BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14291_g2_i1 len=1091 path=[3020:0-826 1952:827-852 1978:853-1090]

Length=1091
                                                                      Score     E

gb|AEM97804.1|  Ran3A-1                                                 438   2e-151   
emb|CDY06600.1|  BnaC02g13240D                                          439   3e-151   
ref|XP_002285307.2|  PREDICTED: GTP-binding nuclear protein Ran-3...    439   3e-151   Vitis vinifera
ref|XP_002864382.1|  hypothetical protein ARALYDRAFT_918663             437   4e-151   
gb|ACJ83982.1|  unknown                                                 437   6e-151   Medicago truncatula
gb|AEM97821.1|  Ran3C-1                                                 436   8e-151   
ref|XP_008242718.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    436   9e-151   
ref|XP_006281068.1|  hypothetical protein CARUB_v10027091mg             436   1e-150   
ref|NP_200330.1|  GTP-binding nuclear protein Ran-3                     436   1e-150   Arabidopsis thaliana [mouse-ear cress]
sp|P38548.1|RAN_VICFA  RecName: Full=GTP-binding nuclear protein ...    436   1e-150   Vicia faba [broad bean]
ref|XP_007202468.1|  hypothetical protein PRUPE_ppa010188mg             437   1e-150   
ref|XP_003522627.1|  PREDICTED: GTP-binding nuclear protein Ran-3       436   2e-150   
gb|KHN07095.1|  GTP-binding nuclear protein Ran-3                       436   2e-150   
ref|XP_006401481.1|  hypothetical protein EUTSA_v10014614mg             435   2e-150   
gb|EYU29235.1|  hypothetical protein MIMGU_mgv1a013409mg                435   2e-150   
gb|AAM12880.1|AF495716_1  GTP-binding protein                           435   3e-150   Helianthus annuus
ref|XP_006450497.1|  hypothetical protein CICLE_v10009427mg             435   3e-150   
ref|XP_011085069.1|  PREDICTED: GTP-binding nuclear protein Ran1B       435   3e-150   
emb|CDY17309.1|  BnaA10g09430D                                          436   4e-150   
ref|XP_009594669.1|  PREDICTED: GTP-binding nuclear protein Ran-A1      435   4e-150   
ref|XP_007137047.1|  hypothetical protein PHAVU_009G095400g             435   4e-150   
gb|ABM73376.1|  Ran1                                                    434   5e-150   Pisum sativum [garden pea]
emb|CDY20779.1|  BnaA02g09190D                                          436   5e-150   
gb|AAN31865.1|  putative small Ras GTP-binding protein                  434   5e-150   Arabidopsis thaliana [mouse-ear cress]
gb|AFK47968.1|  unknown                                                 434   5e-150   
ref|NP_001265929.1|  GTP-binding nuclear protein Ran-3-like             434   6e-150   
ref|NP_001238082.1|  uncharacterized protein LOC100500437               434   6e-150   
gb|AEK78856.1|  ran                                                     434   7e-150   
ref|XP_003522628.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    434   7e-150   
gb|AFK34515.1|  unknown                                                 434   7e-150   
ref|XP_007137048.1|  hypothetical protein PHAVU_009G095500g             434   7e-150   
ref|XP_007013338.1|  RAN GTPase 3                                       434   7e-150   
ref|XP_004489804.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    434   8e-150   
gb|AGG87098.1|  GTP-binding nuclear protein Ran3B-2                     434   8e-150   
gb|AEK84227.1|  GTP-binding protein                                     434   9e-150   
ref|NP_001289503.1|  RAN, member RAS oncogene family                    434   1e-149   
gb|AFK47313.1|  unknown                                                 433   1e-149   
gb|AEM97824.1|  Ran3D-1                                                 433   1e-149   
ref|XP_007222560.1|  hypothetical protein PRUPE_ppa008371mg             438   1e-149   
gb|EPS73370.1|  hypothetical protein M569_01384                         433   1e-149   
ref|XP_010049961.1|  PREDICTED: GTP-binding nuclear protein Ran1A       433   1e-149   
emb|CDY19907.1|  BnaC09g31730D                                          433   2e-149   
gb|AGS16676.1|  GTP-binding nuclear protein Ran3E                       433   2e-149   
ref|XP_006451004.1|  hypothetical protein CICLE_v10009426mg             433   2e-149   
ref|NP_001274933.1|  GTP-binding nuclear protein Ran2-like              433   2e-149   
gb|EPS73273.1|  hypothetical protein M569_01483                         433   2e-149   
gb|ADK73610.1|  small GTP binding protein                               432   2e-149   
ref|XP_008378301.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    432   3e-149   
ref|XP_010541725.1|  PREDICTED: GTP-binding nuclear protein Ran-3       432   3e-149   
ref|XP_008219897.1|  PREDICTED: GTP-binding nuclear protein Ran-3       432   3e-149   
ref|XP_002284967.1|  PREDICTED: GTP-binding nuclear protein Ran-3       432   3e-149   Vitis vinifera
ref|NP_001234016.1|  GTP-binding nuclear protein Ran1                   432   3e-149   
gb|AGV54526.1|  Ras-like GTP-binding protein                            432   4e-149   
gb|KFK27119.1|  hypothetical protein AALP_AA8G337300                    432   4e-149   
ref|XP_002285018.2|  PREDICTED: GTP-binding nuclear protein Ran-3...    434   4e-149   Vitis vinifera
ref|NP_001234020.1|  GTP-binding nuclear protein Ran2                   432   4e-149   
gb|AGG87101.1|  GTP-binding nuclear protein Ran3D-1                     432   4e-149   
ref|XP_010276399.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    432   4e-149   
ref|XP_008361239.1|  PREDICTED: GTP-binding nuclear protein Ran-3       432   5e-149   
gb|EYU21949.1|  hypothetical protein MIMGU_mgv1a011253mg                434   6e-149   
gb|ACJ86144.1|  unknown                                                 432   6e-149   Medicago truncatula
gb|AEH02864.1|  ran                                                     431   7e-149   
emb|CBI21000.3|  unnamed protein product                                433   7e-149   
gb|KHN08109.1|  GTP-binding nuclear protein Ran-3                       431   8e-149   
ref|XP_003526422.1|  PREDICTED: GTP-binding nuclear protein Ran-3       431   8e-149   
gb|AFK34827.1|  unknown                                                 431   9e-149   
ref|XP_002515555.1|  ran, putative                                      431   9e-149   Ricinus communis
gb|ACJ83916.1|  unknown                                                 431   9e-149   Medicago truncatula
gb|KDP32357.1|  hypothetical protein JCGZ_13282                         431   1e-148   
ref|NP_001235194.1|  uncharacterized protein LOC100305680               431   1e-148   
gb|AFD93401.1|  Ras-like GTP-binding protein 3F-1                       431   1e-148   
gb|AHA44504.1|  GTP-binding nuclear protein Ran3G                       431   1e-148   
ref|XP_004287368.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    431   1e-148   
ref|XP_009788705.1|  PREDICTED: GTP-binding nuclear protein Ran-A1      431   2e-148   
ref|XP_010047786.1|  PREDICTED: GTP-binding nuclear protein Ran1A...    430   3e-148   
emb|CAA66049.1|  atran3                                                 430   3e-148   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41562.1|  unknown                                                 430   3e-148   
ref|XP_009120041.1|  PREDICTED: GTP-binding nuclear protein Ran-3       430   3e-148   
ref|XP_008465002.1|  PREDICTED: GTP-binding nuclear protein Ran-3       430   3e-148   
ref|XP_011019766.1|  PREDICTED: GTP-binding nuclear protein Ran-3       430   4e-148   
ref|XP_008465000.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    429   6e-148   
sp|P41919.1|RANB1_TOBAC  RecName: Full=GTP-binding nuclear protei...    429   9e-148   Nicotiana tabacum [American tobacco]
ref|XP_002309606.1|  RAN1B family protein                               429   9e-148   Populus trichocarpa [western balsam poplar]
dbj|BAP11912.1|  Ran-GTPase                                             429   9e-148   
gb|AAB97312.1|  salt stress inducible small GTP binding protein R...    428   1e-147   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26249.1|  hypothetical protein AALP_AA8G222500                    428   1e-147   
ref|XP_008465001.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    429   1e-147   
gb|ABK94282.1|  unknown                                                 428   1e-147   Populus trichocarpa [western balsam poplar]
ref|XP_002871916.1|  hypothetical protein ARALYDRAFT_910039             428   1e-147   
ref|XP_002308648.1|  RAN1B family protein                               428   1e-147   Populus trichocarpa [western balsam poplar]
ref|NP_197501.1|  GTP-binding nuclear protein Ran-1                     428   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150009.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    428   2e-147   
emb|CDX70904.1|  BnaC03g09880D                                          428   3e-147   
emb|CDY69655.1|  BnaA03g56000D                                          427   3e-147   
ref|XP_009126410.1|  PREDICTED: GTP-binding nuclear protein Ran-2...    427   4e-147   
dbj|BAG16529.1|  putative Ran/TC4 protein                               427   6e-147   Capsicum chinense [bonnet pepper]
ref|XP_009131764.1|  PREDICTED: GTP-binding nuclear protein Ran-2       426   6e-147   
ref|XP_010670693.1|  PREDICTED: GTP-binding nuclear protein Ran-3       426   8e-147   
emb|CDP03407.1|  unnamed protein product                                427   8e-147   
ref|XP_004171598.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    426   1e-146   
gb|ABD17866.1|  etiolation seedling like-RAN2 small Ras GTP-bindi...    426   2e-146   Brassica napus [oilseed rape]
ref|XP_011019767.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    425   2e-146   
ref|XP_002324281.1|  GTP-binding family protein                         425   2e-146   Populus trichocarpa [western balsam poplar]
ref|XP_011026487.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    422   2e-145   
ref|XP_004293011.1|  PREDICTED: uncharacterized protein LOC101304165    432   4e-145   
ref|XP_008385896.1|  PREDICTED: GTP-binding nuclear protein Ran-3       422   5e-145   
ref|XP_009405078.1|  PREDICTED: GTP-binding nuclear protein Ran1B...    421   7e-145   
ref|XP_004138736.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    420   2e-144   
ref|XP_007223953.1|  hypothetical protein PRUPE_ppa011168mg             420   2e-144   
ref|XP_009381923.1|  PREDICTED: GTP-binding nuclear protein Ran1B...    419   3e-144   
emb|CDY42324.1|  BnaC02g09300D                                          437   3e-144   
ref|XP_010535882.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    419   3e-144   
ref|XP_010914929.1|  PREDICTED: GTP-binding nuclear protein Ran1B...    419   5e-144   
gb|AHA44507.1|  GTP-binding nuclear protein Ran3E                       419   5e-144   
emb|CDY44958.1|  BnaA02g04630D                                          437   7e-144   
ref|XP_002284971.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    419   8e-144   Vitis vinifera
ref|XP_008775035.1|  PREDICTED: GTP-binding nuclear protein Ran1B       418   1e-143   
ref|XP_009401746.1|  PREDICTED: GTP-binding nuclear protein Ran1B...    418   1e-143   
emb|CDX88865.1|  BnaA03g07840D                                          433   2e-143   
ref|XP_003603437.1|  GTP-binding nuclear protein Ran-A1                 437   3e-143   
gb|ACX81221.1|  Ras-related GTP binding protein                         417   3e-143   Lepidium latifolium
emb|CBI21001.3|  unnamed protein product                                420   4e-143   
ref|XP_010918773.1|  PREDICTED: GTP-binding nuclear protein Ran1B       416   6e-143   
gb|AFD93402.1|  Ras-like GTP-binding protein 3G-1                       416   9e-143   
emb|CDP04794.1|  unnamed protein product                                416   1e-142   
gb|AEM97826.1|  Ran3E-1                                                 415   2e-142   
ref|XP_008792100.1|  PREDICTED: GTP-binding nuclear protein Ran1B...    415   2e-142   
ref|XP_006288511.1|  hypothetical protein CARUB_v10001782mg             416   2e-142   
ref|XP_008775034.1|  PREDICTED: GTP-binding nuclear protein Ran-A1      415   3e-142   
ref|XP_010918870.1|  PREDICTED: GTP-binding nuclear protein Ran-A...    416   3e-142   
gb|KDO61662.1|  hypothetical protein CISIN_1g027607mg                   414   3e-142   
ref|XP_004969141.1|  PREDICTED: GTP-binding nuclear protein Ran-1...    414   3e-142   
gb|ABD17865.1|  putative RAN2 small Ras GTP-binding nuclear protein     414   5e-142   Allium sativum
ref|XP_010925148.1|  PREDICTED: GTP-binding nuclear protein Ran-A1      414   5e-142   
ref|XP_009403004.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    414   5e-142   
ref|NP_197502.1|  GTP-binding nuclear protein Ran-2                     414   6e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010098985.1|  GTP-binding nuclear protein Ran-3                  417   8e-142   
gb|ADK70386.2|  Ran3B                                                   413   1e-141   
gb|AHA44505.1|  GTP-binding nuclear protein Ran3A                       412   1e-141   
ref|XP_006400567.1|  hypothetical protein EUTSA_v10014622mg             413   2e-141   
ref|XP_006827532.1|  hypothetical protein AMTR_s00009p00207870          412   2e-141   
emb|CAA66048.1|  atran2                                                 412   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154954.1|  hypothetical protein PHAVU_003G161100g             412   4e-141   
gb|ABD17864.1|  putative RAN2 small Ras GTP-binding nuclear protein     412   5e-141   Allium cepa
ref|XP_001757701.1|  ran-family small GTPase                            412   5e-141   
gb|AFK47539.1|  unknown                                                 410   8e-141   
ref|XP_008367713.1|  PREDICTED: GTP-binding nuclear protein Ran1-...    410   1e-140   
gb|AFK40430.1|  unknown                                                 411   1e-140   
ref|NP_001043550.1|  Os01g0611100                                       410   2e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001760725.1|  ran-family small GTPase                            409   5e-140   
ref|XP_011072255.1|  PREDICTED: GTP-binding nuclear protein Ran2-...    408   1e-139   
gb|AHA44506.1|  GTP-binding nuclear protein Ran3F                       407   1e-139   
sp|P54765.1|RAN1A_LOTJA  RecName: Full=GTP-binding nuclear protei...    407   1e-139   Lotus japonicus
ref|XP_009399763.1|  PREDICTED: GTP-binding nuclear protein Ran-2...    407   2e-139   
dbj|BAP11913.1|  Ran-GTPase                                             407   2e-139   
ref|NP_001240919.1|  uncharacterized protein LOC100775298               407   2e-139   
sp|P54766.1|RAN1B_LOTJA  RecName: Full=GTP-binding nuclear protei...    406   4e-139   Lotus japonicus
ref|XP_002972496.1|  RAN, ras family GTPase                             407   4e-139   
ref|XP_004969312.1|  PREDICTED: GTP-binding nuclear protein Ran-2...    406   6e-139   
ref|XP_009403002.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    406   8e-139   
ref|XP_006841900.1|  hypothetical protein AMTR_s00042p00113180          405   1e-138   
gb|KHN27403.1|  GTP-binding nuclear protein Ran-1                       408   1e-138   
gb|EAZ12660.1|  hypothetical protein OsJ_02575                          413   2e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002455940.1|  hypothetical protein SORBIDRAFT_03g027660          405   2e-138   Sorghum bicolor [broomcorn]
gb|AFW83430.1|  ran GTP binding protein                                 405   2e-138   
ref|XP_008219916.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    404   3e-138   
ref|XP_010688087.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    404   4e-138   
gb|AFW83428.1|  hypothetical protein ZEAMMB73_449857                    403   1e-137   
ref|NP_001131881.1|  GTP-binding nuclear protein Ran-A1                 402   2e-137   Zea mays [maize]
ref|NP_001149221.1|  LOC100282843                                       402   2e-137   Zea mays [maize]
gb|EAY74933.1|  hypothetical protein OsI_02827                          410   3e-137   Oryza sativa Indica Group [Indian rice]
gb|ACM68936.1|  Ran-related GTP-binding protein                         402   3e-137   Festuca arundinacea [tall fescue]
ref|NP_001056390.1|  Os05g0574500                                       401   6e-137   Oryza sativa Japonica Group [Japonica rice]
gb|ABK23073.1|  unknown                                                 401   8e-137   Picea sitchensis
ref|XP_003566871.1|  PREDICTED: GTP-binding nuclear protein Ran-1...    403   8e-137   
ref|XP_001779455.1|  ran-family small GTPase                            400   1e-136   
ref|XP_003567845.1|  PREDICTED: GTP-binding nuclear protein Ran-2       400   1e-136   
gb|AFW79277.1|  hypothetical protein ZEAMMB73_453609                    400   1e-136   
ref|XP_001760763.1|  predicted protein                                  402   2e-136   
gb|AAL30396.1|AF433653_1  small Ras-related GTP-binding protein         400   2e-136   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005846369.1|  GTP-binding protein                                400   2e-136   
ref|XP_009345292.1|  PREDICTED: GTP-binding nuclear protein Ran1A...    399   6e-136   
gb|ABK27124.1|  unknown                                                 395   1e-134   Picea sitchensis
gb|KCW79960.1|  hypothetical protein EUGRSUZ_C01289                     397   2e-133   
gb|ACN40664.1|  unknown                                                 392   3e-133   Picea sitchensis
ref|XP_009334775.1|  PREDICTED: GTP-binding nuclear protein Ran1A...    391   5e-133   
gb|KFM25438.1|  GTP-binding nuclear protein Ran-A1                      391   5e-133   
ref|XP_006844506.1|  hypothetical protein AMTR_s00016p00135360          391   5e-133   
gb|ABK21426.1|  unknown                                                 391   7e-133   Picea sitchensis
ref|XP_001753774.1|  predicted protein                                  390   8e-133   
gb|AEZ49163.1|  Ran                                                     389   2e-132   
ref|XP_001753663.1|  predicted protein                                  389   4e-132   
ref|XP_001691878.1|  ran-like small GTPase                              387   2e-131   Chlamydomonas reinhardtii
gb|ACN40090.1|  unknown                                                 387   2e-131   Picea sitchensis
gb|KCW79961.1|  hypothetical protein EUGRSUZ_C01291                     393   6e-131   
ref|XP_008657795.1|  PREDICTED: GTP-binding nuclear protein Ran1B...    387   2e-130   
gb|ACN39828.1|  unknown                                                 384   3e-130   Picea sitchensis
ref|XP_010042010.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    388   4e-130   
ref|XP_010047934.1|  PREDICTED: GTP-binding nuclear protein Ran-2...    382   1e-129   
gb|AED99252.1|  small Ras GTP-binding nuclear protein                   379   7e-129   
gb|KFK27116.1|  hypothetical protein AALP_AA8G336700                    380   8e-129   
ref|XP_004965963.1|  PREDICTED: GTP-binding nuclear protein Ran-3...    376   5e-127   
gb|AAA32852.1|  small ras-related protein                               374   1e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16632.1|  hypothetical protein SHCRBa_265_I24_F_300               375   2e-126   
ref|XP_010110340.1|  GTP-binding nuclear protein                        385   2e-125   
ref|NP_001174885.1|  Os06g0600301                                       372   2e-125   
ref|XP_002437238.1|  hypothetical protein SORBIDRAFT_10g023370          372   3e-125   Sorghum bicolor [broomcorn]
ref|XP_002503301.1|  predicted protein                                  369   2e-124   Micromonas commoda
gb|EMT14575.1|  GTP-binding nuclear protein Ran-3                       369   4e-124   
ref|XP_005651398.1|  ran-like small GTPase                              368   5e-124   
ref|XP_010227550.1|  PREDICTED: GTP-binding nuclear protein Ran-3       368   5e-124   
ref|XP_001421080.1|  predicted protein                                  368   5e-124   Ostreococcus lucimarinus CCE9901
ref|XP_002957219.1|  hypothetical protein VOLCADRAFT_110055             368   5e-124   
dbj|BAJ84849.1|  predicted protein                                      368   8e-124   
gb|AFY06646.1|  GTP-binding nuclear protein                             366   1e-123   
gb|EMS58389.1|  GTP-binding nuclear protein Ran-3                       367   2e-123   
gb|KDO80348.1|  hypothetical protein CISIN_1g027593mg                   365   2e-123   
gb|KDO80349.1|  hypothetical protein CISIN_1g027593mg                   364   4e-123   
gb|AGG87096.1|  GTP-binding nuclear protein Ran3A-1a                    363   1e-122   
ref|XP_003082592.1|  GTP-binding protein (ISS)                          364   1e-122   
gb|ACN26424.1|  unknown                                                 362   3e-122   Zea mays [maize]
ref|XP_007508454.1|  unknown                                            363   3e-122   
ref|XP_009401754.1|  PREDICTED: GTP-binding nuclear protein Ran-B...    363   3e-122   
gb|AFW83431.1|  hypothetical protein ZEAMMB73_449857                    362   4e-122   
gb|AFW83228.1|  hypothetical protein ZEAMMB73_460490                    366   8e-122   
ref|XP_003058435.1|  predicted protein                                  362   1e-121   
gb|AFD93408.1|  Ras-like GTP-binding protein 2                          358   1e-120   
gb|KDD75079.1|  Ras family protein                                      357   8e-120   
gb|ABA81874.1|  unknown                                                 353   1e-118   Solanum tuberosum [potatoes]
gb|AAQ54569.1|  small Ras-like GTP-binding protein                      352   4e-118   Malus domestica [apple tree]
ref|XP_010050575.1|  PREDICTED: uncharacterized protein LOC104439165    380   2e-117   
emb|CEF66797.1|  GTP-binding nuclear protein Ran                        350   7e-117   
ref|XP_003669824.1|  hypothetical protein NDAI_0D02670                  348   3e-116   
gb|AES91444.2|  GTP-binding nuclear protein Ran1                        348   3e-116   
ref|XP_001900408.1|  GTP-binding nuclear protein RAN/TC4                348   5e-116   Brugia malayi [agent of lymphatic filariasis]
ref|XP_011105561.1|  gsp2p                                              347   7e-116   
gb|EHN00139.1|  Gsp2p                                                   347   1e-115   
ref|NP_014828.1|  Ran GTPase GSP2                                       347   1e-115   Saccharomyces cerevisiae S288C
ref|XP_009033865.1|  GTP-binding nuclear protein Ran                    346   2e-115   
ref|XP_009020347.1|  hypothetical protein HELRODRAFT_185702             346   2e-115   
emb|CDS07831.1|  Putative GTP-binding nuclear protein GSP1/Ran          346   3e-115   
gb|EHN04400.1|  Gsp2p                                                   346   3e-115   
gb|EME46530.1|  hypothetical protein DOTSEDRAFT_70514                   346   3e-115   
emb|CDH48891.1|  gtp-binding nuclear protein gsp1 ran                   348   3e-115   
gb|KDO80343.1|  hypothetical protein CISIN_1g027593mg                   344   5e-115   
gb|EPB90743.1|  GTP-binding nuclear protein GSP1/Ran                    345   6e-115   
ref|XP_007926326.1|  hypothetical protein MYCFIDRAFT_87708              345   9e-115   
emb|CDH50668.1|  gtp-binding nuclear protein gsp1 ran                   345   9e-115   
gb|AAR08135.1|  small GTPase RanA                                       344   1e-114   Aspergillus nidulans
ref|XP_007374607.1|  hypothetical protein SPAPADRAFT_60402              344   1e-114   
ref|XP_003676884.1|  hypothetical protein NCAS_0F00440                  344   1e-114   
gb|EGA76700.1|  Gsp2p                                                   344   1e-114   
gb|ERG80224.1|  gtp-binding nuclear protein ran                         344   2e-114   
ref|XP_007673479.1|  hypothetical protein BAUCODRAFT_30924              344   2e-114   
gb|KHN79624.1|  GTP-binding nuclear protein Ran                         343   2e-114   
gb|EIE90817.1|  GTP-binding nuclear protein GSP1/CNR1                   343   2e-114   
ref|XP_006685881.1|  ras-domain-containing protein                      343   3e-114   
emb|CDK27866.1|  unnamed protein product                                343   3e-114   
gb|ESW96142.1|  GTP-binding nuclear protein GSP1/Ran                    343   4e-114   
gb|EIF49391.1|  gtp-binding nuclear protein gsp1 ran                    343   5e-114   
gb|EGD93397.1|  GTP-binding protein                                     343   5e-114   
ref|XP_711509.1|  RAN-like GTP binding protein                          342   5e-114   Candida albicans SC5314
ref|XP_006679661.1|  hypothetical protein BATDEDRAFT_89133              342   6e-114   
ref|XP_002618167.1|  GTP-binding nuclear protein GSP1/Ran               342   6e-114   Clavispora lusitaniae ATCC 42720
emb|CDS11656.1|  Putative GTP-binding nuclear protein GSP1/Ran          342   7e-114   
ref|XP_003867735.1|  Gsp1 RAN G-protein                                 342   7e-114   
ref|XP_001527056.1|  GTP-binding nuclear protein GSP1/Ran               342   8e-114   Lodderomyces elongisporus NRRL YB-4239
gb|EUB60932.1|  GTP-binding nuclear protein Ran                         342   8e-114   
ref|XP_003018551.1|  RAN small monomeric GTPase (Ran), putative         342   9e-114   
gb|KGU32723.1|  GTP-binding nuclear protein GSP1/Ran                    342   1e-113   
ref|XP_003014241.1|  RAN small monomeric GTPase (Ran), putative         342   1e-113   
ref|XP_460450.1|  DEHA2F01980p                                          342   1e-113   Debaryomyces hansenii CBS767
ref|XP_007588874.1|  putative gtp-binding nuclear protein gsp1 ra...    341   2e-113   
ref|XP_002866070.1|  predicted protein                                  340   2e-113   
emb|CEG68165.1|  Putative GTP-binding nuclear protein GSP1/Ran          341   2e-113   
ref|XP_002847673.1|  GTP-binding nuclear protein RAN/TC4                341   2e-113   Microsporum canis CBS 113480
ref|XP_002145774.1|  GTP-binding nuclear protein Ran, putative          341   2e-113   Talaromyces marneffei ATCC 18224
gb|EMF14116.1|  GTP-binding nuclear protein Ran                         341   2e-113   
ref|XP_001239221.1|  GTP-binding nuclear protein GSP1/Ran               341   2e-113   Coccidioides immitis RS
ref|NP_499369.1|  Protein RAN-1                                         341   3e-113   
ref|XP_004203532.1|  Piso0_001143                                       340   3e-113   
gb|KEQ93351.1|  hypothetical protein AUEXF2481DRAFT_42078               340   3e-113   
gb|EIE91915.1|  GTP-binding nuclear protein GSP1/Ran                    340   4e-113   
gb|EFX77046.1|  hypothetical protein DAPPUDRAFT_305970                  340   4e-113   
ref|XP_003176253.1|  GTP-binding nuclear protein GSP1/Ran               340   4e-113   
emb|CAE55862.1|  GTP-binding nuclear protein RAN1                       340   5e-113   
gb|AAF78478.1|AF190700_1  small G-protein Gsp1p                         340   5e-113   
gb|KFM80570.1|  hypothetical protein X975_17880                         340   7e-113   
gb|EWM30455.1|  gtp-binding nuclear protein ran                         340   7e-113   
gb|ABP87598.2|  small GTPase                                            340   7e-113   
ref|NP_986960.1|  AGR294Cp                                              339   8e-113   
ref|XP_007754473.1|  GTP-binding nuclear protein GSP1/Ran               339   9e-113   
gb|ABV57373.1|  Ran3 GTP binding protein                                337   9e-113   
ref|XP_005191937.1|  PREDICTED: GTP-binding nuclear protein Ran-like    339   9e-113   
gb|ENN79160.1|  hypothetical protein YQE_04346                          339   1e-112   
ref|XP_002057149.1|  GJ16931                                            339   1e-112   
ref|XP_002543970.1|  GTP-binding nuclear protein GSP1/Ran               339   1e-112   
ref|XP_003699274.1|  PREDICTED: GTP-binding nuclear protein Ran-like    339   1e-112   
ref|XP_002497073.1|  ZYRO0D14784p                                       339   1e-112   
gb|KGB40070.1|  GTP-binding nuclear protein Ran                         339   1e-112   
ref|XP_001486608.1|  GTP-binding nuclear protein GSP1/Ran               339   1e-112   
emb|CCD74880.1|  putative ran                                           338   2e-112   
ref|XP_001659895.1|  ran                                                338   2e-112   
emb|CDH17545.1|  GTP-binding nuclear protein GSP1/Ran                   338   2e-112   
ref|XP_003489712.1|  PREDICTED: GTP-binding nuclear protein Ran-like    338   2e-112   
ref|XP_003856113.1|  hypothetical protein MYCGRDRAFT_98343              338   2e-112   
ref|XP_393761.1|  PREDICTED: GTP-binding nuclear protein Ran isof...    338   2e-112   
ref|XP_007749224.1|  GTP-binding nuclear protein GSP1/Ran               338   2e-112   
ref|XP_002009354.1|  GI15278                                            338   3e-112   
emb|CDR42379.1|  CYFA0S09e02344g1_1                                     338   3e-112   
ref|NP_651969.1|  Ran, isoform A                                        338   3e-112   
ref|XP_002100902.1|  ran                                                338   3e-112   
ref|XP_005093961.1|  PREDICTED: GTP-binding nuclear protein Ran-l...    339   4e-112   
ref|XP_001992095.1|  GH24573                                            338   4e-112   
ref|XP_002612124.1|  hypothetical protein BRAFLDRAFT_282949             338   4e-112   
ref|XP_003841312.1|  similar to GTP-binding nuclear protein Ran         338   4e-112   
ref|XP_002555678.1|  KLTH0G14850p                                       338   4e-112   
ref|XP_008545563.1|  PREDICTED: GTP-binding nuclear protein Ran         338   4e-112   
gb|EFN84506.1|  GTP-binding nuclear protein Ran                         338   4e-112   
emb|CDF89786.1|  ZYBA0S05-01684g1_1                                     338   4e-112   
ref|XP_008484260.1|  PREDICTED: GTP-binding nuclear protein Ran         338   4e-112   
ref|XP_005093963.1|  PREDICTED: GTP-binding nuclear protein Ran-l...    338   4e-112   
ref|XP_001963419.1|  GF20389                                            338   5e-112   
ref|XP_663086.1|  RAN_BRUMA GTP-binding nuclear protein RAN/TC4         338   5e-112   
emb|CCG82703.1|  Ran GTPase Spi1                                        337   5e-112   
ref|XP_003385856.1|  PREDICTED: GTP-binding nuclear protein Ran-like    337   5e-112   
ref|XP_003425684.1|  PREDICTED: GTP-binding nuclear protein Ran         337   5e-112   
ref|XP_007723285.1|  GTP-binding nuclear protein GSP1/Ran               337   6e-112   
ref|XP_006219977.1|  PREDICTED: GTP-binding nuclear protein ran-1...    337   6e-112   
emb|CCK70980.1|  hypothetical protein KNAG_0F03180                      340   6e-112   
ref|XP_007729558.1|  GTP-binding nuclear protein GSP1/Ran               337   6e-112   
ref|XP_001977160.1|  GG18876                                            337   7e-112   
ref|XP_009160843.1|  GTP-binding nuclear protein GSP1/Ran               337   7e-112   
ref|XP_001819633.1|  GTP-binding nuclear protein GSP1/Ran               337   7e-112   
ref|XP_001354693.1|  GA12719                                            337   7e-112   
gb|KDN38633.1|  gtp-binding nuclear protein gsp1 ran                    337   7e-112   
ref|XP_004536145.1|  PREDICTED: GTP-binding nuclear protein Ran-like    337   9e-112   
ref|XP_786730.1|  PREDICTED: GTP-binding nuclear protein Ran-like       337   9e-112   
ref|XP_011056738.1|  PREDICTED: GTP-binding nuclear protein Ran         337   1e-111   
ref|XP_003693258.1|  PREDICTED: LOW QUALITY PROTEIN: GTP-binding ...    337   1e-111   
ref|XP_003296111.1|  hypothetical protein PTT_04918                     337   1e-111   
ref|XP_008020699.1|  hypothetical protein SETTUDRAFT_162231             337   1e-111   
gb|EMS23625.1|  GTP-binding nuclear protein Ran                         337   1e-111   
gb|AFX00006.1|  GTP-binding nuclear protein Ran                         337   1e-111   
ref|XP_008418548.1|  PREDICTED: GTP-binding nuclear protein Ran i...    337   1e-111   
gb|ACO12691.1|  GTP-binding nuclear protein Ran                         337   2e-111   
ref|XP_010778616.1|  PREDICTED: GTP-binding nuclear protein Ran         336   2e-111   
emb|CEJ90752.1|  Putative GTP-binding nuclear protein GSP1/Ran          336   2e-111   
gb|ETN76154.1|  Ras family protein                                      336   2e-111   
gb|AEO23963.1|  Ran protein                                             337   2e-111   
ref|XP_009494478.1|  GTP-binding nuclear protein GSP2/CNR2              336   2e-111   
gb|EFZ10904.1|  hypothetical protein SINV_05802                         337   2e-111   
emb|CBY09463.1|  unnamed protein product                                336   2e-111   
ref|XP_966512.1|  PREDICTED: GTP-binding nuclear protein Ran            336   2e-111   
ref|XP_002414923.1|  GTP-binding nuclear protein RAN1, putative         336   3e-111   
ref|XP_007782497.1|  GTP-binding nuclear protein GSP1/Ran               335   3e-111   
ref|XP_751206.1|  GTP-binding nuclear protein Ran                       335   3e-111   
gb|AEE61624.1|  unknown                                                 335   3e-111   
ref|XP_003398765.1|  PREDICTED: LOW QUALITY PROTEIN: GTP-binding ...    337   3e-111   
ref|XP_005809856.1|  PREDICTED: GTP-binding nuclear protein Ran-like    335   3e-111   
ref|XP_001393114.1|  GTP-binding nuclear protein GSP1/Ran               335   3e-111   
ref|XP_004180677.1|  hypothetical protein TBLA_0E00980                  335   3e-111   
ref|XP_008281841.1|  PREDICTED: GTP-binding nuclear protein Ran         335   3e-111   
gb|AFW98987.1|  Ras-like nuclear protein                                335   3e-111   
emb|CDJ97846.1|  Ras domain containing protein                          335   4e-111   
ref|XP_564524.3|  AGAP007699-PC                                         335   4e-111   
gb|ACO10058.1|  GTP-binding nuclear protein Ran                         335   4e-111   
ref|XP_009173683.1|  hypothetical protein T265_14821                    336   4e-111   
emb|CCA70981.1|  probable GSP1-GTP-binding protein of the ras sup...    335   4e-111   
ref|XP_003444628.1|  PREDICTED: GTP-binding nuclear protein Ran-l...    335   4e-111   
ref|XP_005467653.1|  PREDICTED: GTP-binding nuclear protein Ran-l...    337   4e-111   
gb|KFB36611.1|  AGAP007699-PC-like protein                              335   5e-111   
emb|CBY24032.1|  unnamed protein product                                335   5e-111   
ref|XP_003955051.1|  hypothetical protein KAFR_0A04800                  335   5e-111   
gb|EPS33172.1|  hypothetical protein PDE_08134                          335   5e-111   
emb|CCX04669.1|  Similar to GTP-binding nuclear protein GSP1/Ran;...    335   5e-111   
gb|EJK76514.1|  hypothetical protein THAOC_01718                        336   6e-111   
gb|ACO15129.1|  GTP-binding nuclear protein Ran                         335   6e-111   
gb|ELT90460.1|  hypothetical protein CAPTEDRAFT_21290                   335   6e-111   
sp|P38544.1|RAN_ONCVO  RecName: Full=GTP-binding nuclear protein ...    335   6e-111   
gb|KDR15447.1|  GTP-binding nuclear protein Ran                         335   7e-111   
ref|XP_003656705.1|  hypothetical protein THITE_2121725                 334   8e-111   
ref|XP_007002497.1|  hypothetical protein TREMEDRAFT_37881              334   9e-111   
ref|NP_596827.1|  Ran GTPase Spi1                                       334   1e-110   
gb|ABD65418.1|  Ran                                                     334   1e-110   
ref|NP_001040274.1|  GTP-binding nuclear protein Ran                    334   1e-110   
ref|XP_007906018.1|  PREDICTED: GTP-binding nuclear protein Ran         334   1e-110   
gb|KEF56941.1|  GTP-binding nuclear protein GSP1/Ran                    334   1e-110   
ref|XP_002564170.1|  Pc22g01260                                         334   1e-110   
gb|EKV07014.1|  GTP-binding nuclear protein GSP1/Ran                    334   1e-110   
ref|XP_002166677.1|  PREDICTED: GTP-binding nuclear protein Ran-like    334   1e-110   
gb|AEM37772.1|  GTP-binding nuclear protein                             334   1e-110   
ref|XP_002172700.1|  ran GTPase Spi1                                    333   2e-110   
ref|XP_007692049.1|  hypothetical protein COCMIDRAFT_8859               334   2e-110   
ref|XP_007804350.1|  GTP-binding nuclear protein GSP1/Ran               333   2e-110   
emb|CCO28084.1|  GTP-binding nuclear protein spi1                       334   2e-110   
ref|XP_010752254.1|  PREDICTED: GTP-binding nuclear protein Ran i...    333   2e-110   
gb|ABM55641.1|  putative GTP-binding nuclear protein Ran                333   2e-110   
emb|CBY17542.1|  GTP binding/GTPase/protein binding protein             331   2e-110   
ref|XP_003687674.1|  hypothetical protein TPHA_0K01060                  333   2e-110   
pdb|1BYU|A  Chain A, Canine Gdp-Ran                                     333   2e-110   
ref|XP_004333668.1|  ran, putative                                      333   2e-110   
ref|XP_004073279.1|  PREDICTED: GTP-binding nuclear protein Ran-l...    333   2e-110   
gb|AEB00693.1|  Ras-like nuclear protein                                333   2e-110   
gb|EPX73348.1|  ran GTPase Spi1                                         333   3e-110   
ref|XP_001984002.1|  GH16204                                            333   3e-110   
ref|XP_008864262.1|  GTP-binding nuclear protein Ran                    333   3e-110   
gb|ACQ58502.1|  GTP-binding nuclear protein Ran                         333   3e-110   
ref|XP_002491356.1|  GTP binding protein (mammalian Ranp homolog)       333   4e-110   
gb|AEH41460.1|  GTP-binding nuclear protein Ran                         333   4e-110   
dbj|BAN20580.1|  ran                                                    332   4e-110   
ref|XP_007324724.1|  hypothetical protein SERLADRAFT_481041             332   4e-110   
gb|KEQ58407.1|  ras-domain-containing protein                           333   4e-110   
ref|XP_001749950.1|  hypothetical protein                               332   5e-110   
ref|XP_006956040.1|  GTP-binding nuclear protein GSP1/Ran               332   5e-110   
ref|XP_002287767.1|  ran-type small G protein                           332   5e-110   
ref|XP_005093962.1|  PREDICTED: GTP-binding nuclear protein Ran-l...    333   5e-110   
ref|XP_009839249.1|  GTP-binding nuclear protein Ran                    332   6e-110   
gb|EHN05639.1|  Gsp1p                                                   332   6e-110   
gb|ACN67046.1|  GTP-binding nuclear protein ran                         332   7e-110   
ref|XP_001643721.1|  hypothetical protein Kpol_1009p9                   332   8e-110   
ref|NP_001290304.1|  RAN, member RAS oncogene family                    332   8e-110   
gb|AAY85369.1|  GTP-binding protein                                     332   8e-110   
ref|XP_006640309.1|  PREDICTED: GTP-binding nuclear protein Ran-like    332   8e-110   
ref|XP_447279.1|  hypothetical protein                                  332   8e-110   
ref|XP_001912951.1|  hypothetical protein                               332   8e-110   
ref|XP_008036099.1|  GTP-binding nuclear protein RAN                    332   9e-110   
gb|EHJ65779.1|  GTP-binding nuclear protein ran                         332   9e-110   
ref|XP_003738953.1|  PREDICTED: GTP-binding nuclear protein Ran-like    332   9e-110   
ref|XP_009350962.1|  PREDICTED: GTP-binding nuclear protein Ran         332   9e-110   
ref|XP_003658742.1|  hypothetical protein MYCTH_2141486                 332   9e-110   
ref|NP_001080182.1|  GTP-binding nuclear protein Ran                    332   9e-110   
ref|NP_013396.1|  Ran GTPase GSP1                                       332   1e-109   
ref|XP_001629438.1|  predicted protein                                  332   1e-109   
ref|XP_008325258.1|  PREDICTED: GTP-binding nuclear protein Ran         332   1e-109   
gb|ABB85359.1|  Ran                                                     332   1e-109   
ref|XP_003970318.1|  PREDICTED: GTP-binding nuclear protein Ran-like    331   1e-109   
dbj|BAL46013.1|  Ras-related nuclear protein                            332   1e-109   
gb|KFQ31435.1|  GTP-binding nuclear protein Ran                         331   1e-109   
dbj|GAA98713.1|  hypothetical protein E5Q_05401                         331   2e-109   
ref|NP_001128547.1|  RAN, member RAS oncogene family                    331   2e-109   
gb|EKC36560.1|  GTP-binding nuclear protein Ran                         331   2e-109   
ref|XP_005706158.1|  GTP-binding nuclear protein Ran                    331   2e-109   
emb|CAJ83878.1|  RAN, member RAS oncogene family                        331   2e-109   
gb|KFP34669.1|  GTP-binding nuclear protein Ran                         331   2e-109   
pdb|1RRP|A  Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex         330   2e-109   
gb|KFV63350.1|  GTP-binding nuclear protein Ran                         331   2e-109   
gb|KFM04213.1|  GTP-binding nuclear protein Ran                         331   2e-109   
gb|ELR59628.1|  GTP-binding nuclear protein Ran                         331   2e-109   
ref|XP_003817895.1|  PREDICTED: GTP-binding nuclear protein Ran         332   2e-109   
ref|XP_002115034.1|  conserved hypothetical protein                     331   2e-109   
ref|NP_990589.1|  GTP-binding nuclear protein Ran                       331   2e-109   
emb|CBJ27657.1|  RAN, Ras superfamily GTPase                            330   2e-109   
ref|XP_010114644.1|  PREDICTED: GTP-binding nuclear protein Ran         331   2e-109   
ref|XP_009909323.1|  PREDICTED: GTP-binding nuclear protein Ran         331   2e-109   
gb|AAY96645.1|  Ras-related nuclear protein                             330   3e-109   
ref|XP_002835892.1|  hypothetical protein                               330   3e-109   
ref|XP_006821108.1|  PREDICTED: uncharacterized protein LOC100374136    339   3e-109   
gb|AAP36765.1|  Homo sapiens RAN, member RAS oncogene family            330   3e-109   
gb|KDQ33492.1|  hypothetical protein PLEOSDRAFT_1061152                 330   3e-109   
ref|XP_007090110.1|  PREDICTED: GTP-binding nuclear protein Ran         330   3e-109   
gb|ACO14942.1|  GTP-binding nuclear protein Ran                         330   3e-109   
gb|AAH72000.1|  RAN, member RAS oncogene family                         330   3e-109   
ref|XP_007426723.1|  PREDICTED: GTP-binding nuclear protein Ran         330   3e-109   
ref|NP_006316.1|  GTP-binding nuclear protein Ran isoform 1             330   3e-109   
gb|KEQ85110.1|  ras-domain-containing protein                           331   3e-109   
gb|KDQ61018.1|  hypothetical protein JAAARDRAFT_32017                   330   4e-109   
emb|CAG04789.1|  unnamed protein product                                330   4e-109   
gb|ELW66979.1|  GTP-binding nuclear protein Ran                         332   4e-109   
pdb|3GJ0|A  Chain A, Crystal Structure Of Human Rangdp                  330   4e-109   
ref|XP_003682959.1|  hypothetical protein TDEL_0G03810                  330   5e-109   
gb|EYE97086.1|  putative GTP-binding nuclear protein GSP1/Ran           330   5e-109   
ref|XP_007235370.1|  PREDICTED: GTP-binding nuclear protein Ran-like    330   5e-109   
ref|XP_451197.1|  hypothetical protein                                  330   6e-109   
ref|NP_001232636.1|  putative RAN member RAS oncogene family vari...    330   6e-109   
ref|XP_007529305.1|  PREDICTED: GTP-binding nuclear protein Ran         330   6e-109   
ref|NP_571384.1|  GTP-binding nuclear protein Ran                       330   7e-109   
ref|XP_007385534.1|  ras-domain-containing protein                      330   7e-109   
ref|XP_010353289.1|  PREDICTED: GTP-binding nuclear protein Ran         330   8e-109   
dbj|BAE26338.1|  unnamed protein product                                329   9e-109   
gb|KDE04045.1|  GTP-binding nuclear protein spi1                        329   9e-109   
gb|EHH21331.1|  hypothetical protein EGK_04363                          330   1e-108   
ref|NP_001155556.1|  GTP-binding nuclear protein Ran                    329   1e-108   
pdb|1QG4|A  Chain A, Canine Gdp-Ran F72y Mutant                         329   1e-108   
emb|CCA23259.1|  GTPbinding nuclear protein spi1 putative               329   1e-108   
gb|EMD38557.1|  GTP-binding nuclear protein spi1                        329   1e-108   
gb|AAX42876.1|  RAN member RAS oncogene family                          329   1e-108   
ref|XP_010889930.1|  PREDICTED: GTP-binding nuclear protein Ran-like    329   1e-108   
pdb|3M1I|A  Chain A, Crystal Structure Of Yeast Crm1 (xpo1p) In C...    329   1e-108   
ref|XP_006901057.1|  PREDICTED: GTP-binding nuclear protein Ran         331   1e-108   
ref|NP_001004829.1|  GTP-binding nuclear protein Ran                    329   1e-108   
ref|XP_006695732.1|  hypothetical protein CTHT_0053970                  328   1e-108   
ref|XP_001833111.1|  GTP-binding nuclear protein RAN                    328   2e-108   
ref|XP_007846113.1|  gtp-binding nuclear protein gsp1 ran               328   2e-108   
gb|KDQ17997.1|  hypothetical protein BOTBODRAFT_29312                   328   2e-108   
dbj|BAB27105.1|  unnamed protein product                                328   2e-108   
ref|NP_001135061.1|  GTP-binding nuclear protein Ran                    328   2e-108   
emb|CDS33870.1|  GTP binding nuclear protein Ran                        328   2e-108   
gb|KFP83953.1|  GTP-binding nuclear protein Ran                         328   2e-108   
ref|XP_009076616.1|  PREDICTED: GTP-binding nuclear protein Ran i...    328   2e-108   



>gb|AEM97804.1| Ran3A-1 [Dimocarpus longan]
 gb|AEM97805.1| Ran3A-2 [Dimocarpus longan]
 gb|AEM97806.1| Ran3A-3 [Dimocarpus longan]
 gb|AEM97807.1| Ran3A-4 [Dimocarpus longan]
 gb|AEM97808.1| Ran3A-5 [Dimocarpus longan]
 gb|AEM97809.1| Ran3A-6 [Dimocarpus longan]
 gb|AEM97810.1| Ran3A-7 [Dimocarpus longan]
 gb|AEM97811.1| Ran3A-8 [Dimocarpus longan]
 gb|AEM97812.1| Ran3A-9 [Dimocarpus longan]
 gb|AEM97813.1| Ran3A-10 [Dimocarpus longan]
 gb|AEM97814.1| Ran3A-11 [Dimocarpus longan]
 gb|AFD93406.1| Ras-like GTP-binding protein 3A-14 [Dimocarpus longan]
 gb|AFD93407.1| Ras-like GTP-binding protein 3A-13 [Dimocarpus longan]
 gb|AFM43803.1| Ran3A-12 [Dimocarpus longan]
 gb|AFD93409.2| Ras-like GTP-binding protein 3A [Dimocarpus longan]
Length=221

 Score =   438 bits (1127),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 205/213 (96%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE ELQ AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELQAAASQPLP  213



>emb|CDY06600.1| BnaC02g13240D [Brassica napus]
Length=248

 Score =   439 bits (1128),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 205/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  28   MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  87

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  88   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  147

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  148  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  207

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  208  ESPALAPPEVQIDMAAQQQHEAELAAAASQPLP  240



>ref|XP_002285307.2| PREDICTED: GTP-binding nuclear protein Ran-3-like [Vitis vinifera]
 emb|CBI36254.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   439 bits (1130),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  47   MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  106

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  107  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  166

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  167  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  226

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA QPLP
Sbjct  227  ESPALAPPEVQIDMAAQQQHEAELMAAAAQPLP  259



>ref|XP_002864382.1| hypothetical protein ARALYDRAFT_918663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40641.1| hypothetical protein ARALYDRAFT_918663 [Arabidopsis lyrata subsp. 
lyrata]
Length=221

 Score =   437 bits (1124),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 205/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQIDIAAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDIAAQQQHEAELAAAASQPLP  213



>gb|ACJ83982.1| unknown [Medicago truncatula]
 gb|AFK42338.1| unknown [Medicago truncatula]
 gb|KEH35927.1| GTP-binding nuclear Ran-like protein [Medicago truncatula]
Length=221

 Score =   437 bits (1123),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 205/213 (96%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+ AQQ+HE ELQ+AANQPLP
Sbjct  181  ESPALAPPEVQIDLVAQQQHENELQQAANQPLP  213



>gb|AEM97821.1| Ran3C-1 [Dimocarpus longan]
 gb|AEM97822.1| Ran3C-2 [Dimocarpus longan]
 gb|AEM97823.1| Ran3C-3 [Dimocarpus longan]
Length=221

 Score =   436 bits (1122),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTV+YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVNYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE ELQ AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELQAAASQPLP  213



>ref|XP_008242718.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Prunus mume]
 gb|AHB38746.1| GTP-binding nuclear protein Ran3 [Prunus salicina]
Length=221

 Score =   436 bits (1122),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDTNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL +AANQPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAQAANQPLP  213



>ref|XP_006281068.1| hypothetical protein CARUB_v10027091mg [Capsella rubella]
 ref|XP_010449249.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Camelina sativa]
 ref|XP_010443137.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Camelina sativa]
 ref|XP_010482946.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Camelina sativa]
 gb|EOA13966.1| hypothetical protein CARUB_v10027091mg [Capsella rubella]
Length=221

 Score =   436 bits (1121),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDMAAQQQHEAELAAAASQPLP  213



>ref|NP_200330.1| GTP-binding nuclear protein Ran-3 [Arabidopsis thaliana]
 sp|Q8H156.2|RAN3_ARATH RecName: Full=GTP-binding nuclear protein Ran-3; AltName: Full=Ras-related 
nuclear protein 3 [Arabidopsis thaliana]
 gb|AAB58478.1| small Ras-like GTP-binding protein [Arabidopsis thaliana]
 dbj|BAB08588.1| small Ras-like GTP-binding protein [Arabidopsis thaliana]
 gb|AAK68736.1| small Ras-like GTP-binding protein [Arabidopsis thaliana]
 gb|AAK91334.1| AT5g55190/MCO15_14 [Arabidopsis thaliana]
 gb|AAM51573.1| AT5g55190/MCO15_14 [Arabidopsis thaliana]
 gb|AED96598.1| GTP-binding nuclear protein Ran-3 [Arabidopsis thaliana]
Length=221

 Score =   436 bits (1121),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>sp|P38548.1|RAN_VICFA RecName: Full=GTP-binding nuclear protein Ran/TC4 [Vicia faba]
 emb|CAA80845.1| guanine nucleotide regulatory protein [Vicia faba]
Length=221

 Score =   436 bits (1121),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 205/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQIDIA QQ+HE E+ EAANQPLP
Sbjct  181  ESPALAPPEVQIDIALQQRHENEILEAANQPLP  213



>ref|XP_007202468.1| hypothetical protein PRUPE_ppa010188mg [Prunus persica]
 gb|EMJ03667.1| hypothetical protein PRUPE_ppa010188mg [Prunus persica]
Length=260

 Score =   437 bits (1124),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  40   MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  99

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  100  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  159

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  160  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDTNLHFV  219

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL +AANQPLP
Sbjct  220  ESPALAPPEVHIDLAAQQQHEAELAQAANQPLP  252



>ref|XP_003522627.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Glycine max]
 gb|KHN08111.1| GTP-binding nuclear protein Ran-3 [Glycine soja]
Length=221

 Score =   436 bits (1120),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDTNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELLAAASQPLP  213



>gb|KHN07095.1| GTP-binding nuclear protein Ran-3 [Glycine soja]
Length=221

 Score =   436 bits (1120),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELLAAASQPLP  213



>ref|XP_006401481.1| hypothetical protein EUTSA_v10014614mg [Eutrema salsugineum]
 ref|XP_009127018.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Brassica rapa]
 gb|ESQ42934.1| hypothetical protein EUTSA_v10014614mg [Eutrema salsugineum]
Length=221

 Score =   435 bits (1119),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 205/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDMAAQQQHEAELAAAASQPLP  213



>gb|EYU29235.1| hypothetical protein MIMGU_mgv1a013409mg [Erythranthe guttata]
Length=221

 Score =   435 bits (1119),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ HE EL +AA+QPLP
Sbjct  181  ESPALAPPEVQIDMAAQQLHEQELAQAASQPLP  213



>gb|AAM12880.1|AF495716_1 GTP-binding protein [Helianthus annuus]
Length=221

 Score =   435 bits (1118),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDMAAQQQHEAELAAAASQPLP  213



>ref|XP_006450497.1| hypothetical protein CICLE_v10009427mg [Citrus clementina]
 ref|XP_006483313.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Citrus sinensis]
 gb|ESR63737.1| hypothetical protein CICLE_v10009427mg [Citrus clementina]
 gb|KDO61661.1| hypothetical protein CISIN_1g027607mg [Citrus sinensis]
Length=221

 Score =   435 bits (1118),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_011085069.1| PREDICTED: GTP-binding nuclear protein Ran1B [Sesamum indicum]
 ref|XP_011081927.1| PREDICTED: GTP-binding nuclear protein Ran1B isoform X1 [Sesamum 
indicum]
 ref|XP_011081928.1| PREDICTED: GTP-binding nuclear protein Ran1B isoform X2 [Sesamum 
indicum]
 ref|XP_011081929.1| PREDICTED: GTP-binding nuclear protein Ran1B isoform X3 [Sesamum 
indicum]
Length=221

 Score =   435 bits (1118),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>emb|CDY17309.1| BnaA10g09430D [Brassica napus]
Length=259

 Score =   436 bits (1122),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 210/217 (97%), Gaps = 0/217 (0%)
 Frame = -2

Query  967  LRRLMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFH  788
            L+R  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF 
Sbjct  35   LKRPQALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFF  94

Query  787  TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCE  608
            TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCE
Sbjct  95   TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCE  154

Query  607  NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVN  428
            NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N
Sbjct  155  NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPN  214

Query  427  LHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            LHFVESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  215  LHFVESPALAPPEVQIDMAAQQQHEAELAAAASQPLP  251



>ref|XP_009594669.1| PREDICTED: GTP-binding nuclear protein Ran-A1 [Nicotiana tomentosiformis]
Length=221

 Score =   435 bits (1118),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_007137047.1| hypothetical protein PHAVU_009G095400g [Phaseolus vulgaris]
 ref|XP_007137049.1| hypothetical protein PHAVU_009G095600g [Phaseolus vulgaris]
 gb|AGL52584.1| Ran1 [Hevea brasiliensis]
 gb|ESW09041.1| hypothetical protein PHAVU_009G095400g [Phaseolus vulgaris]
 gb|ESW09043.1| hypothetical protein PHAVU_009G095600g [Phaseolus vulgaris]
 gb|KDP33620.1| hypothetical protein JCGZ_07191 [Jatropha curcas]
Length=221

 Score =   435 bits (1118),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>gb|ABM73376.1| Ran1 [Pisum sativum]
Length=221

 Score =   434 bits (1117),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQT+DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTIDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQIDIA QQ+HE E+ EAANQPLP
Sbjct  181  ESPALAPPEVQIDIALQQRHENEILEAANQPLP  213



>emb|CDY20779.1| BnaA02g09190D [Brassica napus]
Length=254

 Score =   436 bits (1120),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGK
Sbjct  35   ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGK  94

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV
Sbjct  95   IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  154

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVE
Sbjct  155  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVE  214

Query  412  SPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            SPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  215  SPALAPPEVQIDMAAQQQHEAELAAAASQPLP  246



>gb|AAN31865.1| putative small Ras GTP-binding protein [Arabidopsis thaliana]
Length=221

 Score =   434 bits (1117),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLR+GYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLREGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>gb|AFK47968.1| unknown [Lotus japonicus]
Length=221

 Score =   434 bits (1117),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYP+FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPNFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL +AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAQAASQPLP  213



>ref|NP_001265929.1| GTP-binding nuclear protein Ran-3-like [Cicer arietinum]
 emb|CAC10213.1| GTP-binding protein [Cicer arietinum]
Length=221

 Score =   434 bits (1116),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+ AQQ+HE E+ +AANQPLP
Sbjct  181  ESPALAPPEVQIDLVAQQQHEAEIAQAANQPLP  213



>ref|NP_001238082.1| uncharacterized protein LOC100500437 [Glycine max]
 gb|ACU15524.1| unknown [Glycine max]
Length=221

 Score =   434 bits (1116),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDV+NRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVENRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELLAAASQPLP  213



>gb|AEK78856.1| ran [Lepidium latifolium]
Length=221

 Score =   434 bits (1116),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDTNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+PALAPP+VQIDIAAQQK+E EL EAA QPLP
Sbjct  181  ETPALAPPDVQIDIAAQQKNEAELIEAAAQPLP  213



>ref|XP_003522628.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Glycine max]
 ref|XP_003522629.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Glycine max]
 gb|KHN07096.1| GTP-binding nuclear protein Ran-3 [Glycine soja]
 gb|KHN07097.1| GTP-binding nuclear protein Ran-3 [Glycine soja]
 gb|KHN08110.1| GTP-binding nuclear protein Ran-3 [Glycine soja]
Length=221

 Score =   434 bits (1116),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELLAAASQPLP  213



>gb|AFK34515.1| unknown [Medicago truncatula]
 gb|KEH35925.1| GTP-binding nuclear Ran-like protein [Medicago truncatula]
Length=221

 Score =   434 bits (1116),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 205/213 (96%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ HE EL +AANQPLP
Sbjct  181  ESPALAPPEVQIDLAAQQVHENELLQAANQPLP  213



>ref|XP_007137048.1| hypothetical protein PHAVU_009G095500g [Phaseolus vulgaris]
 gb|AGV54506.1| GTP-binding nuclear protein Ran-3 [Phaseolus vulgaris]
 gb|AGV54647.1| Ras-like GTP-binding protein 3G-1 [Phaseolus vulgaris]
 gb|ESW09042.1| hypothetical protein PHAVU_009G095500g [Phaseolus vulgaris]
Length=221

 Score =   434 bits (1116),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARK+AGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKIAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_007013338.1| RAN GTPase 3 [Theobroma cacao]
 gb|EOY30957.1| RAN GTPase 3 [Theobroma cacao]
Length=221

 Score =   434 bits (1116),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_004489804.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Cicer arietinum]
Length=221

 Score =   434 bits (1116),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            K+RFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KVRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+ AQQ+HE E+ +AANQPLP
Sbjct  181  ESPALAPPEVQIDLVAQQQHEAEIAQAANQPLP  213



>gb|AGG87098.1| GTP-binding nuclear protein Ran3B-2 [Musa AB Group]
 gb|AGG87106.1| GTP-binding nuclear protein Ran3B-1 [Musa AB Group]
 gb|AGS16677.1| GTP-binding nuclear protein Ran3B [Musa AB Group]
Length=221

 Score =   434 bits (1115),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>gb|AEK84227.1| GTP-binding protein [Cucurbita maxima]
Length=221

 Score =   434 bits (1115),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHVTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+A Q +HE ELQ+AANQPLP
Sbjct  181  ESPALAPPEVQIDLAVQAQHEAELQQAANQPLP  213



>ref|NP_001289503.1| RAN, member RAS oncogene family [Nicotiana sylvestris]
 ref|XP_009631948.1| PREDICTED: GTP-binding nuclear protein Ran-B1 [Nicotiana tomentosiformis]
 gb|AAT40986.1| RAN [Nicotiana sylvestris]
 gb|AAT40987.1| RAN [Nicotiana sylvestris]
Length=221

 Score =   434 bits (1115),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ HE EL +AA QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQLHEQELLQAAAQPLP  213



>gb|AFK47313.1| unknown [Lotus japonicus]
Length=221

 Score =   433 bits (1114),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYP+FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPNFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>gb|AEM97824.1| Ran3D-1 [Dimocarpus longan]
 gb|AEM97825.1| Ran3D-2 [Dimocarpus longan]
Length=221

 Score =   433 bits (1114),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTV+YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVNYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDV+NRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVRNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE ELQ AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELQAAASQPLP  213



>ref|XP_007222560.1| hypothetical protein PRUPE_ppa008371mg [Prunus persica]
 gb|EMJ23759.1| hypothetical protein PRUPE_ppa008371mg [Prunus persica]
Length=335

 Score =   438 bits (1126),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  115  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  174

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  175  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  234

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  235  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  294

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  295  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  327



>gb|EPS73370.1| hypothetical protein M569_01384, partial [Genlisea aurea]
Length=221

 Score =   433 bits (1114),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 209/212 (99%), Gaps = 0/212 (0%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALP+QQTVDYPSFKLVIVGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDF+TNCGK
Sbjct  2    ALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFYTNCGK  61

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIV
Sbjct  62   IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  121

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE
Sbjct  122  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  181

Query  412  SPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            SPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  182  SPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_010049961.1| PREDICTED: GTP-binding nuclear protein Ran1A [Eucalyptus grandis]
 gb|KCW82793.1| hypothetical protein EUGRSUZ_C04168 [Eucalyptus grandis]
Length=221

 Score =   433 bits (1114),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL +AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAQAASQPLP  213



>emb|CDY19907.1| BnaC09g31730D [Brassica napus]
Length=224

 Score =   433 bits (1114),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            L A+PNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  3    LSAVPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  62

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP
Sbjct  63   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  122

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHF
Sbjct  123  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHF  182

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  183  VESPALAPPEVQIDMAAQQQHEAELAAAASQPLP  216



>gb|AGS16676.1| GTP-binding nuclear protein Ran3E [Musa AB Group]
Length=221

 Score =   433 bits (1113),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_006451004.1| hypothetical protein CICLE_v10009426mg [Citrus clementina]
 ref|XP_006475782.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Citrus sinensis]
 gb|ESR64244.1| hypothetical protein CICLE_v10009426mg [Citrus clementina]
 gb|KDO80342.1| hypothetical protein CISIN_1g027593mg [Citrus sinensis]
Length=221

 Score =   433 bits (1113),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+QQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|NP_001274933.1| GTP-binding nuclear protein Ran2-like [Solanum tuberosum]
 ref|XP_006351825.1| PREDICTED: GTP-binding nuclear protein Ran2-like [Solanum tuberosum]
 gb|ABB02641.1| unknown [Solanum tuberosum]
Length=221

 Score =   433 bits (1113),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDGNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQ  HE ELQ+A NQPLP
Sbjct  181  ESPALAPPEVQIDLAAQALHEQELQQALNQPLP  213



>gb|EPS73273.1| hypothetical protein M569_01483, partial [Genlisea aurea]
Length=221

 Score =   433 bits (1113),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDF+TNCGK
Sbjct  2    ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFYTNCGK  61

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIV
Sbjct  62   IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  121

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVE
Sbjct  122  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVE  181

Query  412  SPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            SPALAPPEVQID AAQQ+HE EL  AA+QPLP
Sbjct  182  SPALAPPEVQIDFAAQQQHEAELAAAASQPLP  213



>gb|ADK73610.1| small GTP binding protein [Ipomoea batatas]
Length=221

 Score =   432 bits (1112),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELIAAASQPLP  213



>ref|XP_008378301.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Malus domestica]
 ref|XP_008394046.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Malus domestica]
 ref|XP_009334776.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Pyrus x bretschneideri]
 ref|XP_009345291.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Pyrus x bretschneideri]
Length=221

 Score =   432 bits (1112),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_010541725.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Tarenaya hassleriana]
 ref|XP_010520597.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Tarenaya hassleriana]
Length=221

 Score =   432 bits (1112),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVTIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_008219897.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Prunus mume]
 gb|AHB38745.1| GTP-binding nuclear protein Ran1 [Prunus salicina]
Length=221

 Score =   432 bits (1112),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_002284967.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Vitis vinifera]
 ref|XP_010254322.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Nelumbo nucifera]
 ref|XP_010257693.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Nelumbo nucifera]
 gb|KHG20890.1| GTP-binding nuclear Ran-3 -like protein [Gossypium arboreum]
Length=221

 Score =   432 bits (1112),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  213



>ref|NP_001234016.1| GTP-binding nuclear protein Ran1 [Solanum lycopersicum]
 ref|NP_001275263.1| Ran/TC4-like protein [Solanum tuberosum]
 sp|P38546.1|RAN1_SOLLC RecName: Full=GTP-binding nuclear protein Ran1; AltName: Full=Ras-related 
nuclear protein 1 [Solanum lycopersicum]
 gb|AAC37402.1| Ran protein/TC4 protein [Solanum lycopersicum]
 gb|ABB02653.1| Ran/TC4-like protein [Solanum tuberosum]
 gb|ABB87102.1| Ran protein/TC4 protein-like [Solanum tuberosum]
Length=221

 Score =   432 bits (1112),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDGNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQ  HE ELQ+AANQPLP
Sbjct  181  ESPALAPPEVHIDLAAQALHEEELQQAANQPLP  213



>gb|AGV54526.1| Ras-like GTP-binding protein [Phaseolus vulgaris]
Length=221

 Score =   432 bits (1111),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNY+FEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYHFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>gb|KFK27119.1| hypothetical protein AALP_AA8G337300 [Arabis alpina]
Length=221

 Score =   432 bits (1111),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYP+FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPNFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQ +HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDMAAQLQHEAELAAAASQPLP  213



>ref|XP_002285018.2| PREDICTED: GTP-binding nuclear protein Ran-3-like [Vitis vinifera]
 emb|CBI28152.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   434 bits (1115),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 204/215 (95%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  961  RLMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTN  782
            R MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN
Sbjct  38   RYMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTN  97

Query  781  CGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENI  602
            CGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENI
Sbjct  98   CGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENI  157

Query  601  PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLH  422
            PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLH
Sbjct  158  PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLH  217

Query  421  FVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            FVESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  218  FVESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  252



>ref|NP_001234020.1| GTP-binding nuclear protein Ran2 [Solanum lycopersicum]
 ref|NP_001234023.1| GTP-binding nuclear protein Ran2 [Solanum lycopersicum]
 sp|P38547.1|RAN2_SOLLC RecName: Full=GTP-binding nuclear protein Ran2; AltName: Full=Ras-related 
nuclear protein 2 [Solanum lycopersicum]
 gb|AAC37403.1| Ran protein/TC4 protein [Solanum lycopersicum]
 gb|AAC37404.1| Ran protein/TC4 protein [Solanum lycopersicum]
Length=221

 Score =   432 bits (1111),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDGNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQ  HE ELQ A NQPLP
Sbjct  181  ESPALAPPEVQIDLAAQALHEQELQAALNQPLP  213



>gb|AGG87101.1| GTP-binding nuclear protein Ran3D-1 [Musa AB Group]
Length=221

 Score =   432 bits (1111),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGK TFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKATFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_010276399.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Nelumbo nucifera]
Length=221

 Score =   432 bits (1111),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA++MFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIVMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_008361239.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Malus domestica]
Length=221

 Score =   432 bits (1110),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV  D+AAQQ+HE EL  AA QPLP
Sbjct  181  ESPALAPPEVHFDMAAQQQHEAELASAAAQPLP  213



>gb|EYU21949.1| hypothetical protein MIMGU_mgv1a011253mg [Erythranthe guttata]
Length=288

 Score =   434 bits (1117),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            LMALPNQQTVDYP+FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  67   LMALPNQQTVDYPNFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  126

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIP
Sbjct  127  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIP  186

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD +LHF
Sbjct  187  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPSLHF  246

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  247  VESPALAPPEVQIDLAAQQQHEQELLTAASQPLP  280



>gb|ACJ86144.1| unknown [Medicago truncatula]
 gb|KEH35926.1| GTP-binding nuclear Ran-like protein [Medicago truncatula]
Length=221

 Score =   432 bits (1110),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ  E EL +AANQPLP
Sbjct  181  ESPALAPPEVQIDLAAQQVQENELLQAANQPLP  213



>gb|AEH02864.1| ran [Fragaria vesca]
Length=221

 Score =   431 bits (1109),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTV+YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVEYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL +AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAQAASQPLP  213



>emb|CBI21000.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   433 bits (1113),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  34   MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  93

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  94   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  153

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  154  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  213

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  214  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  246



>gb|KHN08109.1| GTP-binding nuclear protein Ran-3, partial [Glycine soja]
Length=220

 Score =   431 bits (1109),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGK
Sbjct  1    ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGK  60

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIV
Sbjct  61   IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  120

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVE
Sbjct  121  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVE  180

Query  412  SPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            SPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  SPALAPPEVQIDLAAQQQHEAELLAAASQPLP  212



>ref|XP_003526422.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Glycine max]
Length=221

 Score =   431 bits (1109),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVLIDLAAQQQHEAELLAAASQPLP  213



>gb|AFK34827.1| unknown [Medicago truncatula]
Length=221

 Score =   431 bits (1109),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ  E EL +AANQPLP
Sbjct  181  ESPALAPPEVQIDLAAQQVQENELFQAANQPLP  213



>ref|XP_002515555.1| ran, putative [Ricinus communis]
 gb|EEF47004.1| ran, putative [Ricinus communis]
Length=221

 Score =   431 bits (1108),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQPTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD +LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPSLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL +AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAQAASQPLP  213



>gb|ACJ83916.1| unknown [Medicago truncatula]
Length=221

 Score =   431 bits (1108),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ HE  L +AANQPLP
Sbjct  181  ESPALAPPEVQIDLAAQQVHENGLLQAANQPLP  213



>gb|KDP32357.1| hypothetical protein JCGZ_13282 [Jatropha curcas]
Length=221

 Score =   431 bits (1108),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   QIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
             +PALAPPEVQID+AAQQ+HE EL +AA+QPLP
Sbjct  181  ATPALAPPEVQIDLAAQQQHEAELAQAASQPLP  213



>ref|NP_001235194.1| uncharacterized protein LOC100305680 [Glycine max]
 gb|ACU13489.1| unknown [Glycine max]
Length=221

 Score =   431 bits (1108),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYL RKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLVRKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AA+Q+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAARQQHEAELLAAASQPLP  213



>gb|AFD93401.1| Ras-like GTP-binding protein 3F-1 [Dimocarpus longan]
Length=221

 Score =   431 bits (1108),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDV+ RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVRKRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>gb|AHA44504.1| GTP-binding nuclear protein Ran3G [Musa AB Group]
Length=221

 Score =   431 bits (1107),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLR GYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRGGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_004287368.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Fragaria vesca 
subsp. vesca]
Length=222

 Score =   431 bits (1107),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+A Q +HE EL  AA QPLP
Sbjct  181  ESPALAPPEVQIDMATQLQHEAELNAAAAQPLP  213



>ref|XP_009788705.1| PREDICTED: GTP-binding nuclear protein Ran-A1 [Nicotiana sylvestris]
 sp|P41918.1|RANA1_TOBAC RecName: Full=GTP-binding nuclear protein Ran-A1 [Nicotiana tabacum]
 gb|AAA73563.1| GTP-binding protein [Nicotiana tabacum]
Length=221

 Score =   431 bits (1107),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP QQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPGQQAVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_010047786.1| PREDICTED: GTP-binding nuclear protein Ran1A-like [Eucalyptus 
grandis]
 ref|XP_010047787.1| PREDICTED: GTP-binding nuclear protein Ran1A-like [Eucalyptus 
grandis]
 gb|KCW79771.1| hypothetical protein EUGRSUZ_C01113 [Eucalyptus grandis]
Length=221

 Score =   430 bits (1105),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYP+FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPNFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL +AA QPLP
Sbjct  181  ESPALAPPEVHIDVAAQQQHEAELAQAAIQPLP  213



>emb|CAA66049.1| atran3 [Arabidopsis thaliana]
Length=221

 Score =   430 bits (1105),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGE EKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEPEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE ++  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQRHEADVAAAASQPLP  213



>gb|AFK41562.1| unknown [Medicago truncatula]
Length=231

 Score =   430 bits (1106),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVVVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ  E EL +AANQPLP
Sbjct  181  ESPALAPPEVQIDLAAQQVQENELLQAANQPLP  213



>ref|XP_009120041.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Brassica rapa]
Length=221

 Score =   430 bits (1105),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIV DGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVDDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPP VQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPGVQIDMAAQQQHEAELAAAASQPLP  213



>ref|XP_008465002.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Cucumis melo]
Length=221

 Score =   430 bits (1105),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+Q+TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPDQKTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  213



>ref|XP_011019766.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Populus euphratica]
Length=221

 Score =   430 bits (1105),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQ KHE EL  A +QPLP
Sbjct  181  ESPALAPPEVTIDLAAQAKHEAELAAAVSQPLP  213



>ref|XP_008465000.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Cucumis melo]
Length=221

 Score =   429 bits (1103),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+Q+TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPDQKTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELVAAASQPLP  213



>sp|P41919.1|RANB1_TOBAC RecName: Full=GTP-binding nuclear protein Ran-B1 [Nicotiana tabacum]
 gb|AAA34109.1| small ras-related protein [Nicotiana tabacum]
Length=221

 Score =   429 bits (1102),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ HE EL +AA   LP
Sbjct  181  ESPALAPPEVQIDLAAQQLHEQELLQAAAHALP  213



>ref|XP_002309606.1| RAN1B family protein [Populus trichocarpa]
 gb|ABK93206.1| unknown [Populus trichocarpa]
 gb|EEE93129.1| RAN1B family protein [Populus trichocarpa]
Length=221

 Score =   429 bits (1102),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+PALAPPEV ID+AAQ +HE EL  AA+QPLP
Sbjct  181  ETPALAPPEVPIDLAAQAQHEAELAAAASQPLP  213



>dbj|BAP11912.1| Ran-GTPase [Citrullus lanatus]
Length=221

 Score =   429 bits (1102),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+Q+TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPDQKTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  213



>gb|AAB97312.1| salt stress inducible small GTP binding protein Ran1 homolog 
[Arabidopsis thaliana]
 gb|AAC34900.1| unknown [Arabidopsis thaliana]
Length=221

 Score =   428 bits (1101),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHP DF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPPDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTY+NVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYRNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRK+ LQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKEELQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  213



>gb|KFK26249.1| hypothetical protein AALP_AA8G222500 [Arabis alpina]
Length=222

 Score =   428 bits (1101),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            + ALPNQQTVDYP FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  1    MAALPNQQTVDYPFFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKN+PTWHRDLCRVCENIP
Sbjct  61   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNIPTWHRDLCRVCENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHF
Sbjct  121  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPALAPPEVQID+ +QQK+ELEL +AA QPLP
Sbjct  181  VESPALAPPEVQIDLESQQKNELELAQAAAQPLP  214



>ref|XP_008465001.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Cucumis melo]
Length=254

 Score =   429 bits (1104),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 210/219 (96%), Gaps = 1/219 (0%)
 Frame = -2

Query  970  PLRRL-MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLD  794
            P R + MALP+Q+TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLD
Sbjct  28   PFRFIPMALPDQKTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLD  87

Query  793  FHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRV  614
            F TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRV
Sbjct  88   FFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRV  147

Query  613  CENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD  434
            CENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD
Sbjct  148  CENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD  207

Query  433  VNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
             N+HFVESPALAPPEV ID+AAQQ+HE EL  AA+QPLP
Sbjct  208  ANIHFVESPALAPPEVHIDLAAQQQHEAELAAAASQPLP  246



>gb|ABK94282.1| unknown [Populus trichocarpa]
Length=221

 Score =   428 bits (1101),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQ +HE EL  A +QPLP
Sbjct  181  ESPALAPPEVTIDLAAQAQHEAELTAAVSQPLP  213



>ref|XP_002871916.1| hypothetical protein ARALYDRAFT_910039 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420828.1| PREDICTED: GTP-binding nuclear protein Ran-1 [Camelina sativa]
 ref|XP_010420830.1| PREDICTED: GTP-binding nuclear protein Ran-1 isoform X1 [Camelina 
sativa]
 ref|XP_010420831.1| PREDICTED: GTP-binding nuclear protein Ran-1 isoform X2 [Camelina 
sativa]
 ref|XP_010454293.1| PREDICTED: GTP-binding nuclear protein Ran-1 [Camelina sativa]
 ref|XP_010493092.1| PREDICTED: GTP-binding nuclear protein Ran-1 [Camelina sativa]
 gb|EFH48175.1| hypothetical protein ARALYDRAFT_910039 [Arabidopsis lyrata subsp. 
lyrata]
Length=221

 Score =   428 bits (1101),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+PALAPPEV IDIA QQK+E EL +AA QPLP
Sbjct  181  ETPALAPPEVHIDIADQQKNEAELLQAAAQPLP  213



>ref|XP_002308648.1| RAN1B family protein [Populus trichocarpa]
 gb|EEE92171.1| RAN1B family protein [Populus trichocarpa]
Length=221

 Score =   428 bits (1101),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQ +HE EL  A +QPLP
Sbjct  181  ESPALAPPEVTIDLAAQAQHEAELAAAVSQPLP  213



>ref|NP_197501.1| GTP-binding nuclear protein Ran-1 [Arabidopsis thaliana]
 sp|P41916.1|RAN1_ARATH RecName: Full=GTP-binding nuclear protein Ran-1; AltName: Full=Ras-related 
nuclear protein 1 [Arabidopsis thaliana]
 gb|AAL16185.1|AF428417_1 AT5g20010/F28I16_160 [Arabidopsis thaliana]
 gb|AAA32851.1| small ras-related protein [Arabidopsis thaliana]
 emb|CAA66047.1| atran1 [Arabidopsis thaliana]
 gb|AAM67087.1| RAN1 small Ras-like GTP-binding nuclear protein Ran-1 [Arabidopsis 
thaliana]
 gb|AAM78052.1| AT5g20010/F28I16_160 [Arabidopsis thaliana]
 gb|AED92779.1| GTP-binding nuclear protein Ran-1 [Arabidopsis thaliana]
Length=221

 Score =   428 bits (1100),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+PALAPPEV IDIA QQK+E EL +AA QPLP
Sbjct  181  ETPALAPPEVHIDIADQQKNEAELLQAAAQPLP  213



>ref|XP_004150009.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Cucumis sativus]
 ref|XP_004151718.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Cucumis sativus]
 gb|KGN65297.1| GTP-binding protein [Cucumis sativus]
Length=221

 Score =   428 bits (1100),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+Q+TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPDQKTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+A QQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVQIDLAVQQQHEAELVAAASQPLP  213



>emb|CDX70904.1| BnaC03g09880D [Brassica napus]
Length=237

 Score =   428 bits (1101),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  17   MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  76

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  77   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  136

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  137  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  196

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+A QQ++E +L  AA QPLP
Sbjct  197  ESPALAPPEVHIDVAEQQRNEADLIAAAAQPLP  229



>emb|CDY69655.1| BnaA03g56000D, partial [Brassica napus]
Length=227

 Score =   427 bits (1099),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  7    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  66

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  67   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  126

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  127  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  186

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+A QQ++E +L  AA QPLP
Sbjct  187  ESPALAPPEVHIDVAEQQRNEADLIAAAAQPLP  219



>ref|XP_009126410.1| PREDICTED: GTP-binding nuclear protein Ran-2-like [Brassica rapa]
Length=221

 Score =   427 bits (1098),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+A QQK+E +L  AA QPLP
Sbjct  181  ESPALAPPEVHIDVAEQQKNEADLIAAAAQPLP  213



>dbj|BAG16529.1| putative Ran/TC4 protein [Capsicum chinense]
Length=221

 Score =   427 bits (1097),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENI I
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENILI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDGNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+ AQ +HE EL EAA QPLP
Sbjct  181  ESPALAPPEVQIDLTAQAQHEKELAEAAIQPLP  213



>ref|XP_009131764.1| PREDICTED: GTP-binding nuclear protein Ran-2 [Brassica rapa]
Length=221

 Score =   426 bits (1096),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+A QQ++E +L  AA QPLP
Sbjct  181  ESPALAPPEVHIDVAEQQRNEADLIAAAAQPLP  213



>ref|XP_010670693.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Beta vulgaris subsp. 
vulgaris]
Length=221

 Score =   426 bits (1096),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHL+GEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLSGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   QIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKP+LYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPYLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+A QQ+HE EL  AA QPLP
Sbjct  181  ESPALAPPEVQIDLAEQQRHEQELAVAAAQPLP  213



>emb|CDP03407.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   427 bits (1097),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  10   MALPNQQIVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  69

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            K+RFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCE+IPI
Sbjct  70   KLRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCESIPI  129

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  130  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  189

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPAL PPEVQID+AAQQ+HE EL +AA QPLP
Sbjct  190  ESPALLPPEVQIDLAAQQQHEAELAQAAIQPLP  222



>ref|XP_004171598.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Cucumis sativus]
Length=221

 Score =   426 bits (1095),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+Q+TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPDQKTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+A QQ+HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAVQQQHEAELVAAASQPLP  213



>gb|ABD17866.1| etiolation seedling like-RAN2 small Ras GTP-binding nuclear protein 
[Brassica napus]
Length=221

 Score =   426 bits (1094),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNF+KPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFKKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+A QQK+E +L  AA QPLP
Sbjct  181  ESPALAPPEVHIDVAEQQKNEADLIAAAAQPLP  213



>ref|XP_011019767.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Populus euphratica]
Length=221

 Score =   425 bits (1093),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEV PLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVPPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+PALAPPEV ID+AAQ +HE EL  AA+QPLP
Sbjct  181  ETPALAPPEVPIDLAAQAQHEAELAAAASQPLP  213



>ref|XP_002324281.1| GTP-binding family protein [Populus trichocarpa]
 ref|XP_002324846.1| GTP-binding family protein [Populus trichocarpa]
 ref|XP_011026482.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Populus euphratica]
 ref|XP_011026483.1| PREDICTED: GTP-binding nuclear protein Ran-3-like isoform X1 
[Populus euphratica]
 ref|XP_011026484.1| PREDICTED: GTP-binding nuclear protein Ran-3-like isoform X2 
[Populus euphratica]
 ref|XP_011026485.1| PREDICTED: GTP-binding nuclear protein Ran-3-like isoform X3 
[Populus euphratica]
 gb|ABK93891.1| unknown [Populus trichocarpa]
 gb|ABK96156.1| unknown [Populus trichocarpa]
 gb|EEF02846.1| GTP-binding family protein [Populus trichocarpa]
 gb|EEF03411.1| GTP-binding family protein [Populus trichocarpa]
Length=221

 Score =   425 bits (1093),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHG CA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGNCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+PALAPPEV ID+ AQ +HE EL  AA+QPLP
Sbjct  181  ETPALAPPEVPIDLVAQAQHEAELAAAASQPLP  213



>ref|XP_011026487.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Populus euphratica]
Length=221

 Score =   422 bits (1086),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHG CA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGNCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+P LAPPEV ID+ AQ +HE EL  AA+QPLP
Sbjct  181  ETPPLAPPEVPIDLVAQAQHEAELAAAASQPLP  213



>ref|XP_004293011.1| PREDICTED: uncharacterized protein LOC101304165 [Fragaria vesca 
subsp. vesca]
Length=496

 Score =   432 bits (1111),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTV+YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVEYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL +AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQHEAELAQAASQPLP  213


 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 184/246 (75%), Gaps = 35/246 (14%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGT----------GKTTFVKRHLTGEFEKKYEPTIGVE  809
            + ALPNQQTVDYPSFKLVIVGDGG           GKTTFVKRH+TGEFEKKYEPTIGVE
Sbjct  240  IRALPNQQTVDYPSFKLVIVGDGGNPNIESFDCSAGKTTFVKRHITGEFEKKYEPTIGVE  299

Query  808  VHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHG----QCA-VIMFDVTARLTYKN-  647
            VHPLDFHTN GKIRFYCWDTAGQEKFGGLRDGYY+      QC  +I+F     LT +N 
Sbjct  300  VHPLDFHTNFGKIRFYCWDTAGQEKFGGLRDGYYLVDSVILQCGTMILFMQLISLTTENR  359

Query  646  VPTWH----RDLCR---------------VCENIPIVLCGNKVDVKNRQVKAKQVTFHRK  524
               +H     DL R               VCENIPIVLCGNKVDVKNRQVKAKQVTFHRK
Sbjct  360  TNPYHFDVIDDLVRIILHLGGFYSKILYWVCENIPIVLCGNKVDVKNRQVKAKQVTFHRK  419

Query  523  KNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELEL  344
            KNLQYYEISAKSNYNFEKPFLYLARKLAG++ L FVESPALAPPEV ID+A Q K + +L
Sbjct  420  KNLQYYEISAKSNYNFEKPFLYLARKLAGNMELIFVESPALAPPEVHIDVAEQTKIDEDL  479

Query  343  QEAANQ  326
            +   +Q
Sbjct  480  ERVKHQ  485



>ref|XP_008385896.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Malus domestica]
 ref|XP_008362915.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Malus domestica]
 ref|XP_009348191.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Pyrus x bretschneideri]
Length=221

 Score =   422 bits (1084),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQ D+AAQQ+HE EL  AA QPLP
Sbjct  181  ESPALAPPEVQFDMAAQQQHEAELAAAAAQPLP  213



>ref|XP_009405078.1| PREDICTED: GTP-binding nuclear protein Ran1B-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395080.1| PREDICTED: GTP-binding nuclear protein Ran1B-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395081.1| PREDICTED: GTP-binding nuclear protein Ran1B-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009400512.1| PREDICTED: GTP-binding nuclear protein Ran1B-like [Musa acuminata 
subsp. malaccensis]
 gb|AGG87097.1| GTP-binding nuclear protein Ran3A-1 [Musa AB Group]
 gb|AGG87099.1| GTP-binding nuclear protein Ran3A-2 [Musa AB Group]
 gb|AGG87100.1| GTP-binding nuclear protein Ran3A-3 [Musa AB Group]
 gb|AGG87102.1| GTP-binding nuclear protein Ran3A-4 [Musa AB Group]
 gb|AGG87104.1| GTP-binding nuclear protein Ran3A-5 [Musa AB Group]
 gb|AGG87105.1| GTP-binding nuclear protein Ran3A-6 [Musa AB Group]
 gb|AGS16671.1| GTP-binding nuclear protein Ran3A [Musa AB Group]
 gb|AGS16674.1| GTP-binding nuclear protein Ran3A [Musa AB Group]
 gb|AGS16675.1| GTP-binding nuclear protein Ran3A [Musa AB Group]
Length=221

 Score =   421 bits (1083),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAAAQPLP  213



>ref|XP_004138736.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Cucumis sativus]
 ref|XP_004164529.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Cucumis sativus]
 ref|XP_008445165.1| PREDICTED: GTP-binding nuclear protein Ran1A-like [Cucumis melo]
 gb|KGN62920.1| hypothetical protein Csa_2G380000 [Cucumis sativus]
Length=221

 Score =   420 bits (1080),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN G
Sbjct  1    MALPNQATVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNYG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG+  LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGNPELHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+A Q++HE EL +AA QPLP
Sbjct  181  ESPALAPPEVQIDLAVQEQHERELAQAAVQPLP  213



>ref|XP_007223953.1| hypothetical protein PRUPE_ppa011168mg [Prunus persica]
 gb|EMJ25152.1| hypothetical protein PRUPE_ppa011168mg [Prunus persica]
Length=221

 Score =   420 bits (1079),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/210 (94%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG+  L FV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGETELRFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQ  326
            ESPALAPPEVQID+A Q KHE EL +AA Q
Sbjct  181  ESPALAPPEVQIDMAVQAKHEQELAQAAAQ  210



>ref|XP_009381923.1| PREDICTED: GTP-binding nuclear protein Ran1B-like [Musa acuminata 
subsp. malaccensis]
 gb|AGG87095.2| GTP-binding nuclear protein Ran3C-1 [Musa AB Group]
Length=221

 Score =   419 bits (1078),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCE+IPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCESIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAAAQPLP  213



>emb|CDY42324.1| BnaC02g09300D [Brassica napus]
Length=717

 Score =   437 bits (1125),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  497  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  556

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  557  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  616

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  617  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  676

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+A QQK+E +L  AA QPLP
Sbjct  677  ESPALAPPEVHIDVAEQQKNEADLIAAAAQPLP  709



>ref|XP_010535882.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Tarenaya hassleriana]
Length=221

 Score =   419 bits (1078),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ+HE EL  AA QPLP
Sbjct  181  ESPALAPPEVTIDLAAQQQHEAELLAAAAQPLP  213



>ref|XP_010914929.1| PREDICTED: GTP-binding nuclear protein Ran1B-like [Elaeis guineensis]
Length=221

 Score =   419 bits (1077),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ++E E+  AA QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQYEAEIAAAAAQPLP  213



>gb|AHA44507.1| GTP-binding nuclear protein Ran3E [Musa AB Group]
Length=221

 Score =   419 bits (1077),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYL RKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLVRKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAAAQPLP  213



>emb|CDY44958.1| BnaA02g04630D [Brassica napus]
Length=721

 Score =   437 bits (1123),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  501  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  560

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  561  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  620

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  621  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  680

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+A QQK+E +L  AA QPLP
Sbjct  681  ESPALAPPEVHIDVAEQQKNEADLIAAAAQPLP  713



>ref|XP_002284971.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Vitis vinifera]
Length=221

 Score =   419 bits (1076),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQ  HE EL  AA QPLP
Sbjct  181  ESPALAPPEVQIDMAAQAHHEAELAAAAAQPLP  213



>ref|XP_008775035.1| PREDICTED: GTP-binding nuclear protein Ran1B [Phoenix dactylifera]
Length=221

 Score =   418 bits (1075),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 196/201 (98%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEVQID+AAQQ+HE
Sbjct  181  ESPALAPPEVQIDLAAQQQHE  201



>ref|XP_009401746.1| PREDICTED: GTP-binding nuclear protein Ran1B isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=221

 Score =   418 bits (1075),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYP+FKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPNFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFE+PFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFERPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE EL  AA QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAELAAAAAQPLP  213



>emb|CDX88865.1| BnaA03g07840D [Brassica napus]
Length=629

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            + ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  408  VQALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  467

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP
Sbjct  468  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  527

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHF
Sbjct  528  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHF  587

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPALAPPEV ID+A QQ++E +L  AA QPLP
Sbjct  588  VESPALAPPEVHIDVAEQQRNEADLIAAAAQPLP  621



>ref|XP_003603437.1| GTP-binding nuclear protein Ran-A1 [Medicago truncatula]
Length=778

 Score =   437 bits (1123),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 205/213 (96%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+ AQQ+HE ELQ+AANQPLP
Sbjct  181  ESPALAPPEVQIDLVAQQQHENELQQAANQPLP  213


 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            +MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  557  IMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  616

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIP
Sbjct  617  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIP  676

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHF
Sbjct  677  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHF  736

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPALAPPEVQID+AAQQ HE EL +AANQPLP
Sbjct  737  VESPALAPPEVQIDLAAQQVHENELLQAANQPLP  770


 Score =   430 bits (1106),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            +ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  277  LALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  336

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  337  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  396

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  397  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  456

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ  E EL +AANQPLP
Sbjct  457  ESPALAPPEVQIDLAAQQVQENELLQAANQPLP  489



>gb|ACX81221.1| Ras-related GTP binding protein [Lepidium latifolium]
Length=223

 Score =   417 bits (1072),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 199/215 (93%), Positives = 204/215 (95%), Gaps = 2/215 (1%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHT--N  782
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF     
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFEKLFQ  60

Query  781  CGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENI  602
              +IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENI
Sbjct  61   LWQIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENI  120

Query  601  PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLH  422
            PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLH
Sbjct  121  PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDTNLH  180

Query  421  FVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            FVE+PALAPP+VQIDIAAQQK+E EL EAA QPLP
Sbjct  181  FVETPALAPPDVQIDIAAQQKNEAELIEAAAQPLP  215



>emb|CBI21001.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   420 bits (1080),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  85   MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  144

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  145  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  204

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV
Sbjct  205  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  264

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQ  HE EL  AA QPLP
Sbjct  265  ESPALAPPEVQIDMAAQAHHEAELAAAAAQPLP  297



>ref|XP_010918773.1| PREDICTED: GTP-binding nuclear protein Ran1B [Elaeis guineensis]
Length=221

 Score =   416 bits (1070),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTV+YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVEYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEVQID+AAQQ+HE
Sbjct  181  ESPALAPPEVQIDLAAQQQHE  201



>gb|AFD93402.1| Ras-like GTP-binding protein 3G-1 [Dimocarpus longan]
Length=221

 Score =   416 bits (1069),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQHHEAELAAAASQPLP  213



>emb|CDP04794.1| unnamed protein product [Coffea canephora]
Length=236

 Score =   416 bits (1069),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            L+ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  15   LVALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  74

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIP
Sbjct  75   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIP  134

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHF
Sbjct  135  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHF  194

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPAL PPEVQID+ AQQ+HE EL +AA QPLP
Sbjct  195  VESPALLPPEVQIDLVAQQQHEAELAQAAAQPLP  228



>gb|AEM97826.1| Ran3E-1 [Dimocarpus longan]
Length=221

 Score =   415 bits (1067),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDV+NRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVRNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQHHEAELAAAASQPLP  213



>ref|XP_008792100.1| PREDICTED: GTP-binding nuclear protein Ran1B-like [Phoenix dactylifera]
Length=221

 Score =   415 bits (1067),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+QQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG
Sbjct  1    MALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            K+RFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KVRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD +LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPSLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ++E E+  AA QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQQYEAEIAAAAAQPLP  213



>ref|XP_006288511.1| hypothetical protein CARUB_v10001782mg, partial [Capsella rubella]
 gb|EOA21409.1| hypothetical protein CARUB_v10001782mg, partial [Capsella rubella]
Length=254

 Score =   416 bits (1070),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  967  LRRLMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFH  788
             R  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF 
Sbjct  30   FRFNMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFF  89

Query  787  TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCE  608
            TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCE
Sbjct  90   TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCE  149

Query  607  NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVN  428
            NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N
Sbjct  150  NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQN  209

Query  427  LHFVESPALAPPEVQIDIAAQQKHE  353
            LHFVESPALAPPEV +DIAAQQ++E
Sbjct  210  LHFVESPALAPPEVHLDIAAQQQNE  234



>ref|XP_008775034.1| PREDICTED: GTP-binding nuclear protein Ran-A1 [Phoenix dactylifera]
Length=221

 Score =   415 bits (1066),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP QQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPGQQAVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQIDIAAQQ++E E+  AA QPLP
Sbjct  181  ESPALAPPEVQIDIAAQQQYEAEIAAAAAQPLP  213



>ref|XP_010918870.1| PREDICTED: GTP-binding nuclear protein Ran-A1-like [Elaeis guineensis]
Length=273

 Score =   416 bits (1070),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/216 (93%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  964  RRLMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHT  785
            R  MALP QQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF T
Sbjct  50   RSKMALPGQQAVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFT  109

Query  784  NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCEN  605
            NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCEN
Sbjct  110  NCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCEN  169

Query  604  IPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNL  425
            IPIVLCGNKVDVKNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NL
Sbjct  170  IPIVLCGNKVDVKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNL  229

Query  424  HFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            HFVESPALAPPEVQID+AAQQ++E E+  AA QPLP
Sbjct  230  HFVESPALAPPEVQIDLAAQQQYEAEIAAAAAQPLP  265



>gb|KDO61662.1| hypothetical protein CISIN_1g027607mg [Citrus sinensis]
Length=199

 Score =   414 bits (1063),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQK  359
            ESPALAPPEVQID+AAQQ+
Sbjct  181  ESPALAPPEVQIDLAAQQQ  199



>ref|XP_004969141.1| PREDICTED: GTP-binding nuclear protein Ran-1-like [Setaria italica]
Length=221

 Score =   414 bits (1065),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 192/210 (91%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQC +IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCGIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKK+LQYYE+SAKSNYNFEKPFLYLA+KLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKSLQYYEVSAKSNYNFEKPFLYLAKKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQ  326
            ESPAL PP+V ID+ AQQ+HE +L  AA Q
Sbjct  181  ESPALRPPDVTIDMVAQQQHEADLVIAAAQ  210



>gb|ABD17865.1| putative RAN2 small Ras GTP-binding nuclear protein [Allium sativum]
Length=220

 Score =   414 bits (1064),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEV +DIAAQQ++E
Sbjct  181  ESPALAPPEVHLDIAAQQQNE  201



>ref|XP_010925148.1| PREDICTED: GTP-binding nuclear protein Ran-A1 [Elaeis guineensis]
Length=221

 Score =   414 bits (1064),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP QQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPGQQAVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD +LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPSLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQQ+HE E+  AA QPLP
Sbjct  181  ESPALAPPEVQIDLAAQQQHEAEIAAAAAQPLP  213



>ref|XP_009403004.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   414 bits (1064),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 197/200 (99%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            ESPALAPPEVQID+ AQQ+H
Sbjct  181  ESPALAPPEVQIDLVAQQQH  200



>ref|NP_197502.1| GTP-binding nuclear protein Ran-2 [Arabidopsis thaliana]
 ref|XP_002871917.1| hypothetical protein ARALYDRAFT_910041 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006286565.1| hypothetical protein CARUB_v10001918mg [Capsella rubella]
 ref|XP_010420833.1| PREDICTED: GTP-binding nuclear protein Ran-2 [Camelina sativa]
 ref|XP_010454296.1| PREDICTED: GTP-binding nuclear protein Ran-2 [Camelina sativa]
 ref|XP_010493093.1| PREDICTED: GTP-binding nuclear protein Ran-2 isoform X1 [Camelina 
sativa]
 ref|XP_010493094.1| PREDICTED: GTP-binding nuclear protein Ran-2 isoform X2 [Camelina 
sativa]
 sp|P41917.3|RAN2_ARATH RecName: Full=GTP-binding nuclear protein Ran-2; AltName: Full=Ras-related 
nuclear protein 2 [Arabidopsis thaliana]
 gb|AAK44152.1|AF370337_1 putative RAN2 small Ras GTP-binding nuclear protein Ran-2 [Arabidopsis 
thaliana]
 gb|AAL34171.1| putative RAN2 small Ras GTP-binding nuclear protein Ran-2 [Arabidopsis 
thaliana]
 gb|AAN17401.1| RAN2 small Ras-like GTP-binding nuclear protein (Ran-2) [Arabidopsis 
thaliana]
 gb|AAN31806.1| putative RAN2 small Ras GTP-binding nuclear protein (Ran-2) [Arabidopsis 
thaliana]
 gb|AAP13372.1| At5g20020 [Arabidopsis thaliana]
 dbj|BAE98909.1| small Ras-like GTP-binding protein [Arabidopsis thaliana]
 gb|EFH48176.1| hypothetical protein ARALYDRAFT_910041 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92780.1| GTP-binding nuclear protein Ran-2 [Arabidopsis thaliana]
 gb|EOA19463.1| hypothetical protein CARUB_v10001918mg [Capsella rubella]
Length=221

 Score =   414 bits (1063),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 198/201 (99%), Gaps = 0/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEV +DIAAQQ++E
Sbjct  181  ESPALAPPEVHLDIAAQQQNE  201



>ref|XP_010098985.1| GTP-binding nuclear protein Ran-3 [Morus notabilis]
 gb|EXB76287.1| GTP-binding nuclear protein Ran-3 [Morus notabilis]
Length=302

 Score =   417 bits (1071),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 203/217 (94%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = -2

Query  967  LRRLMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFH  788
            L   +ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF 
Sbjct  78   LESYLALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFF  137

Query  787  TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCE  608
            TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCE
Sbjct  138  TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCE  197

Query  607  NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVN  428
            NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N
Sbjct  198  NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPN  257

Query  427  LHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            LHFVESPALAPPEV ID+AAQQ HE EL +AA QPLP
Sbjct  258  LHFVESPALAPPEVHIDLAAQQLHEAELAQAAAQPLP  294



>gb|ADK70386.2| Ran3B [Dimocarpus longan]
 gb|AEM97815.1| Ran3B-2 [Dimocarpus longan]
 gb|AEM97816.1| Ran3B-3 [Dimocarpus longan]
 gb|AEM97817.1| Ran3B-4 [Dimocarpus longan]
 gb|AEM97818.1| Ran3B-5 [Dimocarpus longan]
 gb|AEM97819.1| Ran3B-6 [Dimocarpus longan]
 gb|AEM97820.1| Ran3B-7 [Dimocarpus longan]
 gb|AFD93404.1| Ras-like GTP-binding protein 3B-8 [Dimocarpus longan]
 gb|AFD93405.1| Ras-like GTP-binding protein 3B-9 [Dimocarpus longan]
 gb|AEY78527.2| Ras-like GTP-binding nuclear protein Ran3B [Dimocarpus longan]
Length=221

 Score =   413 bits (1062),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTV+YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVNYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDV+NRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVRNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEV ID+AAQQ HE EL  AA+QPLP
Sbjct  181  ESPALAPPEVHIDLAAQQHHEAELAAAASQPLP  213



>gb|AHA44505.1| GTP-binding nuclear protein Ran3A, partial [Musa AB Group]
Length=198

 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/198 (97%), Positives = 196/198 (99%), Gaps = 0/198 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQ  362
            ESPALAPPEVQID+AAQQ
Sbjct  181  ESPALAPPEVQIDLAAQQ  198



>ref|XP_006400567.1| hypothetical protein EUTSA_v10014622mg [Eutrema salsugineum]
 gb|ESQ42020.1| hypothetical protein EUTSA_v10014622mg [Eutrema salsugineum]
Length=221

 Score =   413 bits (1061),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEV ID A QQK+E
Sbjct  181  ESPALAPPEVHIDFAEQQKNE  201



>ref|XP_006827532.1| hypothetical protein AMTR_s00009p00207870 [Amborella trichopoda]
 gb|ERM94948.1| hypothetical protein AMTR_s00009p00207870 [Amborella trichopoda]
Length=221

 Score =   412 bits (1060),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQ VDYP+FKLVIVGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQQVDYPNFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+PALAPPEV ID+ AQQ+HE EL  AA QPLP
Sbjct  181  EAPALAPPEVHIDMVAQQQHEAELAAAAAQPLP  213



>emb|CAA66048.1| atran2 [Arabidopsis thaliana]
Length=221

 Score =   412 bits (1059),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEV +DIAAQ K+E
Sbjct  181  ESPALAPPEVHLDIAAQPKNE  201



>ref|XP_007154954.1| hypothetical protein PHAVU_003G161100g [Phaseolus vulgaris]
 gb|ESW26948.1| hypothetical protein PHAVU_003G161100g [Phaseolus vulgaris]
Length=221

 Score =   412 bits (1058),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP  Q VDYPSFKLVIVGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDFHTNCG
Sbjct  1    MALPQHQPVDYPSFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFHTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   RIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLA+KLAGD  LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLAKKLAGDSGLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E PALAPP+V ID+  QQ +E EL +AA QPLP
Sbjct  181  EMPALAPPDVVIDLVTQQMNEEELAKAAAQPLP  213



>gb|ABD17864.1| putative RAN2 small Ras GTP-binding nuclear protein [Allium cepa]
Length=221

 Score =   412 bits (1058),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 193/201 (96%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NL FV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLRFV  180

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEV +DIAAQQ++E
Sbjct  181  ESPALAPPEVHLDIAAQQQNE  201



>ref|XP_001757701.1| ran-family small GTPase [Physcomitrella patens]
 gb|EDQ77341.1| ran-family small GTPase [Physcomitrella patens]
Length=223

 Score =   412 bits (1058),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 203/214 (95%), Gaps = 1/214 (0%)
 Frame = -2

Query  955  MALPNQQTVDY-PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MALP Q T D  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  1    MALPGQTTPDNCPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            G+IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIP
Sbjct  61   GRIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKP+LYLARKLAGDVNLHF
Sbjct  121  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPYLYLARKLAGDVNLHF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPALAPPEVQID+AAQ ++E EL +A + PLP
Sbjct  181  VESPALAPPEVQIDLAAQAQYEAELAKAQSMPLP  214



>gb|AFK47539.1| unknown [Medicago truncatula]
Length=202

 Score =   410 bits (1054),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 193/198 (97%), Positives = 195/198 (98%), Gaps = 0/198 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQ TFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQGTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQ  362
            ESPALAPPEVQID+AAQQ
Sbjct  181  ESPALAPPEVQIDLAAQQ  198



>ref|XP_008367713.1| PREDICTED: GTP-binding nuclear protein Ran1-like [Malus domestica]
Length=222

 Score =   410 bits (1055),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN G
Sbjct  1    MALPNQPTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNFG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFY WDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYSWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG+ +LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGNNDLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQ  326
            ESPALAPPEV ID+A Q KHE EL++AA Q
Sbjct  181  ESPALAPPEVHIDMAVQAKHEQELKDAAAQ  210



>gb|AFK40430.1| unknown [Lotus japonicus]
Length=248

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALP QQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK
Sbjct  30   ALPQQQVVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  89

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIV
Sbjct  90   IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  149

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLA+KLAGD   HFVE
Sbjct  150  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLAKKLAGDPGFHFVE  209

Query  412  SPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
             PALAPP+V +D+ +QQ +E EL  AANQPLP
Sbjct  210  MPALAPPDVVLDLTSQQMNEQELLIAANQPLP  241



>ref|NP_001043550.1| Os01g0611100 [Oryza sativa Japonica Group]
 sp|Q7F7I7.1|RAN1_ORYSJ RecName: Full=GTP-binding nuclear protein Ran-1; Short=OsRan1; 
AltName: Full=Ras-related nuclear protein 1 [Oryza sativa 
Japonica Group]
 sp|A2WSI7.2|RAN1_ORYSI RecName: Full=GTP-binding nuclear protein Ran-1; Short=OsRan1; 
AltName: Full=Ras-related nuclear protein 1 [Oryza sativa 
Indica Group]
 dbj|BAA34943.1| Ran [Oryza sativa (japonica cultivar-group)]
 dbj|BAB21295.1| putative GTP-binding protein Ran/TC4 [Oryza sativa Japonica Group]
 dbj|BAB82437.1| small GTP-binding protein (Ran1) [Oryza sativa Japonica Group]
 dbj|BAB93265.1| putative GTP-binding protein Ran/TC4 [Oryza sativa Japonica Group]
 dbj|BAF05464.1| Os01g0611100 [Oryza sativa Japonica Group]
 dbj|BAG93118.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   410 bits (1053),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 197/200 (99%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+PALAPP+V ID+AAQQ+H
Sbjct  181  ETPALAPPDVTIDLAAQQQH  200



>ref|XP_001760725.1| ran-family small GTPase [Physcomitrella patens]
 gb|EDQ74464.1| ran-family small GTPase [Physcomitrella patens]
Length=223

 Score =   409 bits (1051),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 201/214 (94%), Gaps = 1/214 (0%)
 Frame = -2

Query  955  MALPNQQTVDY-PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MALP QQT D  PSFKLVIVGDGGTGKTTFVKRHLTGEFEK+YEPTIGVEVHPLDF TNC
Sbjct  1    MALPGQQTPDNCPSFKLVIVGDGGTGKTTFVKRHLTGEFEKRYEPTIGVEVHPLDFFTNC  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            G+IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIP
Sbjct  61   GRIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF
Sbjct  121  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPALAPPEV IDIA Q ++E EL +A   PLP
Sbjct  181  VESPALAPPEVHIDIAQQAQYEAELAQAQALPLP  214



>ref|XP_011072255.1| PREDICTED: GTP-binding nuclear protein Ran2-like [Sesamum indicum]
Length=221

 Score =   408 bits (1049),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+Q TVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN G
Sbjct  1    MALPDQPTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNFG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHG CA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGNCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNK+DVKNRQVKAKQ+TFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  +L+FV
Sbjct  121  VLCGNKIDVKNRQVKAKQITFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGAPDLYFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQ D+  Q KHE EL+ A NQPLP
Sbjct  181  ESPALAPPEVQFDLVEQLKHEEELKTAMNQPLP  213



>gb|AHA44506.1| GTP-binding nuclear protein Ran3F, partial [Musa AB Group]
Length=198

 Score =   407 bits (1046),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 190/198 (96%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            K RFYCWDTAGQEKFGGLRDGYYI GQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KTRFYCWDTAGQEKFGGLRDGYYIRGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYELSAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQ  362
            ESPALAPPEVQID+AAQQ
Sbjct  181  ESPALAPPEVQIDLAAQQ  198



>sp|P54765.1|RAN1A_LOTJA RecName: Full=GTP-binding nuclear protein Ran1A, partial [Lotus 
japonicus]
 emb|CAA98187.1| RAN1A [Lotus japonicus]
Length=209

 Score =   407 bits (1047),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  919  SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQ  740
            +FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQ
Sbjct  1    NFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQ  60

Query  739  EKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNR  560
            EKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNR
Sbjct  61   EKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNR  120

Query  559  QVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQI  380
            QVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQI
Sbjct  121  QVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQI  180

Query  379  DIAAQQKHELELQEAANQPLP  317
            D+AAQQ+HE EL +AA+QPLP
Sbjct  181  DLAAQQQHEAELAQAASQPLP  201



>ref|XP_009399763.1| PREDICTED: GTP-binding nuclear protein Ran-2-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   407 bits (1047),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/197 (96%), Positives = 194/197 (98%), Gaps = 0/197 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VTFHRKKN QYYEISAKSNYNFEKPFLYLARKL+GD++LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKMVTFHRKKNFQYYEISAKSNYNFEKPFLYLARKLSGDLSLHFV  180

Query  415  ESPALAPPEVQIDIAAQ  365
            ESPALAPPEV ID+AAQ
Sbjct  181  ESPALAPPEVHIDLAAQ  197



>dbj|BAP11913.1| Ran-GTPase [Citrullus lanatus]
Length=221

 Score =   407 bits (1047),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN G
Sbjct  1    MALPNQATVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNYG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG+  LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGNPELHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+AAQ +HE EL +AA QPLP
Sbjct  181  ESPALAPPEVQIDLAAQAQHEAELAQAAAQPLP  213



>ref|NP_001240919.1| uncharacterized protein LOC100775298 [Glycine max]
 gb|ACU20637.1| unknown [Glycine max]
Length=221

 Score =   407 bits (1047),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP Q TVDYPSFKLVIVGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDFHTNCG
Sbjct  1    MALPQQHTVDYPSFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFHTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +IRFYCWDTAGQEKFGGLRDGYYIHG CA+IMFDVTAR+TY+NV TWHRDLCRVCENIPI
Sbjct  61   RIRFYCWDTAGQEKFGGLRDGYYIHGHCAIIMFDVTARMTYRNVATWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLA+KLAGD  LHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLAKKLAGDQGLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E PALAPP+V IDIA QQ +E E+  AA QPLP
Sbjct  181  EMPALAPPDVVIDIATQQLNEEEICRAAAQPLP  213



>sp|P54766.1|RAN1B_LOTJA RecName: Full=GTP-binding nuclear protein Ran1B, partial [Lotus 
japonicus]
 emb|CAA98188.1| RAN1B [Lotus japonicus]
Length=209

 Score =   406 bits (1044),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 191/201 (95%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  919  SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQ  740
            +FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQ
Sbjct  1    NFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQ  60

Query  739  EKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNR  560
            EKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNR
Sbjct  61   EKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNR  120

Query  559  QVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQI  380
            QVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQI
Sbjct  121  QVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQI  180

Query  379  DIAAQQKHELELQEAANQPLP  317
            D+AAQQ+HE EL  AA+QPLP
Sbjct  181  DLAAQQQHEAELAAAASQPLP  201



>ref|XP_002972496.1| RAN, ras family GTPase [Selaginella moellendorffii]
 ref|XP_002984327.1| RAN, ras family GTPase [Selaginella moellendorffii]
 gb|EFJ14837.1| RAN, ras family GTPase [Selaginella moellendorffii]
 gb|EFJ26582.1| RAN, ras family GTPase [Selaginella moellendorffii]
Length=221

 Score =   407 bits (1045),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MA+P Q T    SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPT+GVEVHPLDF TNCG
Sbjct  1    MAMPGQATPGEVSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTMGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            ++RFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   RLRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E+PALAPPEV ID+AAQQ +E E+  AA QPLP
Sbjct  181  ETPALAPPEVHIDLAAQQLNEQEMNNAAAQPLP  213



>ref|XP_004969312.1| PREDICTED: GTP-binding nuclear protein Ran-2-like [Setaria italica]
 ref|XP_008655237.1| PREDICTED: uncharacterized protein LOC100382806 isoform X1 [Zea 
mays]
 gb|AFW83429.1| ran GTP binding protein [Zea mays]
Length=221

 Score =   406 bits (1044),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQVVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFSTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+ AL PPEVQID+A QQ+H
Sbjct  181  EAVALKPPEVQIDMAMQQQH  200



>ref|XP_009403002.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   406 bits (1043),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 196/200 (98%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MAL NQQTVD+PSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALSNQQTVDFPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRF CWDTAGQEKFGGLRDGYYI+GQCA+IMFDVTARLTYKNVPTWHRDLCRVCEN+PI
Sbjct  61   KIRFNCWDTAGQEKFGGLRDGYYINGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENVPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            ESPALAPPEVQID+AAQQ+H
Sbjct  181  ESPALAPPEVQIDLAAQQQH  200



>ref|XP_006841900.1| hypothetical protein AMTR_s00042p00113180 [Amborella trichopoda]
 gb|ERN03575.1| hypothetical protein AMTR_s00042p00113180 [Amborella trichopoda]
Length=221

 Score =   405 bits (1042),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MAL NQQ VDYP+FKLVIVGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALLNQQQVDYPNFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEVQID+A Q +HE
Sbjct  181  ESPALAPPEVQIDMATQLQHE  201



>gb|KHN27403.1| GTP-binding nuclear protein Ran-1 [Glycine soja]
Length=278

 Score =   408 bits (1048),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = -2

Query  961  RLMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTN  782
            RL ALP Q TVDYPSFKLVIVGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEVHPLDFHTN
Sbjct  56   RLGALPQQHTVDYPSFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFHTN  115

Query  781  CGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENI  602
            CG+IRFYCWDTAGQEKFGGLRDGYYIHG CA+IMFDVTAR+TY+NV TWHRDLCRVCENI
Sbjct  116  CGRIRFYCWDTAGQEKFGGLRDGYYIHGHCAIIMFDVTARMTYRNVATWHRDLCRVCENI  175

Query  601  PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLH  422
            PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLA+KLAGD  LH
Sbjct  176  PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLAKKLAGDQGLH  235

Query  421  FVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            FVE PALAPP+V IDIA QQ +E E+  AA QPLP
Sbjct  236  FVEMPALAPPDVVIDIATQQLNEEEICRAAAQPLP  270



>gb|EAZ12660.1| hypothetical protein OsJ_02575 [Oryza sativa Japonica Group]
Length=421

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 197/200 (99%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            +ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  201  LALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  260

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  261  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  320

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  321  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNLHFV  380

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+PALAPP+V ID+AAQQ+H
Sbjct  381  ETPALAPPDVTIDLAAQQQH  400



>ref|XP_002455940.1| hypothetical protein SORBIDRAFT_03g027660 [Sorghum bicolor]
 gb|EES01060.1| hypothetical protein SORBIDRAFT_03g027660 [Sorghum bicolor]
Length=220

 Score =   405 bits (1041),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 187/200 (94%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTV+YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG
Sbjct  1    MALPNQQTVNYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
             IRFYCWDTAGQEKFGGLRDGYYIHGQC +IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   MIRFYCWDTAGQEKFGGLRDGYYIHGQCGIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKK+LQYYE+SAKSNYNFEKPFLYLARKLAGD NL FV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKSLQYYEVSAKSNYNFEKPFLYLARKLAGDCNLRFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            ESPALAPP+V ID+AAQQ+H
Sbjct  181  ESPALAPPDVTIDMAAQQQH  200



>gb|AFW83430.1| ran GTP binding protein [Zea mays]
Length=233

 Score =   405 bits (1041),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            L ALPNQQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  12   LPALPNQQVVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFSTNC  71

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIP
Sbjct  72   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIP  131

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHF
Sbjct  132  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHF  191

Query  418  VESPALAPPEVQIDIAAQQKH  356
            VE+ AL PPEVQID+A QQ+H
Sbjct  192  VEAVALKPPEVQIDMAMQQQH  212



>ref|XP_008219916.1| PREDICTED: GTP-binding nuclear protein Ran-3-like, partial [Prunus 
mume]
Length=214

 Score =   404 bits (1039),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -2

Query  934  TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCW  755
            TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCW
Sbjct  1    TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCW  60

Query  754  DTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKV  575
            DTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKV
Sbjct  61   DTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKV  120

Query  574  DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAP  395
            DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG+  L FVESPALAP
Sbjct  121  DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGETELRFVESPALAP  180

Query  394  PEVQIDIAAQQKHELELQEAANQ  326
            PEVQID+A Q KHE EL +AA Q
Sbjct  181  PEVQIDMAVQAKHEQELAQAAAQ  203



>ref|XP_010688087.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   404 bits (1038),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTV+YPSFKLVIVGDGGTGKTTFVKRH TGEFEKKYEPTIGVEVHPLDF TN G
Sbjct  1    MALPNQQTVEYPSFKLVIVGDGGTGKTTFVKRHRTGEFEKKYEPTIGVEVHPLDFTTNRG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            K+RFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KVRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYN+EKPFLYL RKLAGD NL F 
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNYEKPFLYLVRKLAGDPNLIFS  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E  AL PPEV ID+ AQQ+HE EL  AA QPLP
Sbjct  181  EELALVPPEVSIDLVAQQQHEQELLRAAAQPLP  213



>gb|AFW83428.1| hypothetical protein ZEAMMB73_449857 [Zea mays]
Length=220

 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 188/198 (95%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQVVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFSTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQ  362
            E+ AL PPEVQID+A QQ
Sbjct  181  EAVALKPPEVQIDMAMQQ  198



>ref|NP_001131881.1| GTP-binding nuclear protein Ran-A1 [Zea mays]
 ref|XP_002441556.1| hypothetical protein SORBIDRAFT_09g029250 [Sorghum bicolor]
 ref|XP_004961145.1| PREDICTED: GTP-binding nuclear protein Ran-2-like [Setaria italica]
 ref|XP_008650047.1| PREDICTED: GTP-binding nuclear protein Ran-2 [Zea mays]
 gb|ACF88287.1| unknown [Zea mays]
 gb|ACG30243.1| GTP-binding nuclear protein Ran-A1 [Zea mays]
 gb|EES19986.1| hypothetical protein SORBIDRAFT_09g029250 [Sorghum bicolor]
 gb|AFW79279.1| GTP-binding nuclear protein Ran-A1 [Zea mays]
Length=221

 Score =   402 bits (1033),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+ AL PPEV ID+A QQ+H
Sbjct  181  EAVALKPPEVTIDMAMQQQH  200



>ref|NP_001149221.1| LOC100282843 [Zea mays]
 gb|ACG34606.1| GTP-binding nuclear protein Ran-A1 [Zea mays]
Length=221

 Score =   402 bits (1033),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQGVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFSTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKF GLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFDGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+ AL PPEVQID+A QQ+H
Sbjct  181  EAVALKPPEVQIDMALQQQH  200



>gb|EAY74933.1| hypothetical protein OsI_02827 [Oryza sativa Indica Group]
Length=442

 Score =   410 bits (1054),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGK
Sbjct  223  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGK  282

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPIV
Sbjct  283  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIV  342

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAKQVTFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFVE
Sbjct  343  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNLHFVE  402

Query  412  SPALAPPEVQIDIAAQQKH  356
            +PALAPP+V ID+AAQQ+H
Sbjct  403  TPALAPPDVTIDLAAQQQH  421



>gb|ACM68936.1| Ran-related GTP-binding protein [Festuca arundinacea]
Length=221

 Score =   402 bits (1032),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 187/200 (94%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+ AL PPEV  D+A QQ+H
Sbjct  181  EAVALKPPEVTFDLAMQQQH  200



>ref|NP_001056390.1| Os05g0574500 [Oryza sativa Japonica Group]
 ref|XP_006654825.1| PREDICTED: GTP-binding nuclear protein Ran-2-like [Oryza brachyantha]
 sp|Q7GD79.1|RAN2_ORYSJ RecName: Full=GTP-binding nuclear protein Ran-2; Short=OsRan2; 
AltName: Full=Ras-related nuclear protein 2 [Oryza sativa 
Japonica Group]
 sp|A2Y7R5.1|RAN2_ORYSI RecName: Full=GTP-binding nuclear protein Ran-2; Short=OsRan2; 
AltName: Full=Ras-related nuclear protein 2 [Oryza sativa 
Indica Group]
 dbj|BAA81911.1| Ran [Oryza sativa (japonica cultivar-group)]
 dbj|BAB82438.1| small GTP-binding protein (Ran2) [Oryza sativa Japonica Group]
 gb|AAT69585.1| GTP-binding nuclear protein RAN-B1 [Oryza sativa Japonica Group]
 dbj|BAF18304.1| Os05g0574500 [Oryza sativa Japonica Group]
 gb|EAY99125.1| hypothetical protein OsI_21085 [Oryza sativa Indica Group]
 dbj|BAG69138.1| GTP-binding nuclear protein Ran-1 [Oryza sativa Japonica Group]
 dbj|BAG88061.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93796.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64779.1| hypothetical protein OsJ_19635 [Oryza sativa Japonica Group]
Length=221

 Score =   401 bits (1031),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+ AL PPEV ID+A QQ+H
Sbjct  181  EAVALKPPEVPIDLAMQQQH  200



>gb|ABK23073.1| unknown [Picea sitchensis]
Length=220

 Score =   401 bits (1030),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 200/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP Q   D PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPGQH-ADCPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  59

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  60   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  119

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL+GD NLHFV
Sbjct  120  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLSGDPNLHFV  179

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQIDIA QQ +E EL  AA QPLP
Sbjct  180  ESPALAPPEVQIDIATQQLYEAELAAAAAQPLP  212



>ref|XP_003566871.1| PREDICTED: GTP-binding nuclear protein Ran-1-like [Brachypodium 
distachyon]
Length=285

 Score =   403 bits (1036),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALP QQTVDYPSFKLV++GDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF+TNCGK
Sbjct  66   ALPGQQTVDYPSFKLVLIGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFYTNCGK  125

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPIV
Sbjct  126  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIV  185

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAKQVTFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD N+HFVE
Sbjct  186  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNVHFVE  245

Query  412  SPALAPPEVQIDIAAQQKH  356
            SPALAPP V ID+A QQ+H
Sbjct  246  SPALAPPLVAIDLALQQQH  264



>ref|XP_001779455.1| ran-family small GTPase [Physcomitrella patens]
 gb|EDQ55733.1| ran-family small GTPase [Physcomitrella patens]
Length=223

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 197/208 (95%), Gaps = 1/208 (0%)
 Frame = -2

Query  955  MALPNQQTVDY-PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MALP Q T D  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  1    MALPGQTTPDNCPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            G+IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRV ENIP
Sbjct  61   GRIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVSENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKP+LYLARKLAGD NLHF
Sbjct  121  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPYLYLARKLAGDANLHF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEA  335
            VESPALAPPEVQID+AAQ ++E EL +A
Sbjct  181  VESPALAPPEVQIDLAAQAQYEAELAKA  208



>ref|XP_003567845.1| PREDICTED: GTP-binding nuclear protein Ran-2 [Brachypodium distachyon]
Length=221

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 185/200 (93%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+ AL PPE+ +D+A QQ+H
Sbjct  181  EAVALKPPEIVLDLAMQQQH  200



>gb|AFW79277.1| hypothetical protein ZEAMMB73_453609 [Zea mays]
Length=228

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            L ALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  7    LQALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNC  66

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIP
Sbjct  67   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIP  126

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHF
Sbjct  127  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHF  186

Query  418  VESPALAPPEVQIDIAAQQKH  356
            VE+ AL PPEV ID+A QQ+H
Sbjct  187  VEAVALKPPEVTIDMAMQQQH  207



>ref|XP_001760763.1| predicted protein [Physcomitrella patens]
 gb|EDQ74502.1| predicted protein [Physcomitrella patens]
Length=275

 Score =   402 bits (1033),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = -2

Query  958  LMALPNQQTVD-YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTN  782
            +MALP QQT D  P FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN
Sbjct  52   IMALPGQQTPDNCPHFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTN  111

Query  781  CGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENI  602
            CG+IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENI
Sbjct  112  CGRIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENI  171

Query  601  PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLH  422
            PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKP+LYLARKLAGD NLH
Sbjct  172  PIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPYLYLARKLAGDPNLH  231

Query  421  FVESPALAPPEVQIDIAAQQKHELELQEA  335
            FVESPALAPPEVQIDIA Q ++E EL +A
Sbjct  232  FVESPALAPPEVQIDIAQQAQYEAELVQA  260



>gb|AAL30396.1|AF433653_1 small Ras-related GTP-binding protein [Triticum aestivum]
 gb|AAM08320.1|AF488730_1 small Ran-related GTP-binding protein [Triticum aestivum]
 dbj|BAJ84948.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFK26593.1| Ran-related GTP-binding protein 1-2 [Triticum aestivum]
 gb|AFK26594.1| Ran-related GTP-binding protein 1-3 [Triticum aestivum]
 gb|EMT17714.1| GTP-binding nuclear protein Ran-2 [Aegilops tauschii]
Length=221

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/200 (93%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQNTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD N+HFV
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNIHFV  180

Query  415  ESPALAPPEVQIDIAAQQKH  356
            E+ AL PPEV  D+A QQ+H
Sbjct  181  EAVALKPPEVTFDLAMQQQH  200



>ref|XP_005846369.1| GTP-binding protein [Chlorella variabilis]
 gb|EFN54267.1| GTP-binding protein [Chlorella variabilis]
Length=223

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 199/214 (93%), Gaps = 1/214 (0%)
 Frame = -2

Query  955  MALPNQQTVD-YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MALP QQT D  PSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN 
Sbjct  1    MALPGQQTPDGVPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNR  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIP
Sbjct  61   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVK KQVTFHRKKNLQY+EISAKSNYN+EKPFLYLARKL GD NLHF
Sbjct  121  IVLCGNKVDVKNRQVKPKQVTFHRKKNLQYHEISAKSNYNYEKPFLYLARKLVGDPNLHF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VE  ALAPPEVQIDI  QQ++E +LQEAAN PLP
Sbjct  181  VEQVALAPPEVQIDIQQQQEYEKQLQEAANMPLP  214



>ref|XP_009345292.1| PREDICTED: GTP-binding nuclear protein Ran1A-like [Pyrus x bretschneideri]
Length=222

 Score =   399 bits (1024),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TV  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN G
Sbjct  1    MALPNQATVYLPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNFG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHG+CA+IMFDVTARLTYKNVPTW RDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGECAIIMFDVTARLTYKNVPTWQRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVK RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  +LHFV
Sbjct  121  VLCGNKVDVKKRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGKNDLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQ  326
            ESPAL PPEV ID+A Q KHE EL++AA Q
Sbjct  181  ESPALGPPEVHIDMAVQAKHEQELKDAAAQ  210



>gb|ABK27124.1| unknown [Picea sitchensis]
 gb|ACN40834.1| unknown [Picea sitchensis]
Length=221

 Score =   395 bits (1015),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 193/201 (96%), Gaps = 1/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP QQ  D PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPGQQ-ADCPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  59

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  60   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  119

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKP+LYLARKL+GD NLHFV
Sbjct  120  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPYLYLARKLSGDPNLHFV  179

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEVQID+A Q ++E
Sbjct  180  ESPALAPPEVQIDMATQLQYE  200



>gb|KCW79960.1| hypothetical protein EUGRSUZ_C01289 [Eucalyptus grandis]
Length=345

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQ VDYP+FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPT GVEVHPLDF TNCG
Sbjct  1    MALPNQQAVDYPNFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTTGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEK GGLR+GYYIHGQCA+IMFDVTAR TYKNVP WHRDLCRVCENIP 
Sbjct  61   KIRFYCWDTAGQEKLGGLREGYYIHGQCAIIMFDVTARWTYKNVPIWHRDLCRVCENIPT  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQV+AKQVTF RKKNLQYYEISAKS YN EKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVEAKQVTFQRKKNLQYYEISAKSKYNLEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E PALAPPEV +D A QQ+HE EL  AA Q LP
Sbjct  181  EPPALAPPEVHMDFAPQQQHEAELAGAAIQALP  213



>gb|ACN40664.1| unknown [Picea sitchensis]
Length=221

 Score =   392 bits (1006),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/201 (93%), Positives = 192/201 (96%), Gaps = 1/201 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP QQ  D PSFKLVIVGD GTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPGQQA-DCPSFKLVIVGDVGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  59

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  60   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  119

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKP+LYLARKL+GD NLHFV
Sbjct  120  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPYLYLARKLSGDPNLHFV  179

Query  415  ESPALAPPEVQIDIAAQQKHE  353
            ESPALAPPEVQID+A Q ++E
Sbjct  180  ESPALAPPEVQIDMATQLQYE  200



>ref|XP_009334775.1| PREDICTED: GTP-binding nuclear protein Ran1A-like [Pyrus x bretschneideri]
Length=222

 Score =   391 bits (1005),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MA   QQTV YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGV+VHPLDF TN G
Sbjct  1    MAFSKQQTVAYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVDVHPLDFCTNFG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
             IRF CWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTW RDLCRVCENIPI
Sbjct  61   WIRFCCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWQRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVD+K RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  +LHFV
Sbjct  121  VLCGNKVDMKKRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGKNDLHFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQ  326
            ESPALAPPEV ID+A Q KHE EL++AA Q
Sbjct  181  ESPALAPPEVHIDMAVQAKHEQELKDAAAQ  210



>gb|KFM25438.1| GTP-binding nuclear protein Ran-A1 [Auxenochlorella protothecoides]
Length=221

 Score =   391 bits (1005),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 197/214 (92%), Gaps = 1/214 (0%)
 Frame = -2

Query  955  MALPNQQTVD-YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MALP Q T D  P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN 
Sbjct  1    MALPGQTTPDGVPAFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNR  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GK+RF+CWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIP
Sbjct  61   GKLRFFCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVK KQVTFHRKKNLQY+EISAKSNYN+EKPFLYLARKL GD NLHF
Sbjct  121  IVLCGNKVDVKNRQVKPKQVTFHRKKNLQYHEISAKSNYNYEKPFLYLARKLVGDPNLHF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VE  ALAPPEVQID+  QQ++E +L EAAN PLP
Sbjct  181  VEQVALAPPEVQIDLQQQQEYERQLTEAANMPLP  214



>ref|XP_006844506.1| hypothetical protein AMTR_s00016p00135360 [Amborella trichopoda]
 gb|ERN06181.1| hypothetical protein AMTR_s00016p00135360 [Amborella trichopoda]
Length=229

 Score =   391 bits (1005),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -2

Query  922  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAG  743
            PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAG
Sbjct  20   PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAG  79

Query  742  QEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN  563
            QEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRD+CRVC+NIPIVLCGNKVDVKN
Sbjct  80   QEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDICRVCDNIPIVLCGNKVDVKN  139

Query  562  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQ  383
            RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHF+ SPAL PPEV+
Sbjct  140  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFIASPALKPPEVE  199

Query  382  IDIAAQQKHELELQEAANQPLP  317
            ID+A QQ  E E+++  +QPLP
Sbjct  200  IDVAQQQLIEEEIRKVVDQPLP  221



>gb|ABK21426.1| unknown [Picea sitchensis]
Length=224

 Score =   391 bits (1004),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  934  TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCW  755
             V+ PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF+TNCGKIRFYCW
Sbjct  11   NVNCPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFYTNCGKIRFYCW  70

Query  754  DTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKV  575
            DTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRD+CRVCE+IPIVLCGNKV
Sbjct  71   DTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDICRVCESIPIVLCGNKV  130

Query  574  DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAP  395
            DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLA+KLAGD NLHFV SPAL P
Sbjct  131  DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLAKKLAGDPNLHFVASPALKP  190

Query  394  PEVQIDIAAQQKHELELQEAANQPLP  317
            PEV ID++ QQ  E E+++ A+QPLP
Sbjct  191  PEVDIDLSQQQHIEEEIRKVADQPLP  216



>ref|XP_001753774.1| predicted protein [Physcomitrella patens]
 gb|EDQ81526.1| predicted protein [Physcomitrella patens]
Length=224

 Score =   390 bits (1003),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  952  ALPNQQTVDY-PSFKLVIVGDGGTG-KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            ALP QQT D  P FKLVIVGDGGTG KTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  2    ALPGQQTPDNCPHFKLVIVGDGGTGRKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNC  61

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            G+IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIP
Sbjct  62   GRIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIP  121

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKP+LYLARKLAGD NLHF
Sbjct  122  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPYLYLARKLAGDPNLHF  181

Query  418  VESPALAPPEVQIDIAAQQKHELELQEA  335
            VESPALAPPEVQIDIA Q   E E+ +A
Sbjct  182  VESPALAPPEVQIDIATQAALEAEIAQA  209



>gb|AEZ49163.1| Ran [Wolffia australiana]
Length=217

 Score =   389 bits (1000),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  940  QQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFY  761
            QQ VD P+FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRF 
Sbjct  2    QQPVDCPNFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFN  61

Query  760  CWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGN  581
            CWDTAGQEKFGGLRDGYYI+GQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGN
Sbjct  62   CWDTAGQEKFGGLRDGYYINGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGN  121

Query  580  KVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPAL  401
            KVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPAL
Sbjct  122  KVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPAL  181

Query  400  APPEVQIDIAAQQKHE  353
            APPEV ID+AAQQ+H+
Sbjct  182  APPEVHIDLAAQQQHK  197



>ref|XP_001753663.1| predicted protein [Physcomitrella patens]
 gb|EDQ81415.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   389 bits (998),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -2

Query  934  TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCW  755
            T    SFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG+IRFYCW
Sbjct  2    TAQVISFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGRIRFYCW  61

Query  754  DTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKV  575
            DTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKV
Sbjct  62   DTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKV  121

Query  574  DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAP  395
            DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKP+LYLARKLAGD NLHFVESPALAP
Sbjct  122  DVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPYLYLARKLAGDPNLHFVESPALAP  181

Query  394  PEVQIDIAAQQKHELELQEA  335
            PEVQIDIA Q   E E+ +A
Sbjct  182  PEVQIDIATQAALEAEIAQA  201



>ref|XP_001691878.1| ran-like small GTPase [Chlamydomonas reinhardtii]
 gb|EDP04368.1| ran-like small GTPase [Chlamydomonas reinhardtii]
Length=223

 Score =   387 bits (995),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 196/214 (92%), Gaps = 1/214 (0%)
 Frame = -2

Query  955  MALPNQQTVD-YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MALP Q T +  P+FKLV+VGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEV PLDF TN 
Sbjct  1    MALPGQTTPEGVPAFKLVLVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVRPLDFTTNR  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIP
Sbjct  61   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVK KQVTFHRKKNLQYYEISAKSNYN+EKPFLYLARKL GD +L F
Sbjct  121  IVLCGNKVDVKNRQVKPKQVTFHRKKNLQYYEISAKSNYNYEKPFLYLARKLTGDPHLSF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VE  AL PPEVQID+A QQ++E EL++AA QPLP
Sbjct  181  VEEVALPPPEVQIDLAEQQRNEAELEQAAQQPLP  214



>gb|ACN40090.1| unknown [Picea sitchensis]
Length=221

 Score =   387 bits (994),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MA    Q VD P+FKLVIVGDGGTGKTTFVKRHLTGEFEK+YEPTIGVEVHPLDF TNCG
Sbjct  1    MAFAGPQ-VDCPNFKLVIVGDGGTGKTTFVKRHLTGEFEKRYEPTIGVEVHPLDFFTNCG  59

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRF CWDTAGQEKFGGLRDGYYI+GQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  60   KIRFNCWDTAGQEKFGGLRDGYYINGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  119

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL+GD NLHFV
Sbjct  120  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLSGDPNLHFV  179

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+A Q ++E EL  AA QPLP
Sbjct  180  ESPALAPPEVQIDMATQHQYEAELAAAAAQPLP  212



>gb|KCW79961.1| hypothetical protein EUGRSUZ_C01291 [Eucalyptus grandis]
Length=407

 Score =   393 bits (1009),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQ VDYPSFKL++VGD GTGKTTFVK+HLTGEFEKKYEPT GVEVHPLDF TNCG
Sbjct  63   MALPNQQNVDYPSFKLLLVGDAGTGKTTFVKKHLTGEFEKKYEPTTGVEVHPLDFFTNCG  122

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEK GGLR+GYYIHGQCA+IMFDVTAR TYKNVP WHRDLCRVCENIP 
Sbjct  123  KIRFYCWDTAGQEKLGGLREGYYIHGQCAIIMFDVTARWTYKNVPIWHRDLCRVCENIPT  182

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQV+AKQVTF RKKNLQYYEISAKS YN EKPFLYLARKLAGD NLHFV
Sbjct  183  VLCGNKVDVKNRQVEAKQVTFQRKKNLQYYEISAKSKYNLEKPFLYLARKLAGDPNLHFV  242

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E PALAPPEV +D A QQ+HE EL  AA Q LP
Sbjct  243  EPPALAPPEVHMDFAPQQQHEAELAGAAIQALP  275



>ref|XP_008657795.1| PREDICTED: GTP-binding nuclear protein Ran1B-like [Zea mays]
Length=293

 Score =   387 bits (995),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = -2

Query  925  YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTA  746
            YP+FKLVIVGDGGT KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTA
Sbjct  83   YPNFKLVIVGDGGTSKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTA  142

Query  745  GQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVK  566
            GQEKFGGLRDGYYIHGQC +IMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVK
Sbjct  143  GQEKFGGLRDGYYIHGQCGIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVK  202

Query  565  NRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEV  386
            N QVKAKQVTF+RKK+LQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFVE+PALAPP+V
Sbjct  203  NMQVKAKQVTFYRKKSLQYYEVSAKSNYNFEKPFLYLARKLAGDSNLHFVETPALAPPDV  262

Query  385  QIDIAAQQKHELELQEAANQPL  320
             ID+AAQQ+HE EL  AA QPL
Sbjct  263  TIDMAAQQQHEAELAAAAAQPL  284



>gb|ACN39828.1| unknown [Picea sitchensis]
Length=221

 Score =   384 bits (986),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 197/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MA    Q VD P+FKLVIVGDG TGKTTFVKRHLTGEFEK+YEPTIGVEVHPLDF TNCG
Sbjct  1    MAFAGPQ-VDCPNFKLVIVGDGCTGKTTFVKRHLTGEFEKRYEPTIGVEVHPLDFFTNCG  59

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRF CWDTAGQEKFGGLRDGYYI+GQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  60   KIRFNCWDTAGQEKFGGLRDGYYINGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  119

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL+GD NLHFV
Sbjct  120  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLSGDPNLHFV  179

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPPEVQID+A Q ++E EL  AA QPLP
Sbjct  180  ESPALAPPEVQIDMATQHQYEAELAAAAAQPLP  212



>ref|XP_010042010.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Eucalyptus 
grandis]
Length=344

 Score =   388 bits (997),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKL++VGD GTGKTTFVK  LTGEFEKKYEPTIGVEVHPLDF TN G
Sbjct  1    MALPNQQTVDYPSFKLLLVGDAGTGKTTFVKSLLTGEFEKKYEPTIGVEVHPLDFFTNRG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            K+RFYCWDTAGQEK GGLR+GYYIHGQCA+IMFDV AR+TYKNVP WHRDLCRVCENIPI
Sbjct  61   KMRFYCWDTAGQEKLGGLREGYYIHGQCAIIMFDVAARMTYKNVPRWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK+VTF RKKNLQYYEISAKS YN EKP LYLARKLAGD NLHF+
Sbjct  121  VLCGNKVDVKNRQVKAKKVTFQRKKNLQYYEISAKSKYNLEKPLLYLARKLAGDPNLHFL  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E PALAPP   +D+A QQ+HE EL EAA QPLP
Sbjct  181  ELPALAPPAAHMDLAPQQQHEAELAEAATQPLP  213



>ref|XP_010047934.1| PREDICTED: GTP-binding nuclear protein Ran-2-like [Eucalyptus 
grandis]
Length=199

 Score =   382 bits (980),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQ VDYP+FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPT GVEVHPLDF TNCG
Sbjct  1    MALPNQQAVDYPNFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTTGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEK GGLR+GYYIHGQCA+IMFDVTAR TYKNVP WHRDLCRVCENIP 
Sbjct  61   KIRFYCWDTAGQEKLGGLREGYYIHGQCAIIMFDVTARWTYKNVPIWHRDLCRVCENIPT  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQV+AKQVTF RKKNLQYYEISAKS YN EKPFLYLARKLAGD NLHFV
Sbjct  121  VLCGNKVDVKNRQVEAKQVTFQRKKNLQYYEISAKSKYNLEKPFLYLARKLAGDPNLHFV  180

Query  415  ESPALAPPEVQIDIAAQQK  359
            E PALAPPEV +D A QQ+
Sbjct  181  EPPALAPPEVHMDFAPQQQ  199



>gb|AED99252.1| small Ras GTP-binding nuclear protein [Dimocarpus longan]
Length=185

 Score =   379 bits (974),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -2

Query  880  KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIH  701
            KTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIH
Sbjct  1    KTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIH  60

Query  700  GQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK  521
            GQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK
Sbjct  61   GQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKK  120

Query  520  NLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELELQ  341
            NLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQID+AAQQ+HE ELQ
Sbjct  121  NLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDLAAQQQHEAELQ  180

Query  340  EAANQ  326
             AA+Q
Sbjct  181  AAASQ  185



>gb|KFK27116.1| hypothetical protein AALP_AA8G336700 [Arabis alpina]
Length=214

 Score =   380 bits (976),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 190/214 (89%), Gaps = 1/214 (0%)
 Frame = -2

Query  955  MALPNQQ-TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MA  NQQ  VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEK Y+PTIGV+VHPLDF TN 
Sbjct  1    MAFYNQQQVVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKIYKPTIGVDVHPLDFFTNH  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRF CWDTAGQEK GGLRDGYYIHGQCA+IMFDVTAR+TYKNVPTW+ DLCRVCENIP
Sbjct  61   GKIRFDCWDTAGQEKLGGLRDGYYIHGQCAIIMFDVTARITYKNVPTWYNDLCRVCENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVK KQ+TFHRKKNLQYYEISAKSNYNFEKPFLY AR+LAGD NLHF
Sbjct  121  IVLCGNKVDVKNRQVKTKQITFHRKKNLQYYEISAKSNYNFEKPFLYFARRLAGDANLHF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VESPALAPPEV IDIA Q  +E EL  AA    P
Sbjct  181  VESPALAPPEVDIDIAHQHMNETELIHAAKSTTP  214



>ref|XP_004965963.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Setaria italica]
Length=221

 Score =   376 bits (965),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPN Q VDYPSFKLV+VGDGGTGKTTFVKRH++GEFEK+YEPTIGVEV PLDF T+ G
Sbjct  1    MALPNTQPVDYPSFKLVLVGDGGTGKTTFVKRHISGEFEKRYEPTIGVEVRPLDFTTSHG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            K+RFYCWDTAGQEKFGGLRDGYYI+GQCA+IMFDVT+RLTYKNVPTWHRD+ RVCENIP+
Sbjct  61   KLRFYCWDTAGQEKFGGLRDGYYINGQCAIIMFDVTSRLTYKNVPTWHRDISRVCENIPV  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VT+HRKKNLQYYEISAKSNYNFEKPFLYLARKLAG+++L F 
Sbjct  121  VLCGNKVDVKNRQVKAKMVTYHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGNMDLRFE  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
               AL P +V ID+AAQ+K E E+  AA+ PLP
Sbjct  181  AEIALVPADVTIDLAAQKKIEEEITAAASMPLP  213



>gb|AAA32852.1| small ras-related protein, partial [Arabidopsis thaliana]
Length=203

 Score =   374 bits (961),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/183 (96%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -2

Query  901  VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGL  722
            VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGL
Sbjct  1    VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGL  60

Query  721  RDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQ  542
            RDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQ
Sbjct  61   RDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQ  120

Query  541  VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQ  362
            VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEV +DIAAQ 
Sbjct  121  VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVESPALAPPEVHLDIAAQP  180

Query  361  KHE  353
            K+E
Sbjct  181  KNE  183



>gb|AGT16632.1| hypothetical protein SHCRBa_265_I24_F_300 [Saccharum hybrid cultivar 
R570]
Length=258

 Score =   375 bits (964),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 198/220 (90%), Gaps = 1/220 (0%)
 Frame = -2

Query  973  QPLRRL-MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPL  797
            + L RL  ALPN Q VDYPSFKLV+VGDGGTGKTT+VKRH+TGEFEK+YEPTIGVEV PL
Sbjct  31   KALERLDAALPNTQPVDYPSFKLVLVGDGGTGKTTYVKRHITGEFEKRYEPTIGVEVRPL  90

Query  796  DFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCR  617
            DF T+ GKIRFYCWDTAGQEKFGGLRDGYYI+GQCA+IMFDVT+R+TYKNVPTWHRD+ R
Sbjct  91   DFTTSHGKIRFYCWDTAGQEKFGGLRDGYYINGQCAIIMFDVTSRITYKNVPTWHRDISR  150

Query  616  VCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  437
            VCENIP+VLCGNKVDVKNRQVKAK VT+HRKKNLQYYEISAKSNYNFEKPFLYLARKLAG
Sbjct  151  VCENIPVVLCGNKVDVKNRQVKAKAVTYHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  210

Query  436  DVNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ++++ FVE  AL P +V ID+AAQQ+ + E++ AA  PLP
Sbjct  211  NMDVKFVEELALVPADVTIDVAAQQQIDKEIELAAAIPLP  250



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 187/212 (88%), Gaps = 19/212 (9%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALPNQQTVDYPSFKLVIVGDGGT                    TIGVEVHPLDF TNCGK
Sbjct  373  ALPNQQTVDYPSFKLVIVGDGGTA-------------------TIGVEVHPLDFFTNCGK  413

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPIV
Sbjct  414  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  473

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVE
Sbjct  474  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVE  533

Query  412  SPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            SPALAPPEVQID+A QQKHE EL +AANQPLP
Sbjct  534  SPALAPPEVQIDLAEQQKHEAELLQAANQPLP  565



>ref|NP_001174885.1| Os06g0600301 [Oryza sativa Japonica Group]
 sp|Q69XM7.1|RAN3_ORYSJ RecName: Full=GTP-binding nuclear protein Ran-3; Short=OsRan3; 
AltName: Full=Ras-related nuclear protein 3 [Oryza sativa 
Japonica Group]
 sp|A2YEQ6.2|RAN3_ORYSI RecName: Full=GTP-binding nuclear protein Ran-3; Short=OsRan3; 
AltName: Full=Ras-related nuclear protein 3 [Oryza sativa 
Indica Group]
 dbj|BAD32834.1| putative small GTP-binding protein Ran [Oryza sativa Japonica 
Group]
 dbj|BAH93613.1| Os06g0600301 [Oryza sativa Japonica Group]
Length=226

 Score =   372 bits (955),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -2

Query  967  LRRLMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFH  788
            + R  ALP+   V YPSFKL++VGDGGTGKTTFVKRH+TGEFEK+YEPTIGVEV PLDFH
Sbjct  1    MSRAQALPDPAAVGYPSFKLILVGDGGTGKTTFVKRHITGEFEKRYEPTIGVEVRPLDFH  60

Query  787  TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCE  608
            T+ GK+RF CWDTAGQEKFGGLRDGYYIHG CA+IMFDVT+RLTYKNVPTWH+D+CRVC+
Sbjct  61   TSRGKVRFCCWDTAGQEKFGGLRDGYYIHGHCAIIMFDVTSRLTYKNVPTWHKDICRVCD  120

Query  607  NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVN  428
            NIPIVLCGNKVD+KNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL GD+N
Sbjct  121  NIPIVLCGNKVDMKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLTGDMN  180

Query  427  LHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            L FVE  AL P +V ID+ AQQK E E+  AA  PLP
Sbjct  181  LRFVEELALLPADVTIDLIAQQKIETEIAAAAAMPLP  217



>ref|XP_002437238.1| hypothetical protein SORBIDRAFT_10g023370 [Sorghum bicolor]
 gb|EER88605.1| hypothetical protein SORBIDRAFT_10g023370 [Sorghum bicolor]
Length=221

 Score =   372 bits (954),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPN   VD+PSFKLV+VGDGGTGKTT+VKRH+TGEFEK+YEPTIGVEV PLDF T+ G
Sbjct  1    MALPNTPPVDFPSFKLVLVGDGGTGKTTYVKRHITGEFEKRYEPTIGVEVRPLDFTTSHG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYI+GQCA+IMFDVT+R+TYKNVPTWHRD+ RVCENIP+
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYINGQCAIIMFDVTSRITYKNVPTWHRDISRVCENIPV  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VT+HRKKNLQYYEISAKSNYNFEKPFLYLARKLAG++++ FV
Sbjct  121  VLCGNKVDVKNRQVKAKAVTYHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGNMDVKFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E  AL P +V ID+AAQQ+ + E++ AA  PLP
Sbjct  181  EELALVPADVTIDVAAQQQIDKEIELAAAIPLP  213



>ref|XP_002503301.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64559.1| predicted protein [Micromonas sp. RCC299]
Length=215

 Score =   369 bits (948),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -2

Query  922  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAG  743
            P+FKL++VGDGGTGKTTFVKRHLTGEFEKKY PT+GV VHPL+FHTNCG IRF CWDTAG
Sbjct  5    PTFKLILVGDGGTGKTTFVKRHLTGEFEKKYLPTVGVAVHPLEFHTNCGPIRFDCWDTAG  64

Query  742  QEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN  563
            QEKFGGLRDGYYIHGQCA+IMFDVT+R TYKNVPTWHRD+ RVCE+IPIVLCGNKVDV+N
Sbjct  65   QEKFGGLRDGYYIHGQCAIIMFDVTSRTTYKNVPTWHRDITRVCEDIPIVLCGNKVDVRN  124

Query  562  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQ  383
            RQV+AK +TFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD  L FVESPALAPPEV 
Sbjct  125  RQVRAKTITFHRKKNLQYYELSAKSNYNFEKPFLYLARKLAGDPTLQFVESPALAPPEVT  184

Query  382  IDIAAQQKHELELQEAANQPLP  317
            ID A Q ++E EL  AA QPLP
Sbjct  185  IDPAEQAQYEAELANAAAQPLP  206



>gb|EMT14575.1| GTP-binding nuclear protein Ran-3 [Aegilops tauschii]
Length=222

 Score =   369 bits (946),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPN   VDYPSFKLV+VGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEV PLDF T+ G
Sbjct  1    MALPNTPPVDYPSFKLVLVGDGGTGKTTFVKRHVTGEFEKKYEPTIGVEVRPLDFQTSHG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRD+CRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDICRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL+GD+ L FV
Sbjct  121  VLCGNKVDVKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLSGDMTLRFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E  AL P +V +D+AAQQ+ E E+  AA  PLP
Sbjct  181  EETALLPADVTVDLAAQQQIEAEIAAAAAMPLP  213



>ref|XP_005651398.1| ran-like small GTPase [Coccomyxa subellipsoidea C-169]
 gb|EIE26854.1| ran-like small GTPase [Coccomyxa subellipsoidea C-169]
Length=222

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 193/214 (90%), Gaps = 1/214 (0%)
 Frame = -2

Query  955  MALPNQQTVD-YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MALP Q T +  P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN 
Sbjct  1    MALPGQTTPEGVPAFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNR  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GK+RF+CWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCE IP
Sbjct  61   GKLRFFCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCEGIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVK KQVTFHRKKNLQY+EISAKSNYN+EKPFLYLARKL GD NLHF
Sbjct  121  IVLCGNKVDVKNRQVKPKQVTFHRKKNLQYHEISAKSNYNYEKPFLYLARKLVGDPNLHF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VE  AL PPEV ID   Q ++E +LQ+AAN PLP
Sbjct  181  VEQVALKPPEVVIDTVQQAQYEQQLQDAANAPLP  214



>ref|XP_010227550.1| PREDICTED: GTP-binding nuclear protein Ran-3 [Brachypodium distachyon]
Length=221

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPN   VDYP FKLV+VGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEV PLDFHT+ G
Sbjct  1    MALPNTPPVDYPCFKLVLVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVRPLDFHTSHG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRD+CRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDICRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVD+KNRQVKAK VTFHRKK+LQYYEISAKSNYNFEKPFLYLARKL+GD+NL FV
Sbjct  121  VLCGNKVDMKNRQVKAKMVTFHRKKSLQYYEISAKSNYNFEKPFLYLARKLSGDMNLRFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E  AL P +V +D+  QQ+ E E+  AA  PLP
Sbjct  181  EETALLPADVTVDLITQQQIEAEIAAAAAMPLP  213



>ref|XP_001421080.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99373.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=220

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            M+ P Q  V  P+FKL++VGDGGTGKTTFVKRHLTGEFEKKY PT+GV VHPLDFHTNCG
Sbjct  1    MSAPPQGQV--PTFKLILVGDGGTGKTTFVKRHLTGEFEKKYLPTVGVSVHPLDFHTNCG  58

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
             IRF CWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+R TYKNVPTWHRD+ RVCE+IPI
Sbjct  59   PIRFDCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRTTYKNVPTWHRDITRVCEDIPI  118

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDV+NRQV+AK +TFHRKKNLQYYE+SAKSNYNFEKPFLYLARKL+G+  L F 
Sbjct  119  VLCGNKVDVRNRQVRAKSITFHRKKNLQYYELSAKSNYNFEKPFLYLARKLSGNAALQFT  178

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPP VQ+D+A    +E EL +AA QPLP
Sbjct  179  ESPALAPPTVQVDLAEVAAYEKELADAAAQPLP  211



>ref|XP_002957219.1| hypothetical protein VOLCADRAFT_110055 [Volvox carteri f. nagariensis]
 gb|EFJ41717.1| hypothetical protein VOLCADRAFT_110055 [Volvox carteri f. nagariensis]
Length=223

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 193/214 (90%), Gaps = 1/214 (0%)
 Frame = -2

Query  955  MALPNQQTVD-YPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            MALP Q T +  P+FKLV+VGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEV PLDF TN 
Sbjct  1    MALPGQVTPEGVPAFKLVLVGDGGTGKTTFVKRHVTGEFEKKYEPTIGVEVRPLDFSTNR  60

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIP
Sbjct  61   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIP  120

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQVK KQVTFHRKKNLQYYEISAKSNYN+EKPFLYLARKL GD +L F
Sbjct  121  IVLCGNKVDVKNRQVKPKQVTFHRKKNLQYYEISAKSNYNYEKPFLYLARKLTGDPHLSF  180

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VE  AL PPEV ID+A QQ++E EL+ AA  PLP
Sbjct  181  VEEVALPPPEVAIDLAEQQRNEAELEAAAQAPLP  214



>dbj|BAJ84849.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   368 bits (944),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPN Q VD P+FKLV+VGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEV PLDF T+ G
Sbjct  1    MALPNTQPVDCPNFKLVLVGDGGTGKTTFVKRHVTGEFEKKYEPTIGVEVRPLDFQTSHG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRF CWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRD+CRVCENIPI
Sbjct  61   KIRFSCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDICRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVKNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL+GD+ L FV
Sbjct  121  VLCGNKVDVKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLSGDMTLRFV  180

Query  415  ESPALAPPEVQIDIAAQQK  359
            E  AL P +V ID+ AQQ+
Sbjct  181  EETALLPADVTIDLVAQQQ  199



>gb|AFY06646.1| GTP-binding nuclear protein, partial [Carica papaya]
Length=188

 Score =   366 bits (940),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  856  LTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMF  677
            LTGEFEKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMF
Sbjct  1    LTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMF  60

Query  676  DVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEIS  497
            DVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEIS
Sbjct  61   DVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEIS  120

Query  496  AKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            AKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  121  AKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  180



>gb|EMS58389.1| GTP-binding nuclear protein Ran-3 [Triticum urartu]
Length=229

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  952  ALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGK  773
            ALPN   VDYPSFKLV+VGDGGTGKTTFVKRH+TGEFEKKYEPTIGVEV PLDF T+ GK
Sbjct  9    ALPNTPPVDYPSFKLVLVGDGGTGKTTFVKRHVTGEFEKKYEPTIGVEVRPLDFQTSHGK  68

Query  772  IRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIV  593
            IRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRD+CRVCENIPIV
Sbjct  69   IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDICRVCENIPIV  128

Query  592  LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVE  413
            LCGNKVDVKNRQVKAK VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKL+GD+ L FVE
Sbjct  129  LCGNKVDVKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLSGDMTLRFVE  188

Query  412  SPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
              AL P +V +D+AAQQ+ E E+  AA  PLP
Sbjct  189  ETALLPADVTVDLAAQQQIEAEIAAAAAMPLP  220



>gb|KDO80348.1| hypothetical protein CISIN_1g027593mg [Citrus sinensis]
Length=176

 Score =   365 bits (936),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/176 (97%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+QQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVN  428
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  +
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGSTD  176



>gb|KDO80349.1| hypothetical protein CISIN_1g027593mg [Citrus sinensis]
 gb|KDO80350.1| hypothetical protein CISIN_1g027593mg [Citrus sinensis]
Length=173

 Score =   364 bits (934),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALP+QQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPSQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  437
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  173



>gb|AGG87096.1| GTP-binding nuclear protein Ran3A-1a [Musa AB Group]
Length=195

 Score =   363 bits (933),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYPSFKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  437
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  173



>ref|XP_003082592.1| GTP-binding protein (ISS) [Ostreococcus tauri]
 emb|CAL56449.1| Small GTPase superfamily, Rho type [Ostreococcus tauri]
Length=219

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 186/213 (87%), Gaps = 3/213 (1%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            M+ P   T   P+FKL++VGDGGTGKTTFVKRHLTGEFEKKY PT+GV VHPLDFHTNCG
Sbjct  1    MSAPPSNT---PTFKLILVGDGGTGKTTFVKRHLTGEFEKKYLPTVGVSVHPLDFHTNCG  57

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
             IRF CWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+R TYKNVPTWHRD+ RVCE+IPI
Sbjct  58   PIRFDCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRTTYKNVPTWHRDITRVCEDIPI  117

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDV+NRQV+AK +TFHRKKNLQYYE+SAKSNYNFEKPFLYLARKL+G+  L F 
Sbjct  118  VLCGNKVDVRNRQVRAKSITFHRKKNLQYYELSAKSNYNFEKPFLYLARKLSGNPQLQFT  177

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            ESPALAPP V +D+A    +E EL +AA QPLP
Sbjct  178  ESPALAPPTVTVDLAEVAAYEKELADAAAQPLP  210



>gb|ACN26424.1| unknown [Zea mays]
 gb|AFW79278.1| hypothetical protein ZEAMMB73_453609 [Zea mays]
Length=173

 Score =   362 bits (929),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQ TVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  437
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  173



>ref|XP_007508454.1| unknown [Bathycoccus prasinos]
 emb|CCO20558.1| unknown [Bathycoccus prasinos]
Length=215

 Score =   363 bits (933),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  922  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAG  743
            P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY PT+GV VHPLDF+TNCG IRF CWDTAG
Sbjct  5    PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYLPTVGVAVHPLDFNTNCGPIRFDCWDTAG  64

Query  742  QEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN  563
            QEKFGGLRDGYYIHGQCA+IMFDVT+R TYKNVPTWHRD+ RVCE+IPIVLCGNKVDV+N
Sbjct  65   QEKFGGLRDGYYIHGQCAIIMFDVTSRTTYKNVPTWHRDITRVCEDIPIVLCGNKVDVRN  124

Query  562  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQ  383
            RQV+AK +TFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAG+  L F ESPALAPPEV+
Sbjct  125  RQVRAKTITFHRKKNLQYYELSAKSNYNFEKPFLYLARKLAGNPQLVFTESPALAPPEVK  184

Query  382  IDIAAQQKHELELQEAANQPLP  317
            +D+A   ++E EL +AA QPLP
Sbjct  185  VDMAEVAQYEKELADAAAQPLP  206



>ref|XP_009401754.1| PREDICTED: GTP-binding nuclear protein Ran-B1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=208

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MALPNQQTVDYP+FKLV+VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNCG
Sbjct  1    MALPNQQTVDYPNFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            KIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNVPTWHRDLCRVCENIPI
Sbjct  61   KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  437
            VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFE+PFLYLARKLAG
Sbjct  121  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFERPFLYLARKLAG  173



>gb|AFW83431.1| hypothetical protein ZEAMMB73_449857 [Zea mays]
Length=195

 Score =   362 bits (930),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/174 (97%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            L ALPNQQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TNC
Sbjct  12   LPALPNQQVVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFSTNC  71

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIP
Sbjct  72   GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIP  131

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  437
            IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG
Sbjct  132  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAG  185



>gb|AFW83228.1| hypothetical protein ZEAMMB73_460490 [Zea mays]
Length=302

 Score =   366 bits (939),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -2

Query  886  TGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYY  707
            +GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYY
Sbjct  105  SGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYY  164

Query  706  IHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR  527
            IHGQC +IMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN QVKAKQVTF+R
Sbjct  165  IHGQCGIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNMQVKAKQVTFYR  224

Query  526  KKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELE  347
            KK+LQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFVE+PALAPP+V ID+AAQQ+HE E
Sbjct  225  KKSLQYYEVSAKSNYNFEKPFLYLARKLAGDSNLHFVETPALAPPDVTIDMAAQQQHEAE  284

Query  346  LQEAANQPL  320
            L  AA QPL
Sbjct  285  LAAAAAQPL  293



>ref|XP_003058435.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56890.1| predicted protein [Micromonas pusilla CCMP1545]
Length=216

 Score =   362 bits (929),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  922  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAG  743
            P+ KL++VGDGGTGKTTFVKRHLTGEFEKKY PT+GV VHPL+F TNCG IRF CWDTAG
Sbjct  6    PTLKLILVGDGGTGKTTFVKRHLTGEFEKKYLPTVGVAVHPLEFTTNCGPIRFDCWDTAG  65

Query  742  QEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN  563
            QEKFGGLRDGYYIHGQCA+IMFDVT+R TYKNVPTWHRD+ RVCE+IPIVLCGNKVDV+N
Sbjct  66   QEKFGGLRDGYYIHGQCAIIMFDVTSRTTYKNVPTWHRDITRVCEDIPIVLCGNKVDVRN  125

Query  562  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQ  383
            RQV+AK +TFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD NL FVES ALAPPEV 
Sbjct  126  RQVRAKTITFHRKKNLQYYELSAKSNYNFEKPFLYLARKLAGDPNLQFVESVALAPPEVM  185

Query  382  IDIAAQQKHELELQEAANQPLP  317
            ID A   K+E EL  AA QPLP
Sbjct  186  IDPAELAKYEAELASAAAQPLP  207



>gb|AFD93408.1| Ras-like GTP-binding protein 2, partial [Dimocarpus longan]
Length=188

 Score =   358 bits (919),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = -2

Query  844  FEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTA  665
             +KKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTA
Sbjct  5    LKKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTA  64

Query  664  RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSN  485
            RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSN
Sbjct  65   RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSN  124

Query  484  YNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            YNFEKPFLYLARKLAGD NLHFVESPALAPPEVQID+AAQQ+HE ELQ AA+QPLP
Sbjct  125  YNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDLAAQQQHEAELQAAASQPLP  180



>gb|KDD75079.1| Ras family protein [Helicosporidium sp. ATCC 50920]
Length=206

 Score =   357 bits (916),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  898  GDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLR  719
            G  GTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDF TN GK+RFYCWDTAGQEKFGGLR
Sbjct  4    GVDGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFMTNRGKLRFYCWDTAGQEKFGGLR  63

Query  718  DGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQV  539
            DGYYIHGQCA+IMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVK KQV
Sbjct  64   DGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKPKQV  123

Query  538  TFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQK  359
            TFHRKKNLQY+EISAKSNYN+EKPFLYLARKL GD  LHFVE  ALAPPEV ID A Q +
Sbjct  124  TFHRKKNLQYHEISAKSNYNYEKPFLYLARKLVGDPILHFVEQVALAPPEVHIDTAQQAE  183

Query  358  HELELQEAANQPLP  317
            +E +L +AAN PLP
Sbjct  184  YEKQLADAANTPLP  197



>gb|ABA81874.1| unknown [Solanum tuberosum]
Length=201

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  838  KKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARL  659
            KKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARL
Sbjct  20   KKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARL  79

Query  658  TYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYN  479
            TYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYN
Sbjct  80   TYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYN  139

Query  478  FEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            FEKPFLYLARKLAGD NLHFVESPALAPPEVQID+AAQ  HE ELQ+A NQPLP
Sbjct  140  FEKPFLYLARKLAGDGNLHFVESPALAPPEVQIDLAAQALHEQELQQALNQPLP  193



>gb|AAQ54569.1| small Ras-like GTP-binding protein [Malus domestica]
Length=183

 Score =   352 bits (902),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -2

Query  841  EKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTAR  662
            EKKYEPTIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTAR
Sbjct  1    EKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTAR  60

Query  661  LTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNY  482
            LTYKN PTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNY
Sbjct  61   LTYKNAPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNY  120

Query  481  NFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            NFEKPFLYLARKLAGD NLHFVESPALAPPEV  D+AAQQ+HE EL  AA QPLP
Sbjct  121  NFEKPFLYLARKLAGDANLHFVESPALAPPEVHFDMAAQQQHEAELASAAAQPLP  175



>ref|XP_010050575.1| PREDICTED: uncharacterized protein LOC104439165 [Eucalyptus grandis]
Length=1270

 Score =   380 bits (977),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/236 (78%), Positives = 192/236 (81%), Gaps = 22/236 (9%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGK----------------------TTFVKRHLTGE  845
            + ALPNQQ VDYPSFKL++VGD GTGK                      TTFVK+HLTGE
Sbjct  610  IAALPNQQNVDYPSFKLLLVGDAGTGKCNVLVAISFKIEDLPFDVADSKTTFVKKHLTGE  669

Query  844  FEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTA  665
            FEKKYEPT GVEVHPLDF TNCGKIRFYCWDTAGQEK GGLR+GYYIHGQCA+IMFDVTA
Sbjct  670  FEKKYEPTTGVEVHPLDFFTNCGKIRFYCWDTAGQEKLGGLREGYYIHGQCAIIMFDVTA  729

Query  664  RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSN  485
            R TYKNVP WHRDLCRVCENIP VLCGNKVDVKNRQV+AKQVTF RKKNLQYYEISAKS 
Sbjct  730  RWTYKNVPIWHRDLCRVCENIPTVLCGNKVDVKNRQVEAKQVTFQRKKNLQYYEISAKSK  789

Query  484  YNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            YN EKPFLYLARKLAGD NLHFVE PALAPPEV +D A QQ+HE EL  AA Q LP
Sbjct  790  YNLEKPFLYLARKLAGDPNLHFVEPPALAPPEVHMDFAPQQQHEAELAGAAIQALP  845


 Score =   323 bits (828),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  823  TIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNV  644
            T GVEVHPLDF TNCGKIRFYCWDTAGQEK GGLR+GYYIHGQCA+IMFDVTA+LTYKNV
Sbjct  323  TTGVEVHPLDFFTNCGKIRFYCWDTAGQEKLGGLREGYYIHGQCAIIMFDVTAQLTYKNV  382

Query  643  PTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPF  464
            PTWHRDLCRVCENIP+VLCGNKVDVKNRQV+AKQVTF RKKNLQYYEISAKS YN EKPF
Sbjct  383  PTWHRDLCRVCENIPVVLCGNKVDVKNRQVEAKQVTFQRKKNLQYYEISAKSKYNLEKPF  442

Query  463  LYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            LYLARKLAGD NLHFVESPALAPPEV +D A QQ+HE EL EAA QPLP
Sbjct  443  LYLARKLAGDPNLHFVESPALAPPEVHMDFAPQQQHEAELAEAAIQPLP  491


 Score =   303 bits (777),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 166/213 (78%), Gaps = 4/213 (2%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            +ALPNQ   D P FKL+IVGD GTGKTTFVKR L  +FE+ YEPT G+EV+PL F TN G
Sbjct  13   LALPNQPMFDDPRFKLLIVGDKGTGKTTFVKRLLREDFEEIYEPTTGIEVYPLHFFTNRG  72

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
             IRF C DT GQ    GLRDGYYI GQCA+IMFDVTA  TY NVP WHRDLCRVCENIPI
Sbjct  73   MIRFDCSDTPGQ----GLRDGYYIRGQCAIIMFDVTAGSTYMNVPGWHRDLCRVCENIPI  128

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVD +NRQV+A Q T+    NLQ+YEISA++ YN E+PFLYLAR+L GD NLHFV
Sbjct  129  VLCGNKVDGENRQVEAGQFTYGWSNNLQHYEISARNMYNLEEPFLYLARELVGDPNLHFV  188

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            E PALAPPEV +D   QQ+HE EL EAA Q LP
Sbjct  189  EPPALAPPEVHMDFDPQQQHEAELAEAAIQALP  221



>emb|CEF66797.1| GTP-binding nuclear protein Ran [Strongyloides ratti]
Length=215

 Score =   350 bits (897),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 182/213 (85%), Gaps = 4/213 (2%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            MA P+    D P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL FHT  G
Sbjct  1    MAAPD----DIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLTFHTTRG  56

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +IRF  WDTAGQEKFGGLRDGYYI GQCA+IMFDVTAR+TYKNVP WHRDL RVCENIPI
Sbjct  57   QIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLVRVCENIPI  116

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVK+R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GD NL FV
Sbjct  117  VLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFV  176

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
              PALAPPEVQ+D     K+E E+ EAAN  LP
Sbjct  177  AMPALAPPEVQMDPTLVAKYEQEIAEAANVELP  209



>ref|XP_003669824.1| hypothetical protein NDAI_0D02670 [Naumovozyma dairenensis CBS 
421]
 emb|CCD24581.1| hypothetical protein NDAI_0D02670 [Naumovozyma dairenensis CBS 
421]
Length=220

 Score =   348 bits (894),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            M+ P Q   + P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  TIGVEVHPL F+TN G
Sbjct  1    MSAPAQPQAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNYG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +I+F CWDTAGQEKFGGLRDGYYI+ QC +IMFDVT+R+TYKNVP WHRDL RVCENIPI
Sbjct  61   EIKFDCWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+  L FV
Sbjct  121  VLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
             SPALAPPEVQ+D    Q+++ E+ +A   PLP
Sbjct  181  ASPALAPPEVQVDEQLMQQYQQEMDQAQALPLP  213



>gb|AES91444.2| GTP-binding nuclear protein Ran1 [Medicago truncatula]
Length=212

 Score =   348 bits (893),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 182/214 (85%), Gaps = 11/214 (5%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEK-KYEPTIGVEVHPLDFHTNC  779
            MALP QQ V+YP+FKLV+VGDGGTGKTTFVKRHLTGEFE+ KYE           F+TNC
Sbjct  1    MALPQQQIVNYPTFKLVLVGDGGTGKTTFVKRHLTGEFEREKYE----------HFYTNC  50

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            GKIRF CWDTAGQ KFGGLRD YY  GQCA+IMFDVTARLTYKNVPTWH D+ RVCENIP
Sbjct  51   GKIRFNCWDTAGQGKFGGLRDAYYTQGQCAIIMFDVTARLTYKNVPTWHGDITRVCENIP  110

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVDVKNRQ+KAKQV FHRKKNLQYYEISAKSNYNFEKPFLYLA+KLAG++NLHF
Sbjct  111  IVLCGNKVDVKNRQIKAKQVIFHRKKNLQYYEISAKSNYNFEKPFLYLAKKLAGNMNLHF  170

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            VE PALAPPEV  DIAAQ+  E E+   A QPLP
Sbjct  171  VEMPALAPPEVAFDIAAQESIEQEICMPAFQPLP  204



>ref|XP_001900408.1| GTP-binding nuclear protein RAN/TC4 [Brugia malayi]
 sp|P38542.2|RAN_BRUMA RecName: Full=GTP-binding nuclear protein Ran; AltName: Full=GTPase 
Ran; AltName: Full=Ras-like protein TC4 [Brugia malayi]
 gb|EJW87615.1| GTP-binding nuclear protein Ran [Wuchereria bancrofti]
Length=215

 Score =   348 bits (892),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  928  DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDT  749
            D P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL FHTN G+IRF  WDT
Sbjct  6    DIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLIFHTNRGQIRFNVWDT  65

Query  748  AGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDV  569
            AGQEKFGGLRDGYYI GQCA+IMFDVTAR+TYKNVP WHRDL RVCENIPIVLCGNKVDV
Sbjct  66   AGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLVRVCENIPIVLCGNKVDV  125

Query  568  KNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPE  389
            K+R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GD NL FV  PALAPPE
Sbjct  126  KDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFVAMPALAPPE  185

Query  388  VQIDIAAQQKHELELQEAANQPLP  317
            VQ+D     ++E E+  AAN  LP
Sbjct  186  VQMDPTMVAQYEQEIAAAANAELP  209



>ref|XP_011105561.1| gsp2p [Saccharomyces arboricola H-6]
 gb|EJS41633.1| gsp2p [Saccharomyces arboricola H-6]
Length=220

 Score =   347 bits (891),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            M+ P Q  V+ P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  TIGVEVHPL F+TN G
Sbjct  1    MSAPVQNNVEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +I+F  WDTAGQEKFGGLRDGYYI+ QCA+IMFDVT+R+TYKNVP WHRDL RVCENIPI
Sbjct  61   EIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+  L FV
Sbjct  121  VLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
             SPALAPPEVQ+D     +++ E+ +A   PLP
Sbjct  181  ASPALAPPEVQVDEQLMHQYQQEMDQATALPLP  213



>gb|EHN00139.1| Gsp2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EJT44299.1| GSP2-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=220

 Score =   347 bits (890),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            M+ P Q   + P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  TIGVEVHPL F+TN G
Sbjct  1    MSAPVQNNAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +I+F  WDTAGQEKFGGLRDGYYI+ QCA+IMFDVT+R+TYKNVP WHRDL RVCENIPI
Sbjct  61   EIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+  L FV
Sbjct  121  VLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
             SPALAPPEVQ+D     +++ E+++A   PLP
Sbjct  181  ASPALAPPEVQVDEQLMHQYQQEMEQATALPLP  213



>ref|NP_014828.1| Ran GTPase GSP2 [Saccharomyces cerevisiae S288c]
 sp|P32836.1|GSP2_YEAST RecName: Full=GTP-binding nuclear protein GSP2/CNR2 [Saccharomyces 
cerevisiae S288c]
 gb|AAA34654.1| GTP-binding protein [Saccharomyces cerevisiae]
 emb|CAA50748.1| CNR1 [Saccharomyces cerevisiae]
 emb|CAA99394.1| GSP2 [Saccharomyces cerevisiae]
 gb|AAT93136.1| YOR185C [Saccharomyces cerevisiae]
 gb|EDN63714.1| GTP-binding protein [Saccharomyces cerevisiae YJM789]
 gb|EDV10768.1| GTP-binding nuclear protein GSP2/CNR2 [Saccharomyces cerevisiae 
RM11-1a]
 gb|EDZ69226.1| YOR185Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU08265.1| Gsp2p [Saccharomyces cerevisiae JAY291]
 emb|CAY86473.1| Gsp2p [Saccharomyces cerevisiae EC1118]
 tpg|DAA10957.1| TPA: Ran GTPase GSP2 [Saccharomyces cerevisiae S288c]
 gb|EGA56730.1| Gsp2p [Saccharomyces cerevisiae FostersB]
 gb|EGA60496.1| Gsp2p [Saccharomyces cerevisiae FostersO]
 gb|EGA72942.1| Gsp2p [Saccharomyces cerevisiae AWRI796]
 gb|EGA84667.1| Gsp2p [Saccharomyces cerevisiae VL3]
 dbj|GAA26501.1| K7_Gsp2p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EIW07614.1| Gsp2p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG83276.1| Gsp2p [Saccharomyces cerevisiae R008]
 gb|EWG88486.1| Gsp2p [Saccharomyces cerevisiae P301]
 gb|EWG93152.1| Gsp2p [Saccharomyces cerevisiae R103]
 gb|EWH16004.1| Gsp2p [Saccharomyces cerevisiae P283]
 gb|AHY77473.1| Gsp2p [Saccharomyces cerevisiae YJM993]
Length=220

 Score =   347 bits (889),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            M+ P Q   + P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  TIGVEVHPL F+TN G
Sbjct  1    MSAPAQNNAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +I+F  WDTAGQEKFGGLRDGYYI+ QCA+IMFDVT+R+TYKNVP WHRDL RVCENIPI
Sbjct  61   EIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+  L FV
Sbjct  121  VLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
             SPALAPPEVQ+D     +++ E+ +A   PLP
Sbjct  181  ASPALAPPEVQVDEQLMHQYQQEMDQATALPLP  213



>ref|XP_009033865.1| GTP-binding nuclear protein Ran [Aureococcus anophagefferens]
 gb|EGB11505.1| GTP-binding nuclear protein Ran [Aureococcus anophagefferens]
Length=211

 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  931  VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWD  752
            ++ P FKL++VGDGG GKTTFVKRHLTGEFEKKY  T+GVEVHPL FHTN G I+F  WD
Sbjct  1    MEMPEFKLILVGDGGVGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWD  60

Query  751  TAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVD  572
            TAGQE+FGGLRDGYYI GQCA+IMFDVT+R+TYKNVP WHRDL RVCENIPIVL GNKV+
Sbjct  61   TAGQERFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLTRVCENIPIVLTGNKVE  120

Query  571  VKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPP  392
            +K+R+VKAKQ+TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GD NLHFVE+PALAPP
Sbjct  121  IKDRKVKAKQITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLCGDNNLHFVEAPALAPP  180

Query  391  EVQIDIAAQQKHELELQEAANQPLP  317
            E  ID    Q++E EL+EAAN PLP
Sbjct  181  EFNIDPVDAQRYEQELREAANIPLP  205



>ref|XP_009020347.1| hypothetical protein HELRODRAFT_185702 [Helobdella robusta]
 gb|ESO01693.1| hypothetical protein HELRODRAFT_185702 [Helobdella robusta]
Length=215

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  928  DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDT  749
            D PSFKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL FHTN G IRF  WDT
Sbjct  6    DMPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLVFHTNRGPIRFNVWDT  65

Query  748  AGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDV  569
            AGQEKFGGLRDGYYI GQCA+IMFDVTAR+TYKNVP WHRDL RVCEN+PIVLCGNKVDV
Sbjct  66   AGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLVRVCENVPIVLCGNKVDV  125

Query  568  KNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPE  389
            K+R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL GD NL FV  PALAPPE
Sbjct  126  KDRKVKAKSITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLTGDQNLEFVAMPALAPPE  185

Query  388  VQIDIAAQQKHELELQEAANQPLP  317
            +++D +   K+E EL+ A +  LP
Sbjct  186  IEMDPSMANKYEEELKIAQSTALP  209



>emb|CDS07831.1| Putative GTP-binding nuclear protein GSP1/Ran [Absidia idahoensis 
var. thermophila]
Length=213

 Score =   346 bits (887),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -2

Query  922  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAG  743
            P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL FHTN G+I F  WDTAG
Sbjct  6    PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLTFHTNFGQIVFNTWDTAG  65

Query  742  QEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN  563
            QEKFGGLRDGYYI GQCA+IMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVD+K 
Sbjct  66   QEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDIKE  125

Query  562  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQ  383
            R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL G+  L FV +PALAPPEVQ
Sbjct  126  RKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNPQLEFVAAPALAPPEVQ  185

Query  382  IDIAAQQKHELELQEAANQPLP  317
            +D    Q+++ E+ EAA QPLP
Sbjct  186  VDNNLMQQYQQEMNEAAAQPLP  207



>gb|EHN04400.1| Gsp2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=220

 Score =   346 bits (887),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  955  MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCG  776
            M+ P Q   + P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  TIGVEVHPL F+TN G
Sbjct  1    MSAPAQNNAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG  60

Query  775  KIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPI  596
            +I+F  WDTAGQEKFGGLRDGYYI+ QCA+IMFDVT+R+TYKNVP WHRDL RVCENIPI
Sbjct  61   EIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLXRVCENIPI  120

Query  595  VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV  416
            VLCGNKVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKLAG+  L FV
Sbjct  121  VLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV  180

Query  415  ESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
             SPALAPPEVQ+D     +++ E+ +A   PLP
Sbjct  181  ASPALAPPEVQVDEQLMHQYQQEMDQATALPLP  213



>gb|EME46530.1| hypothetical protein DOTSEDRAFT_70514 [Dothistroma septosporum 
NZE10]
Length=216

 Score =   346 bits (887),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 184/208 (88%), Gaps = 3/208 (1%)
 Frame = -2

Query  940  QQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFY  761
            QQT   P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+I+F 
Sbjct  5    QQT---PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLGFTTNLGQIQFD  61

Query  760  CWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGN  581
             WDTAGQEKFGGLRDGYYI+GQC +IMFDVT+R+TYKNVP WHRDL RVCENIPIVL GN
Sbjct  62   VWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLTGN  121

Query  580  KVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPAL  401
            KVDVK R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL G+ +L FV +PAL
Sbjct  122  KVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNQSLEFVAAPAL  181

Query  400  APPEVQIDIAAQQKHELELQEAANQPLP  317
            APPEVQ+D AA ++++ E+Q+AAN PLP
Sbjct  182  APPEVQVDQAAMEQYQKEMQDAANMPLP  209



>emb|CDH48891.1| gtp-binding nuclear protein gsp1 ran [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=271

 Score =   348 bits (892),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 185/214 (86%), Gaps = 3/214 (1%)
 Frame = -2

Query  958  LMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNC  779
            L+ + ++QT   P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL FHTN 
Sbjct  55   LLQVMSEQT---PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLTFHTNF  111

Query  778  GKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIP  599
            G+I F  WDTAGQEKFGGLRDGYYI GQCA+IMFDVT+R+TYKNVP WHRDL RVCENIP
Sbjct  112  GQIIFNTWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIP  171

Query  598  IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHF  419
            IVLCGNKVD+K R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL G+  L F
Sbjct  172  IVLCGNKVDIKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNPQLEF  231

Query  418  VESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            V +PALAPPEVQ+D    Q+++ E+ EAA QPLP
Sbjct  232  VAAPALAPPEVQVDTNLMQQYQNEMNEAAAQPLP  265



>gb|KDO80343.1| hypothetical protein CISIN_1g027593mg [Citrus sinensis]
 gb|KDO80344.1| hypothetical protein CISIN_1g027593mg [Citrus sinensis]
Length=186

 Score =   344 bits (882),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/169 (95%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -2

Query  823  TIGVEVHPLDFHTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNV  644
            TIGVEVHPLDF TNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCA+IMFDVTARLTYKNV
Sbjct  10   TIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNV  69

Query  643  PTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPF  464
            PTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPF
Sbjct  70   PTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPF  129

Query  463  LYLARKLAGDVNLHFVESPALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            LYLARKLAGD NLHFVESPALAPPEVQID+AAQQ+HE EL  AA+QPLP
Sbjct  130  LYLARKLAGDPNLHFVESPALAPPEVQIDLAAQQQHEAELAAAASQPLP  178



>gb|EPB90743.1| GTP-binding nuclear protein GSP1/Ran [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=219

 Score =   345 bits (885),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -2

Query  922  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAG  743
            P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL FHTN G I F  WDTAG
Sbjct  12   PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLSFHTNFGAIIFNTWDTAG  71

Query  742  QEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN  563
            QEKFGGLRDGYYI GQCA+IMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK 
Sbjct  72   QEKFGGLRDGYYIGGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKE  131

Query  562  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQ  383
            R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL G+ NL FV +PALAP EVQ
Sbjct  132  RKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGNPNLDFVAAPALAPAEVQ  191

Query  382  IDIAAQQKHELELQEAANQPLP  317
            +D    Q++  E++EAA QPLP
Sbjct  192  VDAQLMQQYNNEMEEAAAQPLP  213



>ref|XP_007926326.1| hypothetical protein MYCFIDRAFT_87708 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME82952.1| hypothetical protein MYCFIDRAFT_87708 [Pseudocercospora fijiensis 
CIRAD86]
Length=215

 Score =   345 bits (884),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  922  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAG  743
            P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+I+F  WDTAG
Sbjct  7    PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLGFTTNLGQIQFDVWDTAG  66

Query  742  QEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN  563
            QEKFGGLRDGYYI+GQC +IMFDVT+R+TYKNVP WHRDL RVCENIPIVL GNKVDVK 
Sbjct  67   QEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLTGNKVDVKE  126

Query  562  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQ  383
            R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL G+ +L FV +PALAPPEVQ
Sbjct  127  RKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNQSLEFVAAPALAPPEVQ  186

Query  382  IDIAAQQKHELELQEAANQPLP  317
            +D AA +  + E+Q+AAN PLP
Sbjct  187  VDQAAMEAAQKEMQDAANMPLP  208



>emb|CDH50668.1| gtp-binding nuclear protein gsp1 ran [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=217

 Score =   345 bits (884),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -2

Query  949  LPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKI  770
            +  QQ    P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL FHTN G I
Sbjct  1    MAEQQQQQTPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLTFHTNFGPI  60

Query  769  RFYCWDTAGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVL  590
             F  WDTAGQEKFGGLRDGYYI GQCA+IMFDVT+R+TYKNVP WHRDL RVCENIPIVL
Sbjct  61   IFNTWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVL  120

Query  589  CGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVES  410
            CGNKVD+K R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+L RKL G+  L FV +
Sbjct  121  CGNKVDIKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLGRKLVGNPQLEFVAA  180

Query  409  PALAPPEVQIDIAAQQKHELELQEAANQPLP  317
            PALAPPEVQ+D    Q+++ E+ EAA QPLP
Sbjct  181  PALAPPEVQVDANLMQQYQNEINEAAAQPLP  211



>gb|AAR08135.1| small GTPase RanA [Aspergillus nidulans]
 tpe|CBF81826.1| TPA: Small GTPase RanA [Source:UniProtKB/TrEMBL;Acc:Q6T4V9] [Aspergillus 
nidulans FGSC A4]
Length=215

 Score =   344 bits (883),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -2

Query  922  PSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDTAG  743
            P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHP+ F TN G I+F  WDTAG
Sbjct  7    PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPIKFTTNLGTIQFDVWDTAG  66

Query  742  QEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKN  563
            QEKFGGLRDGYYI+GQC +IMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDVK 
Sbjct  67   QEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKE  126

Query  562  RQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQ  383
            R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL G+ +L FV +PALAPPEVQ
Sbjct  127  RKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNASLEFVAAPALAPPEVQ  186

Query  382  IDIAAQQKHELELQEAANQPLP  317
            +D    Q++  E+  AANQPLP
Sbjct  187  VDATLMQQYSDEMAAAANQPLP  208



>ref|XP_007374607.1| hypothetical protein SPAPADRAFT_60402 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW33092.1| hypothetical protein SPAPADRAFT_60402 [Spathaspora passalidarum 
NRRL Y-27907]
Length=214

 Score =   344 bits (883),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  928  DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFHTNCGKIRFYCWDT  749
            + P+FKLV+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL FHTN G+++F  WDT
Sbjct  4    EVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLGFHTNFGELKFDVWDT  63

Query  748  AGQEKFGGLRDGYYIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDV  569
            AGQEKFGGLRDGYYI+GQC +IMFDVT+R+TYKNVP WHRDL RVCENIPIVLCGNKVDV
Sbjct  64   AGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDV  123

Query  568  KNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPE  389
            K R+VKAK +TFHRKKNLQYY+ISAKSNYNFEKPFL+LARKL G+  L FV SPALAPPE
Sbjct  124  KERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNAQLEFVASPALAPPE  183

Query  388  VQIDIAAQQKHELELQEAANQPLP  317
            VQ+D    QK++ E+++A   PLP
Sbjct  184  VQVDADLMQKYQQEMEQATALPLP  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2569280546592