGDHDMTV  396

Query  703  PSLSAEAWTKSLNY  744
            P L+ +AW +SLNY
Sbjct  397  PFLATQAWIRSLNY  410



>ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2 [Vitis vinifera]
Length=469

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 144/253 (57%), Gaps = 7/253 (3%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+PE+ SN +YVGGDSYSG  +P++ Q ISNGN+   +P IN KGYL+GN V
Sbjct  159  EFLRKWLIDHPEFLSNPVYVGGDSYSGITVPVVVQHISNGNEDDTEPFINLKGYLLGNPV  218

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T   +E    ++FA G  LIS+E        C    P K P   +C  D+  F       
Sbjct  219  TEQGTETTAQFRFAHGMALISDELYESLKTSCGDEYPFKYPINIQCIKDVQAFYKCISGI  278

Query  358  NPAYILDSVCLINN-GLEDL-LSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVN  525
                IL+ VC   +   ED+ LSG+ ++ I +      +       C++D   +A  + N
Sbjct  279  QFGQILEPVCGFGSLKPEDIFLSGRRYL-IGKLRERRPEPSLSAFECRTDGYILAPYWAN  337

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
              +VQEALH++K +I  W++C   L Y   +  S  YH  LS KG+RSLIY+GD D+ +P
Sbjct  338  NATVQEALHIRKNTIREWQRCAMGLSYTPEIESSFEYHVTLSKKGYRSLIYSGDHDMIVP  397

Query  706  SLSAEAWTKSLNY  744
              S +AW +SLNY
Sbjct  398  FFSTQAWIRSLNY  410



>ref|XP_009764359.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
7 [Nicotiana sylvestris]
Length=461

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 149/251 (59%), Gaps = 6/251 (2%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KW +D+PE+  N LYVGGDSYSG ++P++ Q I+  N+  +KP ++ +GYL+GN  
Sbjct  154  EFLYKWFLDHPEFLKNPLYVGGDSYSGMVVPIITQIIATKNEMGIKPFVDLQGYLLGNPS  213

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFV-MLTFVN  357
            T   E +Y   FA G GLIS+E       +C     +  P  T+C  D+  F  +L  +N
Sbjct  214  TFKGEKNYEIPFAYGMGLISDELYESLTRNCKGEYQNTDPSNTQCLQDVHTFQELLKRIN  273

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVNVE  531
            NP +IL+  C   +    LL G+      +F+ +N       L C++D   +++ + +  
Sbjct  274  NP-HILEPKCQFASPKPHLLFGQRRSLNVKFHQLNNPQQLPALKCRNDWYKLSSHWADDG  332

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
             V+EALH++KG+I  W +C A+L Y   +  SI YHANLS KG+RSLIY+GD D  +  L
Sbjct  333  QVREALHIRKGTIGKWVRC-ASLQYQKTIMSSIPYHANLSAKGYRSLIYSGDHDKVVTFL  391

Query  712  SAEAWTKSLNY  744
            S +AW KSLNY
Sbjct  392  STQAWIKSLNY  402



>emb|CBI19380.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 144/253 (57%), Gaps = 7/253 (3%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+PE+ SN +YVGGDSYSG  +P++ Q ISNGN+   +P IN KGYL+GN V
Sbjct  193  EFLRKWLIDHPEFLSNPVYVGGDSYSGITVPVVVQHISNGNEDDTEPFINLKGYLLGNPV  252

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T   +E    ++FA G  LIS+E        C    P K P   +C  D+  F       
Sbjct  253  TEQGTETTAQFRFAHGMALISDELYESLKTSCGDEYPFKYPINIQCIKDVQAFYKCISGI  312

Query  358  NPAYILDSVCLINN-GLEDL-LSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVN  525
                IL+ VC   +   ED+ LSG+ ++ I +      +       C++D   +A  + N
Sbjct  313  QFGQILEPVCGFGSLKPEDIFLSGRRYL-IGKLRERRPEPSLSAFECRTDGYILAPYWAN  371

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
              +VQEALH++K +I  W++C   L Y   +  S  YH  LS KG+RSLIY+GD D+ +P
Sbjct  372  NATVQEALHIRKNTIREWQRCAMGLSYTPEIESSFEYHVTLSKKGYRSLIYSGDHDMIVP  431

Query  706  SLSAEAWTKSLNY  744
              S +AW +SLNY
Sbjct  432  FFSTQAWIRSLNY  444



>ref|XP_006594522.1| PREDICTED: serine carboxypeptidase-like 12-like [Glycine max]
Length=469

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 147/254 (58%), Gaps = 12/254 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+P + SN +Y+GGDSYSG  IP++ Q IS GN+  L+P IN +GYL+GN  
Sbjct  162  QFLRKWLIDHPNFSSNEVYIGGDSYSGIPIPVIVQEISRGNEKGLQPWINLQGYLLGNAA  221

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   E +Y   FA G GLIS+E       +C     N D +     C  DI  F  +T  
Sbjct  222  TTRREKNYQIPFAHGMGLISDELYGSLQKNCKEEYINVDTRNVL--CSRDIESFNEVTSG  279

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIK--RFNGVNAKIYNRYLLCKSDS--IAAQYV  522
             N A+ILD  C     L+   S +  +  K  R N +N  +    L C+S    +   + 
Sbjct  280  LNSAHILDPSC---EWLDTETSWRRSLLKKYPRKNFLNTHLKLAPLNCRSYVYFLCGYWA  336

Query  523  NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            N ++V+ ALH++KGSI  W +C  ++P   ++  S  YH NLS KG+RSLIY+GD D+ I
Sbjct  337  NDDNVRTALHIRKGSIGKWHRCTFDIPNKKDISSSYEYHVNLSRKGYRSLIYSGDHDMTI  396

Query  703  PSLSAEAWTKSLNY  744
            P L+ +AW +SLNY
Sbjct  397  PFLATQAWIRSLNY  410



>ref|XP_009601001.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=464

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/253 (41%), Positives = 148/253 (58%), Gaps = 10/253 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ +W +D+PE+  N LYV GDSYSG L+P++ Q I   N+  +KP ++ KGYL+GN  
Sbjct  157  EFLYRWFLDHPEFLKNPLYVAGDSYSGMLVPIITQIIETKNEMGIKPFMDLKGYLLGNPS  216

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFV-MLTF  351
            T   E +Y   FA G GLIS+E       +C     N D  P  T+C  D+  F  +L  
Sbjct  217  TFKGEKNYEIPFAYGMGLISDELYESLKRNCKGVYQNTD--PSNTQCLQDVQTFQELLKR  274

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVN  525
            +NNP +IL+  C   +    LL G+      +F+ +N       L C++D   +++ + +
Sbjct  275  INNP-HILEPNCQFASPKPHLLFGQKRSLNVKFHQLNNPQQLPALKCRNDWYILSSHWAD  333

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
               V+EALH++KG+I  W +C A+L Y   V  SI YHANLS KG+RSLIY+GD D  + 
Sbjct  334  DSQVREALHIRKGTIGKWVRC-ASLQYQKTVMSSIPYHANLSAKGYRSLIYSGDHDKVVT  392

Query  706  SLSAEAWTKSLNY  744
             LS +AW KSLNY
Sbjct  393  FLSTQAWIKSLNY  405



>dbj|BAF99698.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=484

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 153/252 (61%), Gaps = 5/252 (2%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++K+L+ +PE+ SN LYVGGDSY+G  +P++A+ I++GN+  ++P+IN KGY++GN +
Sbjct  174  QFLKKFLVHHPEFLSNPLYVGGDSYAGLFVPVVAELIAHGNENGIEPSINLKGYVLGNPL  233

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC-ITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T   + DY   F+ G G+IS+E       +C     D  P  TKC  DI  F  +     
Sbjct  234  TTPYDVDYRVPFSHGMGIISDELYESLKLNCNGVYHDVDPTNTKCLNDIDTFKQVFHGIR  293

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY--LLCKSDSIAAQY--VNV  528
             ++IL+  C+     + +LS +    +   N     + N +    C++D     Y   N 
Sbjct  294  RSHILEPYCVSVLPEQQMLSTERQRSLHENNLRIPDVLNMHHTFRCRTDGYIPAYYWAND  353

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            + V+EALH+ KGSI NW +C  +LP+ +++R+ + YHANLS KG+RSLIY+GD D  +P 
Sbjct  354  DRVREALHIHKGSIKNWVRCNRSLPFEDSIRNVVPYHANLSKKGYRSLIYSGDHDAMVPF  413

Query  709  LSAEAWTKSLNY  744
            ++ +AW +SLNY
Sbjct  414  MATQAWIRSLNY  425



>ref|XP_010321497.1| PREDICTED: serine carboxypeptidase-like 12 [Solanum lycopersicum]
Length=459

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/253 (42%), Positives = 151/253 (60%), Gaps = 13/253 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWLI++ EY +N  YVGGDSYSG  +P++ Q ISNGND  +KP IN KGY++GN V
Sbjct  155  EFIRKWLIEHQEYLNNPFYVGGDSYSGITVPIVTQFISNGNDMGIKPWINLKGYILGNPV  214

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   +  Y   FA G GLIS+E       +C   +   D+      C  D+  F  LT  
Sbjct  215  TFAGQDYYIIPFAHGMGLISDELYESLVTNCEGELIYRDRPIINPLCSRDMDTFNWLTKD  274

Query  355  NNPAYILDSVC-LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVN  525
                 IL+S C L++      L+ +    +K     N+  Y + + C+ +  ++A  + N
Sbjct  275  IYLYNILESPCELVSKDSRRWLT-QNVTKLK-----NSATYPQ-VKCRKEWHALALIWAN  327

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
              +V++ALHV+K +I  WE+CR NL + + + ++I YH+NLS KGFRSLIY+GD D+ +P
Sbjct  328  DNNVRDALHVRKKTIGAWEECRGNLSFGDIINNTILYHSNLSRKGFRSLIYSGDHDMVVP  387

Query  706  SLSAEAWTKSLNY  744
             +S + W KSLNY
Sbjct  388  FISTQVWIKSLNY  400



>ref|XP_010320198.1| PREDICTED: serine carboxypeptidase-like 17 [Solanum lycopersicum]
Length=476

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 148/252 (59%), Gaps = 13/252 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+ KW  D+PE+  N  YV GDSY+G  IP+++Q I+NGN+  L+P I+ KGYL+GN  
Sbjct  174  QFLHKWFNDHPEFFRNPFYVAGDSYAGIGIPIISQLIANGNEKGLEPFIDLKGYLLGNPA  233

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRF-VMLTFVN  357
            T   E++Y   +A G GLIS+E       +C     D  P  TKC  D+  +  ML  + 
Sbjct  234  TFHGEYNYKISYAHGVGLISDELFESLKQNCKGEYFDIHPSNTKCWNDMQTYDQMLGGIT  293

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVNVE  531
            N A+IL+  C       +  S +    I +   ++  +Y   L C+ D   ++  + + +
Sbjct  294  N-AHILEPKC-------EFGSPRPQKWIGQRRSLDEMLYLGRLRCRFDWEKMSYHWADDD  345

Query  532  SVQEALHVKKGSIDNWEQCRAN-LPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
             V+EALHV++GSI  W++C  + LPY   + +SI YHANLS KG+RSLIY+GD D  IP 
Sbjct  346  KVREALHVRRGSIGKWKRCAGDALPYQKIIGNSIPYHANLSVKGYRSLIYSGDHDTMIPY  405

Query  709  LSAEAWTKSLNY  744
             S EAW +SLNY
Sbjct  406  TSTEAWIRSLNY  417



>gb|KHN47358.1| ABC transporter B family member 9 [Glycine soja]
Length=1648

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 147/254 (58%), Gaps = 12/254 (5%)
 Frame = +1

Query  4     EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
             +F+RKWLID+P + SN +Y+GGDSYSG  IP++ Q IS GN+  L+P IN +GYL+GN  
Sbjct  1343  QFLRKWLIDHPNFSSNEVYIGGDSYSGIPIPVIVQEISRGNEKGLQPWINLQGYLLGNAA  1402

Query  184   THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
             T   E +Y   FA G GLIS+E       +C     N D +     C  DI  F  +T  
Sbjct  1403  TTRREKNYQIPFAHGMGLISDELYGSLQKNCKEEYINVDTRNVL--CSRDIESFNEVTSG  1460

Query  355   NNPAYILDSVCLINNGLEDLLSGKAFVPIK--RFNGVNAKIYNRYLLCKSDS--IAAQYV  522
              N A+ILD  C     L+   S +  +  K  R N +N  +    L C+S    +   + 
Sbjct  1461  LNSAHILDPSC---EWLDTETSWRRSLLKKYPRKNFLNTHLKLAPLNCRSYVYFLCGYWA  1517

Query  523   NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
             N ++V+ ALH++KGSI  W +C  ++P   ++  S  YH NLS KG+RSLIY+GD D+ I
Sbjct  1518  NDDNVRTALHIRKGSIGKWHRCTFDIPNKKDISSSYEYHVNLSRKGYRSLIYSGDHDMTI  1577

Query  703   PSLSAEAWTKSLNY  744
             P L+ +AW +SLNY
Sbjct  1578  PFLATQAWIRSLNY  1591



>ref|XP_010556476.1| PREDICTED: serine carboxypeptidase-like 18 isoform X5 [Tarenaya 
hassleriana]
Length=438

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 143/261 (55%), Gaps = 26/261 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+P + SN  YVGGDSYSG ++P + Q ISNGND   +P +N +GY++GN  
Sbjct  156  EFVRKWLIDHPRFTSNPFYVGGDSYSGRVVPAIVQEISNGNDKGFRPRVNLQGYVLGNPK  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  S + +    +A G GLIS+E        C  N  D  P  ++C   +  +       
Sbjct  216  TDGSFDSNSKIPYAHGMGLISDELYESLKRSCGGNYWDVDPSNSECLNLLQDYDKCVSRI  275

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ-------  516
            N A+IL  +C  ++            P    + +  + Y+R LL  S S+ A        
Sbjct  276  NGAFILTPLCEFSS------------PRPSLSDITRRRYSRELLNTSLSVPASDCYTYRY  323

Query  517  -----YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N E V+ ALHV KGSI NW +C   +PY+ ++R SI YH N S KG+RSL+++
Sbjct  324  LLSSYWANDEKVRRALHVVKGSIGNWVRCNWGMPYDYDIRSSIPYHLNNSLKGYRSLVFS  383

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  +AW +SLNY
Sbjct  384  GDHDMMVPFLGTQAWIRSLNY  404



>ref|XP_009600999.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Nicotiana 
tomentosiformis]
Length=465

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 104/254 (41%), Positives = 148/254 (58%), Gaps = 11/254 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ +W +D+PE+  N LYV GDSYSG L+P++ Q I   N+  +KP ++ KGYL+GN  
Sbjct  157  EFLYRWFLDHPEFLKNPLYVAGDSYSGMLVPIITQIIETKNEMGIKPFMDLKGYLLGNPS  216

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFV-MLTF  351
            T   E +Y   FA G GLIS+E       +C     N D  P  T+C  D+  F  +L  
Sbjct  217  TFKGEKNYEIPFAYGMGLISDELYESLKRNCKGVYQNTD--PSNTQCLQDVQTFQELLKR  274

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVN  525
            +NNP +IL+  C   +    LL G+      +F+ +N       L C++D   +++ + +
Sbjct  275  INNP-HILEPNCQFASPKPHLLFGQKRSLNVKFHQLNNPQQLPALKCRNDWYILSSHWAD  333

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIY-NGDRDLFI  702
               V+EALH++KG+I  W +C A+L Y   V  SI YHANLS KG+RSLIY +GD D  +
Sbjct  334  DSQVREALHIRKGTIGKWVRC-ASLQYQKTVMSSIPYHANLSAKGYRSLIYSSGDHDKVV  392

Query  703  PSLSAEAWTKSLNY  744
              LS +AW KSLNY
Sbjct  393  TFLSTQAWIKSLNY  406



>ref|XP_010556475.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Tarenaya 
hassleriana]
Length=441

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 143/261 (55%), Gaps = 26/261 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+P + SN  YVGGDSYSG ++P + Q ISNGND   +P +N +GY++GN  
Sbjct  156  EFVRKWLIDHPRFTSNPFYVGGDSYSGRVVPAIVQEISNGNDKGFRPRVNLQGYVLGNPK  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  S + +    +A G GLIS+E        C  N  D  P  ++C   +  +       
Sbjct  216  TDGSFDSNSKIPYAHGMGLISDELYESLKRSCGGNYWDVDPSNSECLNLLQDYDKCVSRI  275

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ-------  516
            N A+IL  +C  ++            P    + +  + Y+R LL  S S+ A        
Sbjct  276  NGAFILTPLCEFSS------------PRPSLSDITRRRYSRELLNTSLSVPASDCYTYRY  323

Query  517  -----YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N E V+ ALHV KGSI NW +C   +PY+ ++R SI YH N S KG+RSL+++
Sbjct  324  LLSSYWANDEKVRRALHVVKGSIGNWVRCNWGMPYDYDIRSSIPYHLNNSLKGYRSLVFS  383

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  +AW +SLNY
Sbjct  384  GDHDMMVPFLGTQAWIRSLNY  404



>ref|XP_010556472.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Tarenaya 
hassleriana]
Length=462

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 143/261 (55%), Gaps = 26/261 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+P + SN  YVGGDSYSG ++P + Q ISNGND   +P +N +GY++GN  
Sbjct  156  EFVRKWLIDHPRFTSNPFYVGGDSYSGRVVPAIVQEISNGNDKGFRPRVNLQGYVLGNPK  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  S + +    +A G GLIS+E        C  N  D  P  ++C   +  +       
Sbjct  216  TDGSFDSNSKIPYAHGMGLISDELYESLKRSCGGNYWDVDPSNSECLNLLQDYDKCVSRI  275

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ-------  516
            N A+IL  +C  ++            P    + +  + Y+R LL  S S+ A        
Sbjct  276  NGAFILTPLCEFSS------------PRPSLSDITRRRYSRELLNTSLSVPASDCYTYRY  323

Query  517  -----YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N E V+ ALHV KGSI NW +C   +PY+ ++R SI YH N S KG+RSL+++
Sbjct  324  LLSSYWANDEKVRRALHVVKGSIGNWVRCNWGMPYDYDIRSSIPYHLNNSLKGYRSLVFS  383

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  +AW +SLNY
Sbjct  384  GDHDMMVPFLGTQAWIRSLNY  404



>ref|XP_010556474.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Tarenaya 
hassleriana]
Length=455

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 143/261 (55%), Gaps = 26/261 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+P + SN  YVGGDSYSG ++P + Q ISNGND   +P +N +GY++GN  
Sbjct  156  EFVRKWLIDHPRFTSNPFYVGGDSYSGRVVPAIVQEISNGNDKGFRPRVNLQGYVLGNPK  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  S + +    +A G GLIS+E        C  N  D  P  ++C   +  +       
Sbjct  216  TDGSFDSNSKIPYAHGMGLISDELYESLKRSCGGNYWDVDPSNSECLNLLQDYDKCVSRI  275

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ-------  516
            N A+IL  +C  ++            P    + +  + Y+R LL  S S+ A        
Sbjct  276  NGAFILTPLCEFSS------------PRPSLSDITRRRYSRELLNTSLSVPASDCYTYRY  323

Query  517  -----YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N E V+ ALHV KGSI NW +C   +PY+ ++R SI YH N S KG+RSL+++
Sbjct  324  LLSSYWANDEKVRRALHVVKGSIGNWVRCNWGMPYDYDIRSSIPYHLNNSLKGYRSLVFS  383

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  +AW +SLNY
Sbjct  384  GDHDMMVPFLGTQAWIRSLNY  404



>ref|XP_010555479.1| PREDICTED: serine carboxypeptidase-like 7 [Tarenaya hassleriana]
Length=461

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 149/260 (57%), Gaps = 26/260 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+PE+ SN  YVGGDSYSG ++P + Q +S GN+  L P IN +GY++GN  
Sbjct  157  EFVRKWLVDHPEFVSNPFYVGGDSYSGIIVPAIVQQVSKGNEQGLVPLINIEGYVLGNPS  216

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T  S +H+Y   +A G GLIS+E        C  N +   P  ++C   +  +       
Sbjct  217  TDDSFDHNYRIPYAHGMGLISDELYESLKRCCGGNYNNVDPKNSECLRFLRDYDKCVSRI  276

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKR--FNG-VNAKIYN--------RYLLCKSDS  504
            N A+IL  +C       +  S +  +P +R    G VNA +          RYLL     
Sbjct  277  NEAFILTPLC-------EFASPRPNLPERRRYLKGLVNATLSAPSSDCYTYRYLL-----  324

Query  505  IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNG  684
             ++ + N E+V+ ALHV KGS+  W +C  ++PY+ ++  SI YH N S KG+RSL+++G
Sbjct  325  -SSYWANNETVRRALHVVKGSVGKWVRCNQDMPYDKDIESSIPYHVNNSIKGYRSLVFSG  383

Query  685  DRDLFIPSLSAEAWTKSLNY  744
            D DLF+P L  +AW +SLNY
Sbjct  384  DHDLFVPFLGTQAWIRSLNY  403



>ref|XP_010556473.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Tarenaya 
hassleriana]
Length=459

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/261 (39%), Positives = 145/261 (56%), Gaps = 29/261 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+P + SN  YVGGDSYSG ++P + Q ISNGND   +P +N +GY++GN  
Sbjct  156  EFVRKWLIDHPRFTSNPFYVGGDSYSGRVVPAIVQEISNGNDKGFRPRVNLQGYVLGNPK  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  S + +    +A G GLIS+E   +S   C  N  D  P  ++C   +  +       
Sbjct  216  TDGSFDSNSKIPYAHGMGLISDELYERS---CGGNYWDVDPSNSECLNLLQDYDKCVSRI  272

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ-------  516
            N A+IL  +C  ++            P    + +  + Y+R LL  S S+ A        
Sbjct  273  NGAFILTPLCEFSS------------PRPSLSDITRRRYSRELLNTSLSVPASDCYTYRY  320

Query  517  -----YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N E V+ ALHV KGSI NW +C   +PY+ ++R SI YH N S KG+RSL+++
Sbjct  321  LLSSYWANDEKVRRALHVVKGSIGNWVRCNWGMPYDYDIRSSIPYHLNNSLKGYRSLVFS  380

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  +AW +SLNY
Sbjct  381  GDHDMMVPFLGTQAWIRSLNY  401



>ref|XP_003604928.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87125.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 148/257 (58%), Gaps = 23/257 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLI++PE+ SN  Y+GGDSYSG  +P + Q ISNGN+   +P IN +GYL+GN +
Sbjct  168  QFLRKWLIEHPEFLSNEFYIGGDSYSGIPVPAILQEISNGNEKGHQPLINLQGYLLGNPI  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T + E +Y  Q+A G GLIS+E       +C     D       C  D+  F       N
Sbjct  228  TTYREENYQIQYAHGMGLISDELYASLQRNCKGEYIDVDSGNELCLRDLQYFHECLSAIN  287

Query  361  PAYILDSVC---------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAA  513
               ILDS C          +   L + LS +  VP      ++ KIY  YL       A 
Sbjct  288  EFNILDSNCEDDEHLWRRSLTQELNESLSSRLTVP-----ELSCKIYGYYL-------AT  335

Query  514  QYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRD  693
            ++++ ESV++ALH+++G+I  WE+C  N  +  ++  S  +HANLS KG+RSLIY+GD+D
Sbjct  336  KWISNESVRKALHIREGTIGKWERCYMN-DFEYDIFGSFEFHANLSKKGYRSLIYSGDQD  394

Query  694  LFIPSLSAEAWTKSLNY  744
              +P +S +AW ++LNY
Sbjct  395  AVVPFISTQAWIRNLNY  411



>gb|KFK25883.1| hypothetical protein AALP_AA8G174700 [Arabis alpina]
Length=454

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 141/254 (56%), Gaps = 12/254 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL  + EY SN +YVGGDSYSG +IP   Q IS GND   KP IN +GY++GN V
Sbjct  148  EFLRKWLSKHTEYISNPIYVGGDSYSGKVIPAAVQEISKGNDLGFKPQINLQGYVLGNPV  207

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T    E++    FA G  LIS+E        C   I N D      KC   +  F   T 
Sbjct  208  TDIELEYNDRVPFAHGMALISDELYESFKRTCRGNIENVDSSNI--KCLKFVQEFRKCTS  265

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVP---IKRFNGVNAKIYNRYLLCKSDSIAAQYV  522
              N  +IL   C I   L  LLS    VP   ++R    N  + +   +  +D +++ + 
Sbjct  266  NLNEEHILKPTCDIE--LPTLLSSND-VPRTYLRRLLPANPLVSSPVCVLYNDLLSSLWA  322

Query  523  NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            N ESV++ALHV KGSI  W +C   + YN N+  S+ YH N S KG+RSLI++GD DL +
Sbjct  323  NDESVRKALHVAKGSIGEWTRCFPFVTYNYNIESSVPYHMNNSIKGYRSLIFSGDHDLLV  382

Query  703  PSLSAEAWTKSLNY  744
            P +S +AW KSL Y
Sbjct  383  PVMSTQAWIKSLKY  396



>ref|XP_007138067.1| hypothetical protein PHAVU_009G177800g [Phaseolus vulgaris]
 gb|ESW10061.1| hypothetical protein PHAVU_009G177800g [Phaseolus vulgaris]
Length=495

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/256 (38%), Positives = 147/256 (57%), Gaps = 14/256 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+P++ SN +Y+ GDSYSG  +P + Q I+ GN+  ++P IN +GYL+GNG 
Sbjct  186  QFLRKWLVDHPKFLSNEVYIAGDSYSGIPVPAIVQEIAQGNEKGVQPWINLQGYLLGNGF  245

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVML---  345
            T  SE ++   FA G GLIS+E        C     N D K     C  D+  F  L   
Sbjct  246  TTRSEKNFRIPFAHGMGLISDELYESLQRSCKGDYINVDPKNL--PCHRDMESFNELLSG  303

Query  346  TFVNNPAYILDSVCLINNGLEDLLSGKAFV---PIKRFNGVNAKIYNRYLLCKSDSIAAQ  516
             FV N   IL+ +C  + G ++    ++ +   P K F   + K+         + +   
Sbjct  304  IFVYN---ILEPLCERDRGNKETSLRRSLLKKFPRKNFLKTHLKLPPFNCSSYEEFLCGY  360

Query  517  YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
            + N  +V+ ALH+++GSI  W +C +++P+  ++  S  YH NLS KG+RSLIY+GD D+
Sbjct  361  WANDHNVRTALHIREGSIGTWRRCPSDIPFKYDILSSFEYHVNLSRKGYRSLIYSGDHDM  420

Query  697  FIPSLSAEAWTKSLNY  744
             +P LS +AW +SLNY
Sbjct  421  AVPFLSTQAWIRSLNY  436



>ref|XP_009131550.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=449

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 141/249 (57%), Gaps = 11/249 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL ++ E+ SN  YV GDSYSG +IP + Q IS GND   KP IN +G+++GN V
Sbjct  152  EFIRKWLSEHKEFISNPFYVSGDSYSGKIIPAMVQEISKGNDLGFKPQINLEGFVIGNPV  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T    EH+    FA G  LIS+E        C  N D   P  T+C      F+      
Sbjct  212  TDTEFEHNQRIPFAHGMALISDELYESLKRSCKGNYDNIDPHNTECLKHFDEFLKCISRI  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N A IL   C      +  LS + ++ +      +A   +      +D +++ + N ESV
Sbjct  272  NFANILIPRC------DQALSPRRYILLPN---TSAPSTDDDCYEYTDLLSSLWANDESV  322

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHV KGSID W +C +  PY+++++ S+ YH N S KG+RSLI++GD DL  P +S 
Sbjct  323  REALHVVKGSIDKWVRCSSGKPYDSDIKSSVPYHMNNSIKGYRSLIFSGDHDLMAPFIST  382

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  383  QAWIRSLNY  391



>emb|CDP21040.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 149/275 (54%), Gaps = 28/275 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+PE+ S+ +Y+GGDSYSG  +P++ Q IS+GN+  ++P I+ KGYL+GN  
Sbjct  174  EFLRKWLVDHPEFISSPVYIGGDSYSGITVPIVTQIISDGNEVGIEPHIDLKGYLLGNPT  233

Query  184  THFSEHDYTYQFALGYGLISEEF-------ARKSYDD-------CITNPDK--------K  297
            T   + +Y  QFA G GLIS+E         +  Y +       C+ N +          
Sbjct  234  TTPGDGNYAIQFAHGMGLISDELYESLKLSCKGEYQNIDPSNALCLQNMEAYNQASNHFS  293

Query  298  PFFTKCQLDILRFVMLTFVNNPAYILDSVC-LINNGLEDLLSGKAF---VPIKRFNGVNA  465
              F     + L  + L    + A+IL+  C   +    +L  G+     V  K+   +  
Sbjct  294  ASFVLLYFEKLVTIQLLSNIDTAHILEPDCPYASPKPNNLFIGRRSTIQVFCKKTRELKI  353

Query  466  KIYNRYLLCKSDS--IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYH  639
                    C+ D   +   + N ESVQEALHV+KGSI  W +C    PY  N+ +S+ YH
Sbjct  354  LELAAPFTCRMDGYRLVYHWANDESVQEALHVRKGSIGEWIRCNCRYPYIRNIGNSLPYH  413

Query  640  ANLSTKGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            ANLS +G+RSLIY+GD D+ +P    +AW KSLNY
Sbjct  414  ANLSIRGYRSLIYSGDHDMIVPHFGTQAWIKSLNY  448



>ref|XP_006356866.1| PREDICTED: uncharacterized protein LOC102592829 [Solanum tuberosum]
Length=1021

 Score =   178 bits (452),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 144/254 (57%), Gaps = 20/254 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKW +D+PE+  N  YVGGDSYSG ++P++ Q I+  N+  ++P IN KGYL+GN  
Sbjct  154  QFLRKWFVDHPEFLKNPFYVGGDSYSGIVVPIITQIIAIKNEMEVEPFINLKGYLLGNPW  213

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCI-----TNPDKKPFFTKCQLDILRFVMLT  348
            T   E +Y   FA G GLISEE       +C       NP  K     C  D+  F+ L 
Sbjct  214  TFEGEDNYRIPFAYGMGLISEELYESFKSNCKGEYLNINPSNK----LCLQDVQTFIELL  269

Query  349  FVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYV  522
               +   IL+  C   +    LL G+     ++F+          L C++D    + Q+ 
Sbjct  270  QGIDVVNILEPNCGFTSPRPHLLFGQRRSLDEKFHQ---------LKCRNDLYKFSYQWT  320

Query  523  NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            +   V++AL+++KGSI  WE+C +NL YN  V  SI YH NLS+KG+RSLIY+GD D+ +
Sbjct  321  DDGQVRDALNIRKGSIGKWERCASNLQYNRMVMSSIPYHKNLSSKGYRSLIYSGDHDIVV  380

Query  703  PSLSAEAWTKSLNY  744
               S +AW KSLNY
Sbjct  381  TFRSTQAWIKSLNY  394


 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/252 (38%), Positives = 142/252 (56%), Gaps = 9/252 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGND-ARLKPAINFKGYLVGNG  180
            +F+ KW +D+ E+  N  YVGGDS SG ++P++ Q I+  N+   +KP IN KGYL+GN 
Sbjct  715  QFLHKWFVDHQEFLENPFYVGGDSCSGMVVPVITQIIAIKNEIMEVKPFINLKGYLLGNP  774

Query  181  VTHFSEHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRF-VMLTFV  354
             T   E +Y   FA G GLIS+E       +C     +  P    C  D+  F  +L  +
Sbjct  775  TTFEGEDNYRIPFAYGMGLISDELYESLKSNCNGEYFNINPSNVLCLQDVQTFNELLKGI  834

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQY--VNV  528
            NNP +IL+  C + +     L G+     ++ + +N       L C+++     Y   + 
Sbjct  835  NNP-HILEPKCKLFSPRPHQLFGERRSLDEKLHELNNL---PGLKCRNNWYKHSYHWADD  890

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            + V+ AL+++KG+I  WE+C +NL Y   V +SI YH NLS+KG+RSLIY+GD D  +  
Sbjct  891  DQVRNALNIRKGTIGKWERCASNLQYLMMVTNSIPYHENLSSKGYRSLIYSGDHDKLVTF  950

Query  709  LSAEAWTKSLNY  744
             S +AW KSLNY
Sbjct  951  QSTQAWIKSLNY  962



>ref|XP_010321496.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Solanum 
lycopersicum]
Length=454

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 153/259 (59%), Gaps = 27/259 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWLI++ EY +N  YVGGDSYSG  +P++ Q ISNGND  +KP IN KGY++GN V
Sbjct  152  EFIRKWLIEHKEYLNNPFYVGGDSYSGITVPIVTQVISNGNDMGIKPWINLKGYIIGNPV  211

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN--PDKKPFFTK---CQLDILRFVM  342
            T  ++ DY Y+  FA G GLI  E     Y+  +TN   D  P  +    C  DI  F  
Sbjct  212  TS-TDPDYKYKVPFAHGMGLIPNEL----YESFVTNCGRDYSPNDSTNQLCSRDIRTFDW  266

Query  343  LTFVNNPAYILDSVC-LINNGLEDLLSG--KAFVPIKRFNGVNAKIYNRYLLCKSD--SI  507
            L       +IL+S C L+++     L+G  +    +  F G+          C+ +   +
Sbjct  267  LIKDIYQYHILESPCELVSHDSRRSLAGNVQKLKNLSSFFGMK---------CREEWHEL  317

Query  508  AAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGD  687
            +  + N + VQ+ALHV+K S+  WE+CR+NL +   + +S++YHANLS KGFRSLIY+GD
Sbjct  318  SVIWANDKVVQDALHVRKTSM-AWERCRSNLSFGLIINNSVSYHANLSRKGFRSLIYSGD  376

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D+ +P  S + W KSL Y
Sbjct  377  HDMVVPFSSTQLWIKSLKY  395



>ref|XP_003604932.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87129.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=428

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 146/257 (57%), Gaps = 23/257 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+GGDSYSG  +P + Q ISNGN+  L P IN +GYL+GN +
Sbjct  168  QFLRKWLIDHPEFLSNEFYIGGDSYSGIPVPAILQEISNGNEKGLLPLINLQGYLLGNPI  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T + E +Y   +A G GLIS+E       +C     N D +     C  D+  F      
Sbjct  228  TTYKEDNYQIPYAHGMGLISDELYASLQRNCKGEYINVDSRNEL--CLRDLQSFDECLSG  285

Query  355  NNPAYILDSVC-----LINNGLEDLL--SGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAA  513
             N   ILDS C     L    L ++L  S  + + +     ++ +IY  YL       A 
Sbjct  286  INTFNILDSYCEDDSHLWRRSLTEVLKKSSSSHLTVPE---LSCQIYGFYL-------AT  335

Query  514  QYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRD  693
            ++ N E+V++ALH+++GSI  WE+C     +   +  S+ +HANLS KG+RSLIY+GD D
Sbjct  336  KWANDENVRKALHIREGSIGKWERCYTT-DFEREIFSSVEFHANLSKKGYRSLIYSGDHD  394

Query  694  LFIPSLSAEAWTKSLNY  744
              +P +S +AW + LNY
Sbjct  395  AVVPFMSTQAWIRDLNY  411



>ref|XP_003593859.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES64110.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/252 (38%), Positives = 148/252 (59%), Gaps = 8/252 (3%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+P++QSN +Y+ GDSYSG  IP++ Q I+ GN+  ++P IN +GYL+GN  
Sbjct  162  QFLRKWLVDHPKFQSNEVYIAGDSYSGIPIPVIVQKIAEGNEKGVQPWINLQGYLLGNAA  221

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTK---CQLDILRFVMLTFV  354
                E +Y   FA G GLIS+E       +C  N D     T+   C  DI  F  +T  
Sbjct  222  ITGKEKNYVIPFAHGMGLISDELYDSLQKNC--NGDYINVETRNVLCSRDISSFDEVTSG  279

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNV  528
             +  +IL+  C   +  E+    ++ +     N +N  +    L C+S +  +   + N 
Sbjct  280  IHEPHILEPSCEWLDNTEN-SPRRSLINKDPTNFLNTNLKLPLLSCRSYTYFLMGYWAND  338

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ++V++ALH++KGS+  W +C  N+P+  ++ +S  Y  NLS KG RSLIY+GD D+ IP 
Sbjct  339  DNVRKALHIQKGSVAKWHRCTFNIPHKKDIPNSYDYLVNLSRKGIRSLIYSGDHDMKIPF  398

Query  709  LSAEAWTKSLNY  744
            L+ +AW +SLNY
Sbjct  399  LATQAWIRSLNY  410



>dbj|BAF99697.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=494

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/262 (37%), Positives = 153/262 (58%), Gaps = 15/262 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFK--------  159
            +F++K+L+ +PE+ SN LYVGGDSY+G  +P++A+ I++GN+  ++P+IN K        
Sbjct  174  QFLKKFLVHHPEFLSNPLYVGGDSYAGLFVPVVAELIAHGNENGIEPSINLKIFPSECFF  233

Query  160  --GYLVGNGVTHFSEHDYTYQFALGYGLISEEFARKSYDDC-ITNPDKKPFFTKCQLDIL  330
              GY++GN +T   + DY   F+ G G+IS+E       +C     D  P  TKC  DI 
Sbjct  234  DLGYVLGNPLTTPYDVDYRVPFSHGMGIISDELYESLKLNCNGVYHDVDPTNTKCLNDID  293

Query  331  RFVMLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY--LLCKSDS  504
             F  +      ++IL+  C+     + +LS +    +   N     + N +    C++D 
Sbjct  294  TFKQVFHGIRRSHILEPYCVSVLPEQQMLSTERQRSLHENNLRIPDVLNMHHTFRCRTDG  353

Query  505  IAAQY--VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIY  678
                Y   N + V+EALH+ KGSI NW +C  +LP+ +++R+ + YHANLS KG+RSLIY
Sbjct  354  YIPAYYWANDDRVREALHIHKGSIKNWVRCNRSLPFEDSIRNVVPYHANLSKKGYRSLIY  413

Query  679  NGDRDLFIPSLSAEAWTKSLNY  744
            +GD D  +P ++ +AW +SLNY
Sbjct  414  SGDHDAMVPFMATQAWIRSLNY  435



>ref|XP_003604931.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87128.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=470

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 146/257 (57%), Gaps = 23/257 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+GGDSYSG  +P + Q ISNGN+  L P IN +GYL+GN +
Sbjct  168  QFLRKWLIDHPEFLSNEFYIGGDSYSGIPVPAILQEISNGNEKGLLPLINLQGYLLGNPI  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T + E +Y   +A G GLIS+E       +C     N D +     C  D+  F      
Sbjct  228  TTYKEDNYQIPYAHGMGLISDELYASLQRNCKGEYINVDSRNEL--CLRDLQSFDECLSG  285

Query  355  NNPAYILDSVC-----LINNGLEDLL--SGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAA  513
             N   ILDS C     L    L ++L  S  + + +     ++ +IY  YL       A 
Sbjct  286  INTFNILDSYCEDDSHLWRRSLTEVLKKSSSSHLTVPE---LSCQIYGFYL-------AT  335

Query  514  QYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRD  693
            ++ N E+V++ALH+++GSI  WE+C     +   +  S+ +HANLS KG+RSLIY+GD D
Sbjct  336  KWANDENVRKALHIREGSIGKWERCYTT-DFEREIFSSVEFHANLSKKGYRSLIYSGDHD  394

Query  694  LFIPSLSAEAWTKSLNY  744
              +P +S +AW + LNY
Sbjct  395  AVVPFMSTQAWIRDLNY  411



>gb|AFK49380.1| unknown [Medicago truncatula]
Length=470

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 146/257 (57%), Gaps = 23/257 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+GGDSYSG  +P + Q ISNGN+  L P IN +GYL+GN +
Sbjct  168  QFLRKWLIDHPEFLSNEFYIGGDSYSGIPVPAILQEISNGNEKGLLPLINLQGYLLGNPI  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T + E +Y   +A G GLIS+E       +C     N D +     C  D+  F      
Sbjct  228  TTYKEDNYQIPYAHGMGLISDELYASLQRNCKGEYINVDSRNEL--CLRDLQSFDECLSG  285

Query  355  NNPAYILDSVC-----LINNGLEDLL--SGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAA  513
             N   ILDS C     L    L ++L  S  + + +     ++ +IY  YL       A 
Sbjct  286  INTFNILDSYCEDDSHLWRRSLTEVLKKSSSSHLTVPE---LSCQIYGFYL-------AT  335

Query  514  QYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRD  693
            ++ N E+V++ALH+++GSI  WE+C     +   +  S+ +HANLS KG+RSLIY+GD D
Sbjct  336  KWANDENVRKALHIREGSIGKWERCYTT-DFEREIFSSVEFHANLSKKGYRSLIYSGDHD  394

Query  694  LFIPSLSAEAWTKSLNY  744
              +P +S +AW + LNY
Sbjct  395  AVVPFMSTQAWIRDLNY  411



>ref|XP_009126133.1| PREDICTED: serine carboxypeptidase-like 3 isoform X3 [Brassica 
rapa]
Length=365

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 141/249 (57%), Gaps = 10/249 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL  + E+ SN  YV GDSYSG +IP   Q IS GND   KP +N +GY++GN V
Sbjct  67   EFIRKWLSKHTEFISNPFYVAGDSYSGKIIPATVQEISKGNDLGFKPQVNLEGYVLGNPV  126

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T F  +H++   FA G  LIS+E       +C  N +   P  T+C     +++      
Sbjct  127  TDFELDHNHCIPFAHGMALISDELYESLKRNCKGNYENIDPHNTECLKHHDKYLKCISSI  186

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C        L   + F+ ++    V+A +        +D IA+ + N ESV
Sbjct  187  NVVHILMPRCD-----PPLFLQRRFILLRN---VSAPLIADGCYIYTDLIASLWANDESV  238

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALHV KGSI+ W +C +  PY+ +++ S+ YH N S KG+RS+I++GD DL +P  S 
Sbjct  239  RKALHVVKGSIEKWVRCSSGKPYDFDIKSSVPYHMNNSIKGYRSIIFSGDHDLVVPFPST  298

Query  718  EAWTKSLNY  744
            +AW +SL Y
Sbjct  299  QAWIRSLGY  307



>ref|XP_004292764.1| PREDICTED: serine carboxypeptidase-like 18-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 156/258 (60%), Gaps = 15/258 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+R+WL+D+P + SN  Y+GGDSYSG  +P+LA+ ISNGN+A +KP IN +GY++GN V
Sbjct  161  QFLRRWLVDHPSFMSNPFYIGGDSYSGIPVPVLAEQISNGNEAGVKPIINLQGYILGNPV  220

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    E +    FA G GLIS+E        C  +  D  P   +C  ++  F   T   
Sbjct  221  TVRQYEVNSEIPFAHGMGLISDELYESLTTSCRGDFQDVDPSNVECVKNVQAFDECTSHI  280

Query  358  NPAYILDSVC--LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLL----CKSDS--IAA  513
            N A+IL+  C  LI+  L+ +L  + +  +   NG++   ++R  L    C++    ++ 
Sbjct  281  NFAHILERHCDGLISPKLQHMLGKRRY--LSDNNGLHH--HSRSPLPTFGCRTYGYLLSQ  336

Query  514  QYVNVESVQEALHVKKGSIDNWEQCRANLPYNNN-VRDSIAYHANLSTKGFRSLIYNGDR  690
             + N   V++ LH++KGSI NW++C  ++PY  + + +S+ YH NLS KG+ SLIY+GD 
Sbjct  337  YWANDPVVRKVLHIRKGSIGNWQRCDYDMPYVADLLGNSLQYHVNLSAKGYPSLIYSGDH  396

Query  691  DLFIPSLSAEAWTKSLNY  744
            D+ +P L  +AW +SLNY
Sbjct  397  DMLVPFLGTQAWIRSLNY  414



>gb|KHN06942.1| Serine carboxypeptidase-like 19 [Glycine soja]
Length=475

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 143/254 (56%), Gaps = 12/254 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLI++P + S  +Y+GGDSYSG  IP + Q IS GN+  L+P IN +GYL+GN  
Sbjct  168  QFLRKWLIEHPNFLSTDVYIGGDSYSGITIPAIVQEISLGNEKGLQPWINLQGYLLGNPA  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T     +Y   FA G GLIS+E  R    +C     N D K     C  +I  F  +T  
Sbjct  228  TTRRHENYRIPFAHGMGLISDELYRSLQKNCKGEYINVDTKNVL--CSRNIETFNEVTSG  285

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIK--RFNGVNAKIYNRYLLCKSDS--IAAQYV  522
             +   ILD  C   + L+   S +  +  K  R N +N  +    L C+S +  +   + 
Sbjct  286  LSMVNILDPSC---DWLDTETSWRRSLLKKYPRKNFLNTHLKLPSLNCRSYAYFLCGYWA  342

Query  523  NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            N +SV+ ALH++KG+I  W +C  N+P   ++  S  YH NLS KG+RSLIY+GD D+ I
Sbjct  343  NDDSVRSALHIRKGTIGKWRRCTFNIPNKEDISSSYEYHVNLSRKGYRSLIYSGDHDMKI  402

Query  703  PSLSAEAWTKSLNY  744
            P L  +AW  SLNY
Sbjct  403  PFLETQAWISSLNY  416



>ref|XP_009126131.1| PREDICTED: serine carboxypeptidase-like 3 isoform X2 [Brassica 
rapa]
Length=366

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 141/249 (57%), Gaps = 10/249 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL  + E+ SN  YV GDSYSG +IP   Q IS GND   KP +N +GY++GN V
Sbjct  68   EFIRKWLSKHTEFISNPFYVAGDSYSGKIIPATVQEISKGNDLGFKPQVNLEGYVLGNPV  127

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T F  +H++   FA G  LIS+E       +C  N +   P  T+C     +++      
Sbjct  128  TDFELDHNHCIPFAHGMALISDELYESLKRNCKGNYENIDPHNTECLKHHDKYLKCISSI  187

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C        L   + F+ ++    V+A +        +D IA+ + N ESV
Sbjct  188  NVVHILMPRCD-----PPLFLQRRFILLRN---VSAPLIADGCYIYTDLIASLWANDESV  239

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALHV KGSI+ W +C +  PY+ +++ S+ YH N S KG+RS+I++GD DL +P  S 
Sbjct  240  RKALHVVKGSIEKWVRCSSGKPYDFDIKSSVPYHMNNSIKGYRSIIFSGDHDLVVPFPST  299

Query  718  EAWTKSLNY  744
            +AW +SL Y
Sbjct  300  QAWIRSLGY  308



>ref|NP_001242803.1| uncharacterized protein LOC100794342 [Glycine max]
 gb|ACU21515.1| unknown [Glycine max]
Length=485

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 143/254 (56%), Gaps = 12/254 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLI++P + S  +Y+GGDSYSG  IP + Q IS GN+  L+P IN +GYL+GN  
Sbjct  178  QFLRKWLIEHPNFLSTDVYIGGDSYSGITIPAIVQEISLGNEKGLQPWINLQGYLLGNPA  237

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T     +Y   FA G GLIS+E  R    +C     N D K     C  +I  F  +T  
Sbjct  238  TTRRHENYRISFAHGMGLISDELYRSLQKNCKGEYINVDTKNVL--CSRNIETFNEVTSG  295

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIK--RFNGVNAKIYNRYLLCKSDS--IAAQYV  522
             +   ILD  C   + L+   S +  +  K  R N +N  +    L C+S +  +   + 
Sbjct  296  LSMVNILDPSC---DWLDTETSWRRSLLKKYPRKNFLNTHLKLPSLNCRSYAYFLCGYWA  352

Query  523  NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            N +SV+ ALH++KG++  W +C  N+P   ++  S  YH NLS KG+RSLIY+GD D+ I
Sbjct  353  NDDSVRSALHIRKGTVGKWRRCTFNIPNKEDISSSYEYHVNLSRKGYRSLIYSGDHDMKI  412

Query  703  PSLSAEAWTKSLNY  744
            P L  +AW  SLNY
Sbjct  413  PFLETQAWISSLNY  426



>gb|AES73172.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=496

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 154/257 (60%), Gaps = 15/257 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+P++ SN +Y+ GDSYSG  IP++ Q IS GN+  L+P IN +GY++GN V
Sbjct  186  QFLRKWLIDHPKFISNEVYIAGDSYSGLPIPIIVQEISYGNEGGLQPWINLQGYILGNPV  245

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLT  348
            T +  HD  Y+  F  G GLIS+E       +C     N D +  F  C  DI  +    
Sbjct  246  T-WPAHDDNYKIPFNHGMGLISDELYESLQKNCRGEYKNIDPQNVF--CLEDIQSYQETI  302

Query  349  FVNNPAYILDSVCLINNGLEDLL--SGKAFVPIKRFNGV-NAKIYNRYLLCKSDS--IAA  513
                  +IL+S C    GL + L  +G+  + I + N +  + +    L C+S +  + A
Sbjct  303  SGVYEVHILESKCEF--GLPNPLEANGRRRLLIHKANTIFTSSLTLPPLNCRSHAYFLGA  360

Query  514  QYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRD  693
             + N  +VQ ALH++KGSI  W++C  ++P+ + + +S  YH NLS KG+RSLIY+GD D
Sbjct  361  YWANDANVQNALHIRKGSIGKWKRCNFDIPFKHEIDNSFEYHVNLSRKGYRSLIYSGDHD  420

Query  694  LFIPSLSAEAWTKSLNY  744
            + +P ++ +AW +SLNY
Sbjct  421  MKVPFVATQAWIRSLNY  437



>dbj|BAO04182.1| hypothetical protein [Delphinium grandiflorum]
Length=475

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/255 (41%), Positives = 142/255 (56%), Gaps = 14/255 (5%)
 Frame = +1

Query  10   IRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVTH  189
            IRKWLID+P++ SN++YVGGDSYSG  +P+  Q ISNG +A  K  INFKGYL+GN +T 
Sbjct  166  IRKWLIDHPKFLSNAMYVGGDSYSGKTVPITVQHISNGIEAGDKLLINFKGYLLGNPITD  225

Query  190  FSEHDY-TYQFALGYGLISEEFARKSYDDCI-----TNPDKKPFFTKCQLDILRFVMLTF  351
                +Y T QFA G G+ISEE       +C       NPD      KC  DI R    T 
Sbjct  226  PDLGEYSTIQFAHGMGIISEELFESITKNCKGEYVNINPDN----VKCTKDIQRVSKCTN  281

Query  352  VNNPAYILDSVC-LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQY--V  522
              N A+IL+  C L+     +++  +  +             +    C+S      Y   
Sbjct  282  GLNRAHILEPHCLLVTPKPNEIIKERRLLEKNSPTTFALPPVDPGFECRSYGYMLSYYWA  341

Query  523  NVESVQEALHVKKGSIDNWEQC-RANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
            N + VQ+AL ++KG +  W +C + +L Y  +V+ S  YH NLS KG+RSLIY+GD D+ 
Sbjct  342  NDKEVQKALKIRKGMVQEWVRCNKEDLHYVYDVKASTGYHLNLSRKGYRSLIYSGDHDMI  401

Query  700  IPSLSAEAWTKSLNY  744
            +P +  EAW KSLNY
Sbjct  402  VPYMGTEAWIKSLNY  416



>dbj|BAF99694.1| 1-O-acylglucose:anthocyanin-O-acyltransferase [Clitoria ternatea]
Length=487

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 146/254 (57%), Gaps = 11/254 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+P++  N LY+GGDSYSG  IP++ Q IS  N+  ++P IN +GY++GN +
Sbjct  163  EFLRKWLIDHPKFLQNELYIGGDSYSGIPIPVIVQEISQENEKGIQPWINLQGYILGNAI  222

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E  Y+  FA G  LIS+E       +C     +  P    C  DI  +   T   +
Sbjct  223  TTRREKGYSIPFAHGMALISDELYESLRKNCKGEYLNVDPENVLCSRDIDSYSKATSRIS  282

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNG---VNAKIYNRYLLCKS--DSIAAQYVN  525
             A+IL+  C  N+G  D+ +      I+R +    +N  +    L C++  +     + N
Sbjct  283  FAHILERTC--NSG--DIKTSLRRSTIQRHHTKKFLNTNLKLPPLTCRTYANFQCGLWAN  338

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIYNGDRDLFI  702
             ++V+ ALH+ KGSI  W +C   LP+ +++ +S  YH NLS KG +RSLIY+GD D+ +
Sbjct  339  DDNVRSALHIHKGSIGEWHRCSIRLPFTSDIPNSFEYHVNLSRKGYYRSLIYSGDHDMMV  398

Query  703  PSLSAEAWTKSLNY  744
            P L  +AW +SLNY
Sbjct  399  PFLGTQAWIRSLNY  412



>ref|XP_009768014.1| PREDICTED: serine carboxypeptidase-like 17 [Nicotiana sylvestris]
Length=477

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 105/259 (41%), Positives = 149/259 (58%), Gaps = 17/259 (7%)
 Frame = +1

Query  4    EFIRKWLI-DYPEYQSNSLYVGGDSYSGTLIPMLAQAIS--------NGNDARLKPAINF  156
            +F+RKWL+ ++PEY +N  YVGGDSYSG  +P++ Q IS           DA +KP I+ 
Sbjct  165  QFLRKWLLTEHPEYINNPFYVGGDSYSGITLPVVTQVISLCKYFFWGQWIDAGIKPWIDL  224

Query  157  KGYLVGNGVTHFSEHD-YTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDIL  330
            KGY++GN VT   + D Y   FA G GLIS+E  +    +C    +   P  T C  D+ 
Sbjct  225  KGYILGNPVTIIPDQDNYKIPFAHGMGLISDELYKSLKGNCGGEYNHINPSNTLCSKDMR  284

Query  331  RFVMLTFVNNPAYILDSVCLIN-NGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSI  507
             F  L      A+IL+  C  +  G    L+ K  + +        K    +L      +
Sbjct  285  TFNWLLKGIVAAHILEPNCDQSLYGSRRSLARKLPLELNTPAKPGVKCLGDWL-----HL  339

Query  508  AAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGD  687
            +  + N E+V+EALHV+KG+I  WE+CR+NLP+  NV ++I+YHA LSTKG +SLIY+GD
Sbjct  340  SEIWANDENVREALHVRKGTIGAWEKCRSNLPFTMNVNNTISYHAYLSTKGLKSLIYSGD  399

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D+  P +S +AW KSLNY
Sbjct  400  HDMITPFISTQAWIKSLNY  418



>gb|AES87127.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 138/253 (55%), Gaps = 15/253 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+G DSYSG  +P + Q ISNGN+  L+P IN +GYL+GN  
Sbjct  167  QFLRKWLIDHPEFLSNEFYIGADSYSGIPVPAVLQEISNGNEKGLQPLINLQGYLLGNPY  226

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTK-CQLDILRFVMLTFVNN  360
            T   E +Y  Q+A G GLIS+E       +C        +  + C  D+  F       N
Sbjct  227  TTHKEDNYQIQYAHGMGLISDELYASLQRNCKGEYIDVDYRNELCLRDLRSFDECLSGIN  286

Query  361  PAYILDSVC-----LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVN  525
               ILD  C     L    L+  L      P+     ++  IY  YL       A ++ N
Sbjct  287  KENILDGFCEDDSRLWRRSLKQELGAPLSSPLT-VPKLSCHIYRFYL-------ATKWAN  338

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
             ESV++ALH+++GSI  WE+C     +   +  S+ +H NLS KG+RSLIY+GD DL +P
Sbjct  339  DESVRKALHIREGSIGKWERCYTT-DFEREIFSSVEFHVNLSKKGYRSLIYSGDLDLVVP  397

Query  706  SLSAEAWTKSLNY  744
              S +AW + LNY
Sbjct  398  FQSTQAWIRDLNY  410



>emb|CDX85493.1| BnaA02g03200D [Brassica napus]
Length=452

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 141/249 (57%), Gaps = 10/249 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL  + E+ SN  YV GDSYSG +IP   Q IS GND   KP +N +GY++GN V
Sbjct  154  EFIRKWLSKHTEFISNPFYVAGDSYSGKIIPATVQEISKGNDLGFKPQVNLEGYVLGNPV  213

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T F  +H++   FA G  LIS+E       +C  N +   P  T+C     +++      
Sbjct  214  TDFELDHNHCIPFAHGMALISDELYESLKRNCKGNYENIDPHNTECLKHHDKYLKCISSI  273

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C        L   + F+ ++    V+A +        +D IA+ + N ESV
Sbjct  274  NVVHILMPRCD-----PPLFLQRRFILLRN---VSAPLIADGCYIYTDLIASLWANDESV  325

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALHV KGSI+ W +C +  PY+ +++ S+ YH N S KG+RS+I++GD DL +P  S 
Sbjct  326  RKALHVVKGSIEKWVRCSSGKPYDFDIKSSVPYHMNNSIKGYRSIIFSGDHDLVVPFPST  385

Query  718  EAWTKSLNY  744
            +AW +SL Y
Sbjct  386  QAWIRSLGY  394



>ref|XP_009126130.1| PREDICTED: serine carboxypeptidase-like 12 isoform X1 [Brassica 
rapa]
Length=452

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 141/249 (57%), Gaps = 10/249 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL  + E+ SN  YV GDSYSG +IP   Q IS GND   KP +N +GY++GN V
Sbjct  154  EFIRKWLSKHTEFISNPFYVAGDSYSGKIIPATVQEISKGNDLGFKPQVNLEGYVLGNPV  213

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T F  +H++   FA G  LIS+E       +C  N +   P  T+C     +++      
Sbjct  214  TDFELDHNHCIPFAHGMALISDELYESLKRNCKGNYENIDPHNTECLKHHDKYLKCISSI  273

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C        L   + F+ ++    V+A +        +D IA+ + N ESV
Sbjct  274  NVVHILMPRCD-----PPLFLQRRFILLRN---VSAPLIADGCYIYTDLIASLWANDESV  325

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALHV KGSI+ W +C +  PY+ +++ S+ YH N S KG+RS+I++GD DL +P  S 
Sbjct  326  RKALHVVKGSIEKWVRCSSGKPYDFDIKSSVPYHMNNSIKGYRSIIFSGDHDLVVPFPST  385

Query  718  EAWTKSLNY  744
            +AW +SL Y
Sbjct  386  QAWIRSLGY  394



>dbj|BAF99695.1| 1-O-acylglucose:anthocyanin-O-acyltransferase [Clitoria ternatea]
Length=469

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/256 (36%), Positives = 143/256 (56%), Gaps = 17/256 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLID+P++ SN +Y+GGDSYSG  +P + Q IS GN+  ++P+IN +GY++GN  
Sbjct  163  EFLRKWLIDHPKFLSNEVYIGGDSYSGITVPAIVQEISQGNEKGIQPSINLQGYILGNAF  222

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC----ITNPDKKPFFTKCQL---DILRFVM  342
            T   E +Y   FA G  LIS+E       +C    I    K    ++      +++  + 
Sbjct  223  TTRKEENYAIPFAHGMALISDELYESLQKNCKGEYIDVDTKNALCSRVMESYNEVISGIS  282

Query  343  LTFVNNP-AYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQY  519
             + +  P    +D+   +   L     GK F+   R   ++ + Y  +        ++ +
Sbjct  283  FSHILEPNCDWVDTETSLRRSLIQRHHGKKFLNT-RLPALSCRTYANFQ-------SSFW  334

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIYNGDRDL  696
             N ++V+ ALH++KGSI  W +C  NLPY  ++  S  YH NLS KG +RSL+Y+GD DL
Sbjct  335  ANDDNVRSALHIRKGSIGKWRRCTRNLPYTEDIPSSFEYHVNLSGKGYYRSLVYSGDHDL  394

Query  697  FIPSLSAEAWTKSLNY  744
             +P L  +AW +SLNY
Sbjct  395  MVPFLGTQAWIRSLNY  410



>ref|XP_007159376.1| hypothetical protein PHAVU_002G233100g [Phaseolus vulgaris]
 gb|ESW31370.1| hypothetical protein PHAVU_002G233100g [Phaseolus vulgaris]
Length=480

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 152/255 (60%), Gaps = 14/255 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+P + SN +Y+GGDSYSG  IP++ Q IS GN+  ++P IN +GYL+GN +
Sbjct  173  QFLRKWLIDHPTFLSNEVYIGGDSYSGIPIPVIVQEISQGNEKGVQPWINLQGYLLGNAL  232

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   E++    F+ G GLIS+E      ++C     + D K     C  D+  F   T  
Sbjct  233  TTRRENNSRIPFSHGMGLISDELYNSLQNNCKGEYIDVDTKNVL--CTRDMELFNETTSG  290

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRF---NGVNAKIYNRYLLCKSDS--IAAQY  519
             + +YIL   C +   L+   S +  + I+++   N +N+++    L C S    + + +
Sbjct  291  ISSSYILGPSCEV---LDTETSWRRSL-IRKYPSRNFLNSRLKLPSLSCWSYVYFLCSFW  346

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
             N ++V+ ALH+++GSI  W +C  ++P  +++  S  YH NLS  G+RSLIY+GD DL 
Sbjct  347  ANDDNVRTALHIRQGSIGQWRRCSMHIPQKHDIPSSFEYHVNLSKMGYRSLIYSGDHDLL  406

Query  700  IPSLSAEAWTKSLNY  744
            IP L+ +AW +SLNY
Sbjct  407  IPFLATQAWIRSLNY  421



>gb|KEH36682.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=360

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 144/252 (57%), Gaps = 15/252 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+++P++QSN +Y+ GDSYSG  IP + Q I+ GN+  L+P IN +GY++GN +
Sbjct  60   EFLRKWLVEHPKFQSNEIYIAGDSYSGITIPAIVQEIAQGNEKGLQPKINLQGYVLGNPL  119

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   E +Y   +A G G +S+E       +C    TN D K     C  DI  +  +   
Sbjct  120  TIRKEKNYQIPYAHGMGFLSDELYESLQKNCNGDYTNVDPKNLL--CSRDINSYDEVIKG  177

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVP--IKRFNGVNAKIYNRYLLCKSDSIAAQYVNV  528
             N A+ILD         E++L  ++ +   + R   ++   Y + L       +  + N 
Sbjct  178  INTAHILDPTECRWLRPENILR-RSLIKKYLSRVPPISCPNYPQLL-------SGYWANN  229

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
             +V++ALH+++G+I  W +    +PY  ++ +S  YH NLS KG+RSLIY+GD D+ IP 
Sbjct  230  STVRKALHIREGTIGKWSRRSDRIPYTGDISNSFDYHVNLSDKGYRSLIYSGDHDISIPF  289

Query  709  LSAEAWTKSLNY  744
            L  +AW KSLNY
Sbjct  290  LDTKAWIKSLNY  301



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 146/265 (55%), Gaps = 27/265 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL D+P++ S+ +YV GDSYSG  IP+LAQ I NGN+  ++P I+ +GY++GN  
Sbjct  159  QFLRKWLKDHPDFISSPVYVSGDSYSGIPIPVLAQEILNGNEEGIRPIISLQGYVLGNPA  218

Query  184  THFS-EHDYTYQFALGYGLISEEF---ARKSYDDCITNPDKKPFFTKCQLDILRFVMLTF  351
            T  S E +    +A G GLIS+E     ++S D      D  P   +C+ DI  F     
Sbjct  219  TVPSLEANLKIPYAHGMGLISDELYESLKRSCDGEYQTVD--PSNVECEKDIQYFSKCIS  276

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKR--------------FNGVNAKIYNRYLL  489
               PA IL+ +C   +     + GK  +  +                  +  + Y  YLL
Sbjct  277  GIQPAQILEPICPFASPRPQEIGGKRDLEEQHGEVLLEDEPPPPPPLPTLGCRTY-AYLL  335

Query  490  CKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRS  669
            C        + N  +VQ+ALH++KGSI  W++C   LPY  +V  S  YHANLS +G R+
Sbjct  336  CY------YWANDNNVQKALHIRKGSIGQWQRCTLGLPYTADVPSSFPYHANLSARGIRA  389

Query  670  LIYNGDRDLFIPSLSAEAWTKSLNY  744
            LIY+GD DL +P L+ +AW +SLNY
Sbjct  390  LIYSGDHDLTVPFLATQAWIRSLNY  414



>ref|XP_006356867.1| PREDICTED: serine carboxypeptidase-like 19-like [Solanum tuberosum]
Length=839

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 141/250 (56%), Gaps = 12/250 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKW +D+PE+  N  YVGGDSYSG  +P L Q I+  N+  ++P IN KGYL+GN  
Sbjct  149  QFLRKWFVDHPEFLKNPFYVGGDSYSGRTVPFLTQIIAIKNEMEVEPFINLKGYLLGNPS  208

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F  G  LIS+E        C     +  P  T C  D+  F  L    N
Sbjct  209  TFEGEANYKIPFTHGMALISDELYESLKTHCKGEYLNINPSNTLCFQDVQTFKELLKGIN  268

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVNVES  534
              YIL+  C+  +    LL G+          ++ K +   L C++D   ++  + + + 
Sbjct  269  VPYILEPKCVFASPRPHLLLGQR-------RSLDEKCHQ--LKCRTDWYKLSYHWADDDQ  319

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V++AL+++KG+I  WE+C  NL Y N + +SI YH NLS KG+RSLIY+GD D+ +  LS
Sbjct  320  VRDALNIRKGTIGKWERCARNLQYENMIFNSIPYHENLSRKGYRSLIYSGDHDMNVTFLS  379

Query  715  AEAWTKSLNY  744
             ++W +SLNY
Sbjct  380  TQSWIRSLNY  389


 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 143/254 (56%), Gaps = 20/254 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+ KW +D+PE+  N  YVGGDSYSG ++P LAQ I+  N+  ++P IN KGYL+GN +
Sbjct  540  QFLHKWFVDHPEFLKNPFYVGGDSYSGRIVPFLAQIIAIKNEMEVEPFINLKGYLLGNPL  599

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCI-----TNPDKKPFFTKCQLDILRFVMLT  348
            T   E +Y   FA G  LIS+E        C       NP+     T C  D+  F  L 
Sbjct  600  TFEGEANYKIPFAHGMALISDELYESLKSHCKGEYLNINPNN----TLCLQDVQTFKELL  655

Query  349  FVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYV  522
               N  YIL+  C+  +    LL G+          ++ K   R L C+ D   ++  + 
Sbjct  656  KGINVHYILEPKCVFASPRPYLLFGQR-------RSLDEKC--RQLKCRHDWYKLSYHWA  706

Query  523  NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            + + V++AL+++KG+I  WE+C  NL Y   + +SI YH NLS+K +RSLIY+GD D+ +
Sbjct  707  DDDQVRDALNIRKGTIGKWERCARNLQYEKMIFNSIPYHENLSSKVYRSLIYSGDHDMNV  766

Query  703  PSLSAEAWTKSLNY  744
              LS ++W +SLNY
Sbjct  767  TFLSTQSWIRSLNY  780



>ref|XP_007136774.1| hypothetical protein PHAVU_009G072900g [Phaseolus vulgaris]
 gb|ESW08768.1| hypothetical protein PHAVU_009G072900g [Phaseolus vulgaris]
Length=464

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 144/253 (57%), Gaps = 11/253 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN +Y+ GDSY G  IP+L Q IS GN   ++P IN +GYL+GN +
Sbjct  158  QFLRKWLMDHPEFLSNEVYIAGDSYCGLPIPILVQEISYGNQGGIQPWINLQGYLLGNPI  217

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVNN  360
            T  +E +Y   F  G  LIS+E       +C     K  P  T C  D+  +        
Sbjct  218  TTSTEKNYEIPFNHGMSLISDELYESLQKNCRGEYQKIDPRNTFCARDMQSYEESISGIE  277

Query  361  PAYILDSVC---LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVN  525
              ++L+  C    + N  ED  + +     +      + +    L C++ +  ++  + N
Sbjct  278  IGHVLEPHCEESALRNPTEDSWNWR-----RSLAHETSPLTLPPLSCRNHAYVLSTYWAN  332

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
             ++V++ALHV+KGSI  W++C  ++P+  ++  S  YH NLS KG+RSLIY+GD D+ +P
Sbjct  333  DDNVRKALHVRKGSIGKWKRCNHDIPFETDIYTSFEYHLNLSRKGYRSLIYSGDHDMVVP  392

Query  706  SLSAEAWTKSLNY  744
             LS +AW ++LNY
Sbjct  393  LLSTQAWIRALNY  405



>ref|XP_009131551.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Brassica 
rapa]
Length=447

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 140/249 (56%), Gaps = 13/249 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL ++ E+ SN  YV GDSYSG +IP + Q IS GND   KP IN +G+++GN V
Sbjct  152  EFIRKWLSEHKEFISNPFYVSGDSYSGKIIPAMVQEISKGNDLGFKPQINLEGFVIGNPV  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T    EH+    FA G  LIS+E        C  N D   P  T+C      F+      
Sbjct  212  TDTEFEHNQRIPFAHGMALISDELYESLKRSCKGNYDNIDPHNTECLKHFDEFLKCISRI  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N A IL   C      +  LS + ++ +      +A   +      +D +++ + N ESV
Sbjct  272  NFANILIPRC------DQALSPRRYILLPN---TSAPSTDDDCYEYTDLLSSLWANDESV  322

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHV  GSID W +C +  PY+++++ S+ YH N S KG+RSLI++GD DL  P +S 
Sbjct  323  REALHV--GSIDKWVRCSSGKPYDSDIKSSVPYHMNNSIKGYRSLIFSGDHDLMAPFIST  380

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  381  QAWIRSLNY  389



>emb|CDP01265.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 144/254 (57%), Gaps = 8/254 (3%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+PE+ S+ +Y+GGDS +G  +P++ Q IS+GN   ++P I+ KGY++GN V
Sbjct  174  EFLRKWLVDHPEFISSPVYIGGDSKAGISVPIVTQLISDGNAVGIEPHIDLKGYILGNPV  233

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   + +Y  QF  G GLIS+E        C     N D         ++        F 
Sbjct  234  TTPGDGNYAIQFTHGMGLISDELYESLKLSCKGEYQNIDPSNALCLQNMEAYNQASNHFS  293

Query  355  NNPAYILDSVC-LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCK-SDS--IAAQYV  522
             + A+IL+  C   +    +L +G+    I+ F     ++  + L    +D   +   + 
Sbjct  294  ASFAHILEPYCPYASPKPNNLFTGRRST-IQVFCEKTRELKIQELAAPFTDGYRLVYHWA  352

Query  523  NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            N ESVQEALHV+KGSI  W +C    P+  N+ +S+ YHANLS +G+RSLIY+GD D+ +
Sbjct  353  NDESVQEALHVRKGSIGEWIRCNCRYPFIRNIGNSLPYHANLSIRGYRSLIYSGDHDMVV  412

Query  703  PSLSAEAWTKSLNY  744
            P    +AW KSLNY
Sbjct  413  PHFGTQAWVKSLNY  426



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 143/270 (53%), Gaps = 39/270 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN  YVGGDSYSG  +P L Q ISN N+  +KP IN +GY++GN  
Sbjct  155  QFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLINLQGYILGNPR  214

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCI-----TNPDKKPFFTKCQLDILRFVML  345
            T    E +    FA G GLIS E        C       +P+ K     C  DI  F  L
Sbjct  215  TDMVVEQNSQIPFAHGMGLISNELYESLKITCGGEYVNVDPNNK----DCLNDIQTFSKL  270

Query  346  TFVNNPAYILDSVCL-----------------INNGLEDLLSGKAFVPIKRFNGVNAKIY  474
            T     ++IL+  C                  +N   ++ L      P   F  +  + Y
Sbjct  271  TSGVEKSHILEPHCQFFSPKPRASSRNRRSLNVNEQSQEFLD-----PEPTFPPIGCRSY  325

Query  475  NRYLLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLST  654
              YLL      A  + N  +V++ALHV++GS   W +C  +LPY + + +S +YH +LST
Sbjct  326  G-YLL------ARYWDNDHNVRKALHVRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLST  378

Query  655  KGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            KG+RSLIY+GD D+ IP L  EAW KSLNY
Sbjct  379  KGYRSLIYSGDHDMLIPFLGTEAWIKSLNY  408



>ref|XP_010321495.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=457

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 153/262 (58%), Gaps = 30/262 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFK---GYLVG  174
            EFIRKWLI++ EY +N  YVGGDSYSG  +P++ Q ISNGND  +KP IN K   GY++G
Sbjct  152  EFIRKWLIEHKEYLNNPFYVGGDSYSGITVPIVTQVISNGNDMGIKPWINLKNLQGYIIG  211

Query  175  NGVTHFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN--PDKKPFFTK---CQLDILR  333
            N VT  ++ DY Y+  FA G GLI  E     Y+  +TN   D  P  +    C  DI  
Sbjct  212  NPVTS-TDPDYKYKVPFAHGMGLIPNEL----YESFVTNCGRDYSPNDSTNQLCSRDIRT  266

Query  334  FVMLTFVNNPAYILDSVC-LINNGLEDLLSG--KAFVPIKRFNGVNAKIYNRYLLCKSD-  501
            F  L       +IL+S C L+++     L+G  +    +  F G+          C+ + 
Sbjct  267  FDWLIKDIYQYHILESPCELVSHDSRRSLAGNVQKLKNLSSFFGMK---------CREEW  317

Query  502  -SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIY  678
              ++  + N + VQ+ALHV+K S+  WE+CR+NL +   + +S++YHANLS KGFRSLIY
Sbjct  318  HELSVIWANDKVVQDALHVRKTSM-AWERCRSNLSFGLIINNSVSYHANLSRKGFRSLIY  376

Query  679  NGDRDLFIPSLSAEAWTKSLNY  744
            +GD D+ +P  S + W KSL Y
Sbjct  377  SGDHDMVVPFSSTQLWIKSLKY  398



>ref|XP_006356850.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=481

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 143/255 (56%), Gaps = 11/255 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL+D+PE+ SN+ Y+GGDSYSG ++P + Q IS+G +A  KP IN KGYL+GN +
Sbjct  171  EFLLKWLVDHPEFSSNNFYLGGDSYSGIVLPRVVQQISDGIEAGSKPLINLKGYLLGNPL  230

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKK--PFFTKCQLDILRFVMLTFVN  357
            T   E ++   F LG G++  E  +    +C     ++  P   +C  D+     L    
Sbjct  231  TFPEEKNFVIPFLLGMGIVPNELYQSMVQNCKGEYREEFAPTNAQCTQDLDIVDELLNNI  290

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRF---NGVNAKIYNRYLLCKSDSIAAQYVNV  528
            N  ++L+ +C     L+       F   +R    N ++   Y +  L     I+  + N 
Sbjct  291  NDQHVLEPMCGSETELKSPFP-SIFRGRRRSLQENAISPSCYGK--LVDRHEISNYWAND  347

Query  529  ESVQEALHVKKGSIDNWEQCRAN---LPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
              VQ+ALHV+KG+ID+W +C+ N     Y     +SI+YH N S KG+RSLIY+GD D+ 
Sbjct  348  PRVQKALHVRKGTIDHWARCKQNGIKKYYTFTSMESISYHVNHSAKGYRSLIYSGDHDMG  407

Query  700  IPSLSAEAWTKSLNY  744
            +P  S EAW KSLNY
Sbjct  408  VPFQSTEAWIKSLNY  422



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 143/270 (53%), Gaps = 39/270 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN  YVGGDSYSG  +P L Q ISN N+  +KP IN +GY++GN  
Sbjct  155  QFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLINLQGYILGNPR  214

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCI-----TNPDKKPFFTKCQLDILRFVML  345
            T    E +    FA G GLIS E        C       +P+ K     C  DI  F  L
Sbjct  215  TDMVVEQNSQIPFAHGMGLISNELYESLKITCGGEYVNVDPNNK----DCLNDIQTFSKL  270

Query  346  TFVNNPAYILDSVCL-----------------INNGLEDLLSGKAFVPIKRFNGVNAKIY  474
            T     ++IL+  C                  +N   ++ L      P   F  +  + Y
Sbjct  271  TSGVEKSHILEPHCQFFSPKPRASSRNRRSLNVNEQSQEFLD-----PEPTFPPIGCRSY  325

Query  475  NRYLLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLST  654
              YLL      A  + N  +V++ALH+++GS   W +C  +LPY + + +S +YH +LST
Sbjct  326  G-YLL------ARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLST  378

Query  655  KGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            KG+RSLIY+GD D+ IP L  EAW KSLNY
Sbjct  379  KGYRSLIYSGDHDMLIPFLGTEAWIKSLNY  408



>gb|AES87126.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=905

 Score =   171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 142/252 (56%), Gaps = 13/252 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+  DSYSG  +P L Q ISNGN+  L+P IN KGYL+GN +
Sbjct  168  QFLRKWLIDHPEFLSNEFYIAADSYSGIPVPALVQEISNGNEKGLQPLINLKGYLLGNPL  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T F E +Y   +A G GLIS+E       +C     D       C  D+  F       N
Sbjct  228  TTFKEQNYQIPYAHGMGLISDELYASLQRNCKGEYIDVDSGNELCLRDLQYFHECLSGIN  287

Query  361  PAYILDSVCLINNGL--EDLLSGKAFVPIKRFN--GVNAKIYNRYLLCKSDSIAAQYVNV  528
               ILDS C  +  L    L+      P        ++ +IY+ YL  K       + N 
Sbjct  288  TFNILDSYCEDDPHLWRRSLIQELKSSPSSHLKVPELSCQIYSFYLTTK-------WANE  340

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ESV++ALH+++G+I  WE+C  N  +  ++  S+ +HANLS KG+RSLIY+GD D  +P 
Sbjct  341  ESVRKALHIREGTIGKWERCYMN-DFEYDIFGSVEFHANLSKKGYRSLIYSGDHDAVVPF  399

Query  709  LSAEAWTKSLNY  744
            +S +AW ++LNY
Sbjct  400  ISTQAWIRNLNY  411


 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 142/259 (55%), Gaps = 27/259 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+  N  Y+G DSYSG  +P + Q ISNGN+  L+P IN +GYL+GN  
Sbjct  603  QFLRKWLIDHPEFLPNEFYIGADSYSGIPVPPILQEISNGNEKGLQPLINLQGYLLGNPF  662

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   E++Y  Q+A G GLIS+E       +C     + D K     C  D+  F  L   
Sbjct  663  TTHKEYNYRIQYAHGMGLISDELYSSLQRNCKGEYIHVDSKNEL--CSKDLRSFDELLSG  720

Query  355  NNPAYILDSVC---------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSI  507
             N   ILDS+C          +   L   LS    VP      ++  IY  YL       
Sbjct  721  INMDNILDSLCEDDMRRRRRPLTRELIPSLSSHLTVP-----EISCYIYGFYL-------  768

Query  508  AAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGD  687
            +A + N ESV++ALH+++G++  W +C  N  +   +  S+ +HANLS KG+RSLIY+G 
Sbjct  769  SATWSNNESVRQALHIREGTVGKWYRCY-NTDFEKEIFSSVEFHANLSKKGYRSLIYSGV  827

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D  +P +S +AW + LNY
Sbjct  828  LDAIVPFMSTQAWIRDLNY  846



>gb|KEH29042.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=887

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 142/252 (56%), Gaps = 13/252 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+  DSYSG  +P L Q ISNGN+  L+P IN KGYL+GN +
Sbjct  168  QFLRKWLIDHPEFLSNEFYIAADSYSGIPVPALVQEISNGNEKGLQPLINLKGYLLGNPL  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T F E +Y   +A G GLIS+E       +C     D       C  D+  F       N
Sbjct  228  TTFKEQNYQIPYAHGMGLISDELYASLQRNCKGEYIDVDSGNELCLRDLQYFHECLSGIN  287

Query  361  PAYILDSVCLINNGL--EDLLSGKAFVPIKRFN--GVNAKIYNRYLLCKSDSIAAQYVNV  528
               ILDS C  +  L    L+      P        ++ +IY+ YL  K       + N 
Sbjct  288  TFNILDSYCEDDPHLWRRSLIQELKSSPSSHLKVPELSCQIYSFYLTTK-------WANE  340

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ESV++ALH+++G+I  WE+C  N  +  ++  S+ +HANLS KG+RSLIY+GD D  +P 
Sbjct  341  ESVRKALHIREGTIGKWERCYMN-DFEYDIFGSVEFHANLSKKGYRSLIYSGDHDAVVPF  399

Query  709  LSAEAWTKSLNY  744
            +S +AW ++LNY
Sbjct  400  ISTQAWIRNLNY  411


 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 130/250 (52%), Gaps = 27/250 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+  N  Y+G DSYSG  +P + Q ISNGN+  L+P IN +GYL+GN  
Sbjct  603  QFLRKWLIDHPEFLPNEFYIGADSYSGIPVPPILQEISNGNEKGLQPLINLQGYLLGNPF  662

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   E++Y  Q+A G GLIS+E       +C     + D K     C  D+  F  L   
Sbjct  663  TTHKEYNYRIQYAHGMGLISDELYSSLQRNCKGEYIHVDSKNEL--CSKDLRSFDELLSG  720

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N   ILDS+C  +         +  +P                     S+++     E 
Sbjct  721  INMDNILDSLCEDDMRRRRRPLTRELIP---------------------SLSSHLTVPEI  759

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
               ALH+++G++  W +C  N  +   +  S+ +HANLS KG+RSLIY+G  D  +P +S
Sbjct  760  SCYALHIREGTVGKWYRCY-NTDFEKEIFSSVEFHANLSKKGYRSLIYSGVLDAIVPFMS  818

Query  715  AEAWTKSLNY  744
             +AW + LNY
Sbjct  819  TQAWIRDLNY  828



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 144/270 (53%), Gaps = 39/270 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN  YVGGDSYSG  +P L Q ISN N+  +KP IN +GY++GN  
Sbjct  155  QFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLINLQGYILGNPR  214

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCI-----TNPDKKPFFTKCQLDILRFVML  345
            T    E +    FA G GLIS E        C       +P+ K     C  DI  F  L
Sbjct  215  TDMVVEQNSQIPFAHGMGLISNELYESLKITCGGEYVNVDPNNK----DCLNDIQTFSKL  270

Query  346  TFVNNPAYILDSVCL-----------------INNGLEDLLSGKAFVPIKRFNGVNAKIY  474
            T     ++IL+  C                  +N   ++ L+     P   F  +  + Y
Sbjct  271  TSGVEKSHILEPHCQFFSPKPRASSHNRRSLNVNEQSQEFLN-----PEPTFPPIGCRSY  325

Query  475  NRYLLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLST  654
              YLL      A  + N  +V++ALH+++GS   W +C  +LPY + + +S +YH +LST
Sbjct  326  G-YLL------ARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLST  378

Query  655  KGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            KG+RSLIY+GD D+ IP L  EAW KSLNY
Sbjct  379  KGYRSLIYSGDHDMIIPFLGTEAWIKSLNY  408



>emb|CBI22424.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 147/262 (56%), Gaps = 26/262 (10%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            FIRKWLID+P +  N LY+GGDSYSG ++P+L   I+NG    LKP +   GY++GN VT
Sbjct  190  FIRKWLIDHPRFLYNPLYIGGDSYSGIIVPILTLEIANGIQMGLKPLMTLMGYILGNPVT  249

Query  187  HF-SEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            H  ++ +    FA    LIS+E    + + C     +PD+     +C   +      T  
Sbjct  250  HLHNDENSRIPFAHRIALISDELYESAKNACKGEFIDPDES--NGECMEVLAVITKCTEK  307

Query  355  NNPAYILDSVCLIN-------------NGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCK  495
             N A+IL+ VC ++             N +ED+ S    +P+ + + +  + YN YLL  
Sbjct  308  LNSAHILEPVCALDSPKPKESKLKWSLNHIEDVSSDMISLPVPQRSELWCRNYN-YLL--  364

Query  496  SDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLI  675
                +  + N E+VQEALHV+ G+I  W++C   L Y++NV  ++ YH NLS  G+R+LI
Sbjct  365  ----SYIWENDEAVQEALHVRNGTIPFWKRCNKTLDYDSNVVSTVPYHRNLSDLGYRALI  420

Query  676  YNGDRDLFIPSLSAEAWTKSLN  741
            Y+GD D+ IP +  E W KSLN
Sbjct  421  YSGDHDMLIPYVGTERWVKSLN  442



>emb|CDY38096.1| BnaC02g06770D [Brassica napus]
Length=491

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 141/249 (57%), Gaps = 11/249 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL  + E+ SN  YV GDSYSG +IP   Q IS GND   KP +N +GY++GN V
Sbjct  194  EFIRKWLSKHTEFISNLFYVAGDSYSGKIIPATVQEISKGNDLGFKPRVNLEGYILGNPV  253

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T F  +H++   FA G  LIS+E        C  N +   P  T+C     +++      
Sbjct  254  TDFEFDHNHGIPFAHGMALISDELYESLKRSCRGNYENIDPHNTECLKHHDKYLKCISSI  313

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C      +  L  + F+ ++    V+A +        +D +A+ + N ESV
Sbjct  314  NVVHILMPRC------DPPLFPRRFILLRN---VSAPLSADGCYIYTDLLASLWANDESV  364

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALHV KGS++ W +C +  PY+ +++ S+ YH N S KG+RSLI++GD DL +P  S 
Sbjct  365  RKALHVVKGSVEKWVRCSSGKPYDFDIKSSVPYHMNNSIKGYRSLIFSGDHDLVVPFPST  424

Query  718  EAWTKSLNY  744
            +AW +SL Y
Sbjct  425  QAWIRSLGY  433



>ref|XP_003604929.1| Serine carboxypeptidase [Medicago truncatula]
Length=923

 Score =   171 bits (433),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 142/252 (56%), Gaps = 13/252 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+  DSYSG  +P L Q ISNGN+  L+P IN KGYL+GN +
Sbjct  168  QFLRKWLIDHPEFLSNEFYIAADSYSGIPVPALVQEISNGNEKGLQPLINLKGYLLGNPL  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T F E +Y   +A G GLIS+E       +C     D       C  D+  F       N
Sbjct  228  TTFKEQNYQIPYAHGMGLISDELYASLQRNCKGEYIDVDSGNELCLRDLQYFHECLSGIN  287

Query  361  PAYILDSVCLINNGL--EDLLSGKAFVPIKRFN--GVNAKIYNRYLLCKSDSIAAQYVNV  528
               ILDS C  +  L    L+      P        ++ +IY+ YL  K       + N 
Sbjct  288  TFNILDSYCEDDPHLWRRSLIQELKSSPSSHLKVPELSCQIYSFYLTTK-------WANE  340

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ESV++ALH+++G+I  WE+C  N  +  ++  S+ +HANLS KG+RSLIY+GD D  +P 
Sbjct  341  ESVRKALHIREGTIGKWERCYMN-DFEYDIFGSVEFHANLSKKGYRSLIYSGDHDAVVPF  399

Query  709  LSAEAWTKSLNY  744
            +S +AW ++LNY
Sbjct  400  ISTQAWIRNLNY  411


 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 143/268 (53%), Gaps = 34/268 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+  N  Y+G DSYSG  +P + Q ISNGN+  L+P IN +GYL+GN  
Sbjct  610  QFLRKWLIDHPEFLPNEFYIGADSYSGIPVPPILQEISNGNEKGLQPLINLQGYLLGNPF  669

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQL------------DI  327
            T   E++Y  Q+A G GLIS+E   ++      + D K       L             I
Sbjct  670  TTHKEYNYRIQYAHGMGLISDELYSRNCKGEYIHVDSKNELCSKDLRSFDEASKPIIKRI  729

Query  328  LRFVMLTFVNNPAYILDSVC---------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNR  480
            L F +L    N   ILDS+C          +   L   LS    VP      ++  IY  
Sbjct  730  LCFSLLLSGINMDNILDSLCEDDMRRRRRPLTRELIPSLSSHLTVP-----EISCYIYGF  784

Query  481  YLLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG  660
            YL       +A + N ESV++ALH+++G++  W +C  N  +   +  S+ +HANLS KG
Sbjct  785  YL-------SATWSNNESVRQALHIREGTVGKWYRCY-NTDFEKEIFSSVEFHANLSKKG  836

Query  661  FRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            +RSLIY+G  D  +P +S +AW + LNY
Sbjct  837  YRSLIYSGVLDAIVPFMSTQAWIRDLNY  864



>ref|XP_002265842.1| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=491

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 147/262 (56%), Gaps = 26/262 (10%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            FIRKWLID+P +  N LY+GGDSYSG ++P+L   I+NG    LKP +   GY++GN VT
Sbjct  174  FIRKWLIDHPRFLYNPLYIGGDSYSGIIVPILTLEIANGIQMGLKPLMTLMGYILGNPVT  233

Query  187  HF-SEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            H  ++ +    FA    LIS+E    + + C     +PD+     +C   +      T  
Sbjct  234  HLHNDENSRIPFAHRIALISDELYESAKNACKGEFIDPDES--NGECMEVLAVITKCTEK  291

Query  355  NNPAYILDSVCLIN-------------NGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCK  495
             N A+IL+ VC ++             N +ED+ S    +P+ + + +  + YN YLL  
Sbjct  292  LNSAHILEPVCALDSPKPKESKLKWSLNHIEDVSSDMISLPVPQRSELWCRNYN-YLL--  348

Query  496  SDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLI  675
                +  + N E+VQEALHV+ G+I  W++C   L Y++NV  ++ YH NLS  G+R+LI
Sbjct  349  ----SYIWENDEAVQEALHVRNGTIPFWKRCNKTLDYDSNVVSTVPYHRNLSDLGYRALI  404

Query  676  YNGDRDLFIPSLSAEAWTKSLN  741
            Y+GD D+ IP +  E W KSLN
Sbjct  405  YSGDHDMLIPYVGTERWVKSLN  426



>ref|XP_010472296.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Camelina 
sativa]
Length=432

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 135/249 (54%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG ++P L Q IS GN    +P IN +GY++GN +
Sbjct  152  EFLQKWLNKHPQFSSNPFYAAGDSYSGMIVPALVQEISRGNYICCEPPINLQGYVLGNPI  211

Query  184  THFSEHD-YTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            THF E + Y   F+ G GLIS+E        C  N  +  P  TKC   +  +   T   
Sbjct  212  THFEEDEKYRVPFSHGMGLISDEVYESIRSACKGNYFNADPSNTKCLKLVEEYHKCTDKL  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N   IL   C       ++ S   F            +Y  YLL       + + N ESV
Sbjct  272  NEFNILLPDC-------NMTSSDCF------------LYPYYLL-------SFWANDESV  305

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALH+ KGSI  W +C  + PY+ +++ S+ YH N S  G+RSLIYNGD DL +P L+ 
Sbjct  306  RDALHIDKGSIGEWVRCNRSNPYDKDIKSSVPYHMNNSISGYRSLIYNGDHDLVVPFLAT  365

Query  718  EAWTKSLNY  744
            EAW KSLNY
Sbjct  366  EAWIKSLNY  374



>ref|XP_003593861.1| Serine carboxypeptidase family protein [Medicago truncatula]
 gb|AES64112.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=465

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 144/252 (57%), Gaps = 15/252 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+++P++QSN +Y+ GDSYSG  IP + Q I+ GN+  L+P IN +GY++GN +
Sbjct  165  EFLRKWLVEHPKFQSNEIYIAGDSYSGITIPAIVQEIAQGNEKGLQPKINLQGYVLGNPL  224

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   E +Y   +A G G +S+E       +C    TN D K     C  DI  +  +   
Sbjct  225  TIRKEKNYQIPYAHGMGFLSDELYESLQKNCNGDYTNVDPKNLL--CSRDINSYDEVIKG  282

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVP--IKRFNGVNAKIYNRYLLCKSDSIAAQYVNV  528
             N A+ILD         E++L  ++ +   + R   ++   Y + L       +  + N 
Sbjct  283  INTAHILDPTECRWLRPENILR-RSLIKKYLSRVPPISCPNYPQLL-------SGYWANN  334

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
             +V++ALH+++G+I  W +    +PY  ++ +S  YH NLS KG+RSLIY+GD D+ IP 
Sbjct  335  STVRKALHIREGTIGKWSRRSDRIPYTGDISNSFDYHVNLSDKGYRSLIYSGDHDISIPF  394

Query  709  LSAEAWTKSLNY  744
            L  +AW KSLNY
Sbjct  395  LDTKAWIKSLNY  406



>emb|CDX78700.1| BnaA03g06120D [Brassica napus]
Length=456

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 144/264 (55%), Gaps = 32/264 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL ++ E+ SN  YV GDSYSG +IP + Q IS GND   KP IN +G+++GN V
Sbjct  152  EFIRKWLSEHKEFISNPFYVSGDSYSGKIIPAMVQEISKGNDLGFKPQINLEGFVIGNPV  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T    EH+    FA G  LIS+E        C  N D   P  T+C   +  F  + F N
Sbjct  212  TDTEFEHNQRIPFAHGMALISDELYESLKRSCKGNYDNIDPHNTEC---LKHFDEINFAN  268

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNG---------VNAKIYNRYLLC------  492
                IL   C      +  LS + ++ +   +           N   +   +LC      
Sbjct  269  ----ILIPRC------DQALSPRRYILLPNTSAPSTDDDCYVSNPSSFYSSMLCFCNHSE  318

Query  493  KSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSL  672
             +D +++ + N ESV+EALHV  GSID W +C +  PY+++++ S+ YH N S KG+RSL
Sbjct  319  YTDLLSSLWANDESVREALHV--GSIDKWVRCSSGKPYDSDIKSSVPYHMNNSIKGYRSL  376

Query  673  IYNGDRDLFIPSLSAEAWTKSLNY  744
            I++GD DL  P +S +AW +SLNY
Sbjct  377  IFSGDHDLMAPFISTQAWIRSLNY  400



>ref|XP_003604930.1| Serine carboxypeptidase family protein [Medicago truncatula]
Length=981

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 138/252 (55%), Gaps = 15/252 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+G DSYSG  +P + Q ISNGN+  L+P IN +GYL+GN  
Sbjct  252  QFLRKWLIDHPEFLSNEFYIGADSYSGIPVPAVLQEISNGNEKGLQPLINLQGYLLGNPY  311

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
            T   E +Y  Q+A G GLIS+E       +C        +  +  L  LR      +N  
Sbjct  312  TTHKEDNYQIQYAHGMGLISDELYASLQRNCKGEYIDVDYRNELCLRDLRSFDEARINKE  371

Query  364  AYILDSVC-----LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNV  528
              ILD  C     L    L+  L      P+     ++  IY  YL       A ++ N 
Sbjct  372  N-ILDGFCEDDSRLWRRSLKQELGAPLSSPLT-VPKLSCHIYRFYL-------ATKWAND  422

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ESV++ALH+++GSI  WE+C     +   +  S+ +H NLS KG+RSLIY+GD DL +P 
Sbjct  423  ESVRKALHIREGSIGKWERCYTT-DFEREIFSSVEFHVNLSKKGYRSLIYSGDLDLVVPF  481

Query  709  LSAEAWTKSLNY  744
             S +AW + LNY
Sbjct  482  QSTQAWIRDLNY  493



>gb|KHG16860.1| Serine carboxypeptidase-like 19 [Gossypium arboreum]
Length=339

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/255 (38%), Positives = 141/255 (55%), Gaps = 15/255 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+ +P++  N +YV GDSYSG  +P+LAQ ISNGN+  +KP I+ +GY++GN  
Sbjct  33   QFLRKWLMAHPDFILNPVYVSGDSYSGIPVPVLAQEISNGNEEGIKPIIHLQGYILGNPK  92

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTK-CQLDILRFVMLTFVN  357
            T  + E      +  G GLIS+E       +C           K C  DI          
Sbjct  93   TVPNLEKKLKIPYVYGMGLISDELYESLKRNCNGQYQNVNLNNKACLADIQYLDECISGI  152

Query  358  NPAYILDSVCLINN------GLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQY  519
            N A+IL+  C +++      G    L G   +  +    +  + Y  Y LC+       +
Sbjct  153  NSAHILEPDCGLDSPKPRKTGRRRYLDGHQLLNDEPLPPLACRTY-AYYLCR------YW  205

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
             N ++V+ ALH++KGSI  W +C   LPYNN+V  S+ YHANLS KG+R LIY+GD D+ 
Sbjct  206  ANDDNVRNALHIRKGSIGKWLRCNHGLPYNNDVPTSLPYHANLSAKGYRYLIYSGDHDMV  265

Query  700  IPSLSAEAWTKSLNY  744
            +P L+ +AW + LNY
Sbjct  266  VPHLATQAWIRFLNY  280



>emb|CDX70702.1| BnaC03g07860D [Brassica napus]
Length=432

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 136/249 (55%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL ++ E+ SN  YV GDSYSG +IP + Q IS GND   KP IN +G+++GN V
Sbjct  152  EFIRKWLSEHKEFISNPFYVSGDSYSGKIIPAMVQEISKGNDLGFKPQINLEGFVIGNPV  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T    EH+    FA G  LIS+E           N D   P  T+C      F+      
Sbjct  212  TDTEFEHNQRIPFAHGMALISDELYESLERSGKGNYDNIDPHNTECLKHFDEFLK-----  266

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
                     C+      ++L  +           ++ + N Y    +D +++ + N ESV
Sbjct  267  ---------CISRINFANILIPRTVR--------SSLVSNEY----TDLLSSLWANDESV  305

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHV KGSID W +C +  PY+++++ S+ YH N S KG+RSLI++GD DL  P +S 
Sbjct  306  REALHVVKGSIDKWVRCSSGKPYDSDIKSSVPYHINNSIKGYRSLIFSGDHDLMAPFIST  365

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  366  QAWIRSLNY  374



>ref|XP_010461188.1| PREDICTED: serine carboxypeptidase-like 18 [Camelina sativa]
Length=464

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 146/262 (56%), Gaps = 27/262 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL++ PE+ SN LYVGGDSY+G ++P + Q IS GN+    P IN KGYL+GN V
Sbjct  157  EFLQKWLVENPEFVSNPLYVGGDSYAGMVVPAIVQHISIGNEHGYNPRINLKGYLLGNPV  216

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T H S+++   Q+A G G IS+E        C  N  K  P  T+C   +  +       
Sbjct  217  TDHDSDNNSRIQYAHGMGFISDELYESLKRTCQRNYVKVDPTNTQCFKLLEDYQKCVSRI  276

Query  358  NPAYILDSVCLI---------NNG---LEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD  501
            N  +I   +C +         +NG   L+ L+     +P       +  +Y RYL     
Sbjct  277  NEGFISIPLCDLASPNPYSGEHNGRSYLKTLVQSDLSLPTP-----DCYMY-RYL-----  325

Query  502  SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIY  678
             IAA + N E V+ ALHV KGS+  W +C  +LPY  +++ S+ YH N S KG +RSL+Y
Sbjct  326  -IAAYWANDEDVRRALHVVKGSVGKWARCDWDLPYEEDIQSSVPYHRNNSIKGVYRSLVY  384

Query  679  NGDRDLFIPSLSAEAWTKSLNY  744
            +GD DL +P L  EAW KSLNY
Sbjct  385  SGDHDLMVPFLGTEAWIKSLNY  406



>ref|XP_010320344.1| PREDICTED: serine carboxypeptidase-like 10 isoform X3 [Solanum 
lycopersicum]
Length=391

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 139/259 (54%), Gaps = 24/259 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL D+P++ SN  YV G+SYSG  IP++ Q ISN N    +P IN +GYL+GN +
Sbjct  86   EFLRKWLDDHPQFISNPFYVAGNSYSGMTIPVITQLISNRNAEGKEPLINLQGYLLGNPL  145

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPD-KKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F+ G GLIS+E  +    +C        P  T+C  ++  F  +    N
Sbjct  146  TFSQEKNYHIPFSHGMGLISDELYKSLEKNCKGEYTYMDPKNTRCASEVRTFNQMISNIN  205

Query  361  PAYILDSVCLIN----NGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYV  522
               IL   C  +    +G   LL G   + ++R +            C  D   +   + 
Sbjct  206  TKRILRPNCEEDPRKRSGQRRLL-GHKLISLQRGDP-----------CAFDWRKLVKYWA  253

Query  523  NVESVQEALHVKKGSIDNWEQCRANLP-----YNNNVRDSIAYHANLSTKGFRSLIYNGD  687
            N   VQEALHV+KG I +W +CR N+      Y   + + I YHANLSTKG+RSLIY+GD
Sbjct  254  NDPKVQEALHVRKGIIGSWMRCRRNISMSSGNYTITLNNVIPYHANLSTKGYRSLIYSGD  313

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D  IP  S +AW KSLNY
Sbjct  314  HDYIIPFQSTQAWIKSLNY  332



>ref|XP_010277006.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277007.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
Length=467

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 145/256 (57%), Gaps = 14/256 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN++Y+GGDSYSG   P++   I NGNDA  +P IN KGYL+GN V
Sbjct  158  QFLRKWLMDHPEFLSNAVYIGGDSYSGKTAPLVVIDILNGNDAGEEPFINIKGYLLGNPV  217

Query  184  THFSEHDYTYQF--ALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T  S +D   Q   A G GL+S+E  + +  +C     +  P   +C  D+  F      
Sbjct  218  TDVS-YDSNKQLPHAHGLGLVSDELYQSAKINCQGEYVNINPSNVQCLQDMQAFSECLSG  276

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYN----RYLLCKSDSIAAQY-  519
             N A+IL+ +C    G       + F   +     + +I +        C++D     Y 
Sbjct  277  INTAHILEPLC----GFASPKPKEKFGDRRYLEDNSREILDPQPSSTEFCRTDGYLLSYY  332

Query  520  -VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
              N ++V++AL+++KGSI  W +C   L Y   ++ S +YH NLS KG+RSLIY+GD DL
Sbjct  333  WANDDNVRKALNIRKGSIGEWRRCNYGLSYTAEIQSSFSYHVNLSRKGYRSLIYSGDHDL  392

Query  697  FIPSLSAEAWTKSLNY  744
             +P L+ +AW  SLNY
Sbjct  393  IVPFLATQAWIHSLNY  408



>gb|KCW68631.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=461

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 143/261 (55%), Gaps = 25/261 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+R+WLI +PE+ SN +Y+GGDSYSG  +P+L Q I +GND    PAIN +GY++GN +
Sbjct  169  QFLRRWLISHPEFISNPVYIGGDSYSGLTLPILVQEIMDGNDEGKSPAINIQGYVLGNPL  228

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPD-KKPFFTKCQLDILRFVMLTFVN  357
            T  + + +    FA G GLIS+E        C  +    +     C  D++ F   T   
Sbjct  229  TDPAFDQNAPVLFAHGMGLISDELYESLKRTCKGHYQFSESSDADCMNDLMAFHQCTSGL  288

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS-----------  504
              A IL+ +C    G   +  G+ F       G    +   + L +  +           
Sbjct  289  QTAQILEPLC----GYASMKPGEMF-------GDRRSLLENFFLVREPTDLDLGCRTYGY  337

Query  505  -IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
             ++  + N ++V+EALH++KGSI +W++C   L Y N++  ++ YHA LS +G RSLIY+
Sbjct  338  RLSYSWTNDDNVREALHIRKGSIGDWQRCNNELNYTNDISSTLQYHAKLSARGCRSLIYS  397

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P +  +AW +SLNY
Sbjct  398  GDHDMIVPFMGTQAWIRSLNY  418



>ref|XP_010320343.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Solanum 
lycopersicum]
Length=416

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 139/259 (54%), Gaps = 24/259 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL D+P++ SN  YV G+SYSG  IP++ Q ISN N    +P IN +GYL+GN +
Sbjct  111  EFLRKWLDDHPQFISNPFYVAGNSYSGMTIPVITQLISNRNAEGKEPLINLQGYLLGNPL  170

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPD-KKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F+ G GLIS+E  +    +C        P  T+C  ++  F  +    N
Sbjct  171  TFSQEKNYHIPFSHGMGLISDELYKSLEKNCKGEYTYMDPKNTRCASEVRTFNQMISNIN  230

Query  361  PAYILDSVCLIN----NGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYV  522
               IL   C  +    +G   LL G   + ++R +            C  D   +   + 
Sbjct  231  TKRILRPNCEEDPRKRSGQRRLL-GHKLISLQRGDP-----------CAFDWRKLVKYWA  278

Query  523  NVESVQEALHVKKGSIDNWEQCRANLP-----YNNNVRDSIAYHANLSTKGFRSLIYNGD  687
            N   VQEALHV+KG I +W +CR N+      Y   + + I YHANLSTKG+RSLIY+GD
Sbjct  279  NDPKVQEALHVRKGIIGSWMRCRRNISMSSGNYTITLNNVIPYHANLSTKGYRSLIYSGD  338

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D  IP  S +AW KSLNY
Sbjct  339  HDYIIPFQSTQAWIKSLNY  357



>ref|XP_010061646.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW68630.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=477

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 143/261 (55%), Gaps = 25/261 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+R+WLI +PE+ SN +Y+GGDSYSG  +P+L Q I +GND    PAIN +GY++GN +
Sbjct  169  QFLRRWLISHPEFISNPVYIGGDSYSGLTLPILVQEIMDGNDEGKSPAINIQGYVLGNPL  228

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPD-KKPFFTKCQLDILRFVMLTFVN  357
            T  + + +    FA G GLIS+E        C  +    +     C  D++ F   T   
Sbjct  229  TDPAFDQNAPVLFAHGMGLISDELYESLKRTCKGHYQFSESSDADCMNDLMAFHQCTSGL  288

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS-----------  504
              A IL+ +C    G   +  G+ F       G    +   + L +  +           
Sbjct  289  QTAQILEPLC----GYASMKPGEMF-------GDRRSLLENFFLVREPTDLDLGCRTYGY  337

Query  505  -IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
             ++  + N ++V+EALH++KGSI +W++C   L Y N++  ++ YHA LS +G RSLIY+
Sbjct  338  RLSYSWTNDDNVREALHIRKGSIGDWQRCNNELNYTNDISSTLQYHAKLSARGCRSLIYS  397

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P +  +AW +SLNY
Sbjct  398  GDHDMIVPFMGTQAWIRSLNY  418



>ref|XP_010320338.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Solanum 
lycopersicum]
Length=436

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 137/258 (53%), Gaps = 15/258 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL D+P++ SN  YV G+SYSG +IP++ Q ISNGN A  +P +N +GYL+GN V
Sbjct  124  EFLRKWLNDHPQFISNPFYVSGNSYSGMIIPIITQLISNGNIAGKEPLVNLQGYLIGNAV  183

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T  S  D  Y   F  G GLIS+E  +    +C     +  P  T C  D   F  L   
Sbjct  184  T-ISPQDEKYHIVFCHGMGLISDELYKSLEKNCRGEYTNINPKNTGCANDFRNFKQLVKN  242

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVNV  528
             N  ++L   C  ++  +D+         +R          R   C SD       + N 
Sbjct  243  INVEHVLKPFCTNDDDPKDVYQ---MTSERRLLDDKLISLQREDKCDSDWRKHLRYWAND  299

Query  529  ESVQEALHVKKGSIDNWEQCRANLP------YNNNVRDSIAYHANLSTKGFRSLIYNGDR  690
              VQEALHV+KG I++W +CR ++       Y   V + + YHANLSTKG+RSLIY+GD 
Sbjct  300  PQVQEALHVRKGIIESWIKCRRDISEGSHHNYTLTVHNVVPYHANLSTKGYRSLIYSGDH  359

Query  691  DLFIPSLSAEAWTKSLNY  744
            D  +P    + W KSLNY
Sbjct  360  DYMVPFQDTQTWIKSLNY  377



>ref|XP_006415267.1| hypothetical protein EUTSA_v10007571mg [Eutrema salsugineum]
 gb|ESQ33620.1| hypothetical protein EUTSA_v10007571mg [Eutrema salsugineum]
Length=464

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/256 (39%), Positives = 143/256 (56%), Gaps = 15/256 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+PE+ SN  YVGGDSY+G ++P + Q IS GN+   KP IN KGY++GN  
Sbjct  157  EFLRKWLVDHPEFVSNPFYVGGDSYAGVVVPAIVQQISIGNEHGYKPLINLKGYVLGNPT  216

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T + S+++Y   +A G GLIS+E        C  +  K  P  T+C   +  +       
Sbjct  217  TDYDSDYNYRIPYAHGMGLISDELYESLKRSCEGSYLKVDPSNTQCLKLVEDYDKCISRI  276

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS------IAAQY  519
            N A IL  +C     LE L S   +   +R   +   +++   L   D       +A  +
Sbjct  277  NLALILTPLC----DLESLNSFSKYHLGRR--DLRELVHSHLPLQPRDCYSYRYLLATNW  330

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIYNGDRDL  696
             N E V+ ALHV KGSI  W +C  ++ Y  +++ SI +H N+S KG +RSL+Y+GD D+
Sbjct  331  ANDEDVRRALHVVKGSIAKWVRCDWDMAYEKDIKSSIPFHQNISIKGIYRSLVYSGDHDM  390

Query  697  FIPSLSAEAWTKSLNY  744
             +P L   AW KSLNY
Sbjct  391  MVPFLGTHAWIKSLNY  406



>ref|NP_850033.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
 gb|AEC07374.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
Length=408

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 135/251 (54%), Gaps = 30/251 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  153  EFLQKWLSKHPQFSSNPFYASGDSYSGMIVPALVQEISKGNYICCKPPINLQGYILGNPI  212

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+F  + +Y   F+ G  LIS+E       DC  N  +  P  TKC   +  +   T   
Sbjct  213  TYFEVDQNYRIPFSHGMALISDELYESIRRDCKGNYFNVDPRNTKCLKLVEEYHKCTDEL  272

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N   IL   C       D  S   F            +Y  YLL         ++N ESV
Sbjct  273  NEFNILSPDC-------DTTSPDCF------------LYPYYLL-------GYWINDESV  306

Query  538  QEALHVKKGSIDNWEQC--RANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            ++ALHV K SI  WE+C  +  +PYN ++ +SI YH N S  G+RSLIY+GD DL +P L
Sbjct  307  RDALHVNKSSIGKWERCTYQNRIPYNKDINNSIPYHMNNSISGYRSLIYSGDHDLVVPFL  366

Query  712  SAEAWTKSLNY  744
            + +AW KSLNY
Sbjct  367  ATQAWIKSLNY  377



>ref|XP_003520964.1| PREDICTED: serine carboxypeptidase-like 11-like [Glycine max]
Length=462

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 141/252 (56%), Gaps = 8/252 (3%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+G DSYSG   P + Q ISNGN+  L+P IN +GYL+GN +
Sbjct  155  QFLRKWLIDHPEFLSNEFYMGADSYSGIPAPAIVQEISNGNEKGLQPRINLQGYLLGNPI  214

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T  +E +    FA G GLIS+E       +C     N D +     C  D+  +      
Sbjct  215  TTRNEGNDQIPFAHGMGLISDELYASLQRNCKGEYENRDSRNVL--CLRDLKHYDECLSG  272

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNV  528
             N  YILD  C  ++  +     +  +  K    +N+ +    + C+     +A Q+ N 
Sbjct  273  INTFYILDRYCKSDSPKKHEAQWRRSLTQKFEASLNSHLRVPDIRCQIFGFFLATQWAND  332

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ESV+++LH+++G+I  WE+C     +   +  S  +H NLS KG+RSLIY+GD D  +P 
Sbjct  333  ESVRKSLHIREGTIGKWERCYTT-DFEEQIFSSFEFHVNLSGKGYRSLIYSGDHDAVVPF  391

Query  709  LSAEAWTKSLNY  744
            +S +AW ++LNY
Sbjct  392  MSTQAWIRALNY  403



>emb|CDP01267.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/256 (37%), Positives = 143/256 (56%), Gaps = 15/256 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RK+LID+PE+ SNS Y+GGDSYSG  +P++AQ IS+GN+   +P I+ KGYL+GN  
Sbjct  170  QFLRKFLIDHPEHLSNSFYIGGDSYSGLPVPIIAQLISDGNENGNQPLIDLKGYLLGNPG  229

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
                +H+Y  QFA G GLI ++       +C       D + F   C  D+  F  L   
Sbjct  230  ATPLDHNYRVQFAHGMGLIPDDLHESLIRNCKGMYITIDPENFL--CMKDMQNFNQLVES  287

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLL----CKSDS--IAAQ  516
               + IL++ C    GL      K++   +  +  + ++    LL    C+  +  +A  
Sbjct  288  IKFSNILENYC----GLRAPKPQKSYAQRRDLDETSQELSGHDLLLAFKCREQAFVLAEI  343

Query  517  YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
            + N +SV+EAL + K  +  W +C  NL Y   +  S+ YHANLST G+RSL+Y+GD D+
Sbjct  344  WANDQSVREALDIPKKHVGYWHRCNDNLLYTTTIHSSVPYHANLSTLGYRSLVYSGDHDM  403

Query  697  FIPSLSAEAWTKSLNY  744
             +P    + W +SLNY
Sbjct  404  VLPHFGTQDWIRSLNY  419



>ref|NP_179876.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
 sp|O81009.1|SCP12_ARATH RecName: Full=Serine carboxypeptidase-like 12; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC32439.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07373.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
Length=435

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 135/251 (54%), Gaps = 30/251 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  153  EFLQKWLSKHPQFSSNPFYASGDSYSGMIVPALVQEISKGNYICCKPPINLQGYILGNPI  212

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+F  + +Y   F+ G  LIS+E       DC  N  +  P  TKC   +  +   T   
Sbjct  213  TYFEVDQNYRIPFSHGMALISDELYESIRRDCKGNYFNVDPRNTKCLKLVEEYHKCTDEL  272

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N   IL   C       D  S   F            +Y  YLL         ++N ESV
Sbjct  273  NEFNILSPDC-------DTTSPDCF------------LYPYYLL-------GYWINDESV  306

Query  538  QEALHVKKGSIDNWEQC--RANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            ++ALHV K SI  WE+C  +  +PYN ++ +SI YH N S  G+RSLIY+GD DL +P L
Sbjct  307  RDALHVNKSSIGKWERCTYQNRIPYNKDINNSIPYHMNNSISGYRSLIYSGDHDLVVPFL  366

Query  712  SAEAWTKSLNY  744
            + +AW KSLNY
Sbjct  367  ATQAWIKSLNY  377



>ref|NP_001077945.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
 gb|AEC07384.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
Length=443

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 134/249 (54%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y GGDSYSG ++P L Q IS GN     P IN KGY++GN +
Sbjct  153  EFLQKWLSKHPQFSSNHFYAGGDSYSGMIVPALVQEISKGNYICCNPPINLKGYVLGNPI  212

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVNN  360
            TH  + +Y   F+ G  LIS+E      + C  N  +  P  TKC   +  F   T   N
Sbjct  213  THEDDPNYRIPFSHGMALISDELYESIREACKGNYFNVDPRNTKCLKLVEEFHKCTDKLN  272

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESVQ  540
              +IL   C       D  S   +            +Y  YL+       + + N ESV+
Sbjct  273  EFHILSPDC-------DTASPDCY------------LYPFYLI-------SFWANDESVR  306

Query  541  EALHVKKGSIDNWEQCR-ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +ALHV K SI  WE+C   + PYN +++ S+ YH N S  G+RSLIY+GD DL +P L+ 
Sbjct  307  DALHVNKRSIGKWERCNYLSKPYNKDIKSSVPYHMNNSVSGYRSLIYSGDHDLVVPFLAT  366

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  367  QAWIKSLNY  375



>ref|NP_179880.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
 sp|Q2V465.2|SCP11_ARATH RecName: Full=Serine carboxypeptidase-like 11; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC17814.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAK62651.1| T20K9.18/T20K9.18 [Arabidopsis thaliana]
 gb|AAM15007.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM47382.1| At2g22970/T20K9.18 [Arabidopsis thaliana]
 gb|AAN31888.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC07382.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
Length=433

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 134/249 (54%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y GGDSYSG ++P L Q IS GN     P IN KGY++GN +
Sbjct  153  EFLQKWLSKHPQFSSNHFYAGGDSYSGMIVPALVQEISKGNYICCNPPINLKGYVLGNPI  212

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVNN  360
            TH  + +Y   F+ G  LIS+E      + C  N  +  P  TKC   +  F   T   N
Sbjct  213  THEDDPNYRIPFSHGMALISDELYESIREACKGNYFNVDPRNTKCLKLVEEFHKCTDKLN  272

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESVQ  540
              +IL   C       D  S   +            +Y  YL+       + + N ESV+
Sbjct  273  EFHILSPDC-------DTASPDCY------------LYPFYLI-------SFWANDESVR  306

Query  541  EALHVKKGSIDNWEQCR-ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +ALHV K SI  WE+C   + PYN +++ S+ YH N S  G+RSLIY+GD DL +P L+ 
Sbjct  307  DALHVNKRSIGKWERCNYLSKPYNKDIKSSVPYHMNNSVSGYRSLIYSGDHDLVVPFLAT  366

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  367  QAWIKSLNY  375



>ref|XP_010320342.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Solanum 
lycopersicum]
Length=458

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 139/259 (54%), Gaps = 24/259 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL D+P++ SN  YV G+SYSG  IP++ Q ISN N    +P IN +GYL+GN +
Sbjct  153  EFLRKWLDDHPQFISNPFYVAGNSYSGMTIPVITQLISNRNAEGKEPLINLQGYLLGNPL  212

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPD-KKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F+ G GLIS+E  +    +C        P  T+C  ++  F  +    N
Sbjct  213  TFSQEKNYHIPFSHGMGLISDELYKSLEKNCKGEYTYMDPKNTRCASEVRTFNQMISNIN  272

Query  361  PAYILDSVCLIN----NGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYV  522
               IL   C  +    +G   LL G   + ++R +            C  D   +   + 
Sbjct  273  TKRILRPNCEEDPRKRSGQRRLL-GHKLISLQRGDP-----------CAFDWRKLVKYWA  320

Query  523  NVESVQEALHVKKGSIDNWEQCRANLP-----YNNNVRDSIAYHANLSTKGFRSLIYNGD  687
            N   VQEALHV+KG I +W +CR N+      Y   + + I YHANLSTKG+RSLIY+GD
Sbjct  321  NDPKVQEALHVRKGIIGSWMRCRRNISMSSGNYTITLNNVIPYHANLSTKGYRSLIYSGD  380

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D  IP  S +AW KSLNY
Sbjct  381  HDYIIPFQSTQAWIKSLNY  399



>ref|XP_006472322.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=468

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 139/263 (53%), Gaps = 25/263 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE  SN +Y+GGDSYSG ++P L Q ISN N+  +KP IN +GY++GN  
Sbjct  156  QFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAA  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T  + E +    FA G GLIS E        C     N D K     C  DI  F  LT 
Sbjct  216  TEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPK--NEVCLNDIQAFSKLTS  273

Query  352  VNNPAYILDSVCLINNGLEDLLSGKA------------FVPIKRFNGVNAKIYNRYLLCK  495
                A+IL+  C  ++      S K              VP      +  + Y  YLL  
Sbjct  274  EIEGAHILEPRCPFSSPKPRESSRKRRSLNVNEQSQEFLVPEPPLPTIGCRTYG-YLL--  330

Query  496  SDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLI  675
                +  + N  +V++AL ++ GS   W++C   LPY   +  S +YH +LSTKG+RSLI
Sbjct  331  ----SYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLI  386

Query  676  YNGDRDLFIPSLSAEAWTKSLNY  744
            Y+GD D+ +P L  EAW KSLNY
Sbjct  387  YSGDHDMMVPFLGTEAWIKSLNY  409



>ref|XP_006433654.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
 gb|ESR46894.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
Length=468

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 139/263 (53%), Gaps = 25/263 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE  SN +Y+GGDSYSG ++P L Q ISN N+  +KP IN +GY++GN  
Sbjct  156  QFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAA  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T  + E +    FA G GLIS E        C     N D K     C  DI  F  LT 
Sbjct  216  TEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPK--NEVCLNDIQAFSKLTS  273

Query  352  VNNPAYILDSVCLINNGLEDLLSGKA------------FVPIKRFNGVNAKIYNRYLLCK  495
                A+IL+  C  ++      S K              VP      +  + Y  YLL  
Sbjct  274  EIEGAHILEPRCPFSSPKPRESSRKRRSLNVNEQSQEFLVPEPPLPTIGCRTYG-YLL--  330

Query  496  SDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLI  675
                +  + N  +V++AL ++ GS   W++C   LPY   +  S +YH +LSTKG+RSLI
Sbjct  331  ----SYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLI  386

Query  676  YNGDRDLFIPSLSAEAWTKSLNY  744
            Y+GD D+ +P L  EAW KSLNY
Sbjct  387  YSGDHDMMVPFLGTEAWIKSLNY  409



>gb|KDO81471.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=468

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 139/263 (53%), Gaps = 25/263 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE  SN +Y+GGDSYSG ++P L Q ISN N+  +KP IN +GY++GN  
Sbjct  156  QFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAA  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T  + E +    FA G GLIS E        C     N D K     C  DI  F  LT 
Sbjct  216  TEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPK--NEVCLNDIQAFSKLTS  273

Query  352  VNNPAYILDSVCLINNGLEDLLSGKA------------FVPIKRFNGVNAKIYNRYLLCK  495
                A+IL+  C  ++      S K              VP      +  + Y  YLL  
Sbjct  274  EIEGAHILEPRCPFSSPKPRESSRKRRSLNVNEQSQEFLVPEPPLPTIGCRTYG-YLL--  330

Query  496  SDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLI  675
                +  + N  +V++AL ++ GS   W++C   LPY   +  S +YH +LSTKG+RSLI
Sbjct  331  ----SYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLI  386

Query  676  YNGDRDLFIPSLSAEAWTKSLNY  744
            Y+GD D+ +P L  EAW KSLNY
Sbjct  387  YSGDHDMMVPFLGTEAWIKSLNY  409



>ref|XP_010320337.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=468

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 137/258 (53%), Gaps = 15/258 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL D+P++ SN  YV G+SYSG +IP++ Q ISNGN A  +P +N +GYL+GN V
Sbjct  156  EFLRKWLNDHPQFISNPFYVSGNSYSGMIIPIITQLISNGNIAGKEPLVNLQGYLIGNAV  215

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T  S  D  Y   F  G GLIS+E  +    +C     +  P  T C  D   F  L   
Sbjct  216  T-ISPQDEKYHIVFCHGMGLISDELYKSLEKNCRGEYTNINPKNTGCANDFRNFKQLVKN  274

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVNV  528
             N  ++L   C  ++  +D+         +R          R   C SD       + N 
Sbjct  275  INVEHVLKPFCTNDDDPKDVYQ---MTSERRLLDDKLISLQREDKCDSDWRKHLRYWAND  331

Query  529  ESVQEALHVKKGSIDNWEQCRANLP------YNNNVRDSIAYHANLSTKGFRSLIYNGDR  690
              VQEALHV+KG I++W +CR ++       Y   V + + YHANLSTKG+RSLIY+GD 
Sbjct  332  PQVQEALHVRKGIIESWIKCRRDISEGSHHNYTLTVHNVVPYHANLSTKGYRSLIYSGDH  391

Query  691  DLFIPSLSAEAWTKSLNY  744
            D  +P    + W KSLNY
Sbjct  392  DYMVPFQDTQTWIKSLNY  409



>ref|XP_004238067.1| PREDICTED: uncharacterized protein LOC101252078 [Solanum lycopersicum]
Length=907

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 144/255 (56%), Gaps = 11/255 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+ KWL+D+PE+ SN+ Y+GGDSYSG ++P + Q IS+G +A  KP +N KGYL+GN +
Sbjct  597  QFLLKWLVDHPEFSSNNFYLGGDSYSGIVVPRVVQLISDGIEAGNKPLVNLKGYLLGNPL  656

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKK--PFFTKCQLDILRFVMLTFVN  357
            T   E ++   F +G  +I  E  +    +C     K+  P   +C  D+     L+   
Sbjct  657  TFPEEKNFMIPFLVGMAIIPIELYQSMMQNCKGEYRKEFAPTNAQCSQDLNIVDELSNNI  716

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRF---NGVNAKIYNRYLLCKSDSIAAQYVNV  528
            N  ++LD +C     L+     K F   +R    N ++   Y +  L     ++  + N 
Sbjct  717  NDQHVLDPLCGSETELKSPFPSK-FRGSRRSIQENAISPSCYGK--LVDRHELSNYWAND  773

Query  529  ESVQEALHVKKGSIDNWEQCRAN---LPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
              VQ+ALHV+KG+ID+W +C+ N     Y     DSI+YH N S KG+RSLIY+GD D+ 
Sbjct  774  PRVQKALHVRKGTIDHWARCKQNGIKKYYTFTSMDSISYHRNHSAKGYRSLIYSGDHDMG  833

Query  700  IPSLSAEAWTKSLNY  744
            +P  S EAW KSLNY
Sbjct  834  VPFQSTEAWIKSLNY  848


 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/252 (38%), Positives = 144/252 (57%), Gaps = 13/252 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKW +D+P +  N LY+GGDSYSG ++P+++Q I++ N+  +KP IN KGYL+GN  
Sbjct  154  QFLRKWFVDHPTFLKNPLYIGGDSYSGMVVPIISQIIASNNEMEIKPFINLKGYLLGNPS  213

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E++Y   FA G GLIS+E       +C     +  P    C  D+  F  L    N
Sbjct  214  TFEGENNYEIPFAYGMGLISDELYESLNTNCKGEYININPSNLLCLQDVQTFKELLRGIN  273

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIY--NRYLLCKSDSIAAQY--VNV  528
              +IL+  C   +     L G+          +N K++  N  + C+++     Y   + 
Sbjct  274  KPHILEPKCKRFSPRPHQLFGER-------RSLNEKLHQLNNLIKCRNNWYKHSYHWADD  326

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            + V++AL+++KG+I  WE+C A L +   V +SI YH NLS+KG+RSLIY+GD D  +  
Sbjct  327  DQVRDALNIRKGTIGKWERC-ATLKFQKIVTNSIPYHENLSSKGYRSLIYSGDHDKIVTF  385

Query  709  LSAEAWTKSLNY  744
             S +AW KSLNY
Sbjct  386  RSTQAWIKSLNY  397



>emb|CDP21038.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/275 (36%), Positives = 146/275 (53%), Gaps = 28/275 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+PE+ S+ +Y+GGDS +G  +P++ Q IS+GN+  ++P I  KGY++GN V
Sbjct  157  EFLRKWLVDHPEFISSPVYIGGDSKAGIRVPIVTQLISDGNEVGIEPHIYLKGYILGNPV  216

Query  184  THFSEHDYTYQFALGYGLISEEF-------ARKSYDD-------CITNPDK--------K  297
            T   + +Y  QF  G GLIS+E         +  Y +       C+ N            
Sbjct  217  TTPGDGNYAIQFTHGMGLISDELYESLKLSCKGEYQNIDPSNALCLQNMQAYNQASNHFS  276

Query  298  PFFTKCQLDILRFVMLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYN  477
              F     + L  + L    N A+IL+  C   +   + L       I+ F     ++  
Sbjct  277  ASFVLLYFEKLVTIQLLSNINKAHILEPDCPYASPKPNNLFIGRRSTIQVFCEKTRELKI  336

Query  478  RYL----LCKSDS--IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYH  639
            + L     C+ D   +   + N ESVQ+ALHV+K SI  W +C    PY  N+ +S+ YH
Sbjct  337  QELAAPFTCRMDGYRLVYHWANDESVQKALHVRKESIGEWIRCNCRYPYIRNIGNSLPYH  396

Query  640  ANLSTKGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            ANLS +G+RSLIY+GD D+ +P    +AW KSLNY
Sbjct  397  ANLSIRGYRSLIYSGDHDMIVPHFGTQAWIKSLNY  431



>ref|XP_010429230.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Camelina 
sativa]
Length=432

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 133/249 (53%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG  +P L Q IS GN    +P IN +GY++GN +
Sbjct  152  EFLQKWLNKHPQFSSNPFYAAGDSYSGMTVPALVQEISKGNYICCEPPINLQGYVLGNPI  211

Query  184  THFSEHD-YTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            TH+ E + Y   F+ G GLIS E        C  N  +  P  TKC   +  +       
Sbjct  212  THYEEDEKYRVPFSHGMGLISSELYESIRSACKGNYFNVDPSNTKCLKLVEEYHKCIDKL  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C       ++ S   F            +Y  YLL       + + N ESV
Sbjct  272  NEYHILLPDC-------NMTSSDCF------------LYPYYLL-------SFWANDESV  305

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALH+KKGSI  W +C  + PYN +++ S+ YH N S  G+RSLIY GD DL +P L+ 
Sbjct  306  RDALHIKKGSIGEWVRCNRSNPYNKDIKSSVPYHMNNSISGYRSLIYIGDHDLVVPFLAT  365

Query  718  EAWTKSLNY  744
            EAW KSLNY
Sbjct  366  EAWIKSLNY  374



>ref|XP_010429241.1| PREDICTED: serine carboxypeptidase-like 10 isoform X3 [Camelina 
sativa]
Length=337

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 137/250 (55%), Gaps = 25/250 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL  +P++ SNS YV GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  52   DFLQKWLSKHPQFISNSFYVTGDSYSGMIVPALVQEISEGNYICCKPPINLQGYVLGNPI  111

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T ++EH+  Y+  FA G  LIS+E        C  N  +  P  TKC   +  +   T  
Sbjct  112  T-YAEHEKNYRIPFAYGMSLISDELYESMKRTCKGNYENVDPRDTKCLKLVEEYHKCTDK  170

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N  +IL   C           GK   P   +       Y  Y L +       + N E 
Sbjct  171  INTQHILLPDCD--------KKGKGITPPDCY-------YYLYFLIEC------WANDER  209

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V+EALHV KG+   W++C   +PY+N++  S+ YHAN S +G+RSLIY+GD D+ +P  +
Sbjct  210  VREALHVSKGTKGQWDRCNWTIPYDNDIISSVPYHANNSFRGYRSLIYSGDHDITMPFQA  269

Query  715  AEAWTKSLNY  744
             +AW KSLNY
Sbjct  270  TQAWIKSLNY  279



>gb|KFK44962.1| hypothetical protein AALP_AA1G326200 [Arabis alpina]
Length=463

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 139/250 (56%), Gaps = 5/250 (2%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL+ YPE+ SN  Y+GGDS+SG ++P++ Q ISNGN+   KP IN KGY++GN  
Sbjct  158  EFLQKWLVKYPEFASNPFYIGGDSHSGMVVPVIVQLISNGNEHSYKPLINLKGYVLGNPS  217

Query  184  THFSEH-DYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T++  + +Y   FA   GLIS+E        C  N     P  T+C   +  +       
Sbjct  218  TNYEAYINYRIPFAHRMGLISDELYESLKRRCKGNYVQIDPTNTQCLKLMDYYNKCVSRI  277

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N A IL  +C     L +  +      +K F   N  + + +       +A ++ N E V
Sbjct  278  NEALILTPLCEF--ALPNPFTDIGRRDLKEFVHSNLSLPSSHCYTYRYLLATKWANDEDV  335

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIYNGDRDLFIPSLS  714
            + ALHV KGSI  W +C  ++ Y+ +++ ++ YH + S KG  RSLIY+GD D+ +P + 
Sbjct  336  RRALHVVKGSIGKWARCATDMAYDKDIKSTVPYHRSNSIKGNLRSLIYSGDHDMLVPYIG  395

Query  715  AEAWTKSLNY  744
             +AW KSLNY
Sbjct  396  TQAWIKSLNY  405



>gb|AES87130.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=470

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 142/250 (57%), Gaps = 9/250 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+  N  Y+G DSYSG  +P + Q ISNGN+   +P IN +GYL+GN  
Sbjct  168  QFLRKWLIDHPEFLPNEFYIGADSYSGIPVPAILQEISNGNEEGHQPLINLQGYLLGNPW  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T + E +Y  Q+A G GLIS+E       +C     D       C  D+  F       N
Sbjct  228  TTYKEDNYQIQYAHGMGLISDELYASLQRNCKGEYIDVDSGNELCLRDLQYFHECLSGIN  287

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNVES  534
               IL S+C      +DL   +  +  +    +++++    L C+     +A ++++ ES
Sbjct  288  KFNILASIC-----KDDLRMWRRSLTQELNASLSSRLTVPELSCRDYGFYLATKWISDES  342

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V++ALH+++G+I  WE+C     +   +  ++ +HANLS KG+RSLIY+GD DL +P  S
Sbjct  343  VRKALHIREGTIGTWERCYTT-DFKREIFSTVEFHANLSKKGYRSLIYSGDLDLIVPFRS  401

Query  715  AEAWTKSLNY  744
             +AW + LNY
Sbjct  402  TQAWIRDLNY  411



>ref|XP_003604927.1| Serine carboxypeptidase [Medicago truncatula]
Length=624

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 141/257 (55%), Gaps = 25/257 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+G DSYSG  +P + Q IS GN+  L+P IN KGYL+GN +
Sbjct  168  QFLRKWLIDHPEFLSNEFYIGADSYSGIPVPAILQEISIGNEKGLQPLINLKGYLLGNPI  227

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F  G GLIS+E       +C     D       C  D+  +       +
Sbjct  228  TTHREKNYQIPFTHGMGLISDELYASLQRNCKGEYVDVDSRNELCLRDLRSYDEARL--D  285

Query  361  PAYILDSVC---------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAA  513
              +ILD  C          +   L++ L  +  VP      +N + Y+ YL       + 
Sbjct  286  MFHILDRFCDDDPRLWRRSLTRELKESLISRLTVP-----ELNCQFYSFYL-------ST  333

Query  514  QYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRD  693
            ++ N E V++ALH+++G+I  WE+C +N  + N +  S  +H NLS KG+RSLIY+GD D
Sbjct  334  KWANDECVRKALHIREGTIGKWERCYSN-DFENEILGSFEFHVNLSKKGYRSLIYSGDHD  392

Query  694  LFIPSLSAEAWTKSLNY  744
              +P +S +AW ++LNY
Sbjct  393  AVVPFMSTQAWIRNLNY  409



>ref|XP_003604933.1| Serine carboxypeptidase [Medicago truncatula]
Length=469

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 144/255 (56%), Gaps = 20/255 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+  N  Y+G DSYSG  +P + Q ISNGN+   +P IN +GYL+GN  
Sbjct  168  QFLRKWLIDHPEFLPNEFYIGADSYSGIPVPAILQEISNGNEEGHQPLINLQGYLLGNPW  227

Query  184  THFSEHDYTYQFALGYGLISEEF------ARKSYDDCITNPDKKPFFTKCQLDILRFVML  345
            T + E +Y  Q+A G GLIS+E        +  Y D  +  +       C  D+  F   
Sbjct  228  TTYKEDNYQIQYAHGMGLISDELYSLQRNCKGEYIDVDSGNE------LCLRDLQYFHEC  281

Query  346  TFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQY  519
                N   IL S+C      +DL   +  +  +    +++++    L C+     +A ++
Sbjct  282  LSGINKFNILASIC-----KDDLRMWRRSLTQELNASLSSRLTVPELSCRDYGFYLATKW  336

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
            ++ ESV++ALH+++G+I  WE+C     +   +  ++ +HANLS KG+RSLIY+GD DL 
Sbjct  337  ISDESVRKALHIREGTIGTWERCYTT-DFKREIFSTVEFHANLSKKGYRSLIYSGDLDLI  395

Query  700  IPSLSAEAWTKSLNY  744
            +P  S +AW + LNY
Sbjct  396  VPFRSTQAWIRDLNY  410



>ref|XP_010556471.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
7 [Tarenaya hassleriana]
Length=432

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 139/248 (56%), Gaps = 31/248 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RK+LID+PE+ SN  YV GDSY+G ++P + Q IS GN+  LKP +N +GY+VGN V
Sbjct  157  EFVRKFLIDHPEFISNPFYVFGDSYAGKIVPAIVQQISKGNEEGLKPLVNLQGYVVGNPV  216

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T  + + +Y   FA G GLIS+E        C  N    P  ++C           F+ +
Sbjct  217  TDPNFDINYRVPFAHGMGLISDELYESLKRTCGGN-YIVPRNSECT---------KFIQD  266

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESVQ  540
               +   +C +++ +  L +               + Y R L       ++ + + ESVQ
Sbjct  267  YEEVTXFICSLHDCMLLLFT-------------RTQEYRRLL-------SSVWASDESVQ  306

Query  541  EALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSAE  720
             ALHV +GS   W +CR +LPY++++  SI YH N S KG+RSL+++GD D+ +P L  +
Sbjct  307  RALHVAEGSEKEWIRCRWDLPYDHDIESSIPYHVNNSIKGYRSLVFSGDHDMLVPFLGTQ  366

Query  721  AWTKSLNY  744
            AW +SLNY
Sbjct  367  AWVRSLNY  374



>gb|KHN45135.1| Serine carboxypeptidase-like 19 [Glycine soja]
Length=471

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/255 (36%), Positives = 146/255 (57%), Gaps = 9/255 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +FIRKWLID+PE+ SN +Y+ GDSY G  +P++ Q ISNGN+  ++P I  +GYL+GN +
Sbjct  159  QFIRKWLIDHPEFLSNEVYIAGDSYCGIPVPVIVQEISNGNEGGMQPWIYIQGYLLGNPI  218

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T  +E +Y   F  G  LIS+E       +C     +  P    C  D+  +        
Sbjct  219  TTSTEKNYEIPFNHGMALISDELYESLQKNCRGEYRNIDPRNALCLRDMQSYEESISGIE  278

Query  361  PAYILDSVC---LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVN  525
              ++L  +C    + N +E +   ++ +  K     + ++    L C+S +  + + + N
Sbjct  279  TGHVLAPLCDESDLRNDME-VTWRRSSLAHKTSAFFSPRLTLPPLYCRSHAYVLCSYWAN  337

Query  526  VESVQEALHVKKGSIDNWEQCRANL--PYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
             ++V++ALHV+KGSI  W +C  +L   +N ++  S  YH NLS KG+RSLIY+GD D+ 
Sbjct  338  DDNVRKALHVRKGSIGKWTRCNDDLKSKFNADIPSSFQYHVNLSRKGYRSLIYSGDHDMV  397

Query  700  IPSLSAEAWTKSLNY  744
            +P L+ +AW +SLNY
Sbjct  398  VPFLATQAWIRSLNY  412



>ref|XP_010429242.1| PREDICTED: serine carboxypeptidase-like 10 isoform X4 [Camelina 
sativa]
Length=449

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 137/250 (55%), Gaps = 25/250 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL  +P++ SNS YV GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  150  DFLQKWLSKHPQFISNSFYVTGDSYSGMIVPALVQEISEGNYICCKPPINLQGYVLGNPI  209

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T ++EH+  Y+  FA G  LIS+E        C  N  +  P  TKC   +  +   T  
Sbjct  210  T-YAEHEKNYRIPFAYGMSLISDELYESMKRTCKGNYENVDPRDTKCLKLVEEYHKCTDK  268

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N  +IL   C           GK   P   +       Y  Y L +       + N E 
Sbjct  269  INTQHILLPDCD--------KKGKGITPPDCY-------YYLYFLIEC------WANDER  307

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V+EALHV KG+   W++C   +PY+N++  S+ YHAN S +G+RSLIY+GD D+ +P  +
Sbjct  308  VREALHVSKGTKGQWDRCNWTIPYDNDIISSVPYHANNSFRGYRSLIYSGDHDITMPFQA  367

Query  715  AEAWTKSLNY  744
             +AW KSLNY
Sbjct  368  TQAWIKSLNY  377



>ref|XP_006581276.1| PREDICTED: serine carboxypeptidase-like 19-like isoform X2 [Glycine 
max]
Length=491

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/255 (36%), Positives = 146/255 (57%), Gaps = 9/255 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +FIRKWLID+PE+ SN +Y+ GDSY G  +P++ Q ISNGN+  ++P I  +GYL+GN +
Sbjct  179  QFIRKWLIDHPEFLSNEVYIAGDSYCGIPVPVIVQEISNGNEGGMQPWIYIQGYLLGNPI  238

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T  +E +Y   F  G  LIS+E       +C     +  P    C  D+  +        
Sbjct  239  TTSTEKNYEIPFNHGMALISDELYESLQKNCRGEYRNIDPRNALCLRDMQSYEESISGIE  298

Query  361  PAYILDSVC---LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVN  525
              ++L  +C    + N +E +   ++ +  K     + ++    L C+S +  + + + N
Sbjct  299  TGHVLAPLCDESDLRNDME-VTWRRSSLAHKTSAFFSPRLTLPPLYCRSHAYVLCSYWAN  357

Query  526  VESVQEALHVKKGSIDNWEQCRANL--PYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
             ++V++ALHV+KGSI  W +C  +L   +N ++  S  YH NLS KG+RSLIY+GD D+ 
Sbjct  358  DDNVRKALHVRKGSIGKWTRCNDDLKSKFNADIPSSFQYHVNLSRKGYRSLIYSGDHDMV  417

Query  700  IPSLSAEAWTKSLNY  744
            +P L+ +AW +SLNY
Sbjct  418  VPFLATQAWIRSLNY  432



>ref|XP_010429239.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Camelina 
sativa]
Length=435

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 137/250 (55%), Gaps = 25/250 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL  +P++ SNS YV GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  150  DFLQKWLSKHPQFISNSFYVTGDSYSGMIVPALVQEISEGNYICCKPPINLQGYVLGNPI  209

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T ++EH+  Y+  FA G  LIS+E        C  N  +  P  TKC   +  +   T  
Sbjct  210  T-YAEHEKNYRIPFAYGMSLISDELYESMKRTCKGNYENVDPRDTKCLKLVEEYHKCTDK  268

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N  +IL   C           GK   P   +       Y  Y L +       + N E 
Sbjct  269  INTQHILLPDCD--------KKGKGITPPDCY-------YYLYFLIEC------WANDER  307

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V+EALHV KG+   W++C   +PY+N++  S+ YHAN S +G+RSLIY+GD D+ +P  +
Sbjct  308  VREALHVSKGTKGQWDRCNWTIPYDNDIISSVPYHANNSFRGYRSLIYSGDHDITMPFQA  367

Query  715  AEAWTKSLNY  744
             +AW KSLNY
Sbjct  368  TQAWIKSLNY  377



>ref|NP_565546.3| sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 gb|AEC07389.1| serine carboxypeptidase-like 8 [Arabidopsis thaliana]
Length=319

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 135/249 (54%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN LYV GDSYSG ++P L Q IS GN    +P IN +GY++GN V
Sbjct  36   EFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINLQGYMLGNPV  95

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   +A G GLIS+E        C  N  +  P  T+C      +   T   
Sbjct  96   TYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKI  155

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C + N    + S   +             Y  Y L +       + N ESV
Sbjct  156  NIHHILTPDCDVTN----VTSPDCY-------------YYPYHLIEC------WANDESV  192

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALH++KGS   W +C   +PYN+++  SI YH N S  G+RSLIY+GD D+ +P L+ 
Sbjct  193  REALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLAT  252

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  253  QAWIRSLNY  261



>gb|KEH29044.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=466

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 143/250 (57%), Gaps = 9/250 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+  DSY+G  +P + Q ISNGN+  L+P IN +GYL+GN +
Sbjct  164  QFLRKWLIDHPEFLSNEFYIVADSYAGIPVPAILQEISNGNEKGLQPLINLQGYLLGNPL  223

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T + E +Y  Q+A G GLIS+E        C     D       C  D+  F       N
Sbjct  224  TSYREDNYRIQYAHGMGLISDELYASLQRSCKGEYIDVDSRNELCLGDLEYFHECLSGIN  283

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNVES  534
               I+ S C      +DL   +  +  +    +N+++    L C++    +A ++ + ES
Sbjct  284  LFNIVGSFC-----EDDLHMWRRSLTQELNASLNSRLTVPELRCRNYGFYLATKWFSDES  338

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V++ALH+++G+I  WE+C     +   +  S+ +HANLS KG+RSLIY+GD D+ +P +S
Sbjct  339  VRKALHIREGTIGKWERCYRT-DFEREIFSSVEFHANLSKKGYRSLIYSGDHDVVVPFIS  397

Query  715  AEAWTKSLNY  744
             +AW + LNY
Sbjct  398  TQAWIRDLNY  407



>emb|CAN74923.1| hypothetical protein VITISV_038590 [Vitis vinifera]
Length=499

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 148/270 (55%), Gaps = 34/270 (13%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINF--------KG  162
            FIRKWLID+P +  N LY+GGDSYSG ++P+L   I+NG    LKP +          +G
Sbjct  174  FIRKWLIDHPRFLYNPLYIGGDSYSGIIVPILTLEIANGIQMGLKPLMTLMFYNWNGIQG  233

Query  163  YLVGNGVTHF-SEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDIL  330
            Y++GN VTH  ++ +    FA    LIS+E    + + C     +PD+     +C   + 
Sbjct  234  YILGNPVTHLHNDENSRIPFAHRIALISDELYESAKNACKGEFIDPDES--NGECMEVLA  291

Query  331  RFVMLTFVNNPAYILDSVCLIN-------------NGLEDLLSGKAFVPIKRFNGVNAKI  471
                 T   N A+IL+ VC ++             N +ED+ S    +P+ + + +  + 
Sbjct  292  VITKCTEKLNSAHILEPVCALDSPKPKESKLKWSLNHIEDVSSDMISLPVPQRSELWCRN  351

Query  472  YNRYLLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLS  651
            YN YLL      +  + N E+VQEALHV+ G+I  W++C   L Y++NV  ++ YH NLS
Sbjct  352  YN-YLL------SYIWENDEAVQEALHVRNGTIPFWKRCNKTLDYDSNVVSTVPYHRNLS  404

Query  652  TKGFRSLIYNGDRDLFIPSLSAEAWTKSLN  741
              G+R+LIY+GD D+ IP +  E W KSLN
Sbjct  405  DLGYRALIYSGDHDMLIPYVGTERWVKSLN  434



>ref|NP_001154529.1| sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 gb|AEC07394.1| serine carboxypeptidase-like 8 [Arabidopsis thaliana]
Length=319

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 135/249 (54%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN LYV GDSYSG ++P L Q IS GN    +P IN +GY++GN V
Sbjct  36   EFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINLQGYMLGNPV  95

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   +A G GLIS+E        C  N  +  P  T+C      +   T   
Sbjct  96   TYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKI  155

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C + N    + S   +             Y  Y L +       + N ESV
Sbjct  156  NIHHILTPDCDVTN----VTSPDCY-------------YYPYHLIEC------WANDESV  192

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALH++KGS   W +C   +PYN+++  SI YH N S  G+RSLIY+GD D+ +P L+ 
Sbjct  193  REALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLAT  252

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  253  QAWIRSLNY  261



>ref|XP_006342727.1| PREDICTED: uncharacterized protein LOC102585123 [Solanum tuberosum]
Length=913

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 142/257 (55%), Gaps = 21/257 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKW +++PE+ SN  YV GDSYSG  IP++ Q ISNG +A  +P IN KGY +GN +
Sbjct  609  EFLRKWFVNHPEFISNPFYVSGDSYSGITIPVIVQLISNGIEAGKEPLINLKGYSLGNPI  668

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T F E +Y   ++ G GLIS+E      + C  +  +  P   +C  +   F  L    N
Sbjct  669  TFFEESNYQIPYSHGMGLISDELYESLNEFCKGDYINIDPTNKQCVENFKIFKNLVSGIN  728

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCK-----SDSIAAQYVN  525
             A+IL+  C  +           F P +  N    +      +C+     ++ +A  + N
Sbjct  729  NAHILEPECGTDTD---------FHPPQSSN--ERRSLEEDFICQESRVATNKLATYWAN  777

Query  526  VESVQEALHVKKGSIDN-WEQCRANLPYNN---NVRDSIAYHANLSTKGFRSLIYNGDRD  693
             + VQEALHV+K +I   W +C+  + Y +     R+SI YH NLSTKG+RSLIY+GD D
Sbjct  778  DQRVQEALHVRKDTIRRPWTRCKQTIAYTSYKITFRNSIPYHVNLSTKGYRSLIYSGDHD  837

Query  694  LFIPSLSAEAWTKSLNY  744
            + +P  S +AW K LNY
Sbjct  838  MIVPFQSTQAWIKYLNY  854


 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 141/259 (54%), Gaps = 18/259 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWLI++PE+  N  YV GDSYSG  +P++ Q IS+G +A  +P IN KGY +GN V
Sbjct  152  EFLRKWLINHPEFILNPFYVSGDSYSGITVPVIVQLISDGIEAGKEPLINLKGYSLGNPV  211

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F  G GLIS+E      + C  +  +  P    C  +   F  L    N
Sbjct  212  TFPEEDNYRIPFCHGMGLISDELYESLNEFCKGDYINIGPTNKLCVENFKMFKNLVSGIN  271

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY--LLCKSDSIAAQ-----Y  519
               IL+  C  ++     LS +     + F      I+ +Y  L+C+   +A +     +
Sbjct  272  EQQILEPFCGKDSNRPHQLSSERRSLEEDF------IFQKYDDLICRESRVATRKLSTYW  325

Query  520  VNVESVQEALHVKKGSIDN-WEQCRANL---PYNNNVRDSIAYHANLSTKGFRSLIYNGD  687
             N   VQEALHV+KG+I   W +CR ++    Y     +SI YH N+S+KG+RSLIY+GD
Sbjct  326  ANDPRVQEALHVRKGTIRRPWARCRQSIMSTSYTVTFMNSIPYHVNISSKGYRSLIYSGD  385

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D+ +P  S +AW K LNY
Sbjct  386  HDMVVPFQSTQAWIKYLNY  404



>emb|CDP06925.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/248 (40%), Positives = 129/248 (52%), Gaps = 54/248 (22%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL D+PEY+SN  YVGG SY G  +P+L Q ISNGN+  ++P I+ KGY++GN V
Sbjct  199  EFIRKWLHDHPEYKSNPFYVGGISYGGIPVPILTQLISNGNEDGIEPRIDLKGYILGNPV  258

Query  184  THFSE-HDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T  S   +Y   FA G GLIS+E        C           K + +I      T  +N
Sbjct  259  TKVSGLLNYRVPFAYGMGLISDELYESLKVSC-----------KGEYEI------TDPSN  301

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESVQ  540
            P      VC  N              ++ +N  +  IY  ++                VQ
Sbjct  302  P------VCSKN--------------MQGYNEASNHIYAIFI----------------VQ  325

Query  541  EALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSAE  720
            EALHV + +I  W  CR  LPY  N    + YHANLSTKG+RSLIY+GD DL +P +  +
Sbjct  326  EALHVLRETIGQWVSCRDALPYTKNAGSVVPYHANLSTKGYRSLIYSGDHDLMVPHIETQ  385

Query  721  AWTKSLNY  744
            AW +SL+Y
Sbjct  386  AWIRSLHY  393



>ref|XP_010472298.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Camelina 
sativa]
Length=435

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 138/252 (55%), Gaps = 29/252 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL  +P++ SNS YV GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  150  DFLQKWLSKHPQFISNSFYVTGDSYSGMIVPALVQEISKGNYICCKPPINLQGYVLGNPI  209

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T ++EH+  Y+  FA G  LIS+E        C  N  +  P  TKC   +  +   T  
Sbjct  210  T-YAEHEKNYRIPFAYGMSLISDELYESMKRTCKGNYENVDPRDTKCLKLVEEYHKCTDK  268

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAK--IYNRYLLCKSDSIAAQYVNV  528
             N  +IL   C                  K+  GV +    Y  Y L +       + N 
Sbjct  269  INTQHILLPDC-----------------DKKGKGVTSPDCYYYVYFLIEC------WAND  305

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            E V+EALHV KG+   W++C   +PY+N++  S+ YHAN S +G+RSLIY+GD D+ +P 
Sbjct  306  ERVREALHVTKGTKGQWDRCNWTIPYDNDIISSVPYHANNSIRGYRSLIYSGDHDITMPF  365

Query  709  LSAEAWTKSLNY  744
             + +AW KSLNY
Sbjct  366  QATQAWIKSLNY  377



>ref|XP_009393004.1| PREDICTED: serine carboxypeptidase-like 2 [Musa acuminata subsp. 
malaccensis]
Length=468

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/269 (35%), Positives = 143/269 (53%), Gaps = 41/269 (15%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+ KW ID+P+Y  N LY+ GDSY+G  +P++AQAIS  N+A L+P +N KGY++GN  
Sbjct  160  KFLVKWFIDHPQYLPNPLYIAGDSYAGIYVPLVAQAISQDNEAGLQPHLNLKGYILGNPA  219

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQ--LDILRFVMLTFV  354
            T    + +    +A G G+IS+E    +  +C     + P  T C   LD +     + +
Sbjct  220  TGEKIDRNSRIPYAHGMGIISDEMFESTQRNCDGQDYRYPTTTLCSKSLDAVE-KFFSEI  278

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD-----------  501
              P YILD  C             AFV  K      A + +R  + +SD           
Sbjct  279  MKP-YILDPKC-------------AFVSPKP----EATVADRRTMEESDIKLLKPPPLPP  320

Query  502  --------SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTK  657
                     ++  + N +  +EALH+KKG+ + W +C  +LP+   V+ +I YHANL+ +
Sbjct  321  LYCRTYAYVLSYYWANNQVTREALHIKKGTKEEWRRCNEDLPFRKEVKSTIKYHANLTRR  380

Query  658  GFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            G+R+L+Y+GD DL +P L   AW KSLNY
Sbjct  381  GYRALVYSGDHDLVVPFLGTMAWIKSLNY  409



>ref|XP_006403280.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
 gb|ESQ44733.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
Length=419

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/256 (37%), Positives = 135/256 (53%), Gaps = 36/256 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL  +PE+ SN  YV G+SYSG +IP + Q ISNGN    KP IN +GY++GN +
Sbjct  153  EFLRKWLAKHPEFFSNPFYVAGNSYSGIVIPAIVQEISNGNGLCCKPQINLQGYVLGNPL  212

Query  184  THFSEHDYT-YQFALGYGLISEEFARKSYDDCITNPDKK--PFFTKCQLDILRF------  336
            T+F  +D +   FA G  LI +E        C  N   K  P  T C   +  F      
Sbjct  213  TNFDNNDNSRIPFAHGMALIPDELFESLRRSCRGNYYVKMDPLNTGCLKLVQEFEKCVSG  272

Query  337  VMLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ  516
            + LT++  P Y+  S   ++N  E  +S                            ++ +
Sbjct  273  LDLTYILGPKYVNASDPYVSNPSEHRMS---------------------------VLSNR  305

Query  517  YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
            + N E V+ AL V+KGSI  W +C   +PYN ++R S+ YH N S +G+RSLI++GD D+
Sbjct  306  WANEERVRRALGVEKGSIGEWLRCYREIPYNIDIRSSVPYHKNNSIQGYRSLIFSGDHDM  365

Query  697  FIPSLSAEAWTKSLNY  744
            F+P L  + W +SLNY
Sbjct  366  FVPFLETQDWIRSLNY  381



>ref|XP_010108032.1| Serine carboxypeptidase-like 7 [Morus notabilis]
 gb|EXC17678.1| Serine carboxypeptidase-like 7 [Morus notabilis]
Length=759

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 142/264 (54%), Gaps = 27/264 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F +KWLID+ E+ SN +Y+ GDSYSG  +P+LAQ ISNG +  + P IN +GY++GN  
Sbjct  159  QFFKKWLIDHQEFISNPVYIAGDSYSGITVPVLAQEISNGIEEGILPPINLQGYILGNPA  218

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC----ITNPDKKPFFTKCQLDILRFVMLTF  351
            T  S+ +Y   FA G  LIS+E  R     C      N D     T+C  +   +     
Sbjct  219  TSPSDDNYKIPFAHGMALISDELFRSLKRRCRGKYYGNIDSS--NTECLKEFRGYEECIS  276

Query  352  VNNPAYILDSVCL--INNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKS---------  498
                 +IL+  C   +    ED +  +          +N     + LL +S         
Sbjct  277  GIRSTHILEPDCTRALTKPHEDKIDER--------RSLNQNSEAKVLLSESPLPWFGCPG  328

Query  499  --DSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSL  672
                ++  + N   V++ALH++KGSI  W +C  +LPY +N+  S+ YHANLS KG+RSL
Sbjct  329  YPHLLSRYWANDPHVRKALHIQKGSIGEWNRCNWSLPYQHNIHSSVEYHANLSAKGYRSL  388

Query  673  IYNGDRDLFIPSLSAEAWTKSLNY  744
            IY+GD D+ +P L+ +AW +SLNY
Sbjct  389  IYSGDHDMKVPFLATQAWIRSLNY  412


 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 132/250 (53%), Gaps = 51/250 (20%)
 Frame = +1

Query  1    AEFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNG  180
             +F+RKWLI++P++ SN  Y+ GDSYSG  IP+LA  ISN N+A + P IN +GY +GN 
Sbjct  542  VQFLRKWLINHPDFISNPFYISGDSYSGIPIPILAHQISNENEAGVTPLINLQGYAIGNP  601

Query  181  VTHF-SEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            VT   S+ ++   FA    LIS+E  +    +C     +  P  TKC             
Sbjct  602  VTDVKSDDNFEIPFAHAMALISDELYKSLKKNCRGKYKNLDPRNTKC-------------  648

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
                        +NN             ++ +   +   ++ Y           + N  S
Sbjct  649  ------------LNN-------------MQAYEKEDEHWFSLY-----------WANHHS  672

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V+ AL V++G+   W++C  NLPY+ +V +++ YH NLS+KG+RSLIY+GD D+ +P L+
Sbjct  673  VRRALGVREGTKRKWQRCDFNLPYHKDVDNTVPYHFNLSSKGYRSLIYSGDHDMRVPFLA  732

Query  715  AEAWTKSLNY  744
             +AW +SLN+
Sbjct  733  TQAWIRSLNF  742



>ref|XP_006303239.1| hypothetical protein CARUB_v10012575mg [Capsella rubella]
 gb|EOA36137.1| hypothetical protein CARUB_v10012575mg [Capsella rubella]
Length=449

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 143/263 (54%), Gaps = 28/263 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL++ PE+ SN  YVGGDSY+G ++P + Q IS GN+    P IN KGYLVGN V
Sbjct  159  EFLQKWLVENPEFASNPFYVGGDSYAGIVVPAIVQQISIGNEHGDNPHINLKGYLVGNPV  218

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T H S+ +    +A G G IS+E        C  N  K  P  T+C   +  +       
Sbjct  219  TDHESDFNSKIPYAHGMGFISDELYESLKSTCKGNYAKVDPTNTQCLKLMEDYNKCVSRI  278

Query  358  NPAYILDSVCLI---------NNG----LEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKS  498
            N  ++  ++C +         +NG    L+ L+     +P       +  +Y RYLL   
Sbjct  279  NEGFVPIALCDLISPNPYSAEHNGRRSYLKTLVQSDLSLPTP-----DCYMY-RYLL---  329

Query  499  DSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLI  675
               A  + N E V+ ALHV K ++  W +C  +LPY  +++ S+ YH N+S KG +RSL+
Sbjct  330  ---ATYWANNEDVRRALHVVKETVGKWVRCDWDLPYEEDIKSSVPYHRNISIKGEYRSLV  386

Query  676  YNGDRDLFIPSLSAEAWTKSLNY  744
            Y+GD DL +P L  EAW KSLNY
Sbjct  387  YSGDHDLMVPFLGTEAWIKSLNY  409



>ref|XP_006403281.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
 gb|ESQ44734.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
Length=439

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/256 (37%), Positives = 135/256 (53%), Gaps = 36/256 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL  +PE+ SN  YV G+SYSG +IP + Q ISNGN    KP IN +GY++GN +
Sbjct  153  EFLRKWLAKHPEFFSNPFYVAGNSYSGIVIPAIVQEISNGNGLCCKPQINLQGYVLGNPL  212

Query  184  THFSEHDYT-YQFALGYGLISEEFARKSYDDCITNPDKK--PFFTKCQLDILRF------  336
            T+F  +D +   FA G  LI +E        C  N   K  P  T C   +  F      
Sbjct  213  TNFDNNDNSRIPFAHGMALIPDELFESLRRSCRGNYYVKMDPLNTGCLKLVQEFEKCVSG  272

Query  337  VMLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ  516
            + LT++  P Y+  S   ++N  E  +S                            ++ +
Sbjct  273  LDLTYILGPKYVNASDPYVSNPSEHRMS---------------------------VLSNR  305

Query  517  YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
            + N E V+ AL V+KGSI  W +C   +PYN ++R S+ YH N S +G+RSLI++GD D+
Sbjct  306  WANEERVRRALGVEKGSIGEWLRCYREIPYNIDIRSSVPYHKNNSIQGYRSLIFSGDHDM  365

Query  697  FIPSLSAEAWTKSLNY  744
            F+P L  + W +SLNY
Sbjct  366  FVPFLETQDWIRSLNY  381



>ref|XP_009395245.1| PREDICTED: serine carboxypeptidase-like 12 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 144/249 (58%), Gaps = 5/249 (2%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+ KWL+D+P++ SN LY+ GDSY+G ++P++AQ + NG +A  +P +N +GY++GN VT
Sbjct  161  FLIKWLVDHPKFLSNPLYIAGDSYAGKIVPIVAQEVLNGIEAEKRPLLNLQGYVIGNPVT  220

Query  187  HFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
                + +    FA G G+IS++F +     C+    + P  ++C++    F  +    N 
Sbjct  221  GEKIDLNARVPFAHGMGIISDDFFQSIQRSCVGQDYQSPIDSECEMCFDTFDEILSEINK  280

Query  364  AYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCK--SDSIAAQYVNVESV  537
              IL+  C   +        +A    + +  +        L C+  +  +A  + N + V
Sbjct  281  YNILEPKCAPASPKPKTKGRRALK--EEYLHLLKPPPTPALNCRNYAHILAYYWANTDIV  338

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALH+KKG++  W++C  +LPY  +++ SI YH ++++ G+R+L+Y+GD D+ IP +  
Sbjct  339  REALHIKKGTVGEWQRCTYDLPYTRDIKSSIKYHLSVTSSGYRALVYSGDHDMLIPFVGT  398

Query  718  EAWTKSLNY  744
              WT+SLN+
Sbjct  399  NQWTRSLNF  407



>ref|XP_006415266.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
 gb|ESQ33619.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
Length=465

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/256 (38%), Positives = 145/256 (57%), Gaps = 15/256 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL+++PE+ SN  YVGGDSY+G ++P + Q IS GN+   KP IN KGY++GN  
Sbjct  158  EFLQKWLVEHPEFVSNHFYVGGDSYAGVIVPAIVQQISIGNEHGYKPLINLKGYVLGNPS  217

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  + +++Y   +A G GLIS+E        C  N  +  P  T+C   +  +       
Sbjct  218  TDSYIDYNYRIPYAHGMGLISDELYESLKRSCEGNYVNIDPSNTQCLKLMQDYDKCVSRL  277

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS------IAAQY  519
            N A IL  +C ++  L +  S K    I R + V   +++   L   D       +A  +
Sbjct  278  NYALILTPLCDLS--LPNPFSKKH---IGRRD-VRELVHSDLPLPTHDCYTYRYLLATNW  331

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGF-RSLIYNGDRDL  696
             N E V+ ALHV KGSI+ W +C  ++ Y  +++ S+ YH N S KGF RSL+Y+GD D+
Sbjct  332  ANDEDVRRALHVVKGSIEKWVRCDWDMAYEKDIKSSVPYHLNNSMKGFYRSLVYSGDHDM  391

Query  697  FIPSLSAEAWTKSLNY  744
            F+P    +AW +SLNY
Sbjct  392  FVPFPGTQAWIRSLNY  407



>ref|XP_010429236.1| PREDICTED: serine carboxypeptidase-like 12 isoform X3 [Camelina 
sativa]
Length=318

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 127/249 (51%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  +P + SN  Y  GDSYSG  +P L Q IS GN    +P IN +GY++GN +
Sbjct  38   EFLLKWLNKHPTFSSNPFYAAGDSYSGMTVPALVQEISKGNYICCEPPINLQGYVLGNPI  97

Query  184  THFSEH-DYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            TH  E   Y   F+ G GLIS+E        C  N  +  P  TKC              
Sbjct  98   THIEEEIKYRVPFSHGMGLISDELYESIRSACKGNYFNVDPSNTKC--------------  143

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
                 L  V   +  ++ L      +P       +  +Y  YLL         + N ESV
Sbjct  144  -----LKLVEEYHKCIDKLYEYNILLPDCNMTSSDCFLYPYYLL-------NFWANDESV  191

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALH+KKGSI  W  C  +  YNN+++ S+ YH + S  G+RSLIY+GD DL +P L+ 
Sbjct  192  RDALHIKKGSIGEWVICSRSNAYNNDIKSSVPYHMHNSINGYRSLIYSGDHDLVVPFLAT  251

Query  718  EAWTKSLNY  744
            EAW KSLNY
Sbjct  252  EAWIKSLNY  260



>ref|XP_002266354.2| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=468

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 143/255 (56%), Gaps = 14/255 (5%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWLI++P++Q N LYV GDSYSG +IPM+ Q ISNGND   +P +N +GY +GN VT
Sbjct  155  FLRKWLINHPKFQKNPLYVSGDSYSGIIIPMVVQEISNGNDEGKEPKMNIQGYTIGNPVT  214

Query  187  -HFSEHDYTYQFALGYGLISEEFARKSYDDC-----ITNPDKKPFFTKCQLDILRFVMLT  348
             HFS+ +   ++    G++S+E   +  + C       +P       +C  ++  +    
Sbjct  215  DHFSDFNSRIEYTHRVGILSDELYEELKESCNGKYVYVDPSN----VECTNNLKVYTQCI  270

Query  349  FVNNPAYILDSVC--LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYV  522
                 A+IL+  C  L  N     L   +   I     + ++       C+S +    Y+
Sbjct  271  NKIYSAHILEPSCAMLSPNPNASKLDRSSLQEINSIGLLLSQPQKPEPWCRSYNYVFSYL  330

Query  523  --NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
              N ++VQ+ALHV++G++ +W +C  +L Y +NV  S+ YH NL+ K +R+LIY+GD D+
Sbjct  331  WANDKTVQKALHVREGTVKDWVRCNESLSYTSNVFSSVDYHRNLTKKAYRALIYSGDHDM  390

Query  697  FIPSLSAEAWTKSLN  741
             IP +  +AW  SLN
Sbjct  391  LIPYVGTQAWIASLN  405



>ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis]
Length=468

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/260 (36%), Positives = 140/260 (54%), Gaps = 23/260 (9%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWL D+PE+ +N +Y+ GDSYSG  +P + Q ISNGN+   +P IN +GY++GN VT
Sbjct  159  FLRKWLRDHPEFLANPVYIAGDSYSGITLPAIVQHISNGNEKGTEPLINLQGYIIGNPVT  218

Query  187  HFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
              S + +    FA G GLIS+E        C  +     P  T+C   +  F        
Sbjct  219  DSSFDTNSGVPFAHGMGLISDELFESLKRSCGEDYVSIDPSNTECLQYLQDFDKCRSELQ  278

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLL----------CKSDSIA  510
               IL+ +C          S K F    +   +N    ++Y L          C++ +  
Sbjct  279  QGQILEPIC-------GFASPKPFQLFGKRRSLNEN--SQYFLDIDPSIPSIGCRTYAYT  329

Query  511  AQYVNVE--SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNG  684
              Y+ V+  SV++ALH+++GS+  W +C   +PY +++  SI YHA LS KG+RSLIY+G
Sbjct  330  LSYIWVDDRSVRQALHIREGSVKQWLRCNYGIPYASDIPSSIKYHAYLSKKGYRSLIYSG  389

Query  685  DRDLFIPSLSAEAWTKSLNY  744
            D D+ +P L  + W +SLNY
Sbjct  390  DHDMIVPFLGTQGWVRSLNY  409



>ref|NP_850036.1| sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 gb|AEC07392.1| serine carboxypeptidase-like 8 [Arabidopsis thaliana]
Length=416

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 135/249 (54%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN LYV GDSYSG ++P L Q IS GN    +P IN +GY++GN V
Sbjct  150  EFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINLQGYMLGNPV  209

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   +A G GLIS+E        C  N  +  P  T+C      +   T   
Sbjct  210  TYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKI  269

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C + N    + S   +             Y  Y L +       + N ESV
Sbjct  270  NIHHILTPDCDVTN----VTSPDCY-------------YYPYHLIEC------WANDESV  306

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALH++KGS   W +C   +PYN+++  SI YH N S  G+RSLIY+GD D+ +P L+ 
Sbjct  307  REALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLAT  366

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  367  QAWIRSLNY  375



>ref|NP_973516.2| sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 gb|AEC07391.1| serine carboxypeptidase-like 8 [Arabidopsis thaliana]
Length=424

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 135/249 (54%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN LYV GDSYSG ++P L Q IS GN    +P IN +GY++GN V
Sbjct  141  EFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINLQGYMLGNPV  200

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   +A G GLIS+E        C  N  +  P  T+C      +   T   
Sbjct  201  TYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKI  260

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C + N    + S   +             Y  Y L +       + N ESV
Sbjct  261  NIHHILTPDCDVTN----VTSPDCY-------------YYPYHLIEC------WANDESV  297

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALH++KGS   W +C   +PYN+++  SI YH N S  G+RSLIY+GD D+ +P L+ 
Sbjct  298  REALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLAT  357

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  358  QAWIRSLNY  366



>gb|KHN45449.1| Serine carboxypeptidase-like 11 [Glycine soja]
Length=433

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/249 (36%), Positives = 136/249 (55%), Gaps = 31/249 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+PE+ SN  Y+G DSYSG   P + Q ISNGN+  L+P IN +GYL+GN +
Sbjct  155  QFLRKWLIDHPEFLSNEFYMGADSYSGIPAPAIVQEISNGNEKGLQPRINLQGYLLGNPI  214

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
            T  +E +    FA G GLIS+E                            +  L+ +N  
Sbjct  215  TTRNEGNDQIPFAHGMGLISDEL---------------------------YACLSGINT-  246

Query  364  AYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNVESV  537
             YILD  C  ++  +     +  +  K    +N+ +    + C+     +A Q+ N ESV
Sbjct  247  FYILDRYCKSDSPKKHEAQWRRSLTQKFEASLNSHLRVPDIRCQIFGFFLATQWANDESV  306

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +++LH+++G+I  WE+C     +   +  S  +H NLS KG+RSLIY+GD D  +P +S 
Sbjct  307  RKSLHIREGTIGKWERCYTT-DFEEQIFSSFEFHVNLSGKGYRSLIYSGDHDAVVPFMST  365

Query  718  EAWTKSLNY  744
            +AW ++LNY
Sbjct  366  QAWIRALNY  374



>gb|AAC17816.2| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AAM15006.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
Length=433

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 135/249 (54%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN LYV GDSYSG ++P L Q IS GN    +P IN +GY++GN V
Sbjct  150  EFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINLQGYMLGNPV  209

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   +A G GLIS+E        C  N  +  P  T+C      +   T   
Sbjct  210  TYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKI  269

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C + N    + S   +             Y  Y L +       + N ESV
Sbjct  270  NIHHILTPDCDVTN----VTSPDCY-------------YYPYHLIEC------WANDESV  306

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALH++KGS   W +C   +PYN+++  SI YH N S  G+RSLIY+GD D+ +P L+ 
Sbjct  307  REALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLAT  366

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  367  QAWIRSLNY  375



>ref|NP_850035.1| sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 gb|AEC07393.1| serine carboxypeptidase-like 8 [Arabidopsis thaliana]
Length=458

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 135/249 (54%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN LYV GDSYSG ++P L Q IS GN    +P IN +GY++GN V
Sbjct  150  EFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINLQGYMLGNPV  209

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   +A G GLIS+E        C  N  +  P  T+C      +   T   
Sbjct  210  TYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKI  269

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C + N    + S   +             Y  Y L +       + N ESV
Sbjct  270  NIHHILTPDCDVTN----VTSPDCY-------------YYPYHLIEC------WANDESV  306

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALH++KGS   W +C   +PYN+++  SI YH N S  G+RSLIY+GD D+ +P L+ 
Sbjct  307  REALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLAT  366

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  367  QAWIRSLNY  375



>ref|XP_006415268.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
 gb|ESQ33621.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
Length=464

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 140/263 (53%), Gaps = 30/263 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL++YPE+ SN LYVGGDSY+G ++P + Q IS GN+   KP +N KGY++GN  
Sbjct  158  QFLQKWLVEYPEFVSNPLYVGGDSYAGIVVPAIVQQISKGNEHSYKP-MNLKGYILGNPS  216

Query  184  THFSE-HDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T   + H+    +A G GLIS+E        C  N  K  P  T+C   +  +       
Sbjct  217  TDLDQDHNSKIPYAHGMGLISDELFELLKRSCQGNYVKVDPTNTQCLKLMEDYNKCVSRI  276

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD------------  501
            N  +IL  +C       DL S         F+  N    N   L +SD            
Sbjct  277  NEGFILIPLC-------DLASPNP------FSMENVGRRNLGSLVRSDLSLPTPDCYMYR  323

Query  502  -SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGF-RSLI  675
              +A  + N E V++ALHV KGSI  W +C  ++ Y  +++ S+ YH N S KGF RSL+
Sbjct  324  YVLATHWANDEDVRKALHVVKGSIREWVRCDWDMAYEKDIKSSVPYHLNNSMKGFYRSLV  383

Query  676  YNGDRDLFIPSLSAEAWTKSLNY  744
            Y+GD D+ +P L  +AW KSLNY
Sbjct  384  YSGDHDMMVPFLGTQAWIKSLNY  406



>ref|XP_010499905.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18 [Camelina sativa]
Length=467

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/256 (38%), Positives = 142/256 (55%), Gaps = 15/256 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF +KWL++ PE+ SN LYVGGDSY+G ++P + Q IS GN+    P IN KGY++GN  
Sbjct  160  EFFQKWLVENPEFVSNPLYVGGDSYAGIVVPAIVQQISIGNEHGYNPQINLKGYVLGNPS  219

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T   S+H+    +A G GLIS+E        C  N  K  P  T+C   +  +       
Sbjct  220  TDLDSDHNSKIPYAHGMGLISDELYESLERTCKGNYVKVDPTNTQCLKFVDDYDKCVSRL  279

Query  358  NPAYILDSVCLI--NNGLEDLLSGKAFVPIKRFNGVNAKIYN----RYLLCKSDSIAAQY  519
            N  +IL ++C +   N       GK ++     + ++    +    RYLL      A+ +
Sbjct  280  NEGFILIALCDLASPNPYSGEHGGKNYLKTLVQSDLSLPTPDCYMFRYLL------ASHW  333

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIYNGDRDL  696
             N E V+ ALHV K SI  W +C  +LPY+ +++ S+ YH N S KG +RSL+Y+GD D+
Sbjct  334  ANDEDVRRALHVVKESIGEWVRCNWDLPYDKDIKSSVPYHLNNSIKGEYRSLVYSGDHDM  393

Query  697  FIPSLSAEAWTKSLNY  744
             +P +  +AW KSLNY
Sbjct  394  MVPFVGTKAWIKSLNY  409



>ref|NP_850034.1| sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 sp|Q8RUW5.2|SCP8_ARATH RecName: Full=Serine carboxypeptidase-like 8; AltName: Full=Protein 
SINAPOYLGLUCOSE ACCUMULATOR 1; AltName: Full=Sinapoylglucose--malate 
O-sinapoyltransferase; Short=SMT; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF78760.1|AF275313_1 sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 gb|AAK59557.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AAK93737.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07390.1| serine carboxypeptidase-like 8 [Arabidopsis thaliana]
Length=433

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 135/249 (54%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN LYV GDSYSG ++P L Q IS GN    +P IN +GY++GN V
Sbjct  150  EFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEPPINLQGYMLGNPV  209

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   +A G GLIS+E        C  N  +  P  T+C      +   T   
Sbjct  210  TYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKI  269

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C + N    + S   +             Y  Y L +       + N ESV
Sbjct  270  NIHHILTPDCDVTN----VTSPDCY-------------YYPYHLIEC------WANDESV  306

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALH++KGS   W +C   +PYN+++  SI YH N S  G+RSLIY+GD D+ +P L+ 
Sbjct  307  REALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLAT  366

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  367  QAWIRSLNY  375



>emb|CDP06924.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 133/255 (52%), Gaps = 22/255 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EFIRKWL D+PEY+SN  YV G  Y G  +P+L Q ISNGN+  +KP ++ KGY++GN +
Sbjct  145  EFIRKWLHDHPEYKSNPFYVSGILYGGIPVPILTQLISNGNEDGIKPRVDLKGYILGNPI  204

Query  184  THFSE-HDYTYQFALGYGLISEEFARKSYDDC-----ITNPDKKPFFTKCQLDILRFVML  345
               S   +Y   FA G GLIS+E        C     I +PD       C  ++  +   
Sbjct  205  MKVSGILNYRVPFAYGMGLISDELYESLKVSCKGEYEIIDPDN----AACSKNMQAYNKA  260

Query  346  TFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQY  519
            +      +I  +  L+ + L +               + ++ +   L    +  ++   +
Sbjct  261  SNHIYAIFIQINYLLVGDPLNNCC----------IRSLKSQTFGNLLQSNMEWITLVDHW  310

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
             N +SVQEALHV++ +I  W  C   LPY  N    + YHANLSTKG+RSLIY GD DL 
Sbjct  311  ANNKSVQEALHVRRETIGQWVSCSDTLPYTENAGSVVPYHANLSTKGYRSLIYCGDHDLL  370

Query  700  IPSLSAEAWTKSLNY  744
             P +  +AW +SL+Y
Sbjct  371  APHIETQAWIRSLHY  385



>emb|CDP01266.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 139/258 (54%), Gaps = 21/258 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNG-NDARLKPAI--NFKGYLVG  174
            EF+RK+LID+PE+ SN  YVGGDS+SG ++P++ + IS G N  RL   I     GYL+G
Sbjct  171  EFLRKFLIDHPEFISNPFYVGGDSFSGLIVPIITELISEGKNFKRLFSQIVRPKSGYLIG  230

Query  175  NGVTHFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTF  351
            N VT  ++ +Y   FA G GLIS+E       +C     D  P    C  D+     +  
Sbjct  231  NPVTTPTDDNYRVPFAHGMGLISDELYESLKRNCKGKYQDIDPSNFPCSQDLQLLDNIQV  290

Query  352  VNNPAYILDSVC--LINNGLEDLLSG---KAFVPIKRFNGVNAKIYNRYLLCKSDS--IA  510
             N    IL+  C     N     L G   K F+ + RF    A        C++D   ++
Sbjct  291  AN----ILEPTCDFWAPNPRNLFLEGSLDKTFLGLNRFERFLA------FRCRADGYKLS  340

Query  511  AQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDR  690
              + N ++V EAL + K SI  W +C   LPY   V+D + YHANLS+KG+RSL+Y+GD 
Sbjct  341  YAWANDDNVHEALQIHKESIGYWRRCNYGLPYTTTVQDCVPYHANLSSKGYRSLMYSGDH  400

Query  691  DLFIPSLSAEAWTKSLNY  744
            D  +P  + +AW +SLNY
Sbjct  401  DFVVPFFATQAWIRSLNY  418



>ref|XP_006295774.1| hypothetical protein CARUB_v10024896mg [Capsella rubella]
 gb|EOA28672.1| hypothetical protein CARUB_v10024896mg [Capsella rubella]
Length=436

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 137/250 (55%), Gaps = 25/250 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL  +P++ SNS YV GDSYSG ++P L Q IS GN     P IN +GY++GN +
Sbjct  151  KFLQKWLSKHPQFMSNSFYVTGDSYSGMIVPALVQEISKGNYICCNPPINLQGYVLGNPI  210

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T ++EH+  Y+  FA G  LIS+E  +     C  N  +  P  TKC   +  +   T  
Sbjct  211  T-YAEHEKNYRIPFAHGMSLISDELYKSLKRACKGNYENVDPSNTKCLKLVEEYHKCTDK  269

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N  + L   C                  K+  G  +     YL      +  ++ N E 
Sbjct  270  INSQHTLLPDC-----------------DKKGMGETSPDCYYYLYF----LIERWANDEK  308

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V+EALH++KG+   W++C   +PY+NN+  S+ YHAN S +G+RSLIY+GD D+ +P  +
Sbjct  309  VREALHIRKGTKGQWDRCNWTIPYDNNILSSVPYHANNSFRGYRSLIYSGDHDITMPFQA  368

Query  715  AEAWTKSLNY  744
             +AW KSLNY
Sbjct  369  TQAWIKSLNY  378



>ref|XP_010320339.1| PREDICTED: serine carboxypeptidase-like 10 isoform X3 [Solanum 
lycopersicum]
Length=427

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/254 (39%), Positives = 133/254 (52%), Gaps = 15/254 (6%)
 Frame = +1

Query  16   KWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVTHFS  195
            KWL D+P++ SN  YV G+SYSG +IP++ Q ISNGN A  +P +N +GYL+GN VT  S
Sbjct  119  KWLNDHPQFISNPFYVSGNSYSGMIIPIITQLISNGNIAGKEPLVNLQGYLIGNAVT-IS  177

Query  196  EHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNNPA  366
              D  Y   F  G GLIS+E  +    +C     +  P  T C  D   F  L    N  
Sbjct  178  PQDEKYHIVFCHGMGLISDELYKSLEKNCRGEYTNINPKNTGCANDFRNFKQLVKNINVE  237

Query  367  YILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD--SIAAQYVNVESVQ  540
            ++L   C  ++  +D+         +R          R   C SD       + N   VQ
Sbjct  238  HVLKPFCTNDDDPKDVYQ---MTSERRLLDDKLISLQREDKCDSDWRKHLRYWANDPQVQ  294

Query  541  EALHVKKGSIDNWEQCRANLP------YNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            EALHV+KG I++W +CR ++       Y   V + + YHANLSTKG+RSLIY+GD D  +
Sbjct  295  EALHVRKGIIESWIKCRRDISEGSHHNYTLTVHNVVPYHANLSTKGYRSLIYSGDHDYMV  354

Query  703  PSLSAEAWTKSLNY  744
            P    + W KSLNY
Sbjct  355  PFQDTQTWIKSLNY  368



>ref|XP_009771128.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 138/255 (54%), Gaps = 17/255 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLI + E+  N +Y+GGDSYSG  +P++ Q ISNG +A  KP+IN KGY++GN  
Sbjct  163  QFLRKWLIKHQEFIRNPMYIGGDSYSGITVPVITQLISNGIEAGHKPSINLKGYILGNPS  222

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDK--KPFFTKCQLDILRFVMLTFVN  357
            T   +++Y   +A G GLIS+E  +    +C     +   P    C      F  L    
Sbjct  223  TFPLQYNYWVPYAHGMGLISDELYQLLEKNCNGENLQYADPSNVLCYQHYQTFEQLISGI  282

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY-LLCKSD--SIAAQYVNV  528
            N  +IL+  C       D  S ++F    R  G    +Y  Y   C+ +   ++  + N 
Sbjct  283  NKPHILEPSC-----GSDAESKRSF----RLFGKRRSLYENYSTKCRVEVHRLSTYWAND  333

Query  529  ESVQEALHVKKGSIDNWEQCR---ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
              VQEAL+V+KG+I  W +CR    N  Y    +DSI YH  LS K +RSLIY+GD D+ 
Sbjct  334  PRVQEALNVRKGAITRWTRCRESIVNKTYTITFQDSIPYHVELSKKLYRSLIYSGDHDMG  393

Query  700  IPSLSAEAWTKSLNY  744
            IP  S + W KSLNY
Sbjct  394  IPFQSTQFWIKSLNY  408



>ref|XP_006342726.1| PREDICTED: serine carboxypeptidase-like 11-like [Solanum tuberosum]
Length=466

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 137/260 (53%), Gaps = 17/260 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKW I++PE+ SNS YV GDSY+G  +P++ Q ISNG +   +P IN KGY +GN  
Sbjct  152  EFLRKWFINHPEFISNSFYVSGDSYAGITVPVMVQLISNGIEVGKEPLINLKGYSLGNPK  211

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F  G GLIS+E        C     + K   T C  ++  F  L     
Sbjct  212  TFPEEVNYKIPFCHGMGLISDELYESLKQTCKGEYLNIKSTHTPCSENLKIFKELVSGIC  271

Query  361  PAYILDSVC--------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ  516
               +L+  C        L  +  E     + F+ + R    +  IY R     + +++  
Sbjct  272  DEQVLEPYCGTYSEEPKLCQSSSERRSLEENFIFLNR----DDFIYRRISRVDTHNLSVY  327

Query  517  YVNVESVQEALHVKKGSID-NWEQCRANL---PYNNNVRDSIAYHANLSTKGFRSLIYNG  684
            + N   VQEALHV+KG+I   W +CR ++    Y     +SI YH NLSTKG+RSLIY+G
Sbjct  328  WANDPKVQEALHVRKGTIKRTWARCRQSIGDKSYAITFMNSIPYHTNLSTKGYRSLIYSG  387

Query  685  DRDLFIPSLSAEAWTKSLNY  744
            D D+ +P  S +AW K LNY
Sbjct  388  DHDMVVPFQSTQAWIKFLNY  407



>ref|XP_006472316.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 143/261 (55%), Gaps = 21/261 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN+ YVGGDSYSG  +P LAQ ISN N+  +KP IN +GY++GN  
Sbjct  155  QFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPLINLQGYILGNPK  214

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    + +    FA G GLIS E        C  +  +  P    C  D   F  L    
Sbjct  215  TDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLNDNQAFSELISGL  274

Query  358  NPAYILDSVCLI-------NNG----LEDLLSGKAFV-PIKRFNGVNAKIYNRYLLCKSD  501
            +  +IL+  C         +NG    L D    + F+ P      +  + +  Y+L ++ 
Sbjct  275  DQNHILEPHCPFFSPKPRDSNGKRRSLNDNEKSQEFLDPEPALPSIGCRSFG-YMLSQN-  332

Query  502  SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N  +V++AL +++GS   W++C  +LPY   +  S ++H +LSTKG+RSLIY+
Sbjct  333  -----WENDYNVRKALQIRQGSKGKWQRCNYDLPYTQEIGSSFSFHVSLSTKGYRSLIYS  387

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  EAW KSLNY
Sbjct  388  GDHDMVVPFLGTEAWIKSLNY  408



>ref|XP_006472315.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
Length=487

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 143/261 (55%), Gaps = 21/261 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN+ YVGGDSYSG  +P LAQ ISN N+  +KP IN +GY++GN  
Sbjct  155  QFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPLINLQGYILGNPK  214

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    + +    FA G GLIS E        C  +  +  P    C  D   F  L    
Sbjct  215  TDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLNDNQAFSELISGL  274

Query  358  NPAYILDSVCLI-------NNG----LEDLLSGKAFV-PIKRFNGVNAKIYNRYLLCKSD  501
            +  +IL+  C         +NG    L D    + F+ P      +  + +  Y+L ++ 
Sbjct  275  DQNHILEPHCPFFSPKPRDSNGKRRSLNDNEKSQEFLDPEPALPSIGCRSFG-YMLSQN-  332

Query  502  SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N  +V++AL +++GS   W++C  +LPY   +  S ++H +LSTKG+RSLIY+
Sbjct  333  -----WENDYNVRKALQIRQGSKGKWQRCNYDLPYTQEIGSSFSFHVSLSTKGYRSLIYS  387

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  EAW KSLNY
Sbjct  388  GDHDMVVPFLGTEAWIKSLNY  408



>ref|XP_009133996.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Brassica 
rapa]
Length=322

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 135/249 (54%), Gaps = 22/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG  +P L Q IS GN    KP IN +GY++GN V
Sbjct  36   EFLQKWLSKHPQFFSNPFYATGDSYSGKTVPALVQEISQGNYKCCKPLINLQGYVLGNPV  95

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T+   E +Y   F+ G  LIS+E       +C  N  +  P  TKC   +  +   T   
Sbjct  96   TYPEFEENYRIPFSHGMSLISDELHESLKINCKGNYGNVDPRNTKCLKLVEEYHKCTDKI  155

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C      +D  + K   P       +   Y  Y++         + N E V
Sbjct  156  NTQHILLPDC------DDKRNPKNTSP-------DCYYYLYYII-------ECWANNERV  195

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHVKKG+  +W++C   +PY++++  S+ YH N+S  G+RSL+Y+GD D+ +P L  
Sbjct  196  REALHVKKGTKGHWQRCNWTIPYDHDIISSVPYHMNISLSGYRSLVYSGDHDITMPFLGT  255

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  256  QAWIKSLNY  264



>ref|XP_004238557.1| PREDICTED: uncharacterized protein LOC101252581 [Solanum lycopersicum]
Length=921

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 140/255 (55%), Gaps = 18/255 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKW +D+PE+  N  YVGGDSYSG ++P++ Q I+  N+  ++  IN KGYL+GN V
Sbjct  157  QFLRKWFVDHPEFLKNPFYVGGDSYSGIVVPIITQIIAIKNEMEVELFINLKGYLLGNPV  216

Query  184  THFSEH--DYTYQFALGYGLISEEFARKSYDDCITNPDKKPFF------TKCQLDILRFV  339
            T F +H  DY   FA G GLISEE        C     K  +F        C  D+  F 
Sbjct  217  T-FKDHEDDYKIPFAYGMGLISEELYESLKSSC-----KGEYFNINASNAPCLQDVQTFN  270

Query  340  MLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQY  519
             L      A+IL+  C   +     L G+    + + N +   I  R    K    +  +
Sbjct  271  ELLKGIYKAHILEPKCKRFSPRPHQLFGER-RSLHQLNNLPGLIKCRENWYKH---SYHW  326

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
             + + V++AL+++K S   W++C +NL YN  V  SI YH NLS+KG+RSLIY+GD D+ 
Sbjct  327  ADDDQVRDALNIRKRSTGKWKRCESNLQYNRMVMSSIPYHKNLSSKGYRSLIYSGDHDMI  386

Query  700  IPSLSAEAWTKSLNY  744
            +   S +AW KSLNY
Sbjct  387  VTFPSTQAWIKSLNY  401


 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 140/255 (55%), Gaps = 18/255 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGND-ARLKPAINFKGYLVGNG  180
            +F+RKW +D+ E+  N  YVGGDS SG ++P++ Q ++  N+   ++  IN KGYL+GN 
Sbjct  618  QFLRKWFVDHQEFLENPFYVGGDSCSGMIVPVITQIVAIKNEIMEVELFINLKGYLLGNP  677

Query  181  VTHFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFF------TKCQLDILRF-V  339
             T   E +Y   FA G GLIS+E       +C     K  +F        C  D+  F  
Sbjct  678  TTFEGETNYRIPFAYGMGLISDELYESLKSNC-----KGEYFNMNASNVPCLQDVQTFNE  732

Query  340  MLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQY  519
            +L  +NNP +IL+  C   +     L G+    + + N +   I  R    K    +  +
Sbjct  733  LLKGINNP-HILEPKCKRFSPRPHTLFGER-RSLHQLNNLRGLIKCRENWYKH---SYHW  787

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
             + + V++AL+++KG+I  WE+C +NL Y   + +S+ YH NLS KG+RSLIY+GD D  
Sbjct  788  ADDDQVRDALNIRKGTIGKWERCASNLQYQMMITNSLPYHKNLSNKGYRSLIYSGDHDKL  847

Query  700  IPSLSAEAWTKSLNY  744
            +   S +AW KSLNY
Sbjct  848  VTFQSTQAWIKSLNY  862



>ref|XP_006855958.1| hypothetical protein AMTR_s00037p00227730 [Amborella trichopoda]
 gb|ERN17425.1| hypothetical protein AMTR_s00037p00227730 [Amborella trichopoda]
Length=521

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 135/250 (54%), Gaps = 5/250 (2%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+  W I+YPE+ SN LY+ GDSYSG  +P+L   I+NG D+  +P  N KGYLVGN V
Sbjct  163  KFLTNWFIEYPEFLSNPLYIAGDSYSGITVPVLTSEIANGIDSGYRPVFNLKGYLVGNPV  222

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRF-VMLTFVNN  360
            T          FA G GLIS+E    +   C       P  ++C L++      L+ +N 
Sbjct  223  TDVEFDSQVVPFAHGMGLISDELFEATKISC-NGKYAFPKGSQCNLNMQAVHECLSRINT  281

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNVES  534
            P +IL+ +C   +    +  G         N     + +  + C++    ++  + N E 
Sbjct  282  P-HILEPLCPFASPRPRVEIGTGLRRWLHENSSGIHLQSTPIFCRTYGYMLSHYWANNER  340

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            VQE LHVKKG+++ W++C   + +  +V  S+ YH NL+ +G+ +LIY+GD D  +P + 
Sbjct  341  VQEVLHVKKGTVNEWKRCNYGINFKADVASSVVYHYNLTMRGYSALIYSGDHDSSVPFIG  400

Query  715  AEAWTKSLNY  744
             +AW +SL +
Sbjct  401  TQAWIRSLEF  410



>gb|KFK38585.1| hypothetical protein AALP_AA3G132800 [Arabis alpina]
Length=435

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 133/251 (53%), Gaps = 32/251 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL ++PEY SN  YV G+SYSG ++P + Q IS+GN    KP IN +GY++GN +
Sbjct  155  EFVRKWLAEHPEYYSNPFYVSGNSYSGKVVPAIVQEISHGNCICCKPQINLQGYVIGNPL  214

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
              F  + +    FA G  LIS+E        C     N D  P  T+C   +  F     
Sbjct  215  ADFDLDTNARIPFAHGMALISDELYESMKSSCGGIYYNVD--PLNTECLKLVEEFAKSLS  272

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVE  531
              N  ++LD+ C       D  S                  N Y L  S+     + N E
Sbjct  273  RINHDFVLDTKC-------DTTSPDC---------------NTYWLLLSE----YWANSE  306

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            SV++AL V KG+ + WE+C +NL YN +++ SI YH N + +G+RSLI++GD D  +P +
Sbjct  307  SVRKALRVVKGTAEKWERCSSNLRYNKDMKSSIPYHKNNTIEGYRSLIFSGDHDFVVPFV  366

Query  712  SAEAWTKSLNY  744
            S  AW KSLNY
Sbjct  367  STRAWIKSLNY  377



>ref|XP_010556480.1| PREDICTED: serine carboxypeptidase-like 1 [Tarenaya hassleriana]
Length=440

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/256 (34%), Positives = 139/256 (54%), Gaps = 37/256 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKW++ +PE+ SN LY+ GDSYSG ++P     IS+GND  ++P +N KGY++GN +
Sbjct  155  QFVRKWMLLHPEFISNPLYIAGDSYSGMIVPPTTLRISDGNDRGVQPRVNLKGYVLGNPL  214

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDC-----ITNPDKKPFFTKCQLDILRFVML  345
            T   + H+    +A G GLIS+E        C     I +P  +    +C   + R+   
Sbjct  215  TNEETNHNAGIPYAHGMGLISDEIYESLVSSCKGNYHIVDPSNR----ECARALERYNEC  270

Query  346  TFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKS--DSIAAQY  519
                N + I D  C                        +A + N    CK+   ++++ +
Sbjct  271  ITGINLSMITDDAC------------------------DADLPNPRPKCKTYYYTLSSYW  306

Query  520  VNVESVQEALHVKKGSIDNWEQCRA-NLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
             N ESV+ +L +++G+I  W +C   N+PYNN+V  S  YH NLS KG+RSLIY+GD D+
Sbjct  307  SNDESVRRSLGIREGTIGEWVRCNGDNIPYNNDVISSFPYHVNLSMKGYRSLIYSGDHDM  366

Query  697  FIPSLSAEAWTKSLNY  744
             +P ++ + W ++LNY
Sbjct  367  IVPHVATQEWVRALNY  382



>ref|XP_008337031.1| PREDICTED: serine carboxypeptidase-like 18 [Malus domestica]
Length=432

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 143/258 (55%), Gaps = 11/258 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN  +VGGDSYSG  +P+LAQ IS+GN   ++PAIN +GY++GN V
Sbjct  116  QFLRKWLVDHPEFMSNPFFVGGDSYSGIPVPVLAQLISDGNQEGVRPAINLQGYILGNPV  175

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T    E +    FA G GLI ++        C        P   +C      +       
Sbjct  176  TVPQDEGNSQITFAHGMGLIPDDLFESLERSCGGEYQTIDPRNAECLKHKQAYHTCISQI  235

Query  358  NPAYILDSVCLINNGLEDL--LSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVN  525
            N A+IL+  C + +    L  L  + ++  K +N  +       L C+S    ++  + N
Sbjct  236  NLAHILEWNCELVSPKPPLHMLDKRRYLSNKDYNVFSESTPPPILDCRSYGYLLSEYWTN  295

Query  526  VESVQEALHVKK----GSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIYNGDR  690
             + V+EALH++K    GSI  W +C  ++PY  ++  SI +HA  S  G +RSLIY+GD 
Sbjct  296  DQYVREALHIRKYAVQGSIGRWXRCSYDIPYEYDIHTSIQFHAKFSAXGXYRSLIYSGDH  355

Query  691  DLFIPSLSAEAWTKSLNY  744
            D+ +P ++ +AW +SLNY
Sbjct  356  DMXVPFMATQAWIRSLNY  373



>ref|XP_002510076.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52263.1| serine carboxypeptidase, putative [Ricinus communis]
Length=453

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/267 (37%), Positives = 143/267 (54%), Gaps = 35/267 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLID+ E+ SN +YVGGDSYSG  +P L Q I NGN+   KP++N KGYL+GN  
Sbjct  143  QFLRKWLIDHTEFLSNPVYVGGDSYSGMPLPPLVQRILNGNEEGSKPSVNLKGYLLGNAA  202

Query  184  THFSEHDYTYQ------FALGYGLISEEFARKSYDDC-----ITNPDKKPFFTKCQLDIL  330
            T     DYT+       FA G GLIS+E        C     I +P        C   + 
Sbjct  203  T-----DYTFDGNSQVPFAHGMGLISDELFESLRRTCGGEYVIIDPSN----ADCMKHMQ  253

Query  331  RFVMLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY-------LL  489
             F  +T   N A IL+ +C  N      +     +  +R   + AK  +         + 
Sbjct  254  EFNKVTSGLNTAQILEPLC--NFAFPKPIE----ISFRRRRSLYAKSGDFADPDPSIPIG  307

Query  490  CKSDS--IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGF  663
            C++ +  ++  +VN +SV++ALH+++GSI  W +C   L Y   V  +I YH  L  KG+
Sbjct  308  CRTYAYLLSKYWVNDKSVRKALHIREGSIGEWTRCNYGLTYTYEVFSAIKYHLYLGKKGY  367

Query  664  RSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            RSLIY+GD D+ +P +  +AW +SLN+
Sbjct  368  RSLIYSGDHDMLVPFVGTQAWIRSLNF  394



>ref|XP_009103431.1| PREDICTED: serine carboxypeptidase-like 10 [Brassica rapa]
Length=440

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 138/249 (55%), Gaps = 22/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  YV GDSYSG ++P L Q IS GN    KP IN +GY++GN V
Sbjct  154  EFLQKWLSKHPQFFSNPFYVIGDSYSGKIVPALVQKISKGNYICCKPLINLQGYVLGNPV  213

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCI-TNPDKKPFFTKCQLDILRFVMLTFVN  357
            T+   E +Y   F+ G  LIS+E       +C     +  P  TKC   +  +   T   
Sbjct  214  TYPEFELNYRIPFSHGMSLISDELYESLNRNCKGVYENVDPRNTKCLELVAEYHKCTDKI  273

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            NP  IL   C  N+G  + +S   +             Y  Y L +S      + N E V
Sbjct  274  NPHNILLPDC-DNDGNSENISPDCY-------------YYLYYLIES------WANNERV  313

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHV+KG+  +W++C   +PY+ ++  S+ YH N S  G+RSLIY+GD D+ +PS++ 
Sbjct  314  REALHVQKGTKGHWKRCNRTIPYSPDIISSVPYHMNNSISGYRSLIYSGDHDMTVPSIAT  373

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  374  QAWIKSLNY  382



>ref|XP_010429234.1| PREDICTED: serine carboxypeptidase-like 12 isoform X1 [Camelina 
sativa]
Length=433

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 127/249 (51%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  +P + SN  Y  GDSYSG  +P L Q IS GN    +P IN +GY++GN +
Sbjct  153  EFLLKWLNKHPTFSSNPFYAAGDSYSGMTVPALVQEISKGNYICCEPPINLQGYVLGNPI  212

Query  184  THFSEH-DYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            TH  E   Y   F+ G GLIS+E        C  N  +  P  TKC              
Sbjct  213  THIEEEIKYRVPFSHGMGLISDELYESIRSACKGNYFNVDPSNTKC--------------  258

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
                 L  V   +  ++ L      +P       +  +Y  YLL         + N ESV
Sbjct  259  -----LKLVEEYHKCIDKLYEYNILLPDCNMTSSDCFLYPYYLL-------NFWANDESV  306

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALH+KKGSI  W  C  +  YNN+++ S+ YH + S  G+RSLIY+GD DL +P L+ 
Sbjct  307  RDALHIKKGSIGEWVICSRSNAYNNDIKSSVPYHMHNSINGYRSLIYSGDHDLVVPFLAT  366

Query  718  EAWTKSLNY  744
            EAW KSLNY
Sbjct  367  EAWIKSLNY  375



>ref|XP_006354895.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=472

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/261 (40%), Positives = 142/261 (54%), Gaps = 22/261 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGN-G  180
            EF+RKWL D+PEY SN  Y+ G+SY+G +IP++AQ ISNGN A  +P +N +GYL+G+ G
Sbjct  161  EFLRKWLSDHPEYISNPFYMSGNSYAGKMIPVVAQLISNGNTAGKEPFVNLQGYLIGSPG  220

Query  181  VTHFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
                 E +Y   F+ G GLIS+E  +    +C    TN D  P    C  D   F  L  
Sbjct  221  TLRPQEDNYQILFSYGMGLISDELYKSLEKNCGGEYTNID--PNNKGCANDFRIFKQLVK  278

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYN--RYLLCKSD--SIAAQY  519
              N  +IL+  C       D L G   +  +R   ++ K+ +  R   C SD       +
Sbjct  279  NINGEHILEPFCTY-----DYLQGPYQMSGER-RLLDEKLISLQRQDKCASDWRKHMKYW  332

Query  520  VNVESVQEALHVKKGSIDNWEQCR-----ANLP-YNNNVRDSIAYHANLSTKGFRSLIYN  681
             N   VQEALHV+K  I +W QC       + P Y   + + + YHANLSTKG+RSLIY+
Sbjct  333  ANDPKVQEALHVRKRIIGSWVQCNKISSVGSPPNYTLTIDNVVPYHANLSTKGYRSLIYS  392

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D  +P  S + W KSLNY
Sbjct  393  GDHDYSVPFQSTQKWIKSLNY  413



>ref|XP_011006024.1| PREDICTED: serine carboxypeptidase-like 3 isoform X2 [Populus 
euphratica]
Length=463

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/252 (35%), Positives = 144/252 (57%), Gaps = 5/252 (2%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+ E+ +N +Y+ GDSYSG ++P + Q ISNGN+  ++P +N KGY++GN +
Sbjct  153  QFLRKWLMDHQEFLANPIYIAGDSYSGKIVPAIVQNISNGNNDGIEPLLNVKGYILGNPI  212

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T  + + +    FA G GLIS+E        C       KP   +C  ++  F       
Sbjct  213  TDPTFDFNSRIPFAHGMGLISDELYESLKKSCAGEYQTIKPSNAECLKNVEAFDKCISDI  272

Query  358  NPAYILDSVCLINNG-LEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKS--DSIAAQYVNV  528
              A+IL+  C  +   L + L  + ++       ++ K     + C++    +AA + N 
Sbjct  273  EDAHILERKCPSDAPRLIETLGKRRYLRENPRELLHFKPDLPTIGCRAYGHVLAAYWAND  332

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ++V++ALHV++GSI+ W++C   LPY   ++ SI YH +L  KG+R LIY+GD D+  P 
Sbjct  333  DNVRKALHVREGSIEEWKRCNYKLPYTYEIKSSIKYHIDLGIKGYRRLIYSGDHDMEAPF  392

Query  709  LSAEAWTKSLNY  744
            L  +AW + LNY
Sbjct  393  LGTQAWIRYLNY  404



>ref|XP_010429235.1| PREDICTED: serine carboxypeptidase-like 12 isoform X2 [Camelina 
sativa]
Length=424

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 127/249 (51%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  +P + SN  Y  GDSYSG  +P L Q IS GN    +P IN +GY++GN +
Sbjct  144  EFLLKWLNKHPTFSSNPFYAAGDSYSGMTVPALVQEISKGNYICCEPPINLQGYVLGNPI  203

Query  184  THFSEH-DYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            TH  E   Y   F+ G GLIS+E        C  N  +  P  TKC              
Sbjct  204  THIEEEIKYRVPFSHGMGLISDELYESIRSACKGNYFNVDPSNTKC--------------  249

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
                 L  V   +  ++ L      +P       +  +Y  YLL         + N ESV
Sbjct  250  -----LKLVEEYHKCIDKLYEYNILLPDCNMTSSDCFLYPYYLL-------NFWANDESV  297

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALH+KKGSI  W  C  +  YNN+++ S+ YH + S  G+RSLIY+GD DL +P L+ 
Sbjct  298  RDALHIKKGSIGEWVICSRSNAYNNDIKSSVPYHMHNSINGYRSLIYSGDHDLVVPFLAT  357

Query  718  EAWTKSLNY  744
            EAW KSLNY
Sbjct  358  EAWIKSLNY  366



>ref|XP_010314600.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=463

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 139/261 (53%), Gaps = 23/261 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+++PE+  N  YV GDSYSG  IP++ Q ISNG +   +P IN KGY +GN +
Sbjct  153  EFLRKWLVNHPEFILNPFYVSGDSYSGITIPVIVQLISNGIEQGKEPLINLKGYSLGNPL  212

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   E +Y   ++ G GLIS E      + C     N D  P   +C  +   F  L   
Sbjct  213  TFSEESNYQVPYSHGMGLISNELYESLNEICKGEYLNID--PTNKQCVENFKMFKNLVSG  270

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY--LLCKSDSIAAQ----  516
             N   IL+  C  +       S + +   +R       I+ +Y   +C+   +A +    
Sbjct  271  INDQQILEPFCGTD-------SEEQYSSERRSLEEQYFIFQKYDDFICRESRVATRKLSN  323

Query  517  -YVNVESVQEALHVKKGSI-DNWEQCRANL---PYNNNVRDSIAYHANLSTKGFRSLIYN  681
             + N   VQEALHV+KG+I   W +CR ++    Y     +SI YH NLS+KG+RSLIY+
Sbjct  324  YWANDPRVQEALHVRKGTIRRTWARCRQSILSTSYTVTFMNSIPYHVNLSSKGYRSLIYS  383

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P  S +AW K LNY
Sbjct  384  GDHDMVVPFQSTQAWIKYLNY  404



>ref|XP_010320340.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=474

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/265 (39%), Positives = 141/265 (53%), Gaps = 30/265 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGN-G  180
            EFIRKWL D+P+Y SN  Y+ G+SY+G +IP++AQ ISNGN A  +P +N +GYL+G+ G
Sbjct  163  EFIRKWLNDHPKYISNPFYMSGNSYAGKMIPVVAQLISNGNTAGEEPFVNLQGYLMGSPG  222

Query  181  VTHFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
                 E +Y   F+ G GLIS E  +    +C    TN D  P    C  D L F  L  
Sbjct  223  TFRPQEDNYQVLFSYGMGLISNELYKSLEKNCGGEYTNID--PNDKGCANDFLIFKQLVK  280

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQ-----  516
              N  +IL+  C       D L G       + +G    + ++ +  +S    A      
Sbjct  281  NINGEHILEPFCTY-----DYLQGPY-----QMSGERRLLDDKLISSQSQDKCASDWRKH  330

Query  517  ---YVNVESVQEALHVKKGSIDNWEQCR-----ANLP-YNNNVRDSIAYHANLSTKGFRS  669
               + N   VQEALH++KGSI +W QC       + P Y   + + + YHANLS KG+RS
Sbjct  331  MKYWANDPKVQEALHIQKGSIGSWVQCNKISSVGSPPNYTLMIDNVVPYHANLSIKGYRS  390

Query  670  LIYNGDRDLFIPSLSAEAWTKSLNY  744
            LIY+GD D  +P  S + W KSLNY
Sbjct  391  LIYSGDHDYSVPFQSTQKWIKSLNY  415



>ref|XP_002878651.1| hypothetical protein ARALYDRAFT_900758 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54910.1| hypothetical protein ARALYDRAFT_900758 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/252 (38%), Positives = 136/252 (54%), Gaps = 29/252 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  YV GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  152  EFLQKWLSKHPQFFSNPFYVTGDSYSGMIVPALVQEISKGNYICCKPLINLQGYVLGNPI  211

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T ++EH+  Y+  FA G  LIS+E        C  N  +  P  TKC   +  +   T  
Sbjct  212  T-YAEHEKNYRIPFAHGMSLISDELYESLKRTCKGNYENVDPRNTKCLKLVEEYHKCTDK  270

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAK--IYNRYLLCKSDSIAAQYVNV  528
             N  +IL   C                  K+ +G+ +    Y  Y L +       + N 
Sbjct  271  INTQHILIPDC-----------------DKKGHGITSPDCYYYLYFLIEC------WANN  307

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            E V+EALHV+KG+   W++C   + Y+NN+  S+ YH N S  G+RSLIY+GD D+ +P 
Sbjct  308  ERVREALHVRKGTKGQWQRCNWTISYDNNIISSVPYHMNNSISGYRSLIYSGDHDITMPF  367

Query  709  LSAEAWTKSLNY  744
             + +AW KSLNY
Sbjct  368  QATQAWIKSLNY  379



>ref|XP_002878650.1| hypothetical protein ARALYDRAFT_481168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54909.1| hypothetical protein ARALYDRAFT_481168 [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 133/249 (53%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y  N  YV GDSYSG ++P L Q IS GN    +P IN +GY++GN V
Sbjct  152  EFLQKWLRRHPQYFINPFYVVGDSYSGMIVPALVQEISQGNYICCEPPINLQGYMLGNPV  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   +A G GLIS+E        C  N  +  P  TKC      +   T   
Sbjct  212  TYMDFEQNFRILYAYGMGLISDEIYEPMKRSCNGNYYNVDPSNTKCLKLTEEYHKCTDKI  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C + N    + S   +             Y  Y L +       + N ESV
Sbjct  272  NIHHILTPDCDVTN----VTSPDCY-------------YYPYHLIEC------WANDESV  308

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EAL +KKGS   W +C   +PYN+++  SI YH N S +G+RSLIY+GD D+ +P L+ 
Sbjct  309  REALQIKKGSKGKWARCNRTIPYNHDIESSIPYHMNNSIRGYRSLIYSGDHDIAVPFLAT  368

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  369  QAWIRSLNY  377



>emb|CDX73832.1| BnaA03g32150D [Brassica napus]
Length=436

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/248 (36%), Positives = 133/248 (54%), Gaps = 22/248 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+R WL  +PEY SN  YV G+SYSG ++P + Q IS GN    KP IN +GY++GN V
Sbjct  154  EFVRNWLAKHPEYFSNPFYVAGNSYSGKVVPAVVQEISIGNGLCCKPQINLQGYVLGNPV  213

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVNN  360
            T +  +++   FA G GLIS+E        C  N  K  P  T+C   +  F       +
Sbjct  214  TDYVGYNWRIPFAHGMGLISDEIYESLRRICRGNFAKVDPHNTECMNLVEEFEKCVSGLD  273

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESVQ  540
             +YIL    +  +  +D                 A      ++ +S+    ++ N ESV+
Sbjct  274  WSYILGPKYINPSDPDD-----------------ANPLGHRMIVQSN----RWTNEESVR  312

Query  541  EALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSAE  720
             ALHV+KG+I  W  C   LP+ +++  S+ YH N S +G+RSLI++GD D+ +P L+ +
Sbjct  313  RALHVEKGTIGEWSLCDRELPFESDIESSVPYHKNNSIQGYRSLIFSGDHDMGVPFLATQ  372

Query  721  AWTKSLNY  744
             W +SLNY
Sbjct  373  DWIRSLNY  380



>ref|XP_004486284.1| PREDICTED: serine carboxypeptidase-like 12-like [Cicer arietinum]
Length=464

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 138/253 (55%), Gaps = 21/253 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+P++QSN + V          P++ Q I  GN   ++P IN +GYL+GN +
Sbjct  168  QFLRKWLVDHPKFQSNEIPV----------PVIVQEIVQGNKKGVQPWINLQGYLLGNPI  217

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T  +E +Y   FA G GLIS+E       +C     N + K     C  DI  F   T  
Sbjct  218  TTRNERNYAIPFAHGMGLISDELYESLQKNCHGDYVNVETKNVV--CSRDISSFDEATSG  275

Query  355  NNPAYILDSVCL---INNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVN  525
             N A+ILD +C    +       L  K   P K FN  N  +   Y       +   + N
Sbjct  276  LNTAHILDPLCEWLDVEEAPRRSLIKK--YPSKLFN-TNLNLPPLYCRSYPYFLCGFWAN  332

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
             ++V++ALHV+KGSI  W +C  ++P  ++V +S  YH NLS KG+RSLIY+GD D+ +P
Sbjct  333  DDNVRKALHVRKGSIGKWHRCTYDIPRKSDVPNSYDYHVNLSRKGYRSLIYSGDHDMTVP  392

Query  706  SLSAEAWTKSLNY  744
             L+ +AW +SLNY
Sbjct  393  FLATQAWIRSLNY  405



>ref|XP_011006023.1| PREDICTED: serine carboxypeptidase-like 3 isoform X1 [Populus 
euphratica]
Length=487

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/252 (35%), Positives = 144/252 (57%), Gaps = 5/252 (2%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+ E+ +N +Y+ GDSYSG ++P + Q ISNGN+  ++P +N KGY++GN +
Sbjct  153  QFLRKWLMDHQEFLANPIYIAGDSYSGKIVPAIVQNISNGNNDGIEPLLNVKGYILGNPI  212

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T  + + +    FA G GLIS+E        C       KP   +C  ++  F       
Sbjct  213  TDPTFDFNSRIPFAHGMGLISDELYESLKKSCAGEYQTIKPSNAECLKNVEAFDKCISDI  272

Query  358  NPAYILDSVCLINNG-LEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKS--DSIAAQYVNV  528
              A+IL+  C  +   L + L  + ++       ++ K     + C++    +AA + N 
Sbjct  273  EDAHILERKCPSDAPRLIETLGKRRYLRENPRELLHFKPDLPTIGCRAYGHVLAAYWAND  332

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ++V++ALHV++GSI+ W++C   LPY   ++ SI YH +L  KG+R LIY+GD D+  P 
Sbjct  333  DNVRKALHVREGSIEEWKRCNYKLPYTYEIKSSIKYHIDLGIKGYRRLIYSGDHDMEAPF  392

Query  709  LSAEAWTKSLNY  744
            L  +AW + LNY
Sbjct  393  LGTQAWIRYLNY  404



>ref|XP_006433653.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
 gb|ESR46893.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
Length=467

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 141/261 (54%), Gaps = 21/261 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN  YVGGDSYSG  +P L Q ISN N+  +KP IN +GY++GN  
Sbjct  155  QFLRKWLMDHPEFLSNPFYVGGDSYSGITVPPLVQQISNENEEGIKPLINLQGYILGNPK  214

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    + +    FA G GLIS E        C  +  +  P    C  D   F  L    
Sbjct  215  TDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLNDNQAFSELISGL  274

Query  358  NPAYILDSVCLI-------NNG----LEDLLSGKAFV-PIKRFNGVNAKIYNRYLLCKSD  501
            +  +IL+  C         +NG    L D    + F+ P      +  + +  Y+L ++ 
Sbjct  275  DQNHILEPRCPFFSPKPRDSNGKRRSLNDNEKSQEFLDPEPALPSIGCRSFG-YMLSQN-  332

Query  502  SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N  +V++AL +++GS   W++C  +LPY   +  S +YH +LSTKG+RSLIY+
Sbjct  333  -----WENDYNVRKALQIRQGSKGKWQRCNYDLPYTEEIGSSFSYHVSLSTKGYRSLIYS  387

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  EAW K+LNY
Sbjct  388  GDHDMVVPFLGTEAWIKTLNY  408



>ref|XP_002878643.1| SCPL12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54902.1| SCPL12 [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 133/252 (53%), Gaps = 33/252 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG ++P L Q IS GN     P IN +GY++GN +
Sbjct  153  EFLQKWLSKHPQFSSNPFYACGDSYSGMIVPALVQEISKGNYICCTPPINLQGYILGNPI  212

Query  184  THFSEHDYTYQFALGYGLISEEF---ARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFV  354
            T   + +Y   F+ G  LIS+E     R++ +    N D +   TKC   +  +   T  
Sbjct  213  TSIEDQNYQVPFSHGMALISDELYESIRRACNGNYFNVDSR--NTKCLKLVEEYHKCTDK  270

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N   IL   C       D  S   F            +Y  YLL       + ++N E+
Sbjct  271  LNEFNILSPDC-------DTTSPNCF------------LYPYYLL-------SYWINDET  304

Query  535  VQEALHVKKGSIDNWEQCRA--NLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            V+ ALHV K SI  WE+C     +PYN ++ +SI YH N S  G+RSLIY+GD DL +P 
Sbjct  305  VRNALHVNKWSIGEWERCTHLRLIPYNKDINNSIPYHMNNSISGYRSLIYSGDHDLTVPY  364

Query  709  LSAEAWTKSLNY  744
            L+ +AW KSLNY
Sbjct  365  LATQAWIKSLNY  376



>gb|KDO81474.1| hypothetical protein CISIN_1g012236mg [Citrus sinensis]
Length=467

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 141/261 (54%), Gaps = 21/261 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN  YVGGDSYSG  +P L Q ISN N+  +KP IN +GY++GN  
Sbjct  155  QFLRKWLMDHPEFLSNPFYVGGDSYSGITVPPLVQQISNENEEGIKPLINLQGYILGNPK  214

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    + +    FA G GLIS E        C  +  +  P    C  D   F  L    
Sbjct  215  TDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLNDNQAFSELISGL  274

Query  358  NPAYILDSVCLI-------NNG----LEDLLSGKAFV-PIKRFNGVNAKIYNRYLLCKSD  501
            +  +IL+  C         +NG    L D    + F+ P      +  + +  Y+L ++ 
Sbjct  275  DQNHILEPRCPFFSPKPRDSNGKRRSLNDNEKSQEFLDPEPALPSIGCRSFG-YMLSQN-  332

Query  502  SIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
                 + N  +V++AL +++GS   W++C  +LPY   +  S ++H +LSTKG+RSLIY+
Sbjct  333  -----WENDYNVRKALQIRQGSKGKWQRCNYDLPYTQEIGSSFSFHVSLSTKGYRSLIYS  387

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P L  EAW KSLNY
Sbjct  388  GDHDMVVPFLGTEAWIKSLNY  408



>ref|XP_009135216.1| PREDICTED: serine carboxypeptidase-like 15 [Brassica rapa]
Length=453

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 132/248 (53%), Gaps = 22/248 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+R WL  +PEY SN  YV G+SYSG ++P + Q IS GN    KP IN +GY++GN V
Sbjct  169  EFVRNWLAKHPEYFSNPFYVAGNSYSGKVVPAVVQEISIGNGLCCKPQINLQGYVLGNPV  228

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVNN  360
            T +  +++   FA G GLIS+E        C  N  K  P  T+C   +  F       +
Sbjct  229  TDYVGYNWRIPFAHGMGLISDEIYESLRRICRGNFAKVDPHNTECMNLVEEFEKCVSGLD  288

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESVQ  540
             +YIL    +  +  +D                 A      ++ +S    +++ N ESV+
Sbjct  289  WSYILGPKYINPSDPDD-----------------ANPLGHRMIVQS----SRWTNEESVR  327

Query  541  EALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSAE  720
             ALHV+KG+I  W  C   LPY  ++  S+ YH N S +G+RSLI++GD D+ +P L+ +
Sbjct  328  RALHVEKGTIGEWSLCDRELPYKFDINSSVPYHKNNSIQGYRSLIFSGDHDMGVPFLATQ  387

Query  721  AWTKSLNY  744
             W +SLNY
Sbjct  388  DWIRSLNY  395



>ref|XP_008644916.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Zea mays]
Length=481

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 148/258 (57%), Gaps = 15/258 (6%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F++KW   YP++ S+ LY+ GDSYSG ++P +   I+ G +   +P +N KGYLVGN VT
Sbjct  168  FLKKWFDKYPQFFSSPLYIAGDSYSGMIVPTVTSEIARGKEEGSQPNLNLKGYLVGNPVT  227

Query  187  HFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
             F+ +      FA G GLIS+E   ++Y+   +  D +    +C   +          +P
Sbjct  228  DFNFDGPSRIPFAHGMGLISDEI-YEAYEKSCSVGDSRRQSIECINSLGAIDECIKGISP  286

Query  364  AYILDSVC--------LINNGLEDLLSGKAFVPIKRFNGVNA-KIYNRYLLCKSDS--IA  510
             ++L+ +C        LI++G  ++L  +  VP+         ++    L C++    ++
Sbjct  287  NHVLEPLCAFASPKPKLISSGAREML--QLPVPVHTEEEEEELRLSEISLQCRTAGYMMS  344

Query  511  AQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDR  690
            + + N  SV++AL + KG++ +W +C  ++PY N++  ++ YH +++TKG+RSL+YNGD 
Sbjct  345  SMWANDASVRQALGIHKGTVPSWSRCNYDIPYTNDIPSAVKYHLDVTTKGYRSLVYNGDH  404

Query  691  DLFIPSLSAEAWTKSLNY  744
            D+ +P +  +AW +SLN+
Sbjct  405  DMVVPFIGTQAWIRSLNF  422



>ref|XP_009626153.1| PREDICTED: serine carboxypeptidase-like 13 [Nicotiana tomentosiformis]
Length=466

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 136/254 (54%), Gaps = 21/254 (8%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWLI +PE+  N +Y+GGDSYSG  +P++ Q ISNG +A  KP+IN KGY++GN  T
Sbjct  167  FLRKWLIKHPEFIRNPMYIGGDSYSGITLPVITQLISNGIEAGHKPSINLKGYILGNPST  226

Query  187  HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDK--KPFFTKCQLDILRFVMLTFVNN  360
               +++Y   +A G GLIS+E  +   + C     +   P    C      F  L    N
Sbjct  227  FPLQYNYWIPYAHGMGLISDELYKLLKETCNGENLQYVDPSNVLCYQHYQTFEQLISGIN  286

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY-LLCKSD--SIAAQYVNVE  531
              +IL+  C   +  E            R  G    +Y  Y + C+ +   ++  + N  
Sbjct  287  KPHILEPSC--GSDAES-----------RLFGERRSLYENYSIKCRVEVHRLSTYWANDP  333

Query  532  SVQEALHVKKGSIDNWEQCR---ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
             VQEAL+V+KG+I+ W +CR    N  Y    +DSI YH  LS K +RSLIY+GD D+ I
Sbjct  334  RVQEALNVRKGAIERWTRCRESIVNKTYIITFQDSIPYHVELSKKLYRSLIYSGDHDMGI  393

Query  703  PSLSAEAWTKSLNY  744
            P  S + W K LNY
Sbjct  394  PFQSTQFWIKFLNY  407



>ref|NP_174619.1| serine carboxypeptidase-like 18 [Arabidopsis thaliana]
 gb|AAG51208.1|AC051630_5 serine carboxypeptidase, putative; 88458-86107 [Arabidopsis thaliana]
 gb|AEE31604.1| serine carboxypeptidase-like 18 [Arabidopsis thaliana]
Length=446

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 94/256 (37%), Positives = 140/256 (55%), Gaps = 15/256 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL++ P++ SN +YVGGDSY+G ++P + Q IS GN+   KP IN KGY++GN  
Sbjct  157  EFLQKWLVENPQFVSNPIYVGGDSYAGIVVPAIVQQISIGNEHGYKPQINLKGYILGNPS  216

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T   S+H+    +A   GLIS+E        C  N  K  P  TKC   +  +       
Sbjct  217  TDLDSDHNSKIPYAHRMGLISDELYESLKRTCQGNYVKVDPTNTKCLKLMEDYGKCVSRI  276

Query  358  NPAYILDSVCLI--NNGLEDLLSGKAFVPIKRFNGVNAKIYN----RYLLCKSDSIAAQY  519
            N   IL ++C +   N       G++++     + ++    +    RYLL      A+ +
Sbjct  277  NEGLILIALCDLASPNPYSGEHGGRSYLQTLVQSDLSLPTPDCYMYRYLL------ASHW  330

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIYNGDRDL  696
             N E V+  LHV KGSI  W +C  +LPY  +++ S+ YH N S  G +RSL+Y+ D D+
Sbjct  331  ANDEDVRRELHVVKGSIGKWMRCNWDLPYEKDIKSSVPYHRNNSIIGDYRSLVYSSDHDM  390

Query  697  FIPSLSAEAWTKSLNY  744
             +P +  EAW KSLNY
Sbjct  391  MVPYIGTEAWIKSLNY  406



>ref|XP_010486654.1| PREDICTED: serine carboxypeptidase-like 7 isoform X4 [Camelina 
sativa]
Length=350

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 123/250 (49%), Gaps = 27/250 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SN  YVGGDSYSG +IP L Q IS GN    KP IN +GY++GN  
Sbjct  67   EFLHKWLGKHQEFSSNPFYVGGDSYSGKIIPALVQEISKGNYLCCKPPINLQGYVLGNPY  126

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    E +Y   +A G  LIS+E        C  +  +  P   +C   +  +       
Sbjct  127  TESEFERNYRIPYAHGMALISDELYESMKRICKGDYINMDPRNRECLKLVEEYEKCIARI  186

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYN-RYLLCKSDSIAAQYVNVES  534
            NP  I   VC                  +     +   Y  RY+L        ++ N ES
Sbjct  187  NPLLITTPVC------------------EECEETSPDCYEYRYML------TTKWANYES  222

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V  ALHV KGSI  W +C   +PY  +++ SI YH N S  G+ SLI+NGD D+ +P L 
Sbjct  223  VHRALHVNKGSIGEWVRCHWGIPYTRDIKSSIPYHMNNSIDGYPSLIFNGDHDMAVPFLG  282

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  283  TQAWIRSLNY  292



>emb|CDY21472.1| BnaC03g27250D [Brassica napus]
Length=420

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 134/249 (54%), Gaps = 22/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG  +P L Q IS GN    KP IN +GY++GN V
Sbjct  130  EFLQKWLSKHPQFFSNPFYATGDSYSGKTVPALVQEISQGNYKCCKPLINLQGYVLGNPV  189

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T+   E +Y   F+ G  LIS+E       +C  N  +  P  TKC   +  +   T   
Sbjct  190  TYPEFEENYRIPFSHGMSLISDELHESLKINCKGNYGNVDPLNTKCLKLVEEYHKCTDKI  249

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  ++L   C      +D  + K   P       +   Y  YL+         + N E V
Sbjct  250  NTQHLLLPDC------DDKRNPKNTSP-------DCYYYLYYLI-------ECWANNERV  289

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHVKKG+  +W++C   +PYN+++  S+ YH N+S   +RSL+Y+GD D+ +P L  
Sbjct  290  REALHVKKGTKGHWQRCNWTIPYNHDIISSVPYHMNISLSEYRSLVYSGDHDITMPFLGT  349

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  350  QAWIKSLNY  358



>sp|Q9C7Z9.2|SCP18_ARATH RecName: Full=Serine carboxypeptidase-like 18; Flags: Precursor 
[Arabidopsis thaliana]
Length=464

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 94/256 (37%), Positives = 140/256 (55%), Gaps = 15/256 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL++ P++ SN +YVGGDSY+G ++P + Q IS GN+   KP IN KGY++GN  
Sbjct  157  EFLQKWLVENPQFVSNPIYVGGDSYAGIVVPAIVQQISIGNEHGYKPQINLKGYILGNPS  216

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T   S+H+    +A   GLIS+E        C  N  K  P  TKC   +  +       
Sbjct  217  TDLDSDHNSKIPYAHRMGLISDELYESLKRTCQGNYVKVDPTNTKCLKLMEDYGKCVSRI  276

Query  358  NPAYILDSVCLI--NNGLEDLLSGKAFVPIKRFNGVNAKIYN----RYLLCKSDSIAAQY  519
            N   IL ++C +   N       G++++     + ++    +    RYLL      A+ +
Sbjct  277  NEGLILIALCDLASPNPYSGEHGGRSYLQTLVQSDLSLPTPDCYMYRYLL------ASHW  330

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSLIYNGDRDL  696
             N E V+  LHV KGSI  W +C  +LPY  +++ S+ YH N S  G +RSL+Y+ D D+
Sbjct  331  ANDEDVRRELHVVKGSIGKWMRCNWDLPYEKDIKSSVPYHRNNSIIGDYRSLVYSSDHDM  390

Query  697  FIPSLSAEAWTKSLNY  744
             +P +  EAW KSLNY
Sbjct  391  MVPYIGTEAWIKSLNY  406



>ref|XP_009133997.1| PREDICTED: serine carboxypeptidase-like 10 isoform X3 [Brassica 
rapa]
Length=452

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 135/249 (54%), Gaps = 22/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG  +P L Q IS GN    KP IN +GY++GN V
Sbjct  150  EFLQKWLSKHPQFFSNPFYATGDSYSGKTVPALVQEISQGNYKCCKPLINLQGYVLGNPV  209

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T+   E +Y   F+ G  LIS+E       +C  N  +  P  TKC   +  +   T   
Sbjct  210  TYPEFEENYRIPFSHGMSLISDELHESLKINCKGNYGNVDPRNTKCLKLVEEYHKCTDKI  269

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C      +D  + K   P       +   Y  Y++         + N E V
Sbjct  270  NTQHILLPDC------DDKRNPKNTSP-------DCYYYLYYII-------ECWANNERV  309

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHVKKG+  +W++C   +PY++++  S+ YH N+S  G+RSL+Y+GD D+ +P L  
Sbjct  310  REALHVKKGTKGHWQRCNWTIPYDHDIISSVPYHMNISLSGYRSLVYSGDHDITMPFLGT  369

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  370  QAWIKSLNY  378



>ref|XP_008644915.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Zea mays]
Length=482

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 148/258 (57%), Gaps = 15/258 (6%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F++KW   YP++ S+ LY+ GDSYSG ++P +   I+ G +   +P +N KGYLVGN VT
Sbjct  168  FLKKWFDKYPQFFSSPLYIAGDSYSGMIVPTVTSEIARGKEEGSQPNLNLKGYLVGNPVT  227

Query  187  HFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
             F+ +      FA G GLIS+E   ++Y+   +  D +    +C   +          +P
Sbjct  228  DFNFDGPSRIPFAHGMGLISDEI-YEAYEKSCSVGDSRRQSIECINSLGAIDECIKGISP  286

Query  364  AYILDSVC--------LINNGLEDLLSGKAFVPIKRFNGVNA-KIYNRYLLCKSDS--IA  510
             ++L+ +C        LI++G  ++L  +  VP+         ++    L C++    ++
Sbjct  287  NHVLEPLCAFASPKPKLISSGAREML--QLPVPVHTEEEEEELRLSEISLQCRTAGYMMS  344

Query  511  AQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDR  690
            + + N  SV++AL + KG++ +W +C  ++PY N++  ++ YH +++TKG+RSL+YNGD 
Sbjct  345  SMWANDASVRQALGIHKGTVPSWSRCNYDIPYTNDIPSAVKYHLDVTTKGYRSLVYNGDH  404

Query  691  DLFIPSLSAEAWTKSLNY  744
            D+ +P +  +AW +SLN+
Sbjct  405  DMVVPFIGTQAWIRSLNF  422



>ref|XP_009133994.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Brassica 
rapa]
Length=436

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 135/249 (54%), Gaps = 22/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG  +P L Q IS GN    KP IN +GY++GN V
Sbjct  150  EFLQKWLSKHPQFFSNPFYATGDSYSGKTVPALVQEISQGNYKCCKPLINLQGYVLGNPV  209

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T+   E +Y   F+ G  LIS+E       +C  N  +  P  TKC   +  +   T   
Sbjct  210  TYPEFEENYRIPFSHGMSLISDELHESLKINCKGNYGNVDPRNTKCLKLVEEYHKCTDKI  269

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C      +D  + K   P       +   Y  Y++         + N E V
Sbjct  270  NTQHILLPDC------DDKRNPKNTSP-------DCYYYLYYII-------ECWANNERV  309

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHVKKG+  +W++C   +PY++++  S+ YH N+S  G+RSL+Y+GD D+ +P L  
Sbjct  310  REALHVKKGTKGHWQRCNWTIPYDHDIISSVPYHMNISLSGYRSLVYSGDHDITMPFLGT  369

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  370  QAWIKSLNY  378



>ref|XP_009771129.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Nicotiana 
sylvestris]
Length=437

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/253 (37%), Positives = 136/253 (54%), Gaps = 43/253 (17%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLI + E+  N +Y+GGDSYSG  +P++ Q ISNG +A  KP+IN KGY++GN  
Sbjct  163  QFLRKWLIKHQEFIRNPMYIGGDSYSGITVPVITQLISNGIEAGHKPSINLKGYILGNPS  222

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
            T   +++Y   +A G GLIS+E                            + +++ +N P
Sbjct  223  TFPLQYNYWVPYAHGMGLISDEL---------------------------YQLISGINKP  255

Query  364  AYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY-LLCKSD--SIAAQYVNVES  534
             +IL+  C       D  S ++F    R  G    +Y  Y   C+ +   ++  + N   
Sbjct  256  -HILEPSC-----GSDAESKRSF----RLFGKRRSLYENYSTKCRVEVHRLSTYWANDPR  305

Query  535  VQEALHVKKGSIDNWEQCR---ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
            VQEAL+V+KG+I  W +CR    N  Y    +DSI YH  LS K +RSLIY+GD D+ IP
Sbjct  306  VQEALNVRKGAITRWTRCRESIVNKTYTITFQDSIPYHVELSKKLYRSLIYSGDHDMGIP  365

Query  706  SLSAEAWTKSLNY  744
              S + W KSLNY
Sbjct  366  FQSTQFWIKSLNY  378



>ref|XP_006840208.1| hypothetical protein AMTR_s00089p00130140, partial [Amborella 
trichopoda]
 gb|ERN01883.1| hypothetical protein AMTR_s00089p00130140, partial [Amborella 
trichopoda]
Length=356

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/249 (33%), Positives = 131/249 (53%), Gaps = 3/249 (1%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+  W I+YPE+ SN LY+ GDSYSG  +P+L   I+NG D+  +P  N KGYLVGN  
Sbjct  62   KFLTNWFIEYPEFLSNPLYIAGDSYSGITVPVLTYEIANGIDSGYRPVFNLKGYLVGNPG  121

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
            T          FA G GLIS+E    +   C  N    P  ++C L++          N 
Sbjct  122  TDVEFDSQLVPFAHGMGLISDELFEATKISCNGN-YAHPKGSQCNLNMQAVQECLSRINE  180

Query  364  AYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNVESV  537
             +IL+  C   +    L  G            +  + +  ++C+     ++  + N E V
Sbjct  181  VHILEPSCPFASPRPRLEIGTGLRRWLDDKSSDIHLQSTPIVCREYGYILSHYWANDERV  240

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
             EALHVKKG++++W++C   + +  +V+ S+ YH NL+ + + +LIY+GD D  +P +  
Sbjct  241  GEALHVKKGTVEDWKRCNFGITFKADVKSSVLYHHNLTMRSYSALIYSGDHDAKVPFIGT  300

Query  718  EAWTKSLNY  744
            +AW +SL +
Sbjct  301  QAWIRSLEF  309



>ref|XP_002878648.1| SCPL11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54907.1| SCPL11 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 135/251 (54%), Gaps = 32/251 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSYSG ++P L Q IS GN       IN +GY++GN +
Sbjct  153  EFLQKWLSKHPQFSSNPFYASGDSYSGMIVPALVQEISKGNYICCNRPINLQGYILGNPI  212

Query  184  THFSE-HDYTYQFALGYGLISEEF---ARKSYDDCITNPDKKPFFTKCQLDILRFVMLTF  351
            T+F E  +Y   F+ G  LIS+E     R++ +    N D++   TKC   +  +   T 
Sbjct  213  TYFEEDRNYRVPFSHGMALISDELYESIRRACNGNYFNVDQRN--TKCLKLVEEYHKCTN  270

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVE  531
              N  +IL   C       D+ S   F            +Y  YLL       + + N E
Sbjct  271  KLNRFHILSPDC-------DITSPDCF------------LYPYYLL-------SYWANDE  304

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            SV++ALHV K SI  W +C  + PY+ +++ S+ YH N S  G+RSLIY+GD DL +P  
Sbjct  305  SVRDALHVNKWSIGEWVRCNRSKPYDKDIKSSVPYHMNNSINGYRSLIYSGDHDLVVPFQ  364

Query  712  SAEAWTKSLNY  744
            + +AW KSLNY
Sbjct  365  ATQAWIKSLNY  375



>gb|EYU37561.1| hypothetical protein MIMGU_mgv1a005963mg [Erythranthe guttata]
Length=463

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 148/259 (57%), Gaps = 23/259 (9%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWL  +P +  N LY+ GDSY G + PM+A+AIS GN+A L+P +  +GY+VGN  T
Sbjct  151  FLRKWLSLHPRFLKNRLYIAGDSYGGKITPMVARAISEGNEAGLQPRMLLQGYIVGNSRT  210

Query  187  HFSEHD-YTYQFALGYGLISEEFARKSYDDCI---TNPDKKPFFTKCQLDILRFVMLTFV  354
              ++ D     +A   GL+S+E+   +   C+    NPD  P   +C+  +      T +
Sbjct  211  DANKDDNEKIPYAHRMGLVSDEYFELAKSSCLGEYVNPD--PDNIECKYALRLVNECTKL  268

Query  355  NNPAYILDSVCLI-----NNGLEDLLSGKAFV---PIKRFNGVNAKIYNRYLLCKSDSIA  510
             N A+IL+ +C       NN   D L    FV   P++ F  ++ +  +   LC++ + A
Sbjct  269  INNAHILEPMCKFLSPNPNNSQRDPL----FVEDDPVEDFLFMSTQDDS---LCRNYNYA  321

Query  511  AQYV--NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNG  684
            + YV  N ESVQEALH++KG+I +W++C  +L Y  +V   +  H  LS KGF++L Y+G
Sbjct  322  SSYVWANNESVQEALHIRKGTIPDWKRCNTSLTYEYDVESVLEDHRLLSEKGFQALAYSG  381

Query  685  DRDLFIPSLSAEAWTKSLN  741
            D D+ IP +S   W + LN
Sbjct  382  DHDMIIPYMSTLKWIRELN  400



>ref|XP_003525944.2| PREDICTED: serine carboxypeptidase-like 19-like isoform X1 [Glycine 
max]
Length=438

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/252 (35%), Positives = 135/252 (54%), Gaps = 56/252 (22%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +FIRKWLID+PE+ SN +Y+ GDSY G  +P++ Q ISNGN+  ++P I  +GYL+GN +
Sbjct  179  QFIRKWLIDHPEFLSNEVYIAGDSYCGIPVPVIVQEISNGNEGGMQPWIYIQGYLLGNPI  238

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T  +E +Y   F  G  LIS+E       +C     N D +                   
Sbjct  239  TTSTEKNYEIPFNHGMALISDELYESLQKNCRGEYRNIDPR-------------------  279

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
                   +++CL +              ++ +   +A     Y+LC      + + N ++
Sbjct  280  -------NALCLRD--------------MQSYEESHA-----YVLC------SYWANDDN  307

Query  535  VQEALHVKKGSIDNWEQCRANL--PYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            V++ALHV+KGSI  W +C  +L   +N ++  S  YH NLS KG+RSLIY+GD D+ +P 
Sbjct  308  VRKALHVRKGSIGKWTRCNDDLKSKFNADIPSSFQYHVNLSRKGYRSLIYSGDHDMVVPF  367

Query  709  LSAEAWTKSLNY  744
            L+ +AW +SLNY
Sbjct  368  LATQAWIRSLNY  379



>ref|XP_011030310.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/266 (35%), Positives = 139/266 (52%), Gaps = 35/266 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+P++ +N LYV GDSYSG + P++ Q IS+GN+   +P +N KGY++GN +
Sbjct  166  EFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPTMNLKGYVLGNPL  225

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T H  + +    FA    LIS++       +C     NPD+      C  DIL       
Sbjct  226  TDHEIDTNSIVPFAYLKALISDKLYESFMKNCKGEYLNPDQSN--ASCMEDILAIKECIG  283

Query  352  VNNPAYILDSVC----------------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY  483
                A IL+  C                LI +  + LLS        R +G   + YN  
Sbjct  284  DLYTAQILEPTCKLISPKPVALKWDPRFLIADDADILLSSP------RVHGHWCRSYNHV  337

Query  484  LLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGF  663
             +         + N E+V++ALH++KG+I +W +C   L Y+ NV  ++ YH NL+ K +
Sbjct  338  YI-------YGWANDETVRDALHIRKGTIKDWRRCNKTLAYSYNVESAVDYHRNLTKKPY  390

Query  664  RSLIYNGDRDLFIPSLSAEAWTKSLN  741
            R+LIY+GD D+ IP +    W +SLN
Sbjct  391  RALIYSGDHDIIIPYIGTHEWIESLN  416



>ref|XP_004960851.1| PREDICTED: serine carboxypeptidase-like 19-like [Setaria italica]
Length=465

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 139/250 (56%), Gaps = 4/250 (2%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+ KW   +P++ +N  YVGGDSY G ++P L Q I+   +A+++PA+N KGYLVGN VT
Sbjct  157  FLYKWFEGHPDFLANPFYVGGDSYGGKIVPYLVQKITEDIEAQVRPALNLKGYLVGNPVT  216

Query  187  HFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
              S + D    +A G+G+IS++    + + C       P    C   + R   L    + 
Sbjct  217  GESIDTDSRVPYAHGFGIISDQLYEATLEHCKGESYSNPTNMICDQLLKRVHELLGECSK  276

Query  364  AYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKS--DSIAAQYVNVESV  537
             +IL   C   +  ++  S +  +  K   G+        + C++  + ++  + N  + 
Sbjct  277  PHILYKKCFYVSPGQNDESPRRIILKKEIGGLKRPPPRPPMDCQNYVNYLSYFWANSMAT  336

Query  538  QEALHVKKGSIDNWEQCR-ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            ++AL +KKGS D W +C   +LPY+ +++ SI YH N++ KG+R+L+Y+GD D  IP L 
Sbjct  337  RDALGIKKGSKDEWVRCHDGDLPYSKDIKSSIKYHRNVTLKGYRALVYSGDHDSVIPFLG  396

Query  715  AEAWTKSLNY  744
             +AW +SLN+
Sbjct  397  TQAWVRSLNF  406



>ref|XP_006399444.1| hypothetical protein EUTSA_v10016050mg [Eutrema salsugineum]
 gb|ESQ40897.1| hypothetical protein EUTSA_v10016050mg [Eutrema salsugineum]
Length=470

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 142/259 (55%), Gaps = 14/259 (5%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+R W +D+PE+ SN +YVGGDSYSG ++P LAQ IS GN+  L P IN +GY++GN V
Sbjct  155  QFLRSWFVDHPEFTSNPVYVGGDSYSGIIVPGLAQQISFGNEKGLTPLINIQGYVLGNPV  214

Query  184  THFSEHDY-TYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            T+ S   Y    FA   GLIS+E       +C     D  P   KC  D+  +       
Sbjct  215  TYPSIESYHQVSFAHRMGLISDELFESLVRNCGGKVFDVDPSNAKCSDDLQSYGQCISKI  274

Query  358  NPAYILDSVCLINN-------GLEDLLSGKAFVPIKRFNG--VNAKIYNRYLLCKSDSIA  510
              A IL   C +++        L ++++G+    +K F+G   ++ +           ++
Sbjct  275  YVAQILLPNCKVDHVFQSKIPTLPNIINGRR-RELKEFSGNEYSSSLPPPSCFTYKYFLS  333

Query  511  AQYVNVESVQEALHVKKGSIDNWEQCRA-NLPYNNNVRDSIAYHANLSTKGFRSLIYNGD  687
              + N E+V+ AL VKK     W +C   N+PY  ++ ++I YH N S KGFRSL+Y+GD
Sbjct  334  GFWANDENVRRALGVKK-EFGKWSRCNTENIPYTYDIHNAIPYHVNNSLKGFRSLLYSGD  392

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D+ IP  S EAW ++LNY
Sbjct  393  HDMVIPFSSTEAWIRTLNY  411



>ref|XP_010417054.1| PREDICTED: serine carboxypeptidase-like 9 [Camelina sativa]
Length=440

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 133/250 (53%), Gaps = 23/250 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN  Y  G++Y+G LIP L + IS  N    KP IN +GY++GN V
Sbjct  153  EFLQKWLSKHPQYLSNPFYATGNAYAGMLIPALVEKISKENYICCKPPINLQGYVLGNPV  212

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITN--PDKKPFFTKCQLDILRFVMLTFV  354
            T + +E +Y  QFA G  LIS+E       +C  N      P   KC   +  F  LT  
Sbjct  213  TDYATERNYRVQFAHGMSLISDELYESLKRECNGNYFNVDPPRSKKCLKLVEEFNKLT--  270

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
                   D +        D+L  K    +   N      Y +Y L        ++ N ES
Sbjct  271  -------DDI-----NFYDILLPKCDEQLDPENMEPDCFYYKYYL------EERWANTES  312

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V+EALH+KKG+ ++W +    +PY N++R S+ YH   S  G+RSLI++GD D+  P+++
Sbjct  313  VREALHIKKGTTEDWLRLNHVIPYENDIRSSVPYHKKNSIIGYRSLIFSGDHDMVSPTIA  372

Query  715  AEAWTKSLNY  744
             +AW KSLNY
Sbjct  373  TQAWIKSLNY  382



>emb|CDX76889.1| BnaC08g34750D [Brassica napus]
Length=438

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 132/249 (53%), Gaps = 22/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  YV GDSYSG  IP L Q IS GN    KP IN +GY++GN V
Sbjct  152  EFLQKWLSKHPQFLSNPFYVTGDSYSGKTIPALVQEISKGNYICCKPLINLQGYVLGNPV  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T+   E +Y   F+ G  LIS+E       +C  N  +  P  TKC   +  +   T   
Sbjct  212  TYPEIEENYRIPFSHGMSLISDELYESLKRNCEGNYGNVDPRNTKCLKLVEEYHKCTDKI  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C      +D  +     P       +   Y  YL+         + N E V
Sbjct  272  NTQHILLPDC------DDKSNSSNTSP-------DCYYYLYYLI-------ECWANNERV  311

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHV+KG+  +W++C   +PYN ++  S+ YH N S  G+RSLIY+GD D+ +P    
Sbjct  312  REALHVEKGTKGHWQRCNWTIPYNQDIISSVPYHMNNSISGYRSLIYSGDHDITMPFQGT  371

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  372  QAWIKSLNY  380



>ref|NP_179883.1| sinapoylglucose:anthocyanin sinapoyltransferase [Arabidopsis 
thaliana]
 sp|O64810.1|SCP10_ARATH RecName: Full=Serine carboxypeptidase-like 10; AltName: Full=Sinapoylglucose--anthocyanin 
acyltransferase; AltName: Full=Sinapoylglucose--anthocyanin 
sinapoyltransferase; Short=SAT; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17817.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07395.1| serine carboxypeptidase-like 10 [Arabidopsis thaliana]
Length=437

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 136/252 (54%), Gaps = 29/252 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  YV GDSYSG ++P L Q IS GN    K  IN +GY++GN +
Sbjct  152  EFLQKWLSKHPQFFSNPFYVTGDSYSGMIVPALVQEISKGNYICCKHLINLQGYVLGNPI  211

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T ++EH+  Y+  F+ G  LIS+E       +C  N  +  P  TKC   +  +   T  
Sbjct  212  T-YAEHEKNYRIPFSHGMSLISDELYESLKRNCKGNYENVDPRNTKCVRLVEEYHKCTDK  270

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAK--IYNRYLLCKSDSIAAQYVNV  528
             N  +IL   C                  K+ +G+ +    Y  Y L +       + N 
Sbjct  271  INTQHILIPDC-----------------DKKGHGITSPDCYYYLYFLIEC------WANN  307

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            E V+EALHV KG+   W++C   +PY+NN+  S+ YH + S  G+RSLIY+GD D+ +P 
Sbjct  308  ERVREALHVTKGTKGQWQRCNWTIPYDNNIISSVPYHMDNSINGYRSLIYSGDHDITMPF  367

Query  709  LSAEAWTKSLNY  744
             + +AW KSLNY
Sbjct  368  QATQAWIKSLNY  379



>emb|CBI22420.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 142/255 (56%), Gaps = 15/255 (6%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWLI++P++Q N LYV GDSYSG +IPM+ Q ISNGND   +P +N +GY +GN VT
Sbjct  191  FLRKWLINHPKFQKNPLYVSGDSYSGIIIPMVVQEISNGNDEGKEPKMNIQGYTIGNPVT  250

Query  187  -HFSEHDYTYQFALGYGLISEEFARKSYDDC-----ITNPDKKPFFTKCQLDILRFVMLT  348
             HFS+ +   ++    G++S+E   +  + C       +P       +C  ++  +    
Sbjct  251  DHFSDFNSRIEYTHRVGILSDELYEELKESCNGKYVYVDPSN----VECTNNLKVYTQCI  306

Query  349  FVNNPAYILDSVC--LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYV  522
                 A+IL+  C  L  N     L   +   I     + ++       C+S +    Y+
Sbjct  307  NKIYSAHILEPSCAMLSPNPNASKLDRSSLQEINSIGLLLSQPQKPEPWCRSYNYVFSYL  366

Query  523  --NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
              N ++VQ+ALHV++ +I +W +C  +L Y +NV  S+ YH NL+ K +R+LIY+GD D+
Sbjct  367  WANDKTVQKALHVRE-AIKDWVRCNESLSYTSNVFSSVDYHRNLTKKAYRALIYSGDHDM  425

Query  697  FIPSLSAEAWTKSLN  741
             IP +  +AW  SLN
Sbjct  426  LIPYVGTQAWIASLN  440



>ref|XP_010486652.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Camelina 
sativa]
Length=440

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 123/250 (49%), Gaps = 27/250 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SN  YVGGDSYSG +IP L Q IS GN    KP IN +GY++GN  
Sbjct  157  EFLHKWLGKHQEFSSNPFYVGGDSYSGKIIPALVQEISKGNYLCCKPPINLQGYVLGNPY  216

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    E +Y   +A G  LIS+E        C  +  +  P   +C   +  +       
Sbjct  217  TESEFERNYRIPYAHGMALISDELYESMKRICKGDYINMDPRNRECLKLVEEYEKCIARI  276

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYN-RYLLCKSDSIAAQYVNVES  534
            NP  I   VC                  +     +   Y  RY+L        ++ N ES
Sbjct  277  NPLLITTPVC------------------EECEETSPDCYEYRYML------TTKWANYES  312

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V  ALHV KGSI  W +C   +PY  +++ SI YH N S  G+ SLI+NGD D+ +P L 
Sbjct  313  VHRALHVNKGSIGEWVRCHWGIPYTRDIKSSIPYHMNNSIDGYPSLIFNGDHDMAVPFLG  372

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  373  TQAWIRSLNY  382



>ref|XP_010472297.1| PREDICTED: serine carboxypeptidase-like 11 isoform X2 [Camelina 
sativa]
Length=425

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 130/249 (52%), Gaps = 35/249 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++K       + SN  Y  GDSYSG ++P L Q IS GN    +P IN +GY++GN +
Sbjct  152  EFLQK-------FSSNPFYAAGDSYSGMIVPALVQEISRGNYICCEPPINLQGYVLGNPI  204

Query  184  THFSEHD-YTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            THF E + Y   F+ G GLIS+E        C  N  +  P  TKC   +  +   T   
Sbjct  205  THFEEDEKYRVPFSHGMGLISDEVYESIRSACKGNYFNADPSNTKCLKLVEEYHKCTDKL  264

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N   IL   C       ++ S   F            +Y  YLL       + + N ESV
Sbjct  265  NEFNILLPDC-------NMTSSDCF------------LYPYYLL-------SFWANDESV  298

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALH+ KGSI  W +C  + PY+ +++ S+ YH N S  G+RSLIYNGD DL +P L+ 
Sbjct  299  RDALHIDKGSIGEWVRCNRSNPYDKDIKSSVPYHMNNSISGYRSLIYNGDHDLVVPFLAT  358

Query  718  EAWTKSLNY  744
            EAW KSLNY
Sbjct  359  EAWIKSLNY  367



>ref|XP_010486651.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Camelina 
sativa]
Length=453

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 123/250 (49%), Gaps = 27/250 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SN  YVGGDSYSG +IP L Q IS GN    KP IN +GY++GN  
Sbjct  170  EFLHKWLGKHQEFSSNPFYVGGDSYSGKIIPALVQEISKGNYLCCKPPINLQGYVLGNPY  229

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    E +Y   +A G  LIS+E        C  +  +  P   +C   +  +       
Sbjct  230  TESEFERNYRIPYAHGMALISDELYESMKRICKGDYINMDPRNRECLKLVEEYEKCIARI  289

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYN-RYLLCKSDSIAAQYVNVES  534
            NP  I   VC                  +     +   Y  RY+L        ++ N ES
Sbjct  290  NPLLITTPVC------------------EECEETSPDCYEYRYML------TTKWANYES  325

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V  ALHV KGSI  W +C   +PY  +++ SI YH N S  G+ SLI+NGD D+ +P L 
Sbjct  326  VHRALHVNKGSIGEWVRCHWGIPYTRDIKSSIPYHMNNSIDGYPSLIFNGDHDMAVPFLG  385

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  386  TQAWIRSLNY  395



>ref|XP_010314652.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=677

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 137/257 (53%), Gaps = 21/257 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKW +++ E+ SN  YV GDSYSG  IP++ Q ISNG +A  +P IN KGY +GN +
Sbjct  152  EFLRKWFVNHSEFISNPFYVSGDSYSGITIPIIVQLISNGIEAGKEPLINLKGYSLGNPI  211

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T F E +Y   ++   GLIS E      + C  +  +  P   +C  +   F  L    N
Sbjct  212  TFFEESNYQIPYSHSMGLISNELYESLNEFCKGDYINIDPTNKQCVENFKMFKNLVSGIN  271

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSI-----AAQYVN  525
               IL+  C     +E       F P +  N    +     L+C+   I     A  ++N
Sbjct  272  NGQILEPEC--GTDIE-------FYPPQSSN--ERRSLEEDLICQESRIATYKLATYWMN  320

Query  526  VESVQEALHVKKGSI-DNWEQCRANLPYNN---NVRDSIAYHANLSTKGFRSLIYNGDRD  693
               VQE+LHV KG+I   W +C+  + Y +    +++SI YH NLS KG+RSLIY+GD D
Sbjct  321  DLRVQESLHVTKGTIRRTWTRCKRTIGYTSYKVTLKNSIPYHVNLSIKGYRSLIYSGDHD  380

Query  694  LFIPSLSAEAWTKSLNY  744
            + +P  S +AW K LNY
Sbjct  381  MVVPFQSTQAWIKYLNY  397


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = +1

Query  442  KRFNGVNAKIYNR-YLLCKSD--SIAAQYVNVESVQEALHVKKGSID-NWEQCRANL---  600
            K +NG    + +R Y   K D  +++A + N   VQEALHV+KG+I   W +CRA++   
Sbjct  511  KAYNGSLPFLVSRPYSWTKVDKHNLSAYWANDPKVQEALHVRKGTIKRTWARCRASIGDK  570

Query  601  PYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
             Y     +SI YHANLS KG+RSLIY+GD ++ +P  S +AW K LNY
Sbjct  571  SYAITFMNSIPYHANLSKKGYRSLIYSGDHEMVVPFQSTQAWIKYLNY  618



>emb|CDY52618.1| BnaCnng22970D [Brassica napus]
Length=439

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 133/256 (52%), Gaps = 37/256 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+  WL  +PEY SN  YV G+SYSG ++P + Q IS  N    KP +N +GY++GN V
Sbjct  156  EFVHNWLAKHPEYYSNPFYVTGNSYSGIVVPAIVQEISKENGLCCKPLVNLQGYVLGNPV  215

Query  184  THFSEHD-YTYQFALGYGLISEE----FARKSYDDCITNPDKKPFFTKCQLDILRFVMLT  348
            T F  +D +   FA G  LIS+E      R    +CI      P  T C   +  F    
Sbjct  216  TDFDNNDNWRIPFAHGMALISDENYQLLRRSCRGNCII---VDPLNTDCLKSVQEF----  268

Query  349  FVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSD-SIAAQ---  516
                               E+ +SG     I     VNA   + Y+   S+  ++ Q   
Sbjct  269  -------------------ENCVSGLDVTYILGLKYVNAS--DPYVSNPSEHRMSVQSNC  307

Query  517  YVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDL  696
            + N ESV+ ALHV+KGSI  W +C   +PY  ++R S+ YH N S +G+RSLI++GD D+
Sbjct  308  WANDESVRRALHVEKGSIGEWLRCYREIPYKFDIRSSVPYHKNNSIQGYRSLIFSGDHDM  367

Query  697  FIPSLSAEAWTKSLNY  744
            ++P L+ + W +SLNY
Sbjct  368  YVPFLATQDWIRSLNY  383



>emb|CDP17360.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 139/260 (53%), Gaps = 21/260 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGN-G  180
            EF+RKWL D PEY SNS Y+GG SY+G  +P+LAQ +SNGN A ++P I+ KGYL+GN  
Sbjct  163  EFLRKWLHDNPEYISNSFYIGGGSYAGITVPILAQLVSNGNVAGIEPHIHLKGYLLGNPA  222

Query  181  VTHFSEHDYTYQFALGYGLISEEFARKSYDDCI-----TNPDKKPFFTKCQLDILRFVML  345
             T   + ++   FA    LIS+E        C       +P   P    C  +I  +  L
Sbjct  223  PTTQGDGNHAIPFAHRTALISDELYESLKVTCKGEYVNIDPSNAP----CLKNIQAYNKL  278

Query  346  TFVNNPAYILDSVCL-INNGLEDLLSGKAFVP---IKRFNGVNAKIYNRYLLCK---SDS  504
                N  ++L+  C  ++     L SG+        K+F  ++   +N  + C+   ++ 
Sbjct  279  IDNINIEHVLEPTCPDVSPKPNSLFSGRRSTVETFYKKFEELDVLEFNP-VQCRAATAEK  337

Query  505  IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNG  684
            +   + N  SVQEALH   G+I  W  C  ++ Y  N    + YHANLSTKG+RSLIY+G
Sbjct  338  LIYYWANDMSVQEALH---GTIKEWVGCNYSILYTKNAGSVVPYHANLSTKGYRSLIYSG  394

Query  685  DRDLFIPSLSAEAWTKSLNY  744
            D D+  P L  E W +SLNY
Sbjct  395  DHDMISPYLGTEEWIRSLNY  414



>ref|XP_009117321.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Brassica 
rapa]
Length=438

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 132/249 (53%), Gaps = 22/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL  +P++ SNS YV GDSYSG  IP L Q IS GN    KP IN +GY++GN V
Sbjct  152  QFLQKWLSKHPQFLSNSFYVSGDSYSGKTIPALVQEISKGNYICCKPPINLQGYVLGNPV  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            TH   + +Y   F+ G  LIS+E       +C  N  +  P  TKC   +  +   T   
Sbjct  212  THPEIDENYRIPFSHGMSLISDELYESLKRNCKGNYRNVDPRNTKCLKLVEEYHKCTDKI  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C      +D  +     P       +   Y  YL+         + N E V
Sbjct  272  NTQHILLPDC------DDKSNSSNTSP-------DCYYYLYYLI-------ECWANNERV  311

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHV+KG+  +W++C   +PYN ++  S+ YH N S  G+RSLIY+GD D+ +     
Sbjct  312  REALHVEKGTKGHWQRCNWTIPYNQDIISSVPYHMNNSISGYRSLIYSGDHDITMTFQGT  371

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  372  QAWIKSLNY  380



>ref|XP_011030307.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 137/261 (52%), Gaps = 25/261 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+P++ +N LYV GDSYSG + P++ Q IS+GN+   +P +N KGY++GN V
Sbjct  166  EFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPTMNLKGYVLGNPV  225

Query  184  THFSEHDYTYQFALGY--GLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLT  348
            T   E D   +    Y   LIS++       +C     NPD+      C  DIL      
Sbjct  226  TD-DEIDTNSRVPFAYLKALISDKLYESFMKNCKGEYLNPDQSN--ASCMEDILAIKECI  282

Query  349  FVNNPAYILDSVC--------LINNGLEDLLSGKA--FVPIKRFNGVNAKIYNRYLLCKS  498
                   IL+  C         +      L++  A   +P  R  G   + YN   +   
Sbjct  283  GTVFTGQILEPACKSVSPKPVALKWDPRFLIADDADILLPRPRVPGQWCRSYNHVYI---  339

Query  499  DSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIY  678
                  + N E+V++ALH++KG+I +W +C   L Y+ NV+ ++ YH NL+ K +R+LIY
Sbjct  340  ----YGWANDETVRDALHIRKGTIKDWRRCNKTLAYSYNVKSTVDYHRNLTKKPYRALIY  395

Query  679  NGDRDLFIPSLSAEAWTKSLN  741
            +GD D+ IP +    W +SLN
Sbjct  396  SGDHDMTIPYIGTHEWIESLN  416



>ref|XP_003560245.1| PREDICTED: serine carboxypeptidase-like 18 [Brachypodium distachyon]
Length=481

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 144/262 (55%), Gaps = 28/262 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
             F+ KW  D+P+Y SN  Y+GGDSY+G +IP++AQ IS G + R +P IN KGYLVGN  
Sbjct  174  RFLNKWFTDHPQYLSNPFYLGGDSYAGMVIPLIAQNISEGIEKRQQPLINLKGYLVGNPK  233

Query  184  THFS-EHDYTYQFALGYGLISE---EFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTF  351
            T    ++++  Q A G+G+IS+   E ARK+  +   NP+ +     C   +     L  
Sbjct  234  TDPKFDNNFKIQSAHGFGIISDQIYEAARKNCKEDYVNPENQ----MCAEVLHTINSLIS  289

Query  352  VNNPAYILDSVCLI--NNGLEDLLSGKAFV---------PIKRFNGVNAKIYNRYLLCKS  498
                A+IL   C++     LED  SG+ F+         P  R   V+   Y  YL    
Sbjct  290  EIADAHILYKKCVVAVPKPLEDD-SGRKFLLEESIQLNQPPGRPT-VDCFTYGYYL----  343

Query  499  DSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIY  678
               A  ++N    ++AL +K+G+I  W +C   LPY   +  SI YH NL+ +G+R+L+Y
Sbjct  344  ---AYFWMNNNLTRDALGIKEGTIGEWIRCNRGLPYTYEMPSSIPYHLNLTRRGYRALVY  400

Query  679  NGDRDLFIPSLSAEAWTKSLNY  744
            +GD DL +P L  +AW +SLN+
Sbjct  401  SGDHDLEVPLLGTQAWIRSLNF  422



>ref|XP_006418601.1| hypothetical protein EUTSA_v10002783mg [Eutrema salsugineum]
 gb|ESQ37037.1| hypothetical protein EUTSA_v10002783mg [Eutrema salsugineum]
Length=428

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 139/254 (55%), Gaps = 13/254 (5%)
 Frame = +1

Query  16   KWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVTHF-  192
            KW + +PE+ SN  YVGGDSYSG ++P + Q IS GN+  L P IN KGY++GN VT+  
Sbjct  118  KWFVYHPEFLSNPFYVGGDSYSGKVVPGVVQQISFGNEKGLTPLINIKGYVLGNPVTYPN  177

Query  193  SEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNNPAY  369
            SE ++   FA   GLIS+E        C     D  P   KC  D+  +       N   
Sbjct  178  SESNHEVSFAHRMGLISDELFGSLVRSCGGKFFDVDPSNEKCSNDLQTYDQCISEINARQ  237

Query  370  ILDSVCL-------INNGLEDLLSGKAFVPIKRFNGVN-AKIYNRYLLCKSDSIAAQYVN  525
            IL  +C        I   + ++++G+    +K F+G + + +           ++A + N
Sbjct  238  ILLPICKDDYVLPSIRQTITNIITGRR-RELKEFSGNDSSSLPPPSCFTYKYFLSAFWAN  296

Query  526  VESVQEALHVKKGSIDNWEQCR-ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
             E+V+ AL VKKG  + W +C   N+PY  ++ ++I YH N S KGFRSLIY+GD D+ I
Sbjct  297  NENVRRALGVKKG-FEKWSRCNIQNIPYTYDIHNAIPYHVNNSLKGFRSLIYSGDHDMVI  355

Query  703  PSLSAEAWTKSLNY  744
            P  S EAW +SLNY
Sbjct  356  PLSSTEAWIRSLNY  369



>gb|KDP41600.1| hypothetical protein JCGZ_16007 [Jatropha curcas]
Length=472

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/266 (35%), Positives = 139/266 (52%), Gaps = 31/266 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL D+PE+ SN +YVGGDSYSG  +P + Q IS GN+   KP IN KGYL+GN  
Sbjct  160  QFLRKWLNDHPEFLSNPVYVGGDSYSGIPLPGVVQKISIGNEEGRKPFINLKGYLLGNAG  219

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPD-KKPFFTKCQLDILRFVMLTFVN  357
            T FS + +    FA G GLIS+E        C        P   +C   +  F   T   
Sbjct  220  TDFSFDGNSQVPFAHGMGLISDELYESLKRTCGGEYTFISPSNAECLKHMQEFTNCTSGL  279

Query  358  NPAYILDSVC-----------------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYL  486
            + A+IL+ +C                 LI++   + +    F+P      +  + Y  YL
Sbjct  280  DGAHILEPLCAFVSPKPIEISFRERRSLIDSNSREFVDSDPFLPT-----IGCRTYG-YL  333

Query  487  LCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFR  666
            L      +  + N  SV++ALH+++G++  W +C   + Y   +  +I +H  LS KG+R
Sbjct  334  L------SIYWANDNSVRKALHIREGTVGEWIRCNYGINYRREISSTIKHHLYLSNKGYR  387

Query  667  SLIYNGDRDLFIPSLSAEAWTKSLNY  744
            SLIY+GD D+ +  +  +AW +SLN+
Sbjct  388  SLIYSGDHDMLVSFVGTQAWIRSLNF  413



>ref|XP_009140442.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Brassica 
rapa]
Length=440

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 133/250 (53%), Gaps = 29/250 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +PE+ SN  YV GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  153  EFLQKWLSKHPEFYSNPFYVTGDSYSGKIVPPLVQEISRGNYICCKPPINIQGYILGNPI  212

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T   SE +    +A G  LIS+E        C  N  +     T+C   I  +   T   
Sbjct  213  TQIKSEDNSKIPYAHGMALISDELYESLKRICKGNYENVGSRNTECLKHIEMYNKCTDKL  272

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C       D+ S   F            +YN +LL K       + N E V
Sbjct  273  NRYHILLPDC-------DMTSPDCF------------LYNYFLLDK-------WANNERV  306

Query  538  QEALHVKKGSIDNWEQCRAN-LPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            + AL V KGSI  W++C  + +PYN +++ ++ YH N S  GFRSLIY+GD D+ +P ++
Sbjct  307  RRALQVTKGSIGEWKRCNYDVIPYNYDIQSTVPYHMNNSISGFRSLIYSGDHDMVVPFIA  366

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  367  TQAWIRSLNY  376



>ref|XP_009140440.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brassica 
rapa]
Length=434

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 133/250 (53%), Gaps = 29/250 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +PE+ SN  YV GDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  153  EFLQKWLSKHPEFYSNPFYVTGDSYSGKIVPPLVQEISRGNYICCKPPINIQGYILGNPI  212

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T   SE +    +A G  LIS+E        C  N  +     T+C   I  +   T   
Sbjct  213  TQIKSEDNSKIPYAHGMALISDELYESLKRICKGNYENVGSRNTECLKHIEMYNKCTDKL  272

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C       D+ S   F            +YN +LL K       + N E V
Sbjct  273  NRYHILLPDC-------DMTSPDCF------------LYNYFLLDK-------WANNERV  306

Query  538  QEALHVKKGSIDNWEQCRAN-LPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            + AL V KGSI  W++C  + +PYN +++ ++ YH N S  GFRSLIY+GD D+ +P ++
Sbjct  307  RRALQVTKGSIGEWKRCNYDVIPYNYDIQSTVPYHMNNSISGFRSLIYSGDHDMVVPFIA  366

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  367  TQAWIRSLNY  376



>ref|XP_011088733.1| PREDICTED: serine carboxypeptidase-like 7 [Sesamum indicum]
Length=493

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 139/259 (54%), Gaps = 32/259 (12%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWL+++PE+  N LYV GDSY G + PM+A  I  GNDA  +P +  +GY+VGN +T
Sbjct  158  FLRKWLLNHPEFVKNRLYVAGDSYGGKITPMVALEIVKGNDAGFEPRMLLQGYIVGNSIT  217

Query  187  HFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            +FS + +    +A    LI +E+   +   C     NPD +       L +++  +    
Sbjct  218  NFSKDQNERVPYAHKMALIPDEYFEVASSSCHGEYVNPDPQNMQCLSALQLIKECLSRIY  277

Query  355  NNPAYILDSVCLINNG---LED-----LLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIA  510
            +  A+IL+  C+  +G   LED     L S K   P                LC++ +  
Sbjct  278  D--AHILEPKCISRSGQLILEDDPVDLLSSSKQEQP----------------LCRNYNYV  319

Query  511  AQYV--NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNG  684
              YV  N E+VQEALH++KG+I  W++C  +L Y ++V     +H  L+ KGF++L+Y+G
Sbjct  320  TSYVWANDETVQEALHIRKGTITEWKRCNRSLSYEHDVESVFQHHRLLNEKGFQALVYSG  379

Query  685  DRDLFIPSLSAEAWTKSLN  741
            D D+ IP LS   W   LN
Sbjct  380  DHDMAIPYLSTLKWICDLN  398



>ref|NP_177471.1| serine carboxypeptidase-like 3 [Arabidopsis thaliana]
 sp|Q9CAU1.1|SCP3_ARATH RecName: Full=Serine carboxypeptidase-like 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52138.1|AC010556_20 putative serine carboxypeptidase; 12385-14737 [Arabidopsis thaliana]
 gb|AEE35437.1| serine carboxypeptidase-like 3 [Arabidopsis thaliana]
Length=441

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 131/250 (52%), Gaps = 30/250 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  + E+ SN  YVGGDSYSG ++P   Q IS GN     P IN +GY++GN +
Sbjct  161  EFLQKWLGKHQEFSSNPFYVGGDSYSGMVVPATVQEISKGNYECCNPPINLQGYVLGNPL  220

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T F  +DY  +  FA G  LIS+E        C  +  +  P  T+C         L F+
Sbjct  221  TDFV-YDYNSRIPFAHGMALISDELFESLKKTCKGDYRNVHPRNTEC---------LKFI  270

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
                   +S+C            +   P       N  IY R+LL      AA + N E+
Sbjct  271  EEFNKCTNSIC----------QRRIIDPFCETETPNCYIY-RFLL------AAYWANDET  313

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V++AL +KK +I  W +C   +PYN +++ SI YH N S  G+RSLIY+GD D  +P L 
Sbjct  314  VRKALQIKKETIGEWVRCHYGIPYNYDIKSSIPYHMNNSINGYRSLIYSGDHDFEVPFLG  373

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  374  TQAWIRSLNY  383



>ref|XP_009612206.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nicotiana 
tomentosiformis]
Length=386

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 138/261 (53%), Gaps = 20/261 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KW  ++PE+ SN  YV GDSYSG  +P++ Q IS+G +A   P IN KGY +GN +
Sbjct  73   EFLLKWFNNHPEFISNPFYVSGDSYSGITVPVIVQLISDGIEAGKNPLINLKGYSLGNPL  132

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F  G GLIS E      + C  +  +  P    C  +   F  L    N
Sbjct  133  TFPEESNYQIPFCHGMGLISNELYESLKETCKGDCRNIDPTNKLCLENFKMFKKLVSSIN  192

Query  361  PAYILDSVCLINNGLED--LLSGKAFVPIKRFNGVNAKIYNRY--LLCKSDSIAAQ----  516
               IL+  C  ++   +   LSG+     + F      I+ ++   +C+   +A +    
Sbjct  193  DQQILEPFCGTDSESPNPRQLSGERRSLEEDF------IFLKHDDFICRESRVATRKLSN  246

Query  517  -YVNVESVQEALHVKKGSIDN-WEQCRANL---PYNNNVRDSIAYHANLSTKGFRSLIYN  681
             + N   VQEALHV+KG+I   W +CR ++    Y     +SI YH NLS+KG+RSLIY+
Sbjct  247  HWANDPCVQEALHVRKGTIRRPWARCRQSIMGKTYRVTFMNSIPYHVNLSSKGYRSLIYS  306

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P  S +AW K LNY
Sbjct  307  GDHDMVVPFQSTQAWIKYLNY  327



>ref|XP_008790304.1| PREDICTED: uncharacterized protein LOC103707550 [Phoenix dactylifera]
Length=982

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/253 (34%), Positives = 147/253 (58%), Gaps = 11/253 (4%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKW ID+PE+ SN LYVGGDSYSG ++P++AQ I+ G+    +   N KGY+VGN  T
Sbjct  169  FLRKWFIDHPEFLSNPLYVGGDSYSGIVVPVVAQEIAKGDQDGDELPYNLKGYMVGNPST  228

Query  187  HFSEHDYTY-QFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
                 +  +  +A G GLIS+E    +   C       P   +C   +          N 
Sbjct  229  DEKFDNGAFVPYAHGMGLISDELYESTKKSC-GGEYASPRNEQCANYLQSINECIEGING  287

Query  364  AYILDSVCLINNGLEDLLS--GKAFVP--IKRFNGVNAKIYNRYLLCKSDSIAAQY--VN  525
            A IL+ VC   +   ++++  G+  +   IK F  +N+ +    L C+S +    Y   +
Sbjct  288  AQILEPVCFFVSPKPNMVAAYGRRLLKEDIKEFPLLNSDLP---LECRSSAYLLSYFWAD  344

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
             ++V+EAL+++KG++ +W++C ++L Y +NV  S+ +H NL+++G+R+L+Y+GD D+ +P
Sbjct  345  NDTVREALNIRKGTVQHWQRCNSDLLYTHNVPSSLKFHLNLTSRGYRALVYSGDHDMLVP  404

Query  706  SLSAEAWTKSLNY  744
             L  + W +SLN+
Sbjct  405  FLGTQGWIRSLNF  417


 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 144/253 (57%), Gaps = 11/253 (4%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKW ID+P++ SN LY+GGDSYSG ++P++AQ I+ G+    +   N KGYLVGN VT
Sbjct  675  FLRKWFIDHPKFLSNPLYIGGDSYSGIIVPVVAQKIAKGDQDGDELPYNLKGYLVGNPVT  734

Query  187  HFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
                ++     +A G GLIS+E    +   C       P   +C   +      T   N 
Sbjct  735  DEKFDNGAVVPYAHGMGLISDELYESTKKSC-GGEYASPRNEQCANYLQSVNECTKGINS  793

Query  364  AYILDSVCLINNGLEDLLSGKAF----VPIKRFNGVNAKIYNRYLLCKSDSIAAQY--VN  525
              IL+ +C   +   ++++  +       IK+F  +N+ +    L C+S      Y   +
Sbjct  794  EQILEPLCFSASPKPNMVAAYSRRLLKEDIKKFPLLNSDLP---LECRSFGYLLSYFWAD  850

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
             ++V+EAL+++KG++ +W++C  +L Y  ++  SI +H NL+++G+R+L+Y+GD D+ +P
Sbjct  851  NDTVREALNIRKGTVQHWQRCNHDLLYTYDIPSSIKFHLNLTSRGYRALVYSGDHDMGVP  910

Query  706  SLSAEAWTKSLNY  744
             +  + W +SLN+
Sbjct  911  FVGTQGWIRSLNF  923



>ref|XP_006663388.1| PREDICTED: serine carboxypeptidase-like 18-like [Oryza brachyantha]
Length=490

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/254 (35%), Positives = 142/254 (56%), Gaps = 9/254 (4%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+ KW +++PE+ +N LYVGG+SY+G L+P L Q IS   +A +KP  N KGYLVGN  
Sbjct  180  KFVNKWFVEHPEFLANPLYVGGESYAGKLVPFLVQKISEDTEAGVKPVPNLKGYLVGNPS  239

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T  S +HD    +A G G+IS++      ++C       P    C   + RF  L     
Sbjct  240  TGESIDHDTVVPYAHGVGIISDQLYETILENCGRGDYANPKNGICAQAMNRFNDLIGEVW  299

Query  361  PAYILDSVCL-INNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLL-CKS--DSIAAQYVNV  528
             A+IL   C+  +   +D  +G+    +K    V  ++  R  + C++  + ++  + N 
Sbjct  300  GAHILYKNCIDASPKPDDATAGRKI--LKEEIVVQNRLPPRPAMDCQTYPNYLSYFWANS  357

Query  529  ESVQEALHVKKGSIDNWEQCRAN--LPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
               +E L +KKG++D W +C  +  LPY+ ++   I YH NL+++G+R L+Y+GD D  +
Sbjct  358  NITRETLRIKKGTVDEWVRCDDDGLLPYSGDLGSIIKYHRNLTSRGYRVLVYSGDHDSIV  417

Query  703  PSLSAEAWTKSLNY  744
            P L  +AW +SLNY
Sbjct  418  PFLGTQAWVRSLNY  431



>ref|XP_006294243.1| hypothetical protein CARUB_v10023242mg [Capsella rubella]
 gb|EOA27141.1| hypothetical protein CARUB_v10023242mg [Capsella rubella]
Length=437

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 133/249 (53%), Gaps = 23/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  YV GDSYSG ++P L Q IS GN     P IN +GY++GN +
Sbjct  152  EFLQKWLRKHPQFSSNPFYVVGDSYSGMIVPALVQEISKGNYICCNPPINLQGYVLGNPI  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            TH   E +Y   FA    LIS+E        C  N  +  P  TKC   +  +   T   
Sbjct  212  THIEIEQNYRIPFAHAMSLISDELYESLKRFCKGNYFNVDPRNTKCSKLVEEYNKCTDKI  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  + L   C      +D        P  R    +   Y  +L+         + N ESV
Sbjct  272  NMHHTLIPDC------DD--------PNTRNISPDCCYYPYHLV-------ECWANNESV  310

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALHVKKGSI  W +   N+PYN++++ S+ YH + S  G+RSLI++GD D+ +PS + 
Sbjct  311  RKALHVKKGSIGEWIRDNPNIPYNSDLKSSVPYHMDNSIYGYRSLIFSGDHDITMPSQAT  370

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  371  QAWIKSLNY  379



>ref|XP_010474419.1| PREDICTED: serine carboxypeptidase-like 9 [Camelina sativa]
Length=440

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 132/250 (53%), Gaps = 23/250 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN  Y  G++Y+G +IP L + IS  N    KP IN +GY++GN V
Sbjct  153  EFLQKWLSKHPQYLSNPFYATGNAYAGMIIPALVEKISKENYICCKPPINLQGYVIGNPV  212

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITN--PDKKPFFTKCQLDILRFVMLTFV  354
            T + +E +Y  QFA G  LIS+E       +C  N      P   KC   +  F   T  
Sbjct  213  TDYATERNYRVQFAHGMSLISDELYESLKRECNGNYFNVDPPRSKKCLKLVEEFNKCTDD  272

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N   IL   C      +D +  +   P       +   Y  YL         ++ N ES
Sbjct  273  INAYDILLPNC------DDQIDSENMEP-------DCFYYKYYL-------EERWANTES  312

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V+EALH+KKG+ + W +    +PY N++R S+ YH   S  G+RSLI++GD D+  P+++
Sbjct  313  VREALHIKKGTREEWLRLNHVIPYENDIRSSVPYHKENSIIGYRSLIFSGDHDMVSPTIA  372

Query  715  AEAWTKSLNY  744
             +AW KSLNY
Sbjct  373  TQAWIKSLNY  382



>ref|XP_010065879.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW63577.1| hypothetical protein EUGRSUZ_G01201 [Eucalyptus grandis]
Length=465

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 144/257 (56%), Gaps = 18/257 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL  +PE+ SN LY+GGDSY G + P++   ++ G +A L+P +N KGYL+GN V
Sbjct  153  EFLRKWLTLHPEFLSNPLYIGGDSYGGFINPIVTLKVAEGIEAGLEPIMNLKGYLLGNPV  212

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVN-  357
            T+  S+ +   +FA    LISEE  + +  +C  +           +D L+ V +     
Sbjct  213  TNLQSDENSRVRFAYLKALISEELYKSADKNCNGDFINVNESNAACVDDLKIVTMCLEKL  272

Query  358  NPAYILDSVCLIN------NGLED---LLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIA  510
            + A IL+  CL +      +G  D   L     F+ + +  GV  ++YN Y+L  +    
Sbjct  273  DIANILEPNCLYSTPKSTVDGTWDPSLLNRDPTFLALPQLPGVWCRVYN-YMLSYT----  327

Query  511  AQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDR  690
              + N  +VQEALHV+ G+I  W +C  ++ Y  ++R+ I YH  L  +G+R+LIY+GD 
Sbjct  328  --WANDRAVQEALHVRPGTIRKWARCNESISYEYSIREVIDYHKELLKRGYRALIYSGDH  385

Query  691  DLFIPSLSAEAWTKSLN  741
            D+ IP +   AW ++LN
Sbjct  386  DMAIPYVGTLAWIETLN  402



>emb|CDY50564.1| BnaA01g30780D [Brassica napus]
Length=439

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/253 (37%), Positives = 133/253 (53%), Gaps = 31/253 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+  WL  +PEY SN  YV G+SYSG ++P + Q ISN N    KP +N +GY++GN V
Sbjct  156  EFVHNWLAKHPEYYSNPFYVTGNSYSGIVVPAIVQEISNENGLCCKPLVNLQGYVLGNPV  215

Query  184  THFSEHD-YTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T F  +D +   FA G  LIS+E  +     C  N     P  T C   +  F       
Sbjct  216  TDFDNNDNWRIPFAHGMALISDENYQLLRRSCRGNYIIVDPLNTDCLKSVKEF-------  268

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS-IAAQ---YVN  525
                            E+ +SG     I     VNA   + Y+   S+  ++ Q   + N
Sbjct  269  ----------------ENCVSGLDVTYILGLKYVNAS--DPYVSNPSEHRMSVQSNCWAN  310

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
             ESV+ ALHV+KGSI  W +C   +PY  ++R S+ YH N S +G+RSLI++GD D+++P
Sbjct  311  DESVRRALHVEKGSIGEWLRCYREIPYKFDIRSSVPYHKNNSIQGYRSLIFSGDHDMYVP  370

Query  706  SLSAEAWTKSLNY  744
             L+ + W +SLNY
Sbjct  371  FLATQDWIRSLNY  383



>ref|XP_006597032.1| PREDICTED: uncharacterized protein LOC100794342 isoform X1 [Glycine 
max]
Length=461

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 128/250 (51%), Gaps = 28/250 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWLI++P + S  +Y+GGDSYSG  IP + Q IS GN+  L+P IN +GYL+GN  
Sbjct  178  QFLRKWLIEHPNFLSTDVYIGGDSYSGITIPAIVQEISLGNEKGLQPWINLQGYLLGNPA  237

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTFV  354
            T     +Y   FA G GLIS+E  R    +C     N D K     C  +I  F  +T  
Sbjct  238  TTRRHENYRISFAHGMGLISDELYRSLQKNCKGEYINVDTKNVL--CSRNIETFNEVTSG  295

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             +   ILD  C       D L  +               + R LL K       ++N   
Sbjct  296  LSMVNILDPSC-------DWLDTET-------------SWRRSLLKKYPR--KNFLNTHL  333

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
               +L+  +G+I  W +C  N+P   ++  S  YH NLS KG+RSLIY+GD D+ IP L 
Sbjct  334  KLPSLNC-RGTIGKWRRCTFNIPNKEDISSSYEYHVNLSRKGYRSLIYSGDHDMKIPFLE  392

Query  715  AEAWTKSLNY  744
             +AW  SLNY
Sbjct  393  TQAWISSLNY  402



>ref|NP_001030669.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
 gb|AEE74909.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
Length=394

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 129/250 (52%), Gaps = 30/250 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SN  YVGGDSY G +IP L Q IS GN    KP IN +GY++GN  
Sbjct  114  EFLHKWLGKHQEFSSNPFYVGGDSYCGMVIPALVQEISKGNYVCCKPPINLQGYILGNPS  173

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T  +E D  Y+  +A G  LIS+E        C     +  P  TKC   +  +   T  
Sbjct  174  TE-NEVDINYRIPYAHGMALISDELYESMKRICKGKYENVDPRNTKCLKLVGEYQKCTKR  232

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N A I+   C+  +                    +  +Y RYLL         + N E+
Sbjct  233  INKALIITPECVDTS-------------------PDCYMY-RYLL------TTYWANDEN  266

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            VQ ALHV KGSI  W +C   +PYN++++ S+ YH N S  G+ SLI++GD D+ +P L 
Sbjct  267  VQRALHVNKGSIGEWVRCYFEIPYNHDIKSSVPYHMNNSIDGYASLIFSGDHDMEVPYLG  326

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  327  TQAWIRSLNY  336



>gb|KDP44531.1| hypothetical protein JCGZ_16364 [Jatropha curcas]
Length=549

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 139/254 (55%), Gaps = 15/254 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+PE+QSN LY+ GDSYSG ++P++ +   NGNDA   P +N  GY++GN V
Sbjct  151  EFLRKWLLDHPEFQSNRLYIAGDSYSGKIVPLVVKETVNGNDAGRNPKMNLVGYVLGNPV  210

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPD-KKPFFTKCQLDILRFVMLTFVN  357
            T    + +  +++A   GLISEE       +C  N    +P  T C + +  +       
Sbjct  211  TDEAKDTNSRFKYASFTGLISEEVYETGKRNCKGNYTYAEPNNTACAVVLQVYEQCIEKI  270

Query  358  NPAYILDSVCLI----NNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQY--  519
            N   IL+  C       + LE   S     PI           +R   C++ +    Y  
Sbjct  271  NLMQILEPFCGYLSPKPSKLERAESALMEDPIDIHT-------SRSPWCRTYNYIPSYAW  323

Query  520  VNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
            +N + VQ+ALH+++G+I+NW +C  +L Y  ++  S   H NL+ KG + LIY+GD+D+ 
Sbjct  324  LNDKMVQKALHIREGTIENWVRCNTSLLYTKDLTSSFGLHRNLTEKGLKVLIYSGDQDIS  383

Query  700  IPSLSAEAWTKSLN  741
            +P LS  AW ++LN
Sbjct  384  VPFLSTMAWIEALN  397



>ref|XP_010936156.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=394

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 143/254 (56%), Gaps = 13/254 (5%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWLID+PE+ SN LY+GGDSYSG ++P++AQ I+ G+    K   N KGYLVGN VT
Sbjct  87   FLRKWLIDHPEFISNPLYIGGDSYSGIVVPVVAQEIAKGDQDGDKLLYNLKGYLVGNPVT  146

Query  187  --HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
               F +  +   FA G GLIS+E    +   C       P   +C   +      T   N
Sbjct  147  DDKFDKGAFV-PFAHGMGLISDELYESTKKSC-GEEYASPRNDQCANYLESIEECTEGIN  204

Query  361  PAYILDSVCLINNGLEDLLS--GKAFVP--IKRFNGVNAKIYNRYLLCKSDSIAAQYVNV  528
               IL+ VC   +     ++  G+  +   IK F  + + +    L C+S      Y   
Sbjct  205  IFQILEPVCFYASPKPGRVAAYGRRLLKEDIKEFRLLKSGL---PLECRSSGYLLSYFWA  261

Query  529  E--SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFI  702
            +  +V+EAL+++KG++ +W++C  +L Y  +V  S+ +H NL++ G+R+L+Y+GD D+ +
Sbjct  262  DNNTVREALNIRKGTVQHWQRCNHDLHYAYDVPSSLKFHLNLTSIGYRALVYSGDHDMIV  321

Query  703  PSLSAEAWTKSLNY  744
            P +  +AW +SLN+
Sbjct  322  PFVGTQAWIRSLNF  335



>ref|XP_010936150.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936151.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/253 (34%), Positives = 142/253 (56%), Gaps = 11/253 (4%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWLID+PE+ SN LY+GGDSYSG ++P++AQ I+ G+    +   N KGYLVGN VT
Sbjct  169  FLRKWLIDHPEFLSNPLYIGGDSYSGIVVPVVAQEIAKGDRDGDELLYNLKGYLVGNPVT  228

Query  187  HFSEHDYTY-QFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
                 +  +  +A G GLIS+E    +   C       P   +C   +          N 
Sbjct  229  DEKFDNGAFVPYAHGMGLISDELYESTKKSC-GGEYASPRNEQCANYLQSINECIEGINE  287

Query  364  AYILDSVCLINNGLEDLLSGKAF----VPIKRFNGVNAKIYNRYLLCKSDSIAAQY--VN  525
              IL+ VC   +    +++  +       IK F+ + + +    L C+S      Y   +
Sbjct  288  GQILEPVCFFVSPKPHIVAAYSRRLLKEDIKEFSLLKSDLP---LECRSSGYLLSYFWAD  344

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
             ++V+E L++ KG++ +W++C   LPY +++  S+ +H NL+++G+R+L+Y+GD D+ +P
Sbjct  345  NDTVREVLNIHKGTVQHWQRCNYGLPYAHDIPSSLKFHLNLTSRGYRALVYSGDHDMVVP  404

Query  706  SLSAEAWTKSLNY  744
             L  +AW +SLN+
Sbjct  405  FLGTQAWIRSLNF  417



>gb|EYU37560.1| hypothetical protein MIMGU_mgv1a005845mg [Erythranthe guttata]
Length=468

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 142/254 (56%), Gaps = 13/254 (5%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWL  +P +  N LY+ GDSY G + PM+A+AIS GN+A L+P +  +GY+VGN  T
Sbjct  156  FLRKWLSLHPRFVKNRLYIAGDSYGGKITPMVARAISEGNEAGLQPRMLLQGYIVGNSRT  215

Query  187  HFSEHD-YTYQFALGYGLISEEFARKSYDDCI---TNPDKKPFFTKCQLDILRFV--MLT  348
              ++ D     +A   GL+S+E+   +   C+    NPD  P   +C+   LR V     
Sbjct  216  DANKDDNEKIPYAHRMGLVSDEYFELAKSSCLGEYVNPD--PDNIECKY-ALRLVNECTK  272

Query  349  FVNNPAYILDSVC-LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYV-  522
             VNNP +IL+  C  ++        G  FV     + V         LC++ + A+ YV 
Sbjct  273  LVNNP-HILEPKCKFLSPNPNYSQRGPLFVEDDPVDDVLFMSTQDDSLCRNYNYASSYVW  331

Query  523  -NVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLF  699
             N E+VQEALH++KG+I +W++C  +L Y  +V   +  H  LS KGF++L Y+GD D+ 
Sbjct  332  ANNETVQEALHIRKGTIPDWKRCNKSLSYEYDVESVLEDHRLLSEKGFQALAYSGDHDMS  391

Query  700  IPSLSAEAWTKSLN  741
            IP +S   W + LN
Sbjct  392  IPYMSTLKWIRELN  405



>ref|XP_010429238.1| PREDICTED: serine carboxypeptidase-like 9 [Camelina sativa]
Length=440

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 130/250 (52%), Gaps = 23/250 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN  Y  G+SY+G +IP L + I   N    KP IN +GY++GN V
Sbjct  153  EFLQKWLSKHPQYLSNPFYATGNSYAGMIIPALVEKIQKENYICCKPPINLQGYVLGNPV  212

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITN--PDKKPFFTKCQLDILRFVMLTFV  354
            T + +E +Y  QFA G  LIS+E       +C  N      P   KC   +  F      
Sbjct  213  TDYATERNYRVQFAHGMSLISDELYESLKRECNGNYFNVDPPRSKKCLKLVEEF------  266

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
                    + C  +    D+L  K    +   N      Y +Y L        ++ N ES
Sbjct  267  --------NKCTDDLNAYDILLPKCDEQLDPENMEPDCFYYKYYL------EERWANTES  312

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V+EALH+KKG+ + W +    +PY N++R S+ YH   S  G+RSLI++GD D+  P+++
Sbjct  313  VREALHIKKGTTEEWLRLNHVIPYENDIRSSVPYHKKNSIIGYRSLIFSGDHDMVSPTIA  372

Query  715  AEAWTKSLNY  744
             +AW KSLNY
Sbjct  373  TQAWIKSLNY  382



>emb|CDY49438.1| BnaA09g42290D [Brassica napus]
Length=438

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 131/249 (53%), Gaps = 22/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F++KWL  +P++ SN  YV GDSYSG  IP L Q IS GN    KP IN +GY++GN V
Sbjct  152  QFLQKWLSKHPQFLSNPFYVSGDSYSGKTIPALVQEISKGNYICCKPPINLQGYVLGNPV  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            TH   + +Y   F+ G  LIS+E       +C  N  +  P  TKC   +  +   T   
Sbjct  212  THPEIDENYRIPFSHGMSLISDELYESLKRNCKGNYRNVDPRNTKCLKLVEEYHKCTDKI  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C      +D  +     P       +   Y  YL+         + N E V
Sbjct  272  NTQHILLPDC------DDKSNSSNTSP-------DCYYYLYYLI-------ECWANNERV  311

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            +EALHV+KG+  +W++C   +PYN ++  S+ YH N S  G+RSLIY+GD D+ +     
Sbjct  312  REALHVEKGTKGHWQRCNWTIPYNQDIISSVPYHMNNSISGYRSLIYSGDHDITMTFQGT  371

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  372  QAWIKSLNY  380



>ref|XP_002298786.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
 gb|EEE83591.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
Length=469

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/266 (35%), Positives = 137/266 (52%), Gaps = 35/266 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+P++ +N LYV GDS+SG + P++ Q IS+GN+   +P IN KGY++GN V
Sbjct  151  EFLRKWLVDHPKFLTNPLYVAGDSFSGIVAPIIVQEISDGNEVGRQPTINLKGYVLGNPV  210

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T H  + +    FA    LIS++       +C     NPD+      C  DIL       
Sbjct  211  TDHEIDTNSIVPFAHLKALISDKLYESFMKNCKGEYLNPDQS--NASCMEDILAIKECIG  268

Query  352  VNNPAYILDSVC----------------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY  483
                  IL+  C                LI +  + LLS        R  G   + YN  
Sbjct  269  NVFTGQILEPACKEISPKPVALKWDPRFLIADDADILLSR------PRVPGPWCRSYNYV  322

Query  484  LLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGF  663
             +         + N E+V++ALH++KG+I +W +C   L Y+ NV  ++ YH NL+ K +
Sbjct  323  YI-------YMWANDETVRDALHIRKGTIKDWRRCNKTLAYSYNVESTVDYHRNLTKKPY  375

Query  664  RSLIYNGDRDLFIPSLSAEAWTKSLN  741
            R+LIY+GD D+ IP +    W +SLN
Sbjct  376  RALIYSGDHDMTIPYIGTHEWIESLN  401



>ref|NP_187656.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
 sp|Q9SQX6.1|SCP7_ARATH RecName: Full=Serine carboxypeptidase-like 7; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51371.1|AC011560_3 putative glucose acyltransferase; 97813-95037 [Arabidopsis thaliana]
 gb|AAF76347.1| glucose acyltransferase, putative [Arabidopsis thaliana]
 gb|AAM67067.1| putative glucose acyltransferase [Arabidopsis thaliana]
 gb|AEE74908.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
Length=437

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 129/250 (52%), Gaps = 30/250 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SN  YVGGDSY G +IP L Q IS GN    KP IN +GY++GN  
Sbjct  157  EFLHKWLGKHQEFSSNPFYVGGDSYCGMVIPALVQEISKGNYVCCKPPINLQGYILGNPS  216

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T  +E D  Y+  +A G  LIS+E        C     +  P  TKC   +  +   T  
Sbjct  217  TE-NEVDINYRIPYAHGMALISDELYESMKRICKGKYENVDPRNTKCLKLVGEYQKCTKR  275

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N A I+   C+  +                    +  +Y RYLL         + N E+
Sbjct  276  INKALIITPECVDTS-------------------PDCYMY-RYLL------TTYWANDEN  309

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            VQ ALHV KGSI  W +C   +PYN++++ S+ YH N S  G+ SLI++GD D+ +P L 
Sbjct  310  VQRALHVNKGSIGEWVRCYFEIPYNHDIKSSVPYHMNNSIDGYASLIFSGDHDMEVPYLG  369

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  370  TQAWIRSLNY  379



>ref|XP_009146839.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Brassica 
rapa]
Length=345

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 131/249 (53%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + ++ SN  YVGGDSY+G ++P L Q IS GN    KP IN +GY++GN  
Sbjct  62   EFLHKWLNKHQDFLSNPFYVGGDSYAGMVVPALVQEISKGNYVCCKPPINLQGYVLGNPS  121

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  + ++++   +A G  LIS+E        C     +  P  T+C   +  +       
Sbjct  122  TEVAFDYNHRIPYAHGMALISDELYESMERICKGEYENVNPSNTECLKLVEEYHKCVDRI  181

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N A IL  +C      ED L              +   Y RY+L       A + N ESV
Sbjct  182  NFALILTPLC---EESEDTLP-------------DCYTY-RYVL------TAYWTNDESV  218

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++AL + K S + W +C   +PY ++++ S+ YH N S  G+RSLIYNGD D+F+P L  
Sbjct  219  RKALQIHKKSKEKWVRCNWGMPYTHDIKSSVPYHMNNSINGYRSLIYNGDHDMFVPFLGT  278

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  279  QAWIRSLNY  287



>ref|XP_003576949.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 138/253 (55%), Gaps = 8/253 (3%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KW  ++P+Y  N  YVGGDSY+G ++P L Q IS   +A LKP +N KGYLVGN V
Sbjct  173  EFLTKWFAEHPDYLVNPFYVGGDSYAGKIVPFLVQKISEDIEAGLKPTVNLKGYLVGNPV  232

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T    +H     F  G G+IS++      D+C      KP    C   + RF  L     
Sbjct  233  TGDRVDHGSRVPFLHGAGIISDQLYEAIMDNCQGEDYTKPKNALCAQALERFKRLLNEIW  292

Query  361  PAYILDSVCL-INNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLL-CKS--DSIAAQYVNV  528
              +IL   C+ ++    D  +G+    +K   G+      R  + C S  + ++  + N 
Sbjct  293  KEHILYKKCISVSARPNDGSTGRKI--LKEETGLLKHPPPRPPMECLSYVNYLSYFWANN  350

Query  529  ESVQEALHVKKGSIDNWEQCR-ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
               ++ L +KKG++D W +C   +LP+  ++ +SI YH N+++KG+R+LIY+GD D  IP
Sbjct  351  NITRKILGIKKGTVDEWVRCHDGDLPFKQDIDNSIKYHRNVTSKGYRALIYSGDHDATIP  410

Query  706  SLSAEAWTKSLNY  744
             L  ++W +SLN+
Sbjct  411  FLGTQSWVRSLNF  423



>ref|XP_002882669.1| hypothetical protein ARALYDRAFT_478377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58928.1| hypothetical protein ARALYDRAFT_478377 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 129/250 (52%), Gaps = 30/250 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SN  YVGGDSY G +IP L Q IS GN    KP IN +GY++GN  
Sbjct  157  EFLHKWLGKHQEFSSNPFYVGGDSYCGMVIPALVQEISKGNYVCCKPPINIQGYILGNPS  216

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFV  354
            T  +E D +Y+  +A G  LIS+E        C     +  P  TKC   +  +      
Sbjct  217  TE-NEVDNSYRIPYAHGMALISDELYESMKRICKGKYENVDPRNTKCLKLVGEYQKCINR  275

Query  355  NNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVES  534
             N A I+   C+  +                    +  +Y RYLL         + N ES
Sbjct  276  INKALIITPECVETS-------------------PDCYMY-RYLL------TTYWANDES  309

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            VQ ALHV KGSI  W +C   +PYN++++ S+ YH N S  G+ SLI++GD D+ +P L 
Sbjct  310  VQRALHVNKGSIGEWVRCYREIPYNHDIKSSVPYHMNNSIDGYPSLIFSGDHDMEVPYLG  369

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  370  TQAWIRSLNY  379



>ref|XP_006472317.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X3 [Citrus 
sinensis]
Length=463

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 131/249 (53%), Gaps = 21/249 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE+ SN+ YVGGDSYSG  +P LAQ ISN N+  +KP IN +GY++GN  
Sbjct  155  QFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPLINLQGYILGNPK  214

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    + +    FA G GLIS E        C  +  +  P    C  D   F  L    
Sbjct  215  TDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLNDNQAFSELISGL  274

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            +  +IL+  C              F P  R +    +  N       +  + ++++ E  
Sbjct  275  DQNHILEPHCPF------------FSPKPRDSNGKRRSLN------DNEKSQEFLDPEPA  316

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
              ++   +GS   W++C  +LPY   +  S ++H +LSTKG+RSLIY+GD D+ +P L  
Sbjct  317  LPSIGC-RGSKGKWQRCNYDLPYTQEIGSSFSFHVSLSTKGYRSLIYSGDHDMVVPFLGT  375

Query  718  EAWTKSLNY  744
            EAW KSLNY
Sbjct  376  EAWIKSLNY  384



>ref|XP_009122528.1| PREDICTED: serine carboxypeptidase-like 19 [Brassica rapa]
Length=469

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 138/261 (53%), Gaps = 20/261 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+R+WL+D+PE+ S+  YVGGDSY+G ++P + Q IS GN+  LKP I+ +GY++GN V
Sbjct  156  QFLRRWLVDHPEFISSPFYVGGDSYAGHIVPGVVQQISLGNEKGLKPFISLQGYVLGNPV  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T+   E ++   FA G GLIS E        C  N  D  P   KC  D     + T+ N
Sbjct  216  TNLKVETNHRVSFAHGMGLISNELFESLEKSCGGNYMDVHPSNAKCVKD-----LQTYKN  270

Query  358  NPAYILDSVCLINNGLEDLLSGK----------AFVPIKRFNGVNA-KIYNRYLLCKSDS  504
              + I     L+ N   D +  K          +   +K F+G +   +           
Sbjct  271  CISEIYTEQILLPNCPVDYVPQKLQFLSNIKTGSRRELKEFSGYDTPSLPPPGCFTYGQF  330

Query  505  IAAQYVNVESVQEALHVKKGSIDNWEQCR-ANLPYNNNVRDSIAYHANLSTKGFRSLIYN  681
            +A+ + N E+V+ AL VKK  +  W +C   N+PY  ++   I YH N S KGFRSLIY+
Sbjct  331  LASFWANDENVRRALGVKK-ELGKWTRCNFQNIPYTYDIDSPIPYHVNNSRKGFRSLIYS  389

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ IP  S E W K LNY
Sbjct  390  GDHDMSIPFSSTEEWIKGLNY  410



>gb|KDO81472.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=414

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 129/251 (51%), Gaps = 55/251 (22%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL+D+PE  SN +Y+GGDSYSG ++P L Q ISN N+  +KP IN +GY++GN  
Sbjct  156  QFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAA  215

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T  + E +    FA G GLIS E        C     N D K                  
Sbjct  216  TEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPK------------------  257

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVE  531
                    + VCL +              I+ F    +K Y  YLL      +  + N  
Sbjct  258  --------NEVCLND--------------IQAF----SKTYG-YLL------SYYWNNDY  284

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            +V++AL ++ GS   W++C   LPY   +  S +YH +LSTKG+RSLIY+GD D+ +P L
Sbjct  285  NVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFL  344

Query  712  SAEAWTKSLNY  744
              EAW KSLNY
Sbjct  345  GTEAWIKSLNY  355



>ref|XP_010429231.1| PREDICTED: serine carboxypeptidase-like 11 isoform X2 [Camelina 
sativa]
Length=425

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 128/249 (51%), Gaps = 35/249 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++K       + SN  Y  GDSYSG  +P L Q IS GN    +P IN +GY++GN +
Sbjct  152  EFLQK-------FSSNPFYAAGDSYSGMTVPALVQEISKGNYICCEPPINLQGYVLGNPI  204

Query  184  THFSEHD-YTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            TH+ E + Y   F+ G GLIS E        C  N  +  P  TKC   +  +       
Sbjct  205  THYEEDEKYRVPFSHGMGLISSELYESIRSACKGNYFNVDPSNTKCLKLVEEYHKCIDKL  264

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C       ++ S   F            +Y  YLL       + + N ESV
Sbjct  265  NEYHILLPDC-------NMTSSDCF------------LYPYYLL-------SFWANDESV  298

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALH+KKGSI  W +C  + PYN +++ S+ YH N S  G+RSLIY GD DL +P L+ 
Sbjct  299  RDALHIKKGSIGEWVRCNRSNPYNKDIKSSVPYHMNNSISGYRSLIYIGDHDLVVPFLAT  358

Query  718  EAWTKSLNY  744
            EAW KSLNY
Sbjct  359  EAWIKSLNY  367



>ref|XP_010464719.1| PREDICTED: serine carboxypeptidase-like 7 isoform X3 [Camelina 
sativa]
Length=395

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 124/250 (50%), Gaps = 27/250 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SNS YVGGDSYSG ++P L Q IS GN    KP IN +GY++GN  
Sbjct  112  EFLHKWLGKHQEFSSNSFYVGGDSYSGKVVPALVQEISKGNYLCCKPPINLQGYILGNPY  171

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    E +Y   +A G  +IS+E        C  +  +  P   +C   +  +       
Sbjct  172  TESEFEKNYRIPYAHGMAMISDELYESMKIICKGDYINVDPRNRECLKLVEEYEKCIARI  231

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYN-RYLLCKSDSIAAQYVNVES  534
            NP  I   VC                  +     +   Y  RY+L         + N +S
Sbjct  232  NPLLITTPVC------------------EESQETSPNCYEYRYML------TTYWANYQS  267

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V  ALHV KGSI  W +C   +PY ++++ SI YH N S  G+ SLI++GD D+ +P L 
Sbjct  268  VHRALHVNKGSIGEWVRCHWGIPYTHDIKSSIPYHMNNSIDGYPSLIFSGDHDMVVPFLG  327

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  328  TQAWIRSLNY  337



>ref|XP_009612197.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
tomentosiformis]
Length=474

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 138/261 (53%), Gaps = 20/261 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KW  ++PE+ SN  YV GDSYSG  +P++ Q IS+G +A   P IN KGY +GN +
Sbjct  161  EFLLKWFNNHPEFISNPFYVSGDSYSGITVPVIVQLISDGIEAGKNPLINLKGYSLGNPL  220

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   F  G GLIS E      + C  +  +  P    C  +   F  L    N
Sbjct  221  TFPEESNYQIPFCHGMGLISNELYESLKETCKGDCRNIDPTNKLCLENFKMFKKLVSSIN  280

Query  361  PAYILDSVCLINNGLED--LLSGKAFVPIKRFNGVNAKIYNRY--LLCKSDSIAAQ----  516
               IL+  C  ++   +   LSG+     + F      I+ ++   +C+   +A +    
Sbjct  281  DQQILEPFCGTDSESPNPRQLSGERRSLEEDF------IFLKHDDFICRESRVATRKLSN  334

Query  517  -YVNVESVQEALHVKKGSIDN-WEQCRANL---PYNNNVRDSIAYHANLSTKGFRSLIYN  681
             + N   VQEALHV+KG+I   W +CR ++    Y     +SI YH NLS+KG+RSLIY+
Sbjct  335  HWANDPCVQEALHVRKGTIRRPWARCRQSIMGKTYRVTFMNSIPYHVNLSSKGYRSLIYS  394

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D+ +P  S +AW K LNY
Sbjct  395  GDHDMVVPFQSTQAWIKYLNY  415



>ref|XP_009388678.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/260 (33%), Positives = 143/260 (55%), Gaps = 25/260 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+ KW ID+P++ SN LY+ GDSY G ++P++A  +S G     K  +N KGYL+GN V
Sbjct  173  KFLIKWFIDHPQFLSNPLYISGDSYGGKIVPIVAHLVSEGTKVGNK-QLNLKGYLIGNPV  231

Query  184  T--HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVN  357
            T  +F E+     +A G G+IS+         C     + P   +C   +  F       
Sbjct  232  TGENFDENSRV-PYAHGVGIISDGVFEMIQRSCKGQDHRNPTTVQCASCLETFENFCSEI  290

Query  358  NPAYILDSVC-LINNGLEDLLSGKAFV----------PIKRFNGVNAKIYNRYLLCKSDS  504
               +IL+  C L +   +D++  +  +          P+     +N + Y  +L      
Sbjct  291  YENHILEPKCALASPKRKDMILDRRSLKENMDLLKPPPVPE---LNCRGYAYFL------  341

Query  505  IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNG  684
             +  + N  +V++ALH+KKG+++ W++C ++LPY N ++ ++ YH NL+T+GFR+L+Y+G
Sbjct  342  -SYYWANSNAVRQALHIKKGTVEEWQRCNSDLPYANGLKSNLEYHLNLTTRGFRALVYSG  400

Query  685  DRDLFIPSLSAEAWTKSLNY  744
            D DL+IP +   AW KSLN+
Sbjct  401  DHDLYIPFVGTMAWIKSLNF  420



>emb|CDY08603.1| BnaA05g28390D [Brassica napus]
Length=443

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 131/249 (53%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SN  YVGGDSY+G ++P L Q IS GN    KP IN +GY++GN  
Sbjct  160  EFLHKWLNKHQEFLSNPFYVGGDSYAGMVVPALVQEISKGNYVCCKPPINLQGYVLGNPS  219

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  + ++++   +A G  LIS+E        C     +  P  T+C   +  +       
Sbjct  220  TEVAFDYNHRIPYAHGMALISDELYESMERICKGEYENVNPSNTECLKLVEEYHKCVDRI  279

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N A IL  +C      ED L              +   Y RY+L       A + N ESV
Sbjct  280  NFALILTPLC---EESEDTLP-------------DCYTY-RYVL------TAYWTNDESV  316

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++AL + K S + W +C   +PY ++++ S+ YH N S  G+RSLIYNGD D+F+P L  
Sbjct  317  RKALQIHKKSKEKWVRCNWGMPYTHDIKSSVPYHMNNSINGYRSLIYNGDHDMFVPFLGT  376

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  377  QAWIRSLNY  385



>ref|XP_006369725.1| hypothetical protein POPTR_0001s29900g [Populus trichocarpa]
 gb|ERP66294.1| hypothetical protein POPTR_0001s29900g [Populus trichocarpa]
Length=441

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 140/266 (53%), Gaps = 35/266 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+P++ +N LYV GDSY+G + P++ Q IS+GN+   +P +N KGY++GN  
Sbjct  151  EFLRKWLVDHPKFLTNPLYVAGDSYTGIVAPIIVQEISDGNEVGHQPTMNLKGYVLGNPR  210

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T +  + +    FA    LIS++       +C     NPD++     C  DIL       
Sbjct  211  TDYEIQINSIVPFAHLKVLISDKLYESFMKNCKGEYLNPDQR--NASCMEDILAIKECIR  268

Query  352  VNNPAYILDSVC----------------LINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY  483
                A+IL+  C                LI +  + LLS        R  G   + YN  
Sbjct  269  NLCNAHILEPTCKDISPKPVPLKWDPRFLIADDADILLSSP------RVPGPWCRSYNYV  322

Query  484  LLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGF  663
             +         + N E+V++ALH++KG+I +W +C   L Y+ NV+ ++ YH NL+ K +
Sbjct  323  YI-------YMWANDETVRDALHIRKGTIKDWRRCNKTLAYSYNVKSTVDYHRNLTKKPY  375

Query  664  RSLIYNGDRDLFIPSLSAEAWTKSLN  741
            R+LIY+GD D+ IP +    W +SLN
Sbjct  376  RALIYSGDHDMLIPYVGTLEWIESLN  401



>ref|XP_010939017.1| PREDICTED: serine carboxypeptidase-like 12 isoform X2 [Elaeis 
guineensis]
Length=471

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/251 (33%), Positives = 141/251 (56%), Gaps = 7/251 (3%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKW +D+  + SNSLY+ GDSY+G ++P++A+AIS   +A  + ++N KGYL+GN V
Sbjct  165  KFLRKWFVDHARFLSNSLYISGDSYAGKVVPVIAKAISEDIEADQQSSLNLKGYLIGNPV  224

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T    + +    +A G G+IS+        +C     + P   KC   +  F       +
Sbjct  225  TGLKIDMNARVPYAHGVGIISDALYELIQKNCEGEDYENPVRAKCVTKLDAFHKFYSEIH  284

Query  361  PAYILDSVCL-INNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNVE  531
              YILD  C   +   ED++  +  +     +       +  L C++ +  ++  + N  
Sbjct  285  AGYILDPKCTRASPKPEDMIGDRRSLEELELHSPPP---HPALKCRTYAYFLSYYWANSN  341

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
              ++ALH+KKG++  W++C  +L Y  ++ ++I YH +L++KG+R+LIY+GD DL IP L
Sbjct  342  VTRKALHIKKGTVREWQRCNDDLGYIKDIPNNINYHLSLTSKGYRALIYSGDHDLMIPFL  401

Query  712  SAEAWTKSLNY  744
              +AW  SLN+
Sbjct  402  GTQAWISSLNF  412



>gb|KDP41601.1| hypothetical protein JCGZ_16008 [Jatropha curcas]
Length=478

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 143/273 (52%), Gaps = 36/273 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFK--------  159
            +F+RKWL D+PE+  + +Y+ GDSYSG  +P + Q ISNGN+  ++P IN K        
Sbjct  157  QFLRKWLRDHPEFLPSPVYIAGDSYSGIPLPAIVQQISNGNEEGMEPLINLKVLFKKKKK  216

Query  160  ---GYLVGNGVTHFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLD  324
               GY++GN +T  + + +    +A G GLIS+E        C  N  D +P  T+C  +
Sbjct  217  NLKGYILGNPITDPNFDTNSKVSYAHGMGLISDELYESLKRSCRGNYVDIEPSNTECLRN  276

Query  325  ILRFVMLTFVNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS  504
            +  F          YIL+  C          S K   P + F+   + I N     + D 
Sbjct  277  MQGFNKCVEGLQTGYILEPSC-------GFASPK---PFEIFDKRRSLIQNSPDFLQIDP  326

Query  505  -------------IAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHAN  645
                         ++  +VN  SV+EALH+++GSI+ W +C   L Y +++  S+ YH +
Sbjct  327  TYPSFGCPAYGYVLSYIWVNDSSVREALHIREGSIEQWVRCNTELSYTSDIPISLVYHVS  386

Query  646  LSTKGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            L  KG+RSLIY+GD+D+ +P L  +AW +SLNY
Sbjct  387  LGKKGYRSLIYSGDQDMVVPFLGTQAWIRSLNY  419



>ref|XP_009104819.1| PREDICTED: serine carboxypeptidase-like 2 isoform X3 [Brassica 
rapa]
Length=399

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 131/251 (52%), Gaps = 32/251 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  + E+ SN LYVGGDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  160  EFLQKWLGKHEEFISNPLYVGGDSYSGKVVPALVQEISKGNYQCCKPPINLQGYVLGNPL  219

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T F ++ +    FA G  LIS+E        C     N D  P  T+C   +  +   T 
Sbjct  220  TEFETDMNSRIPFAHGMALISDELYESLKIICKGKYVNVD--PSNTECLKLVEEYNKCTE  277

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVE  531
              NP  IL+                   P       ++ IY RYLL      A  + N E
Sbjct  278  TVNPFLILE-------------------PFYEAETPDSYIY-RYLL------ATYWANDE  311

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            SV++AL + K SI  W +C  ++PY  ++  S+ Y  + S  G+RSLIY+GD DL +P L
Sbjct  312  SVRKALQINKESIGRWIRCNLDIPYTQDIISSVPYQVDNSIDGYRSLIYSGDHDLGMPYL  371

Query  712  SAEAWTKSLNY  744
              +AW +SLNY
Sbjct  372  GTQAWIRSLNY  382



>ref|XP_010939016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=498

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/251 (33%), Positives = 141/251 (56%), Gaps = 7/251 (3%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKW +D+  + SNSLY+ GDSY+G ++P++A+AIS   +A  + ++N KGYL+GN V
Sbjct  192  KFLRKWFVDHARFLSNSLYISGDSYAGKVVPVIAKAISEDIEADQQSSLNLKGYLIGNPV  251

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T    + +    +A G G+IS+        +C     + P   KC   +  F       +
Sbjct  252  TGLKIDMNARVPYAHGVGIISDALYELIQKNCEGEDYENPVRAKCVTKLDAFHKFYSEIH  311

Query  361  PAYILDSVCL-INNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAAQYVNVE  531
              YILD  C   +   ED++  +  +     +       +  L C++ +  ++  + N  
Sbjct  312  AGYILDPKCTRASPKPEDMIGDRRSLEELELHSPPP---HPALKCRTYAYFLSYYWANSN  368

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
              ++ALH+KKG++  W++C  +L Y  ++ ++I YH +L++KG+R+LIY+GD DL IP L
Sbjct  369  VTRKALHIKKGTVREWQRCNDDLGYIKDIPNNINYHLSLTSKGYRALIYSGDHDLMIPFL  428

Query  712  SAEAWTKSLNY  744
              +AW  SLN+
Sbjct  429  GTQAWISSLNF  439



>ref|XP_010464717.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Camelina 
sativa]
Length=440

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 124/250 (50%), Gaps = 27/250 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SNS YVGGDSYSG ++P L Q IS GN    KP IN +GY++GN  
Sbjct  157  EFLHKWLGKHQEFSSNSFYVGGDSYSGKVVPALVQEISKGNYLCCKPPINLQGYILGNPY  216

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T    E +Y   +A G  +IS+E        C  +  +  P   +C   +  +       
Sbjct  217  TESEFEKNYRIPYAHGMAMISDELYESMKIICKGDYINVDPRNRECLKLVEEYEKCIARI  276

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYN-RYLLCKSDSIAAQYVNVES  534
            NP  I   VC                  +     +   Y  RY+L         + N +S
Sbjct  277  NPLLITTPVC------------------EESQETSPNCYEYRYML------TTYWANYQS  312

Query  535  VQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLS  714
            V  ALHV KGSI  W +C   +PY ++++ SI YH N S  G+ SLI++GD D+ +P L 
Sbjct  313  VHRALHVNKGSIGEWVRCHWGIPYTHDIKSSIPYHMNNSIDGYPSLIFSGDHDMVVPFLG  372

Query  715  AEAWTKSLNY  744
             +AW +SLNY
Sbjct  373  TQAWIRSLNY  382



>ref|XP_006296372.1| hypothetical protein CARUB_v10025545mg [Capsella rubella]
 gb|EOA29270.1| hypothetical protein CARUB_v10025545mg [Capsella rubella]
Length=439

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 130/249 (52%), Gaps = 23/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P+Y SN  Y  GDSY+G +IP +   IS GN     P IN +GY++GN V
Sbjct  154  EFLQKWLSKHPQYYSNPFYATGDSYAGMIIPAVVDEISKGNYICCNPPINLQGYVLGNPV  213

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            TH   E +Y   FA G   IS+E        C  N  +  P  TKC   +  F   T   
Sbjct  214  THIEMEINYRIPFAYGMSFISDELYESLKIFCKGNYFNVDPSNTKCLKLVEEFNKCTENI  273

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N   IL   C   N  E  +S   F             Y RY L +      ++ N +SV
Sbjct  274  NIHQILIPNCDHTNTEE--ISPDCF-------------YYRYHLLE------RWSNKDSV  312

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++ALH+ KG+   W +   ++PY+ N++ SI YH N S  G+RSLI++GD D+ +PS + 
Sbjct  313  RKALHIHKGTKGQWLRYNHSIPYDKNIKSSIPYHMNNSINGYRSLIFSGDHDMVLPSFAT  372

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  373  QAWIKSLNY  381



>ref|XP_009135217.1| PREDICTED: serine carboxypeptidase-like 14 [Brassica rapa]
Length=438

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/249 (36%), Positives = 130/249 (52%), Gaps = 23/249 (9%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  +PEY SN  YV G+SY+G ++P   Q IS GN    KP IN +GY++GN +
Sbjct  153  EFVHKWLAKHPEYFSNPFYVTGNSYAGKVVPATVQEISIGNGLCCKPQINLQGYVLGNPI  212

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITNPDK-KPFFTKCQLDILRFVMLTFVN  357
            T   +E ++   FA G  LIS+E        C  N  K  P  T+C   +  F       
Sbjct  213  TDLDNEKNWHIPFAHGMALISDEHYESLRRICRGNFAKVDPHNTECMNLVEEFEKCVSGL  272

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            + +YIL    +  +  +D                 A      ++ +S    +++ N ESV
Sbjct  273  DWSYILGPKYINPSDPDD-----------------ANPLGHRMIVQS----SRWTNEESV  311

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            + ALHV+KG+I  W  C   LPY  ++  S+ YH N S +G+RSLI++GD DL +P L+ 
Sbjct  312  RRALHVEKGTIGEWSLCDRELPYKFDINSSVPYHKNNSIQGYRSLIFSGDHDLLVPFLAT  371

Query  718  EAWTKSLNY  744
            + W +SLNY
Sbjct  372  QDWMRSLNY  380



>ref|XP_006415429.1| hypothetical protein EUTSA_v10007675mg [Eutrema salsugineum]
 gb|ESQ33782.1| hypothetical protein EUTSA_v10007675mg [Eutrema salsugineum]
Length=435

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/251 (39%), Positives = 130/251 (52%), Gaps = 32/251 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL  +PEY SN  YV G+SYSG +IP + Q ISNGN    KP IN +GY++GN +
Sbjct  155  EFVRKWLDKHPEYFSNPFYVTGNSYSGKVIPSIVQEISNGNYICCKPQINLQGYVLGNPL  214

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T +  + +   QFA G  LIS+E        C   + N D  P  T+C   +  F     
Sbjct  215  TDYDLDFNSRIQFAHGMALISDELNESMKRSCKGKLFNVD--PLNTECLRLVEDFKKCVS  272

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVE  531
                  IL+S C       D  S   +               RYLL      +  + N E
Sbjct  273  RIYEELILESNC-------DSTSPNCYT-------------YRYLL------SEYWANNE  306

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            SV+ AL V KG+   WE+C  N+  N ++  SI YH N+S KG+RSLI +GD D+ IP +
Sbjct  307  SVRRALKVVKGTKGKWERCDYNVRCNKDIISSIPYHMNISIKGYRSLILSGDHDMTIPFV  366

Query  712  SAEAWTKSLNY  744
            S + W +SLNY
Sbjct  367  STQDWIRSLNY  377



>ref|XP_009784017.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
sylvestris]
Length=457

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 136/259 (53%), Gaps = 16/259 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KW  ++ E+ SN  YV GDSYSG  +P++ Q IS+G +A  KP IN KGY +GN +
Sbjct  144  EFLCKWFNNHQEFISNPFYVSGDSYSGITVPVIVQLISDGIEAGKKPLINLKGYSLGNPL  203

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   +  G GLIS+E      + C  +  +  P    C  +   F  L    N
Sbjct  204  TFPEESNYQIPYCHGMGLISDELYESLKETCKGDYQNIDPTNKLCSENFKMFKKLVSRIN  263

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY--LLCKSDSIAAQ-----Y  519
               IL+  C    G +        +  +R +  +  I  R+   +C+   +A +     +
Sbjct  264  DQQILEPFC----GTDSESPKPHQLSGERRSLEDNLISLRHGDFICRESRVATRKLSNHW  319

Query  520  VNVESVQEALHVKKGSIDN-WEQCRANL---PYNNNVRDSIAYHANLSTKGFRSLIYNGD  687
             N   VQEALHV+KG+I   W +CR ++    Y     +SI YH NLS+KG+RSLIY+GD
Sbjct  320  ANDPRVQEALHVRKGTIRRPWARCRQSIMGTTYTITFMNSIPYHVNLSSKGYRSLIYSGD  379

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D+ IP  S +AW K LNY
Sbjct  380  HDMVIPFQSTQAWIKYLNY  398



>emb|CDX89533.1| BnaC04g35520D [Brassica napus]
Length=472

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 137/270 (51%), Gaps = 37/270 (14%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +PE+ SN  YV GDSYSG ++P L Q IS GN    +P IN +GY++GN +
Sbjct  153  EFLQKWLSKHPEFYSNPFYVTGDSYSGKIVPPLVQEISRGNYICCEPPINIQGYILGNPI  212

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T   SE++    +A G  LIS+E        C  N  +     T+C   I  +   T   
Sbjct  213  TQITSENNSKIPYAHGMALISDELYESLKRICKGNYENVGSRNTECLKHIEIYNKCTDKL  272

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFN--------------------GVNAKIYN  477
            N  +IL   C       D+ S   FV    F                      V  ++YN
Sbjct  273  NTYHILLPDC-------DMTSPDCFVSHTSFTLLVTAVKMIGRNIYREMTMIYVALQLYN  325

Query  478  RYLLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCRAN-LPYNNNVRDSIAYHANLST  654
             +LL K       + N E V+ AL V KGSI  W +C  + +PYN +++ ++ YH N S 
Sbjct  326  YFLLNK-------WANNERVRRALQVTKGSIGEWRRCNYDVIPYNYDIQSTVPYHMNNSI  378

Query  655  KGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
             GFRSLIY+GD D+ +P ++ +AW +SLNY
Sbjct  379  SGFRSLIYSGDHDMLVPFIATQAWIRSLNY  408



>ref|XP_006301868.1| hypothetical protein CARUB_v10022339mg [Capsella rubella]
 gb|EOA34766.1| hypothetical protein CARUB_v10022339mg [Capsella rubella]
Length=439

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/251 (39%), Positives = 127/251 (51%), Gaps = 32/251 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  + E+ SN  YV GDSYSG +IP   Q IS GN     P IN +GY++GN V
Sbjct  159  EFVQKWLGKHQEFSSNPFYVTGDSYSGLVIPATVQEISKGNYQCCNPPINLQGYVLGNPV  218

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T H  + +Y   FA G  LIS E        C   I N D  P  T+C   I  +   T 
Sbjct  219  TDHTIDLNYRIPFAHGMALISNELNESLKRICKGEIINVD--PRNTECLKLIEEYNKCTS  276

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVE  531
                  + D +C            + + P       +  IY RYLL         + N  
Sbjct  277  GVCKEVVTDPLC------------ETYTP-------DCYIY-RYLL------TTYWGNDA  310

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            +VQEAL + K SI  W +C   +PYNN+++ SI YH N S  G+RSLIY+GD D  +P L
Sbjct  311  TVQEALQISKESIGEWVRCYFGIPYNNDIKSSIPYHMNNSINGYRSLIYSGDHDFQVPFL  370

Query  712  SAEAWTKSLNY  744
              +AW +SLNY
Sbjct  371  GTQAWIRSLNY  381



>ref|XP_009104821.1| PREDICTED: serine carboxypeptidase-like 2 isoform X5 [Brassica 
rapa]
Length=443

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 131/251 (52%), Gaps = 32/251 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  + E+ SN LYVGGDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  161  EFLQKWLGKHEEFISNPLYVGGDSYSGKVVPALVQEISKGNYQCCKPPINLQGYVLGNPL  220

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T F ++ +    FA G  LIS+E        C     N D  P  T+C   +  +   T 
Sbjct  221  TEFETDMNSRIPFAHGMALISDELYESLKIICKGKYVNVD--PSNTECLKLVEEYNKCTE  278

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVE  531
              NP  IL+                   P       ++ IY RYLL      A  + N E
Sbjct  279  TVNPFLILE-------------------PFYEAETPDSYIY-RYLL------ATYWANDE  312

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            SV++AL + K SI  W +C  ++PY  ++  S+ Y  + S  G+RSLIY+GD DL +P L
Sbjct  313  SVRKALQINKESIGRWIRCNLDIPYTQDIISSVPYQVDNSIDGYRSLIYSGDHDLGMPYL  372

Query  712  SAEAWTKSLNY  744
              +AW +SLNY
Sbjct  373  GTQAWIRSLNY  383



>emb|CDY59210.1| BnaA09g54030D [Brassica napus]
Length=468

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 142/264 (54%), Gaps = 32/264 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL+++PE+ SN LYVGGDSY+G ++P + Q IS GN+   KP IN KGY++GN  
Sbjct  162  EFLQKWLVEHPEFVSNPLYVGGDSYAGIVVPAIVQQISIGNENSNKP-INLKGYVLGNPS  220

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T    +H+    +A G GLIS+E        C     N D     T+C   +  +     
Sbjct  221  TELDKDHNAKIPYAHGMGLISDELFESLKISCNGNYVNIDHT--NTQCLKLVEDYDKCVS  278

Query  352  VNNPAYILDSVC---------LINNG---LEDLLSGKAFVPIKRFNGVNAKIYNRYLLCK  495
              N   IL  +C         + N G   LE L+    ++P          +Y RY+L  
Sbjct  279  RINEGSILIPLCDLASPNPFSMENAGRRSLERLVQSDLYLPTP-----GCYMY-RYVL--  330

Query  496  SDSIAAQYVNVESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKG-FRSL  672
                A  + N E V++AL V+KGSI  W +C  ++ Y  +++ S+ YH N+S KG +RSL
Sbjct  331  ----ATYWANDEDVRKALRVEKGSIGKWMRCDWDMAYEKDIKSSLPYHMNISRKGLYRSL  386

Query  673  IYNGDRDLFIPSLSAEAWTKSLNY  744
            +Y+GD D+ +P +   AW +SLNY
Sbjct  387  VYSGDHDMMVPYVGTVAWIRSLNY  410



>ref|XP_002459781.1| hypothetical protein SORBIDRAFT_02g010510 [Sorghum bicolor]
 gb|EER96302.1| hypothetical protein SORBIDRAFT_02g010510 [Sorghum bicolor]
Length=483

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 136/268 (51%), Gaps = 31/268 (12%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+ KW  D+PEY +N  Y+GGDSY+G ++P + Q IS G +A  +P  N KGYLVGN  
Sbjct  167  DFLIKWFDDHPEYLANPFYIGGDSYAGKIVPFIGQMISEGIEAGRRPFPNLKGYLVGNAA  226

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T  S +      +A G G+IS +        C       P  T C   +  F  L     
Sbjct  227  TGESIDTTSRVPYAHGVGIISAQLYETILGHCQGEDYTNPANTLCAQALYTFNNLIDEVQ  286

Query  361  PAYILDSVCLINNGLEDLLS---------------GKAFV--PIKR--FNGVNAKIYNRY  483
             A+IL   C+  +   +++S               G+  +  P  R  F  +  + Y  Y
Sbjct  287  HAHILLDRCVYASPAPNVVSRMDGSDNRRILRAEMGRGMLNHPPARPPFGCLTYRYYLSY  346

Query  484  LLCKSDSIAAQYVNVESVQEALHVKKGSIDNWEQCR-ANLPYNNNVRDSIAYHANLSTKG  660
                       + N +  +EAL +KKG++D W +C   +LPY  +++ SI YH NL+++G
Sbjct  347  F----------WANDKRTREALGIKKGTVDEWVRCHDGDLPYTKDLKSSIKYHRNLTSRG  396

Query  661  FRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            +R+L+Y+GD DL +P L  +AW +SLN+
Sbjct  397  YRALVYSGDHDLLVPHLGTQAWVRSLNF  424



>ref|XP_010936146.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=394

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/253 (34%), Positives = 137/253 (54%), Gaps = 11/253 (4%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+RKWLID+ E+ SN LY+GGDSYSG ++P++AQ I+ G     +   N KGYLVGN VT
Sbjct  87   FLRKWLIDHLEFLSNPLYIGGDSYSGIVVPVVAQEIAKGAQDGDELLYNLKGYLVGNPVT  146

Query  187  HFSEHDYTY-QFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNP  363
                 +  +  +A G GLIS+E    +   C       P   +C   +          N 
Sbjct  147  DEKFDNGAFVPYAHGMGLISDELYESTKKSC-GGEYASPTNEQCASHLQSINKCIEGINT  205

Query  364  AYILDSVCLINNGLEDLLSGKAF----VPIKRFNGVNAKIYNRYLLCKSDSIAAQY--VN  525
              IL+ VC   +    +++  +       IK F  + A +    L C+S      Y   N
Sbjct  206  PQILEPVCFFVSPKPSIVAAYSRRLLKEDIKEFPLLKADLP---LECRSSGYLLSYFWAN  262

Query  526  VESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIP  705
             ++V+E L++ KG++  W++C   LPY +++  S+ +H NL+++G R+L+Y+GD D+ +P
Sbjct  263  NDTVREVLNIHKGTVQQWQRCNYGLPYAHDIPSSLKFHLNLTSRGHRALVYSGDHDMIVP  322

Query  706  SLSAEAWTKSLNY  744
             +  +AW +SLN+
Sbjct  323  FVGTQAWIRSLNF  335



>ref|XP_010464978.1| PREDICTED: serine carboxypeptidase-like 14 [Camelina sativa]
Length=435

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 130/249 (52%), Gaps = 28/249 (11%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL  +PEY SN  YV G+SYSG +IP + Q ISNGN    KP IN +GY++GN +
Sbjct  155  EFVRKWLAKHPEYFSNPFYVAGNSYSGKVIPAIVQEISNGNYICCKPQINLQGYVIGNPL  214

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T +  + D    FA G GLIS+E        C  N  +  P  T+C   I  +       
Sbjct  215  TSYDPDRDARIPFAHGMGLISDELFESMKRSCGGNYYNVDPLNTECLKLIEDY-------  267

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
                     C+  +G+ D L      P       +   Y RY+L      +  + N ESV
Sbjct  268  -------HKCV--SGIYDEL---VVAPKCETTSPDCYTY-RYML------SEYWANNESV  308

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            + AL V KGS   WE+C  ++  N +++ SI YH N S KG+RSL+ +GD D+ IP +  
Sbjct  309  RRALKVVKGSKGKWERCDFSVRCNKDIKSSIPYHMNNSIKGYRSLVISGDHDMTIPFVGT  368

Query  718  EAWTKSLNY  744
            +AW  SLNY
Sbjct  369  QAWIASLNY  377



>gb|AAQ91191.1| 1-O-sinapoylglucose:choline sinapoyltransferase [Brassica napus]
 gb|AAQ91192.1| 1-O-sinapoylglucose:choline sinapoyltransferase [Brassica napus]
Length=466

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 134/259 (52%), Gaps = 15/259 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+R W +D+PE+ SNS YVGGDSYSG ++P + Q IS GN+  L P IN KGY++GN  
Sbjct  152  QFLRSWFVDHPEFISNSFYVGGDSYSGKIVPGVVQQISLGNEKGLTPLINIKGYVLGNPA  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
               + E ++   FA   GLIS+E       +C     N D  P   KC   +L +     
Sbjct  212  VRTNLEPNHRVSFAHRMGLISDELHESLERNCGGKFFNVD--PSNAKCSNGLLAYHQCIS  269

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS-------IA  510
                  IL   C ++  L D+      +   R   +     N        S       ++
Sbjct  270  EIYIEQILLPNCKVDYVLADISQTLPNIRTSRRRELKEFSRNDSSSLPPPSCFTYRYFLS  329

Query  511  AQYVNVESVQEALHVKKGSIDNWEQCRA-NLPYNNNVRDSIAYHANLSTKGFRSLIYNGD  687
            A + N E+V+ AL VKKG    W +C   N+PY  ++ ++I YH N S KGFR+LIY+GD
Sbjct  330  AFWANDENVRRALGVKKG-FGKWSRCNTQNIPYTYDIHNAIPYHVNNSRKGFRALIYSGD  388

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D+ IP  S EAW KSLNY
Sbjct  389  HDMMIPFSSTEAWIKSLNY  407



>ref|NP_001067796.1| Os11g0432900 [Oryza sativa Japonica Group]
 gb|ABA93121.2| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28159.1| Os11g0432900 [Oryza sativa Japonica Group]
Length=479

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/261 (34%), Positives = 138/261 (53%), Gaps = 23/261 (9%)
 Frame = +1

Query  1    AEFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGN-  177
             +F+ KW   + E+ SN LYVGG+SY+G L+P L Q IS   +A +KP +N KGYLVGN 
Sbjct  170  TKFVNKWFSQHREFLSNPLYVGGESYAGKLVPFLLQKISEDVEAGVKPVLNLKGYLVGNP  229

Query  178  GVTHFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVN  357
            G     +++    +A G G+IS++      + C       P    C   + RF  L    
Sbjct  230  GTGESIDYESKVPYAHGVGIISDQLYETILEHCGREDYANPKNATCAQALNRFSELMGEV  289

Query  358  NPAYILDSVCLI-----NNG------LEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS  504
            + A+IL   C+      ++G      LE+++ G    P      ++   Y  YL      
Sbjct  290  SEAHILYKKCIYVSPKPDDGTIGRKILEEIVVGNHRPPRPP---MDCSTYPNYL------  340

Query  505  IAAQYVNVESVQEALHVKKGSIDNWEQCRAN-LPYNNNVRDSIAYHANLSTKGFRSLIYN  681
             +  + N  + +E L +KKG++D W +C  + LPY+ ++  SI YH NL+++G+R L+Y+
Sbjct  341  -SYFWANSNNTRENLGIKKGTVDEWVRCHDDGLPYSQDIESSIKYHQNLTSRGYRVLVYS  399

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D  +P L  +AW +SLNY
Sbjct  400  GDHDSVVPFLGTQAWVRSLNY  420



>ref|XP_008236287.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=480

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 144/258 (56%), Gaps = 15/258 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+RKWL+D+P++ +N LY+ GDSYSG ++PM+ Q IS+GN     P +N KGY++GN V
Sbjct  163  EFLRKWLMDHPKFYNNPLYIAGDSYSGIIVPMVVQEISDGNQDEHVPPMNLKGYVLGNPV  222

Query  184  THFSEHDYTYQFALGY--GLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLT  348
            T   + DY Y+    Y   LIS+E  +    +C     N D     T C  D+  +    
Sbjct  223  TD-KKKDYNYKVLFAYLKALISDELYQSIKKNCKGEYINVDLNN--TLCVEDLELYNECI  279

Query  349  FVNNPAYILDSVCLINNGLEDLLS---GKAFVPIKRFNGVNAKIYNRYLLCKSDS--IAA  513
               + A+IL+  C I    +   S   G  F      N + + +  R   C+S +   ++
Sbjct  280  EGIHSAHILEPSCTIIESPKSARSKWNGNYFSNKDSVNLLLSFLQLRRPWCRSYNYLYSS  339

Query  514  QYVNVESVQEALHVKKGSIDNWEQCRANLP--YNNNVRDSIAYHANLSTKGFRSLIYNGD  687
             + N ++VQ+ALH+++GSI  WE+C   L   Y ++V  S+ YH N+  +G+R L+Y+GD
Sbjct  340  IWENDKTVQDALHIQEGSITEWERCNKTLQELYTSDVSSSLVYHENIIKQGYRVLVYSGD  399

Query  688  RDLFIPSLSAEAWTKSLN  741
             D+ IP ++  AW +SLN
Sbjct  400  HDMDIPYVATMAWIESLN  417



>ref|XP_009104820.1| PREDICTED: serine carboxypeptidase-like 2 isoform X4 [Brassica 
rapa]
Length=441

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 131/251 (52%), Gaps = 32/251 (13%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  + E+ SN LYVGGDSYSG ++P L Q IS GN    KP IN +GY++GN +
Sbjct  161  EFLQKWLGKHEEFISNPLYVGGDSYSGKVVPALVQEISKGNYQCCKPPINLQGYVLGNPL  220

Query  184  THF-SEHDYTYQFALGYGLISEEFARKSYDDC---ITNPDKKPFFTKCQLDILRFVMLTF  351
            T F ++ +    FA G  LIS+E        C     N D  P  T+C   +  +   T 
Sbjct  221  TEFETDMNSRIPFAHGMALISDELYESLKIICKGKYVNVD--PSNTECLKLVEEYNKCTE  278

Query  352  VNNPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVE  531
              NP  IL+                   P       ++ IY RYLL      A  + N E
Sbjct  279  TVNPFLILE-------------------PFYEAETPDSYIY-RYLL------ATYWANDE  312

Query  532  SVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSL  711
            SV++AL + K SI  W +C  ++PY  ++  S+ Y  + S  G+RSLIY+GD DL +P L
Sbjct  313  SVRKALQINKESIGRWIRCNLDIPYTQDIISSVPYQVDNSIDGYRSLIYSGDHDLGMPYL  372

Query  712  SAEAWTKSLNY  744
              +AW +SLNY
Sbjct  373  GTQAWIRSLNY  383



>emb|CDY00943.1| BnaC05g42570D [Brassica napus]
Length=443

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 130/249 (52%), Gaps = 25/249 (10%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KWL  + E+ SN  YVGGDSY+G ++P L Q IS GN     P IN +GY++GN  
Sbjct  160  EFLHKWLKKHQEFLSNPFYVGGDSYAGMVVPALVQEISKGNYVCCNPPINLQGYVLGNPS  219

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVN  357
            T  + ++++   +A G  LIS+E        C     +  P  T+C   +  +       
Sbjct  220  TEVAFDYNHRIPYAHGMALISDELYESLKRICKGEYENVDPSNTECLKLVEEYHKCVDKI  279

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N A IL  +C      ED L              +   Y RY+L       A + N ESV
Sbjct  280  NSALILTPLC---EESEDTLP-------------DCYTY-RYVL------TAYWTNDESV  316

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++AL + K S + W +C   +PY ++++ S+ YH N S  G+RSLIYNGD D+F+P L  
Sbjct  317  RKALQIHKESKEKWVRCNWGMPYTHDIKSSVPYHMNNSINGYRSLIYNGDHDMFVPFLGT  376

Query  718  EAWTKSLNY  744
            +AW +SLNY
Sbjct  377  QAWIRSLNY  385



>ref|XP_010936154.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=499

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 138/252 (55%), Gaps = 5/252 (2%)
 Frame = +1

Query  1    AEFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNG  180
            ++ + +WLID+PE+ SN LY+GGDSYSG ++P++ Q I+ G+    +   N KGYLVGN 
Sbjct  190  SQVVMQWLIDHPEFLSNPLYIGGDSYSGIVVPVVVQEIAKGDQDGDELLYNLKGYLVGNP  249

Query  181  VTHFSEHDYTY-QFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVN  357
            VT     +  +  +A G GLIS+E    +   C       P   +C   +          
Sbjct  250  VTDEKFDNGAFVPYAHGMGLISDELYESTKKSC-GGEYASPTNEQCASHLQSINKCIEGI  308

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKR-FNGVNAKIYNRYLLCKSDSIAAQY--VNV  528
            N   IL+ VC   +    +++  +   +K    G      +  L C++      Y   + 
Sbjct  309  NTVQILEPVCFFASPKPGIVAAYSRRLLKEDIKGFPLLKADLSLECRTSGYLLSYFWADN  368

Query  529  ESVQEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
            ++V+EAL++ KG++  W++C   LPY +++  S+ +H NL+++G+R+L+Y+GD DL +P 
Sbjct  369  DTVREALNIHKGTVQQWQRCNYGLPYAHDIPSSLKFHLNLTSRGYRALVYSGDHDLLVPF  428

Query  709  LSAEAWTKSLNY  744
            +  +AW +SLN+
Sbjct  429  VGTQAWIRSLNF  440



>gb|ABR16352.1| unknown [Picea sitchensis]
Length=505

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/283 (34%), Positives = 143/283 (51%), Gaps = 42/283 (15%)
 Frame = +1

Query  7    FIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGVT  186
            F+ KW   +PE+ SN +YVGGDSYSG ++P++   I+NGN+A +KP +N KGYLVGNG T
Sbjct  169  FLIKWFEAFPEFLSNPIYVGGDSYSGMVVPLVVHEIANGNEAGIKPTLNLKGYLVGNGGT  228

Query  187  HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNNPA  366
              +  +    FA G GLIS+E  +   + C  N         C  ++L         N A
Sbjct  229  DEAFDNAQVPFAHGKGLISDELYQAVKETC-NNSYLYSTNASCLSNLLAMWKDLIGINTA  287

Query  367  YILDSVCL-INNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCK---------SDSIAAQ  516
            +ILD +C  I+   E L S K     KR+  +  +++++ L  +         + S    
Sbjct  288  HILDPICFPISKKQESLSSQKILT--KRYEKL--EVFDQLLESRRRMSSHGWFTKSSEDG  343

Query  517  YVNVE--------------------------SVQEALHVKKGSID-NWEQCRANLPYNNN  615
            Y+ V+                           V++A+H +   I   W++C     YN +
Sbjct  344  YLTVQLQLGYQDRPCPTVDKYQLSYIWAKNPYVRKAIHAQSEEITGEWKRCTPRFKYNYD  403

Query  616  VRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSAEAWTKSLNY  744
            VR  I YH NL+ KG+R+LIY+GD DL +P +  +AW +SLNY
Sbjct  404  VRSVIEYHRNLTRKGYRALIYSGDHDLIVPFIGTQAWIRSLNY  446



>ref|XP_009784016.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
sylvestris]
Length=474

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 136/259 (53%), Gaps = 16/259 (6%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KW  ++ E+ SN  YV GDSYSG  +P++ Q IS+G +A  KP IN KGY +GN +
Sbjct  161  EFLCKWFNNHQEFISNPFYVSGDSYSGITVPVIVQLISDGIEAGKKPLINLKGYSLGNPL  220

Query  184  THFSEHDYTYQFALGYGLISEEFARKSYDDCITN-PDKKPFFTKCQLDILRFVMLTFVNN  360
            T   E +Y   +  G GLIS+E      + C  +  +  P    C  +   F  L    N
Sbjct  221  TFPEESNYQIPYCHGMGLISDELYESLKETCKGDYQNIDPTNKLCSENFKMFKKLVSRIN  280

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRY--LLCKSDSIAAQ-----Y  519
               IL+  C    G +        +  +R +  +  I  R+   +C+   +A +     +
Sbjct  281  DQQILEPFC----GTDSESPKPHQLSGERRSLEDNLISLRHGDFICRESRVATRKLSNHW  336

Query  520  VNVESVQEALHVKKGSIDN-WEQCRANL---PYNNNVRDSIAYHANLSTKGFRSLIYNGD  687
             N   VQEALHV+KG+I   W +CR ++    Y     +SI YH NLS+KG+RSLIY+GD
Sbjct  337  ANDPRVQEALHVRKGTIRRPWARCRQSIMGTTYTITFMNSIPYHVNLSSKGYRSLIYSGD  396

Query  688  RDLFIPSLSAEAWTKSLNY  744
             D+ IP  S +AW K LNY
Sbjct  397  HDMVIPFQSTQAWIKYLNY  415



>ref|XP_010509542.1| PREDICTED: serine carboxypeptidase-like 9 isoform X1 [Camelina 
sativa]
Length=443

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 133/249 (53%), Gaps = 17/249 (7%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF++KWL  +P++ SN  Y  GDSY+G ++P+L   IS GN     P IN +GY++GN +
Sbjct  152  EFLQKWLSKHPQFISNPFYATGDSYAGMIVPVLVDEISKGNYICCNPPINLQGYVLGNPI  211

Query  184  THFS-EHDYTYQFALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFVN  357
            TH   E DY   F  G  LIS+E  +     C  N  +  P  TKC   +  +   T   
Sbjct  212  THDQVELDYRIPFVHGMSLISDELYQSLKRFCKGNYYNVDPRNTKCLKVVQEYHKCTDKI  271

Query  358  NPAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDSIAAQYVNVESV  537
            N  +IL   C      +D ++    +    F  +  + Y  YL         ++ N ESV
Sbjct  272  NIHHILFPNC------DDTITQN--IAPDCFKRLIMQYYKYYLF-------ERWANKESV  316

Query  538  QEALHVKKGSIDNWEQCRANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPSLSA  717
            ++AL +KKGS   W +    +PY+ N+  S+ YH N S  G+RSLI++GD D+ +PS++ 
Sbjct  317  RKALQIKKGSKVEWVRYNHTIPYDRNIISSVPYHMNNSINGYRSLIFSGDHDMVLPSIAT  376

Query  718  EAWTKSLNY  744
            +AW KSLNY
Sbjct  377  QAWIKSLNY  385



>gb|EEE52047.1| hypothetical protein OsJ_33777 [Oryza sativa Japonica Group]
Length=480

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/261 (34%), Positives = 138/261 (53%), Gaps = 23/261 (9%)
 Frame = +1

Query  1    AEFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGN-  177
             +F+ KW   + E+ SN LYVGG+SY+G L+P L Q IS   +A +KP +N KGYLVGN 
Sbjct  170  TKFVNKWFSQHREFLSNPLYVGGESYAGKLVPFLLQKISEDVEAGVKPVLNLKGYLVGNP  229

Query  178  GVTHFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVN  357
            G     +++    +A G G+IS++      + C       P    C   + RF  L    
Sbjct  230  GTGESIDYESKVPYAHGVGIISDQLYETILEHCGREDYANPKNATCAQALNRFSELMGEV  289

Query  358  NPAYILDSVCLI-----NNG------LEDLLSGKAFVPIKRFNGVNAKIYNRYLLCKSDS  504
            + A+IL   C+      ++G      LE+++ G    P      ++   Y  YL      
Sbjct  290  SEAHILYKKCIYVSPKPDDGTIGRKILEEIVVGNHRPPRPP---MDCSTYPNYL------  340

Query  505  IAAQYVNVESVQEALHVKKGSIDNWEQCRAN-LPYNNNVRDSIAYHANLSTKGFRSLIYN  681
             +  + N  + +E L +KKG++D W +C  + LPY+ ++  SI YH NL+++G+R L+Y+
Sbjct  341  -SYFWANSNNTRENLGIKKGTVDEWVRCHDDGLPYSQDIESSIKYHQNLTSRGYRVLVYS  399

Query  682  GDRDLFIPSLSAEAWTKSLNY  744
            GD D  +P L  +AW +SLNY
Sbjct  400  GDHDSVVPFLGTQAWVRSLNY  420



>ref|XP_010556479.1| PREDICTED: serine carboxypeptidase-like 19 [Tarenaya hassleriana]
Length=456

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 100/257 (39%), Positives = 143/257 (56%), Gaps = 20/257 (8%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            +F+RKWL D+ E+ SN  YVGGDSYSG ++P + Q IS GN   + P IN +GYL+GN +
Sbjct  152  QFLRKWLTDHLEFVSNPFYVGGDSYSGKVVPGVVQQISRGNGKGITPLINLQGYLLGNPL  211

Query  184  THFSEHDYTYQ--FALGYGLISEEFARKSYDDCITNP-DKKPFFTKCQLDILRFVMLTFV  354
            T     DY ++  FA G GLIS+E        C  +  +  P   +C L+ LR    T V
Sbjct  212  TD-DNFDYNHRIPFAHGMGLISDELYESLQRSCGNDYFNMHPSNAEC-LNGLR-AYDTCV  268

Query  355  NN--PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVN----AKIYNRYLLCKSDSIAAQ  516
            ++     IL   C ++  +     G+  +   R N  +    +    RY L      +A 
Sbjct  269  SDIYTEQILLPNCEVDYVMPTRPDGRRELKESRANESSLPPPSCFTYRYFL------SAF  322

Query  517  YVNVESVQEALHVKKGSIDNWEQCRA-NLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRD  693
            + N E+V+ ALHVKKG I  W++C   N+PY  +V  S+ YH N S +GFRSLIY+GD D
Sbjct  323  WANDENVRRALHVKKG-IGKWKRCNTVNIPYTYDVASSVPYHLNNSRQGFRSLIYSGDHD  381

Query  694  LFIPSLSAEAWTKSLNY  744
            L +P ++ EAW + LN+
Sbjct  382  LMVPFMATEAWIRDLNF  398



>ref|XP_010238599.1| PREDICTED: serine carboxypeptidase-like 3 [Brachypodium distachyon]
Length=491

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 138/252 (55%), Gaps = 6/252 (2%)
 Frame = +1

Query  4    EFIRKWLIDYPEYQSNSLYVGGDSYSGTLIPMLAQAISNGNDARLKPAINFKGYLVGNGV  183
            EF+ KW   +P+Y  N  Y+GGDSY+G ++P LAQ IS   +A LKP +N KGYLVGN  
Sbjct  182  EFLTKWFTQHPDYLKNPFYIGGDSYAGKIVPFLAQKISEDIEAGLKPTVNLKGYLVGNPR  241

Query  184  T-HFSEHDYTYQFALGYGLISEEFARKSYDDCITNPDKKPFFTKCQLDILRFVMLTFVNN  360
            T   +++D    F  G+G+IS++      D C       P    C   + RF  L    +
Sbjct  242  TGEPNDYDSRVPFLHGFGVISDQLYETIMDKCQGEDYTYPKNALCAQALDRFNSLRNEIS  301

Query  361  PAYILDSVCLINNGLEDLLSGKAFVPIKRFNGVNAKIYNRYLL-CKS--DSIAAQYVNVE  531
              +IL   C+  +   +  + +  + +K   G+      R  + C+S  + ++  + N  
Sbjct  302  EPHILYKKCVYASDRPNDGTTERKI-LKEETGLMKHPPPRPPMDCQSYVNYLSYFWANNN  360

Query  532  SVQEALHVKKGSIDNWEQCR-ANLPYNNNVRDSIAYHANLSTKGFRSLIYNGDRDLFIPS  708
              ++ L +KKG++D W +C   +LPY  ++  SI YH N+++KG+R+LIY+GD D  +P 
Sbjct  361  ITRKMLGIKKGTMDEWVRCHNGDLPYTEDIGSSIKYHRNITSKGYRALIYSGDHDSVVPF  420

Query  709  LSAEAWTKSLNY  744
            L  ++W +SLN+
Sbjct  421  LGTQSWVRSLNF  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1302315395061