BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14285_g2_i1 len=476 path=[41:0-475]

Length=476
                                                                      Score     E

ref|XP_002521575.1|  abhydrolase domain containing, putative            103   2e-23   Ricinus communis
ref|XP_009603274.1|  PREDICTED: epoxide hydrolase 4-like                102   5e-23   
ref|XP_011099621.1|  PREDICTED: monoacylglycerol lipase ABHD6           102   6e-23   
emb|CDP02016.1|  unnamed protein product                                102   7e-23   
ref|XP_010315873.1|  PREDICTED: alpha/beta fold family protein is...    102   7e-23   
ref|XP_009804699.1|  PREDICTED: epoxide hydrolase 4                     102   8e-23   
ref|XP_007046925.1|  Alpha/beta-Hydrolases superfamily protein is...    100   3e-22   
ref|XP_006340628.1|  PREDICTED: protein PHYLLO, chloroplastic-like      100   3e-22   
ref|XP_003629418.1|  Epoxide hydrolase                                99.4    7e-22   
ref|XP_004287894.1|  PREDICTED: epoxide hydrolase 4-like              99.0    9e-22   
ref|XP_004509266.1|  PREDICTED: epoxide hydrolase 4-like              99.0    1e-21   
ref|XP_010679732.1|  PREDICTED: epoxide hydrolase 4                   98.6    1e-21   
ref|XP_004969269.1|  PREDICTED: epoxide hydrolase 3-like              98.6    1e-21   
emb|CBI17511.3|  unnamed protein product                              98.2    1e-21   
ref|XP_008338088.1|  PREDICTED: monoacylglycerol lipase abhd6-A       98.2    2e-21   
ref|XP_002266831.1|  PREDICTED: epoxide hydrolase 3                   98.2    2e-21   Vitis vinifera
ref|XP_010089035.1|  hypothetical protein L484_020321                 97.1    4e-21   
ref|XP_008241683.1|  PREDICTED: monoacylglycerol lipase ABHD6         96.7    6e-21   
gb|KHG01052.1|  Epoxide hydrolase 3                                   96.7    7e-21   
ref|XP_007202273.1|  hypothetical protein PRUPE_ppa008887mg           96.7    7e-21   
ref|XP_003547985.1|  PREDICTED: epoxide hydrolase 4-like isoform X1   95.9    1e-20   
ref|XP_010070057.1|  PREDICTED: monoacylglycerol lipase ABHD6         95.5    2e-20   
ref|XP_009358230.1|  PREDICTED: epoxide hydrolase 4-like              95.5    2e-20   
gb|KCW58615.1|  hypothetical protein EUGRSUZ_H01277                   95.5    2e-20   
ref|XP_011003732.1|  PREDICTED: epoxide hydrolase 3-like isoform X1   94.4    4e-20   
ref|XP_008338404.1|  PREDICTED: monoacylglycerol lipase ABHD6         94.7    4e-20   
ref|XP_009340765.1|  PREDICTED: LOW QUALITY PROTEIN: monoacylglyc...  94.7    4e-20   
ref|XP_008452085.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...  94.4    5e-20   
ref|XP_003520313.1|  PREDICTED: epoxide hydrolase 4-like              94.0    5e-20   
gb|KDO79561.1|  hypothetical protein CISIN_1g020916mg                 93.6    8e-20   
gb|KHN11099.1|  Epoxide hydrolase 4                                   93.2    9e-20   
tpg|DAA58416.1|  TPA: hypothetical protein ZEAMMB73_516241            89.7    9e-20   
ref|XP_006425667.1|  hypothetical protein CICLE_v10026099mg           93.2    1e-19   
ref|XP_006383191.1|  hydrolase family protein                         92.8    1e-19   
ref|XP_004146500.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    92.8    1e-19   
ref|XP_007156048.1|  hypothetical protein PHAVU_003G254000g           92.8    1e-19   
ref|XP_004171539.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    92.8    1e-19   
ref|XP_009347549.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  92.4    2e-19   
ref|XP_003612012.1|  Epoxide hydrolase                                92.0    2e-19   
gb|KDP39466.1|  hypothetical protein JCGZ_05147                       91.7    4e-19   
ref|XP_010437328.1|  PREDICTED: epoxide hydrolase 4-like              91.3    4e-19   
ref|XP_004979896.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    91.3    5e-19   
gb|ABK94693.1|  unknown                                               90.5    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002458211.1|  hypothetical protein SORBIDRAFT_03g029020        90.5    9e-19   Sorghum bicolor [broomcorn]
ref|XP_002310238.2|  hypothetical protein POPTR_0007s12940g           90.1    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006409162.1|  hypothetical protein EUTSA_v10023049mg           90.1    1e-18   
ref|XP_011025800.1|  PREDICTED: epoxide hydrolase 4                   89.7    2e-18   
tpg|DAA58414.1|  TPA: hypothetical protein ZEAMMB73_516241            89.4    2e-18   
ref|XP_010432163.1|  PREDICTED: epoxide hydrolase 4-like              89.4    2e-18   
ref|NP_001149890.1|  catalytic/ hydrolase                             89.4    2e-18   Zea mays [maize]
ref|XP_003569421.1|  PREDICTED: uncharacterized protein LOC100846919  89.4    2e-18   
ref|XP_010263643.1|  PREDICTED: epoxide hydrolase 4                   89.0    4e-18   
ref|XP_010467647.1|  PREDICTED: epoxide hydrolase 4 isoform X1        88.6    5e-18   
ref|XP_010467648.1|  PREDICTED: epoxide hydrolase 4 isoform X2        88.6    5e-18   
ref|XP_010446771.1|  PREDICTED: epoxide hydrolase 4-like              87.4    1e-17   
ref|XP_006284148.1|  hypothetical protein CARUB_v10005282mg           87.0    1e-17   
ref|XP_002886166.1|  hydrolase, alpha/beta fold family protein        87.0    2e-17   
ref|NP_565437.1|  esterase/lipase domain-containing protein           87.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969268.1|  PREDICTED: epoxide hydrolase 3-like              87.0    2e-17   
ref|XP_009395686.1|  PREDICTED: uncharacterized protein LOC103980888  87.0    2e-17   
ref|XP_006878596.1|  hypothetical protein AMTR_s00011p00254080        86.7    2e-17   
ref|XP_006411983.1|  hypothetical protein EUTSA_v10025766mg           86.7    2e-17   
ref|XP_010925926.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    86.3    3e-17   
gb|KFK30282.1|  hypothetical protein AALP_AA7G241000                  85.1    7e-17   
ref|XP_009143412.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    85.1    7e-17   
ref|XP_002867006.1|  predicted protein                                84.7    8e-17   
ref|XP_003612007.1|  Epoxide hydrolase                                84.7    1e-16   
ref|XP_010548328.1|  PREDICTED: epoxide hydrolase 4 isoform X1        84.3    1e-16   
gb|AAM65281.1|  putative hydrolase                                    84.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195379.1|  hydrolase, alpha/beta fold family protein           84.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299489.1|  hypothetical protein CARUB_v10015657mg           84.0    2e-16   
ref|XP_008805395.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    84.0    2e-16   
ref|XP_010489541.1|  PREDICTED: epoxide hydrolase 4-like isoform X1   83.6    3e-16   
ref|XP_003612006.1|  2-hydroxy-6-oxononadienedioate/2-hydroxy-6-o...  82.8    5e-16   
gb|ACJ84440.1|  unknown                                               82.8    5e-16   Medicago truncatula
ref|XP_003547986.1|  PREDICTED: epoxide hydrolase 3-like              82.4    5e-16   
gb|KHN11098.1|  Epoxide hydrolase 3                                   82.4    5e-16   
ref|NP_001043665.2|  Os01g0636400                                     80.9    8e-16   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ98525.1|  predicted protein                                    82.0    8e-16   
ref|XP_006644410.1|  PREDICTED: epoxide hydrolase 3-like              82.0    9e-16   
dbj|BAK01681.1|  predicted protein                                    82.0    9e-16   
emb|CDY64609.1|  BnaA01g34540D                                        82.0    9e-16   
gb|EMS47770.1|  2-hydroxy-6-oxononadienedioate/2-hydroxy-6- oxono...  81.3    1e-15   
emb|CDX69236.1|  BnaC01g02170D                                        81.6    1e-15   
emb|CDM83475.1|  unnamed protein product                              81.3    2e-15   
emb|CDY36478.1|  BnaC03g48370D                                        80.9    2e-15   
ref|XP_010924284.1|  PREDICTED: epoxide hydrolase 4                   80.9    2e-15   
gb|EMT21059.1|  hypothetical protein F775_25997                       81.3    2e-15   
dbj|BAD68930.1|  hydrolase-like                                       81.3    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ12829.1|  hypothetical protein OsJ_02750                        80.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405657.1|  PREDICTED: epoxide hydrolase 4-like isoform X2   80.5    3e-15   
ref|XP_009405656.1|  PREDICTED: epoxide hydrolase 4-like isoform X1   80.5    4e-15   
gb|EMS54456.1|  hypothetical protein TRIUR3_25793                     79.7    4e-15   
emb|CDY29230.1|  BnaA06g25270D                                        79.7    5e-15   
ref|XP_009150734.1|  PREDICTED: epoxide hydrolase 4                   79.7    5e-15   
gb|EPS66257.1|  hypothetical protein M569_08525                       79.3    6e-15   
ref|XP_003576834.1|  PREDICTED: uncharacterized protein LOC100838...  77.4    4e-14   
ref|XP_010238499.1|  PREDICTED: uncharacterized protein LOC100838...  77.4    4e-14   
gb|KCW63982.1|  hypothetical protein EUGRSUZ_G016631                  74.3    5e-14   
gb|KDO47526.1|  hypothetical protein CISIN_1g0222531mg                72.8    7e-14   
ref|XP_006655626.1|  PREDICTED: alpha/beta hydrolase domain-conta...  76.3    1e-13   
gb|KDO47525.1|  hypothetical protein CISIN_1g0222531mg                73.2    1e-13   
ref|NP_001148540.1|  catalytic/ hydrolase                             76.3    2e-13   Zea mays [maize]
ref|XP_004953623.1|  PREDICTED: uncharacterized protein LOC101758156  75.5    3e-13   
gb|KCW45335.1|  hypothetical protein EUGRSUZ_L009972                  71.6    4e-13   
gb|KCW63983.1|  hypothetical protein EUGRSUZ_G01665                   74.3    5e-13   
ref|XP_003578638.1|  PREDICTED: uncharacterized protein LOC100841479  73.9    7e-13   
gb|AAL87168.1|AF480496_22  putative hydrolase                         73.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87227.1|  hypothetical protein OsI_08629                        73.6    1e-12   Oryza sativa Indica Group [Indian rice]
gb|EMT20986.1|  hypothetical protein F775_17841                       72.0    1e-12   
ref|XP_003578639.1|  PREDICTED: epoxide hydrolase 4-like              73.2    1e-12   
gb|KCW63989.1|  hypothetical protein EUGRSUZ_G016731                  70.5    2e-12   
gb|ACF84815.1|  unknown                                               72.4    2e-12   Zea mays [maize]
gb|AFW73031.1|  hypothetical protein ZEAMMB73_600923                  72.4    2e-12   
ref|XP_007156948.1|  hypothetical protein PHAVU_002G030900g           72.0    2e-12   
ref|XP_006423282.1|  hypothetical protein CICLE_v10028935mg           72.0    2e-12   
tpg|DAA61315.1|  TPA: catalytic/ hydrolase                            72.8    3e-12   
ref|NP_001146375.1|  uncharacterized protein LOC100279953             72.4    3e-12   Zea mays [maize]
ref|XP_010068563.1|  PREDICTED: uncharacterized protein LOC104455476  71.6    3e-12   
ref|XP_006423281.1|  hypothetical protein CICLE_v10028935mg           72.0    3e-12   
ref|XP_006647769.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    72.4    3e-12   
ref|XP_008382204.1|  PREDICTED: uncharacterized protein LOC103445011  72.0    3e-12   
dbj|BAK00702.1|  predicted protein                                    72.0    4e-12   
gb|KCW63984.1|  hypothetical protein EUGRSUZ_G01668                   71.6    5e-12   
ref|XP_003570197.1|  PREDICTED: epoxide hydrolase 4                   70.5    2e-11   
ref|XP_004164828.1|  PREDICTED: epoxide hydrolase 3-like              69.7    2e-11   
ref|XP_004148865.1|  PREDICTED: epoxide hydrolase 3-like              69.7    2e-11   
emb|CDY71957.1|  BnaUnng04770D                                        66.6    2e-11   
gb|EMT14159.1|  hypothetical protein F775_05095                       69.7    5e-11   
ref|XP_009109326.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    67.8    8e-11   
ref|XP_002462333.1|  hypothetical protein SORBIDRAFT_02g023970        68.2    1e-10   Sorghum bicolor [broomcorn]
emb|CDX69235.1|  BnaC01g02180D                                        67.4    1e-10   
ref|XP_004230956.1|  PREDICTED: monoacylglycerol lipase abhd6-A       67.4    1e-10   
ref|XP_009762310.1|  PREDICTED: uncharacterized protein LOC104214353  67.0    2e-10   
gb|EMT25786.1|  hypothetical protein F775_21288                       67.8    2e-10   
gb|KCW63978.1|  hypothetical protein EUGRSUZ_G01660                   65.5    3e-10   
ref|XP_006365115.1|  PREDICTED: uncharacterized protein LOC102589861  65.9    4e-10   
ref|XP_010066157.1|  PREDICTED: uncharacterized protein LOC104453330  65.9    5e-10   
ref|XP_009143626.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    65.5    6e-10   
emb|CDY64608.1|  BnaA01g34530D                                        65.5    6e-10   
ref|XP_009788105.1|  PREDICTED: uncharacterized protein LOC104235966  65.1    9e-10   
gb|KHG01877.1|  Monoacylglycerol lipase abhd6-A                       61.6    1e-09   
gb|KDO47521.1|  hypothetical protein CISIN_1g0210701mg                62.0    1e-09   
ref|XP_009587042.1|  PREDICTED: uncharacterized protein LOC104084...  64.7    2e-09   
ref|XP_008377296.1|  PREDICTED: uncharacterized protein LOC103440399  63.9    2e-09   
ref|XP_010068572.1|  PREDICTED: uncharacterized protein LOC104455485  63.9    2e-09   
gb|KCW63990.1|  hypothetical protein EUGRSUZ_G01677                   63.9    3e-09   
gb|KHG10485.1|  Epoxide hydrolase 4                                   62.0    4e-09   
ref|XP_008236906.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    63.2    5e-09   
ref|XP_010088927.1|  hypothetical protein L484_018554                 63.2    5e-09   
ref|XP_006365111.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    62.8    6e-09   
gb|EMS66424.1|  hypothetical protein TRIUR3_08137                     62.4    9e-09   
gb|EMT31254.1|  hypothetical protein F775_17120                       62.4    9e-09   
gb|KDP46260.1|  hypothetical protein JCGZ_10100                       62.4    9e-09   
ref|XP_003631665.1|  PREDICTED: epoxide hydrolase 4-like              62.0    1e-08   
emb|CDO97042.1|  unnamed protein product                              61.2    2e-08   
ref|XP_007042181.1|  Alpha/beta-Hydrolases superfamily protein, p...  61.2    2e-08   
ref|XP_007199433.1|  hypothetical protein PRUPE_ppa026591mg           61.2    2e-08   
ref|XP_007200797.1|  hypothetical protein PRUPE_ppa024898mg           61.2    2e-08   
ref|XP_006469148.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    61.2    2e-08   
ref|XP_011048375.1|  PREDICTED: epoxide hydrolase 3-like              61.2    3e-08   
ref|XP_011037515.1|  PREDICTED: epoxide hydrolase 4-like              60.8    3e-08   
ref|XP_010690865.1|  PREDICTED: uncharacterized protein LOC104904342  60.1    5e-08   
ref|XP_002305433.1|  hypothetical protein POPTR_0004s16310g           59.7    8e-08   Populus trichocarpa [western balsam poplar]
dbj|BAJ85024.1|  predicted protein                                    58.9    1e-07   
ref|XP_006379247.1|  hypothetical protein POPTR_0009s11980g           57.0    6e-07   
ref|XP_002313792.2|  hypothetical protein POPTR_0009s11970g           56.2    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007042178.1|  Alpha/beta-Hydrolases superfamily protein, p...  55.1    3e-06   
ref|XP_011048355.1|  PREDICTED: epoxide hydrolase 4-like isoform X1   54.3    5e-06   
ref|XP_006423280.1|  hypothetical protein CICLE_v10029764mg           50.4    7e-06   
ref|XP_006379243.1|  hypothetical protein POPTR_0009s11960g           53.1    1e-05   
ref|XP_011048411.1|  PREDICTED: uncharacterized protein LOC105142...  53.1    1e-05   
ref|XP_011048404.1|  PREDICTED: uncharacterized protein LOC105142...  53.1    1e-05   
gb|EMT17909.1|  hypothetical protein F775_17771                       49.7    1e-05   
ref|XP_006645536.1|  PREDICTED: uncharacterized protein LOC102703741  51.6    2e-05   
ref|NP_001042132.1|  Os01g0168800                                     52.0    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAY72695.1|  hypothetical protein OsI_00563                        52.0    3e-05   Oryza sativa Indica Group [Indian rice]
gb|EEE53941.1|  hypothetical protein OsJ_00529                        52.0    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968331.1|  PREDICTED: uncharacterized protein LOC101759345  52.0    4e-05   
gb|AFK39625.1|  unknown                                               49.7    4e-05   
ref|XP_009362895.1|  PREDICTED: uncharacterized protein LOC103952919  51.2    6e-05   
ref|XP_007223174.1|  hypothetical protein PRUPE_ppa009136mg           51.2    6e-05   
ref|XP_006379242.1|  hypothetical protein POPTR_0009s11950g           51.2    6e-05   
ref|XP_010680530.1|  PREDICTED: uncharacterized protein LOC104895664  50.8    7e-05   
ref|XP_008393578.1|  PREDICTED: monoacylglycerol lipase ABHD6         50.8    8e-05   
ref|XP_002305432.2|  hypothetical protein POPTR_0004s16300g           50.8    9e-05   Populus trichocarpa [western balsam poplar]
ref|XP_007046921.1|  Major facilitator superfamily protein isoform 1  51.2    1e-04   
emb|CBI32599.3|  unnamed protein product                              50.8    1e-04   
ref|XP_011037514.1|  PREDICTED: epoxide hydrolase 4-like              50.4    1e-04   
ref|XP_010049288.1|  PREDICTED: uncharacterized protein LOC104437938  50.4    1e-04   
gb|KDO73661.1|  hypothetical protein CISIN_1g0219212mg                47.0    2e-04   
gb|KDP41386.1|  hypothetical protein JCGZ_15793                       49.7    2e-04   
ref|XP_002455119.1|  hypothetical protein SORBIDRAFT_03g004630        49.7    2e-04   Sorghum bicolor [broomcorn]
ref|XP_008220584.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    49.3    2e-04   
ref|XP_006826568.1|  hypothetical protein AMTR_s01033p00010870        46.2    3e-04   
gb|KDO73660.1|  hypothetical protein CISIN_1g0219212mg                46.6    3e-04   
ref|XP_002455118.1|  hypothetical protein SORBIDRAFT_03g004620        48.9    4e-04   Sorghum bicolor [broomcorn]
ref|XP_010098384.1|  4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandro...  48.5    5e-04   
ref|XP_002465758.1|  hypothetical protein SORBIDRAFT_01g045310        48.5    5e-04   Sorghum bicolor [broomcorn]
ref|XP_007222763.1|  hypothetical protein PRUPE_ppa008754mg           48.5    6e-04   
gb|ABR18124.1|  unknown                                               48.1    6e-04   Picea sitchensis
ref|XP_008219440.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...  48.1    6e-04   
ref|XP_008219441.1|  PREDICTED: valacyclovir hydrolase isoform X2     48.1    7e-04   
ref|XP_010526035.1|  PREDICTED: monoacylglycerol lipase ABHD6         48.1    7e-04   
ref|XP_006400700.1|  hypothetical protein EUTSA_v10014154mg           48.1    7e-04   
ref|XP_010531367.1|  PREDICTED: monoacylglycerol lipase ABHD6         48.1    8e-04   
ref|XP_002974805.1|  hypothetical protein SELMODRAFT_101938           47.8    0.001   
gb|EYU18474.1|  hypothetical protein MIMGU_mgv1a010034mg              47.8    0.001   
gb|KFK42211.1|  hypothetical protein AALP_AA2G225700                  47.8    0.001   



>ref|XP_002521575.1| abhydrolase domain containing, putative [Ricinus communis]
 gb|EEF40846.1| abhydrolase domain containing, putative [Ricinus communis]
Length=317

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND+IFK+E A+ MKEQLG   TFEGI+KAGHLVHLERPCVYNRCLKKFL SLQ  +A 
Sbjct  257  GENDEIFKLEFAQNMKEQLGENATFEGIKKAGHLVHLERPCVYNRCLKKFLASLQGPQAE  316

Query  181  K  183
            K
Sbjct  317  K  317



>ref|XP_009603274.1| PREDICTED: epoxide hydrolase 4-like [Nicotiana tomentosiformis]
Length=341

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF +ELA+ MK+QLG KTTF GI KAGHLVHLERPCVYNRCLK FL SL  +KA+
Sbjct  271  GENDQIFNLELAQNMKDQLGDKTTFHGIEKAGHLVHLERPCVYNRCLKHFLTSLHAEKAQ  330



>ref|XP_011099621.1| PREDICTED: monoacylglycerol lipase ABHD6 [Sesamum indicum]
Length=319

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF +ELA+ MKEQLG K TF+GI+KAGHLVHLERPCVYNR L +FL SL  D+AR
Sbjct  259  GENDQIFNLELAQNMKEQLGDKATFQGIKKAGHLVHLERPCVYNRFLNQFLASLHADEAR  318

Query  181  K  183
            K
Sbjct  319  K  319



>emb|CDP02016.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIFK+ELA+ MK+QLG   T +GI KAGHLVHLERPCVYNRCLKKFL SL+ D+A+
Sbjct  268  GENDQIFKLELAQNMKQQLGDMATIQGIGKAGHLVHLERPCVYNRCLKKFLASLKADEAQ  327

Query  181  K  183
            K
Sbjct  328  K  328



>ref|XP_010315873.1| PREDICTED: alpha/beta fold family protein isoform X1 [Solanum 
lycopersicum]
Length=332

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF +ELA+ MK QLG KTTF GI KAGHLVHLERPCVYN+CLK+FL SL  +KA+
Sbjct  272  GENDQIFNLELAQNMKHQLGEKTTFHGIDKAGHLVHLERPCVYNKCLKQFLTSLHAEKAQ  331

Query  181  K  183
            K
Sbjct  332  K  332



>ref|XP_009804699.1| PREDICTED: epoxide hydrolase 4 [Nicotiana sylvestris]
Length=331

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF +ELA+ MK+QLG KTTF GI KAGHLVHLERPCVYNRCLK+FL SL  +K++
Sbjct  271  GENDQIFNLELAQNMKDQLGDKTTFHGIEKAGHLVHLERPCVYNRCLKQFLTSLHAEKSQ  330



>ref|XP_007046925.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007046926.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX91082.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX91083.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=314

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GE DQIFK ELA  MKEQLG  TTFEGI+KAGHLVHLERPCVYNRCLK+FL SL  +K  
Sbjct  254  GEEDQIFKQELAHNMKEQLGGNTTFEGIKKAGHLVHLERPCVYNRCLKRFLASLLAEKVD  313

Query  181  K  183
            K
Sbjct  314  K  314



>ref|XP_006340628.1| PREDICTED: protein PHYLLO, chloroplastic-like [Solanum tuberosum]
Length=332

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF +ELA+ MK QLG KTTF GI KAGHLVHLERPCVYN+CLK+FL SL  +K +
Sbjct  272  GENDQIFNLELAQNMKHQLGEKTTFHGIDKAGHLVHLERPCVYNKCLKQFLTSLHAEKGQ  331

Query  181  K  183
            K
Sbjct  332  K  332



>ref|XP_003629418.1| Epoxide hydrolase [Medicago truncatula]
 gb|AET03894.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=314

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GENDQIFK+ELA+ MKEQLG   TFEGI+KAGHLVHLERPCVYNRCLKKF+ S 
Sbjct  255  GENDQIFKLELAQNMKEQLGDGATFEGIKKAGHLVHLERPCVYNRCLKKFIASF  308



>ref|XP_004287894.1| PREDICTED: epoxide hydrolase 4-like [Fragaria vesca subsp. vesca]
Length=314

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GENDQIFK ELA  MKEQLG+  TFEGI+KAGHLVHLERPCVYNRCLK+FL SL 
Sbjct  254  GENDQIFKQELAHNMKEQLGANATFEGIKKAGHLVHLERPCVYNRCLKRFLASLN  308



>ref|XP_004509266.1| PREDICTED: epoxide hydrolase 4-like [Cicer arietinum]
Length=318

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GENDQIFK ELA+ MKEQLG  TTFEGI+KAGHLVHLERPCVYNRCLK F+ S 
Sbjct  255  GENDQIFKSELAQNMKEQLGDGTTFEGIKKAGHLVHLERPCVYNRCLKHFIASF  308



>ref|XP_010679732.1| PREDICTED: epoxide hydrolase 4 [Beta vulgaris subsp. vulgaris]
Length=315

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKA  177
            GENDQIF  E+A+ MKE+LG K T+EGI+KAGHLVHLERPCVYNRCLK+FL S+  D A
Sbjct  254  GENDQIFTTEIAQQMKEKLGEKATYEGIKKAGHLVHLERPCVYNRCLKRFLASVYADGA  312



>ref|XP_004969269.1| PREDICTED: epoxide hydrolase 3-like [Setaria italica]
Length=335

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND IF +ELAKAMKEQLG KT  + IRKAGHLVHLERPCVYNRCLK+FL S+   +  
Sbjct  274  GENDNIFNIELAKAMKEQLGEKTMLQSIRKAGHLVHLERPCVYNRCLKEFLASVTATETT  333

Query  181  K  183
            K
Sbjct  334  K  334



>emb|CBI17511.3| unnamed protein product [Vitis vinifera]
Length=284

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIFK ELA  MKEQLG K TF+GI+KAGHLVHLERPCVYNR LK FL SL  D A 
Sbjct  224  GENDQIFKQELAHNMKEQLGDKATFQGIKKAGHLVHLERPCVYNRHLKLFLASLNTDGAP  283

Query  181  K  183
            K
Sbjct  284  K  284



>ref|XP_008338088.1| PREDICTED: monoacylglycerol lipase abhd6-A [Malus domestica]
Length=319

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GENDQIF  ELA  MKEQLG   TFEGI+KAGHLVHLERPCVYNRCLK+FL SLQ
Sbjct  254  GENDQIFNQELAHNMKEQLGENATFEGIKKAGHLVHLERPCVYNRCLKRFLASLQ  308



>ref|XP_002266831.1| PREDICTED: epoxide hydrolase 3 [Vitis vinifera]
 ref|XP_010649140.1| PREDICTED: epoxide hydrolase 3 [Vitis vinifera]
Length=314

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIFK ELA  MKEQLG K TF+GI+KAGHLVHLERPCVYNR LK FL SL  D A 
Sbjct  254  GENDQIFKQELAHNMKEQLGDKATFQGIKKAGHLVHLERPCVYNRHLKLFLASLNTDGAP  313

Query  181  K  183
            K
Sbjct  314  K  314



>ref|XP_010089035.1| hypothetical protein L484_020321 [Morus notabilis]
 gb|EXB37262.1| hypothetical protein L484_020321 [Morus notabilis]
Length=314

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GEND++FK ELA+ MKEQLG  TTF+GI+KAGHLVHLERPCVYNRCLK+F  SL  D
Sbjct  258  GENDELFKQELAQNMKEQLGDNTTFQGIKKAGHLVHLERPCVYNRCLKQFFASLHED  314



>ref|XP_008241683.1| PREDICTED: monoacylglycerol lipase ABHD6 [Prunus mume]
Length=313

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GENDQIF+ ELA  MKEQLG   TFEGI+KAGHLVHLERPCVYNRCLK+FL SL
Sbjct  254  GENDQIFQQELAHNMKEQLGENATFEGIKKAGHLVHLERPCVYNRCLKRFLASL  307



>gb|KHG01052.1| Epoxide hydrolase 3 [Gossypium arboreum]
Length=315

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GE DQIFK ELA  MKEQLG  TTFEGI+KAGHLVHLERPCVYN CLK FL SL  ++  
Sbjct  255  GEEDQIFKQELAHNMKEQLGETTTFEGIQKAGHLVHLERPCVYNSCLKHFLASLYAEQVN  314

Query  181  K  183
            K
Sbjct  315  K  315



>ref|XP_007202273.1| hypothetical protein PRUPE_ppa008887mg [Prunus persica]
 gb|EMJ03472.1| hypothetical protein PRUPE_ppa008887mg [Prunus persica]
Length=315

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GENDQIF+ ELA  MKEQLG   TFEGI+KAGHLVHLERPCVYNRCLK+FL SL
Sbjct  254  GENDQIFQRELAHNMKEQLGENATFEGIKKAGHLVHLERPCVYNRCLKRFLASL  307



>ref|XP_003547985.1| PREDICTED: epoxide hydrolase 4-like isoform X1 [Glycine max]
 ref|XP_006599378.1| PREDICTED: epoxide hydrolase 4-like isoform X2 [Glycine max]
Length=316

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IFK+ELA++MKEQLG+ TTFEGI+KAGHLVHLERPCVYNRCLK  + S 
Sbjct  255  GENDRIFKLELAQSMKEQLGNGTTFEGIKKAGHLVHLERPCVYNRCLKHIIASF  308



>ref|XP_010070057.1| PREDICTED: monoacylglycerol lipase ABHD6 [Eucalyptus grandis]
Length=317

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GE DQIFK+ELA+ MKEQLG K T EGI KAGHL HLERPCVYNRCLK+FL S+   +A 
Sbjct  257  GEQDQIFKMELAENMKEQLGEKATVEGIEKAGHLTHLERPCVYNRCLKRFLASVHQTEAD  316

Query  181  K  183
            K
Sbjct  317  K  317



>ref|XP_009358230.1| PREDICTED: epoxide hydrolase 4-like [Pyrus x bretschneideri]
Length=319

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GENDQIF  ELA  MK QLG   TFEGI+KAGHLVHLERPCVYNRCLK+FL SLQ
Sbjct  254  GENDQIFNQELAHNMKVQLGENATFEGIKKAGHLVHLERPCVYNRCLKRFLASLQ  308



>gb|KCW58615.1| hypothetical protein EUGRSUZ_H01277 [Eucalyptus grandis]
Length=390

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GE DQIFK+ELA+ MKEQLG K T EGI KAGHL HLERPCVYNRCLK+FL S+   +A 
Sbjct  330  GEQDQIFKMELAENMKEQLGEKATVEGIEKAGHLTHLERPCVYNRCLKRFLASVHQTEAD  389

Query  181  K  183
            K
Sbjct  390  K  390



>ref|XP_011003732.1| PREDICTED: epoxide hydrolase 3-like isoform X1 [Populus euphratica]
Length=316

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF + LA+ MK QLG   TF+GIRKAGHLVHLERPCVYNRCLK+FL SL  +  +
Sbjct  256  GENDQIFNLGLAQNMKGQLGETATFQGIRKAGHLVHLERPCVYNRCLKRFLTSLLENGVQ  315

Query  181  K  183
            K
Sbjct  316  K  316



>ref|XP_008338404.1| PREDICTED: monoacylglycerol lipase ABHD6 [Malus domestica]
Length=346

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GENDQIF  ELA+ MKEQLG+  TFEGI+KAGHLVHLERPCVYNR LK+FL SLQ
Sbjct  254  GENDQIFNQELAQNMKEQLGANATFEGIKKAGHLVHLERPCVYNRRLKRFLASLQ  308



>ref|XP_009340765.1| PREDICTED: LOW QUALITY PROTEIN: monoacylglycerol lipase abhd6-A-like 
[Pyrus x bretschneideri]
Length=365

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GENDQIF  ELA  MKEQLG+  TFEGI+KAGHLVHLERPCVYNR LK+FL SLQ
Sbjct  254  GENDQIFNQELAHNMKEQLGANATFEGIKKAGHLVHLERPCVYNRRLKRFLASLQ  308



>ref|XP_008452085.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Cucumis 
melo]
Length=314

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF VELA+ ++++LG   TF GI KAGHLVHLERPCVYNRCLK+FL +L  D   
Sbjct  254  GENDQIFNVELARKLQQELGDNATFRGIPKAGHLVHLERPCVYNRCLKQFLATLHSDAQT  313

Query  181  K  183
            K
Sbjct  314  K  314



>ref|XP_003520313.1| PREDICTED: epoxide hydrolase 4-like [Glycine max]
 gb|KHN00539.1| Epoxide hydrolase 4 [Glycine soja]
Length=316

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IFK+ELA++MKEQLG+  TFEGI+KAGHLVHLERPCVYNRCLK  + S 
Sbjct  255  GENDRIFKLELAQSMKEQLGNGATFEGIKKAGHLVHLERPCVYNRCLKHIIASF  308



>gb|KDO79561.1| hypothetical protein CISIN_1g020916mg [Citrus sinensis]
Length=320

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSK-TTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDK  174
            GE+DQIF VELA  MKEQLG+   TF+GI+KAGHLVHLERPC YNRCLK+FL SL  D+
Sbjct  257  GEDDQIFNVELAHNMKEQLGADHVTFQGIKKAGHLVHLERPCAYNRCLKQFLASLHADE  315



>gb|KHN11099.1| Epoxide hydrolase 4 [Glycine soja]
Length=314

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IFK+ELA++MKEQLG+ TTFE I+KAGHLVHLERPCVYNRCLK  + S 
Sbjct  253  GENDRIFKLELAQSMKEQLGNGTTFESIKKAGHLVHLERPCVYNRCLKHIIASF  306



>tpg|DAA58416.1| TPA: hypothetical protein ZEAMMB73_516241 [Zea mays]
Length=108

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND IF +ELAK MKEQLG KTT + I KAGHLVHLERPCVYNR LK+FL
Sbjct  46   GENDNIFNIELAKTMKEQLGEKTTLQSISKAGHLVHLERPCVYNRLLKEFL  96



>ref|XP_006425667.1| hypothetical protein CICLE_v10026099mg [Citrus clementina]
 ref|XP_006466802.1| PREDICTED: epoxide hydrolase 4-like [Citrus sinensis]
 gb|ESR38907.1| hypothetical protein CICLE_v10026099mg [Citrus clementina]
Length=320

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSK-TTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GE+DQIF VELA  MKEQLG+   TF+GI+KAGHLVHLERPC YNRCLK+FL SL  D
Sbjct  257  GEDDQIFNVELAHNMKEQLGADHVTFQGIKKAGHLVHLERPCAYNRCLKQFLASLHAD  314



>ref|XP_006383191.1| hydrolase family protein [Populus trichocarpa]
 gb|ERP60988.1| hydrolase family protein [Populus trichocarpa]
Length=316

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF + LA+ MK QLG   TF+GI+KAGHLVHLERPCVYNRCLK+FL SL  +  +
Sbjct  256  GENDQIFNLGLAQNMKGQLGETATFQGIQKAGHLVHLERPCVYNRCLKRFLTSLLENGVQ  315

Query  181  K  183
            K
Sbjct  316  K  316



>ref|XP_004146500.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Cucumis sativus]
Length=314

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF V+LA+ ++++LG   TF GI KAGHLVHLERPCVYNRCLK+FL +L  D   
Sbjct  254  GENDQIFNVDLARKLQQELGDNATFRGIPKAGHLVHLERPCVYNRCLKQFLATLHSDAQT  313

Query  181  K  183
            K
Sbjct  314  K  314



>ref|XP_007156048.1| hypothetical protein PHAVU_003G254000g [Phaseolus vulgaris]
 gb|ESW28042.1| hypothetical protein PHAVU_003G254000g [Phaseolus vulgaris]
Length=313

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G+NDQIFKVELA+ MKE+LG  TTFE I KAGHLVHLERPCVYNRCLK FL S 
Sbjct  255  GKNDQIFKVELAENMKEELGDGTTFECIEKAGHLVHLERPCVYNRCLKHFLASF  308



>ref|XP_004171539.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Cucumis sativus]
 gb|KGN53303.1| hypothetical protein Csa_4G046660 [Cucumis sativus]
Length=314

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIF V+LA+ ++++LG   TF GI KAGHLVHLERPCVYNRCLK+FL +L  D   
Sbjct  254  GENDQIFNVDLARKLQQELGDNATFRGIPKAGHLVHLERPCVYNRCLKQFLATLHSDAQT  313

Query  181  K  183
            K
Sbjct  314  K  314



>ref|XP_009347549.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103939216 
[Pyrus x bretschneideri]
Length=365

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GENDQIF  ELA  MKEQLG+  TFEGI+KAGHLVHLERPCVYNR LK+FL SL
Sbjct  254  GENDQIFNQELAHNMKEQLGANATFEGIKKAGHLVHLERPCVYNRRLKRFLASL  307



>ref|XP_003612012.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES94970.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=305

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDK  174
            GE D++FK+E+A+ MKE+LG+ TTFE I+KAGHL HLERPC+YNRCLKKFL S+ +D+
Sbjct  246  GEKDKVFKLEIAQNMKERLGNNTTFEVIKKAGHLAHLERPCIYNRCLKKFLSSVMLDE  303



>gb|KDP39466.1| hypothetical protein JCGZ_05147 [Jatropha curcas]
Length=315

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVS  159
            GENDQIFK+ELA+ MKEQLG   T EGI+KAGHLVHLERPCVYNR LK+FL S
Sbjct  258  GENDQIFKLELAQNMKEQLGENATVEGIKKAGHLVHLERPCVYNRLLKQFLKS  310



>ref|XP_010437328.1| PREDICTED: epoxide hydrolase 4-like [Camelina sativa]
Length=311

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GE+DQIF +ELAK MKEQLG K + E I+KAGHLVHLERPCVYNR LKKFL S+  D
Sbjct  254  GESDQIFDLELAKNMKEQLGEKASIESIKKAGHLVHLERPCVYNRRLKKFLASIHYD  310



>ref|XP_004979896.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Setaria italica]
Length=347

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND IF +EL K MKEQLG K   + IRKAGHLVHLERPCVYNRCLK+FL S+
Sbjct  278  GENDNIFHIELGKTMKEQLGEKMMLQSIRKAGHLVHLERPCVYNRCLKEFLASI  331



>gb|ABK94693.1| unknown [Populus trichocarpa]
Length=302

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIFK+E A+ MKE+LG   TF+GI+KAGHLV LERPCVYN+CLK+FL SL  ++ +
Sbjct  242  GENDQIFKLEHAQNMKEKLGETVTFQGIQKAGHLVQLERPCVYNKCLKQFLTSLLENEEQ  301

Query  181  K  183
            K
Sbjct  302  K  302



>ref|XP_002458211.1| hypothetical protein SORBIDRAFT_03g029020 [Sorghum bicolor]
 gb|EES03331.1| hypothetical protein SORBIDRAFT_03g029020 [Sorghum bicolor]
Length=323

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND IF +ELAK MKEQLG KT  + I KAGHLVHLERPCVYNR LK+FL S+   +  
Sbjct  262  GENDNIFNIELAKTMKEQLGEKTMLQSISKAGHLVHLERPCVYNRLLKEFLASVTAAETT  321

Query  181  K  183
            K
Sbjct  322  K  322



>ref|XP_002310238.2| hypothetical protein POPTR_0007s12940g [Populus trichocarpa]
 gb|EEE90688.2| hypothetical protein POPTR_0007s12940g [Populus trichocarpa]
Length=317

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GENDQIFK+E A+ MKE+LG   TF+GI+KAGHLV LERPCVYN+CLK+FL SL
Sbjct  257  GENDQIFKLEHAQNMKEKLGETVTFQGIQKAGHLVQLERPCVYNKCLKQFLTSL  310



>ref|XP_006409162.1| hypothetical protein EUTSA_v10023049mg [Eutrema salsugineum]
 gb|ESQ50615.1| hypothetical protein EUTSA_v10023049mg [Eutrema salsugineum]
Length=313

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQ+F VE+AK MK+QLG  TT + I+KAGHL H+ERPCVYNRCLKKFL S+
Sbjct  256  GESDQLFHVEMAKNMKQQLGENTTMDSIKKAGHLAHMERPCVYNRCLKKFLTSV  309



>ref|XP_011025800.1| PREDICTED: epoxide hydrolase 4 [Populus euphratica]
Length=317

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GENDQIFK+E A+ MKE+LG   T +GI+KAGHLV LERPCVYN+CLK+FL SL  ++ +
Sbjct  257  GENDQIFKLEFAQNMKEKLGETVTLQGIQKAGHLVQLERPCVYNKCLKQFLTSLLENEKQ  316

Query  181  K  183
            K
Sbjct  317  K  317



>tpg|DAA58414.1| TPA: hypothetical protein ZEAMMB73_516241 [Zea mays]
Length=269

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND IF +ELAK MKEQLG KTT + I KAGHLVHLERPCVYNR LK+FL
Sbjct  207  GENDNIFNIELAKTMKEQLGEKTTLQSISKAGHLVHLERPCVYNRLLKEFL  257



>ref|XP_010432163.1| PREDICTED: epoxide hydrolase 4-like [Camelina sativa]
Length=311

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GE+DQIF +ELAK MKEQLG K + E I+KAGHLVHLERPCVYNR LKKFL S+  +
Sbjct  254  GESDQIFDLELAKNMKEQLGEKASIESIKKAGHLVHLERPCVYNRRLKKFLASIHYE  310



>ref|NP_001149890.1| catalytic/ hydrolase [Zea mays]
 gb|ACG37115.1| catalytic/ hydrolase [Zea mays]
 tpg|DAA58415.1| TPA: catalytic/ hydrolase [Zea mays]
Length=340

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND IF +ELAK MKEQLG KTT + I KAGHLVHLERPCVYNR LK+FL
Sbjct  278  GENDNIFNIELAKTMKEQLGEKTTLQSISKAGHLVHLERPCVYNRLLKEFL  328



>ref|XP_003569421.1| PREDICTED: uncharacterized protein LOC100846919 [Brachypodium 
distachyon]
Length=336

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND IF +ELAK MKEQLG KTT + I KAGHLVHLERPCVYNR LK+FL  +  D+A 
Sbjct  274  GENDNIFNIELAKTMKEQLGEKTTLQSIDKAGHLVHLERPCVYNRRLKEFLAYVN-DEAP  332

Query  181  K  183
            K
Sbjct  333  K  333



>ref|XP_010263643.1| PREDICTED: epoxide hydrolase 4 [Nelumbo nucifera]
Length=325

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GENDQIF +ELAKA+KE+LG+K +   I+KAGHLVHLERPC YNR LK+ L S+Q D
Sbjct  266  GENDQIFNLELAKALKEKLGNKASLHSIKKAGHLVHLERPCAYNRHLKRILASVQAD  322



>ref|XP_010467647.1| PREDICTED: epoxide hydrolase 4 isoform X1 [Camelina sativa]
Length=324

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQIF +  AK MKEQLG   T E I+KAGHL HLERPCVYNRCLKKFL S+
Sbjct  267  GESDQIFNIGFAKKMKEQLGENATMESIKKAGHLAHLERPCVYNRCLKKFLASV  320



>ref|XP_010467648.1| PREDICTED: epoxide hydrolase 4 isoform X2 [Camelina sativa]
Length=317

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQIF +  AK MKEQLG   T E I+KAGHL HLERPCVYNRCLKKFL S+
Sbjct  260  GESDQIFNIGFAKKMKEQLGENATMESIKKAGHLAHLERPCVYNRCLKKFLASV  313



>ref|XP_010446771.1| PREDICTED: epoxide hydrolase 4-like [Camelina sativa]
Length=311

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GE+D+IF +ELAK MKEQLG K + E I+KAGHLVHLERPCVYNR LKKFL S+  +
Sbjct  254  GESDRIFDLELAKNMKEQLGEKASIESIKKAGHLVHLERPCVYNRRLKKFLASIHYE  310



>ref|XP_006284148.1| hypothetical protein CARUB_v10005282mg [Capsella rubella]
 gb|EOA17046.1| hypothetical protein CARUB_v10005282mg [Capsella rubella]
Length=317

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQIF +ELA+ MKEQ+G   T E I+KAGHLVHLERPCVYNR LKKFL S+
Sbjct  254  GESDQIFDLELARDMKEQIGENATIESIKKAGHLVHLERPCVYNRRLKKFLASI  307



>ref|XP_002886166.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH62425.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=313

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQIF +E AK+MKEQLG   T E I+KAGHL HLERPCVYNR LKKFL S+
Sbjct  256  GESDQIFNLEFAKSMKEQLGENATMESIKKAGHLAHLERPCVYNRRLKKFLASV  309



>ref|NP_565437.1| esterase/lipase domain-containing protein [Arabidopsis thaliana]
 gb|AAK32799.1|AF361631_1 At2g18360/T30D6.13 [Arabidopsis thaliana]
 gb|AAD15501.2| expressed protein [Arabidopsis thaliana]
 gb|AAM47467.1| At2g18360/T30D6.13 [Arabidopsis thaliana]
 gb|AEC06761.1| esterase/lipase domain-containing protein [Arabidopsis thaliana]
Length=313

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQIF +E AK+MKEQLG   T E I+KAGHL HLERPCVYNR LKKFL S+
Sbjct  256  GESDQIFNLEFAKSMKEQLGENATMESIKKAGHLAHLERPCVYNRRLKKFLASV  309



>ref|XP_004969268.1| PREDICTED: epoxide hydrolase 3-like [Setaria italica]
Length=347

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDK  174
            GEND IF +E AK +KEQLG KT    IRKAGHLVHLERPCVYNR +K+FL S+   K
Sbjct  276  GENDNIFNIEPAKTLKEQLGEKTILHSIRKAGHLVHLERPCVYNRYIKEFLASVTAPK  333



>ref|XP_009395686.1| PREDICTED: uncharacterized protein LOC103980888 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GEND IF +E AK +KEQLG KTT + I+KAGHLVHLERPC+YNRCLK+FLV
Sbjct  258  GENDNIFNLEHAKNIKEQLGEKTTLKIIKKAGHLVHLERPCIYNRCLKEFLV  309



>ref|XP_006878596.1| hypothetical protein AMTR_s00011p00254080 [Amborella trichopoda]
 gb|ERM94741.1| hypothetical protein AMTR_s00011p00254080 [Amborella trichopoda]
Length=308

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE DQIF +E+AK M+E+LG K TFEGI+KAGHLVHLERPCVYNR L +FL
Sbjct  244  GEKDQIFNLEVAKNMREELGKKATFEGIKKAGHLVHLERPCVYNRLLNRFL  294



>ref|XP_006411983.1| hypothetical protein EUTSA_v10025766mg [Eutrema salsugineum]
 gb|ESQ53436.1| hypothetical protein EUTSA_v10025766mg [Eutrema salsugineum]
Length=315

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE+DQIF  ELAK MKEQLG K T + I+KAGHLV LERPCVYNR LKKFL S+ 
Sbjct  254  GESDQIFDFELAKKMKEQLGEKATIDSIKKAGHLVQLERPCVYNRHLKKFLASIH  308



>ref|XP_010925926.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Elaeis guineensis]
Length=330

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND IF ++LAK MKEQLG K T  GI+KAGH+V LERPCVYNRCLK+FL
Sbjct  270  GENDNIFNMDLAKNMKEQLGEKATLHGIKKAGHIVPLERPCVYNRCLKQFL  320



>gb|KFK30282.1| hypothetical protein AALP_AA7G241000 [Arabis alpina]
Length=321

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQIF +ELA+ MK+QLG K T + I+KAGHLV LERPCVYNR LKKFL S+
Sbjct  254  GESDQIFDLELARNMKDQLGEKATIDSIKKAGHLVQLERPCVYNRRLKKFLASI  307



>ref|XP_009143412.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Brassica rapa]
Length=315

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE+DQIF  ELAK MK QLG  TT E I+KAGHLV LERPCVYNR LKKFL S+ 
Sbjct  254  GESDQIFDFELAKNMKTQLGENTTIESIKKAGHLVQLERPCVYNRRLKKFLASVH  308



>ref|XP_002867006.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43265.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=315

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE+DQIF +ELA+ MKEQLG   T E I+KAGHLV LERPCVYNR LKKFL S+ 
Sbjct  254  GESDQIFDLELARDMKEQLGENATIESIKKAGHLVQLERPCVYNRRLKKFLASIH  308



>ref|XP_003612007.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES94965.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=317

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQV  168
            G+ D+IFK E+A+ +KE LGS  TFE I+KAGHL HLERPC+YNRCLKKFL S+ +
Sbjct  252  GDKDKIFKSEVAENIKETLGSNATFEVIKKAGHLAHLERPCIYNRCLKKFLSSITL  307



>ref|XP_010548328.1| PREDICTED: epoxide hydrolase 4 isoform X1 [Tarenaya hassleriana]
Length=284

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE D+IF +E+AK M+EQLG K T E I+KAGHLVHLERPCVYNR L KFL S+
Sbjct  223  GEGDKIFNLEVAKNMREQLGEKATMESIKKAGHLVHLERPCVYNRHLNKFLASV  276



>gb|AAM65281.1| putative hydrolase [Arabidopsis thaliana]
Length=317

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE+DQIF +ELA+ MKEQ+G   T E I+KAGHLV LERPCVYNR LKKFL S+ 
Sbjct  254  GESDQIFDLELARDMKEQIGENATIESIKKAGHLVQLERPCVYNRRLKKFLASIH  308



>ref|NP_195379.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 emb|CAB16832.1| putative protein [Arabidopsis thaliana]
 emb|CAB80327.1| putative protein [Arabidopsis thaliana]
 dbj|BAE98661.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABI49444.1| At4g36610 [Arabidopsis thaliana]
 gb|AEE86677.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
Length=317

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE+DQIF +ELA+ MKEQ+G   T E I+KAGHLV LERPCVYNR LKKFL S+ 
Sbjct  254  GESDQIFDLELARDMKEQIGENATIESIKKAGHLVQLERPCVYNRRLKKFLASIH  308



>ref|XP_006299489.1| hypothetical protein CARUB_v10015657mg [Capsella rubella]
 gb|EOA32387.1| hypothetical protein CARUB_v10015657mg [Capsella rubella]
Length=313

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQIF +  AK MKEQLG   T E I+KAGHL HLERPCVYNR LKKFL S+
Sbjct  256  GESDQIFNIGFAKKMKEQLGENATMESIKKAGHLAHLERPCVYNRRLKKFLASV  309



>ref|XP_008805395.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Phoenix dactylifera]
Length=334

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D IF ++LA+  KEQLG K T   IRKAGHLVHLERPCVYNRCLK+FL
Sbjct  277  GEKDNIFNMDLARNAKEQLGEKATLHAIRKAGHLVHLERPCVYNRCLKQFL  327



>ref|XP_010489541.1| PREDICTED: epoxide hydrolase 4-like isoform X1 [Camelina sativa]
 ref|XP_010489542.1| PREDICTED: epoxide hydrolase 4-like isoform X2 [Camelina sativa]
Length=333

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+DQIF +  AK MKEQLG   T E I+KAGHL HLERPCVYNR LKKFL S+
Sbjct  276  GESDQIFNIGFAKKMKEQLGENATMESIKKAGHLAHLERPCVYNRRLKKFLASV  329



>ref|XP_003612006.1| 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate 
hydrolase [Medicago truncatula]
 gb|AES94964.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=318

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
             E D++F  E+A+ MKE+LG+K+T + I+KAGHL H+ERPCVYNRCLK+FL S+ +D+ +
Sbjct  252  AEKDKLFTPEVAQNMKEKLGNKSTLQEIKKAGHLAHIERPCVYNRCLKQFLASVMLDEKK  311

Query  181  K  183
            +
Sbjct  312  R  312



>gb|ACJ84440.1| unknown [Medicago truncatula]
 gb|AFK34362.1| unknown [Medicago truncatula]
Length=318

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
             E D++F  E+A+ MKE+LG+K+T + I+KAGHL H+ERPCVYNRCLK+FL S+ +D+ +
Sbjct  252  AEKDKLFTPEVAQNMKEKLGNKSTLQEIKKAGHLAHIERPCVYNRCLKQFLASVMLDEKK  311

Query  181  K  183
            +
Sbjct  312  R  312



>ref|XP_003547986.1| PREDICTED: epoxide hydrolase 3-like [Glycine max]
Length=316

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND+IF +ELA+ MKEQLG  TTFE I+KAGH+V++ERP ++NRCLK+F+ S       
Sbjct  255  GENDKIFNLELAQNMKEQLGDGTTFEAIKKAGHMVNMERPRLFNRCLKQFIASFLAPNGP  314

Query  181  K  183
            K
Sbjct  315  K  315



>gb|KHN11098.1| Epoxide hydrolase 3 [Glycine soja]
Length=316

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND+IF +ELA+ MKEQLG  TTFE I+KAGH+V++ERP ++NRCLK+F+ S       
Sbjct  255  GENDKIFNLELAQNMKEQLGDGTTFEAIKKAGHMVNMERPRLFNRCLKQFIASFLAPNGP  314

Query  181  K  183
            K
Sbjct  315  K  315



>ref|NP_001043665.2| Os01g0636400 [Oryza sativa Japonica Group]
 dbj|BAF05579.2| Os01g0636400 [Oryza sativa Japonica Group]
Length=181

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND IF +ELA  MKEQLG K   + I KAGHLVH+ERPCVYN+ LK+FL  +  +  +
Sbjct  119  GENDNIFNIELAMTMKEQLGEKAMLQSISKAGHLVHIERPCVYNQHLKEFLAYVNAESPK  178

Query  181  K  183
            +
Sbjct  179  E  179



>dbj|BAJ98525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G ND IF +ELAK MKEQLG KT  E I KAGHLVHLERPCVYN+ L +FL
Sbjct  262  GHNDNIFNIELAKTMKEQLGEKTMLESIDKAGHLVHLERPCVYNQHLMEFL  312



>ref|XP_006644410.1| PREDICTED: epoxide hydrolase 3-like [Oryza brachyantha]
Length=331

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GEND IF +ELA  MKEQLG K T + I KAGHLVH+ERPCVYN+ LK+FL  +  +
Sbjct  269  GENDNIFNIELAMTMKEQLGEKATLQSISKAGHLVHIERPCVYNQHLKEFLAYVNAE  325



>dbj|BAK01681.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98721.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            G+ND IF +ELAK MKEQLG +T  + I KAGHLVHLERPCVYNR L +FL  +  + ++
Sbjct  276  GQNDNIFNIELAKTMKEQLGEETMLQSIDKAGHLVHLERPCVYNRRLLEFLAYVSAEASK  335

Query  181  K  183
            +
Sbjct  336  E  336



>emb|CDY64609.1| BnaA01g34540D [Brassica napus]
Length=315

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDK  174
            GE+DQIF  ELAK MK +LG   T E I+KAGHLV LERPCVYNR LKKFL S+  ++
Sbjct  254  GESDQIFDFELAKNMKSELGENATIESIKKAGHLVQLERPCVYNRRLKKFLASVHSEE  311



>gb|EMS47770.1| 2-hydroxy-6-oxononadienedioate/2-hydroxy-6- oxononatrienedioate 
hydrolase [Triticum urartu]
Length=238

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            G ND IF +ELAK MKEQLG +T  + I KAGHLVHLERPCVYNR L +FL  +  + ++
Sbjct  178  GHNDNIFNIELAKTMKEQLGEETMLQSIDKAGHLVHLERPCVYNRRLLEFLAYVTAEASK  237

Query  181  K  183
            +
Sbjct  238  E  238



>emb|CDX69236.1| BnaC01g02170D [Brassica napus]
Length=315

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE+DQIF  ELAK MK +LG   T E I+KAGHLV LERPCVYNR LKKFL S+ 
Sbjct  254  GESDQIFDFELAKNMKTELGENATIESIKKAGHLVQLERPCVYNRRLKKFLASVH  308



>emb|CDM83475.1| unnamed protein product [Triticum aestivum]
 emb|CDM83488.1| unnamed protein product [Triticum aestivum]
Length=321

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            G ND IF +ELAK MKEQLG +T  + I KAGHLVHLERPCVYNR L +FL  +  + ++
Sbjct  261  GHNDNIFNIELAKTMKEQLGEETMLQSIDKAGHLVHLERPCVYNRRLLEFLAYVSAEASK  320

Query  181  K  183
            +
Sbjct  321  E  321



>emb|CDY36478.1| BnaC03g48370D [Brassica napus]
Length=314

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+D++F +E+AK+MKEQLG   T + I+KAGHL HLERPCVYN+ LKKFL ++
Sbjct  257  GESDKLFNLEMAKSMKEQLGENATMDSIKKAGHLAHLERPCVYNKRLKKFLTAV  310



>ref|XP_010924284.1| PREDICTED: epoxide hydrolase 4 [Elaeis guineensis]
Length=321

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GEND+I  ++LA+ MK+QLG K T +GI+KAGHLVHLERP VYNRCLK+FL  + 
Sbjct  261  GENDRILNMKLAEDMKKQLGEKATLQGIKKAGHLVHLERPRVYNRCLKQFLAQVH  315



>gb|EMT21059.1| hypothetical protein F775_25997 [Aegilops tauschii]
Length=331

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            G ND IF +ELAK MKEQLG +T  + I KAGHLVHLERPCVYNR L +FL  +  + ++
Sbjct  271  GHNDNIFNIELAKTMKEQLGEETMLQSIDKAGHLVHLERPCVYNRRLLEFLAYVSAEASK  330

Query  181  K  183
            +
Sbjct  331  E  331



>dbj|BAD68930.1| hydrolase-like [Oryza sativa Japonica Group]
 gb|EAY75096.1| hypothetical protein OsI_02990 [Oryza sativa Indica Group]
 dbj|BAH00883.1| unnamed protein product [Oryza sativa Japonica Group]
Length=337

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND IF +ELA  MKEQLG K   + I KAGHLVH+ERPCVYN+ LK+FL  +  +  +
Sbjct  275  GENDNIFNIELAMTMKEQLGEKAMLQSISKAGHLVHIERPCVYNQHLKEFLAYVNAESPK  334

Query  181  K  183
            +
Sbjct  335  E  335



>gb|EAZ12829.1| hypothetical protein OsJ_02750 [Oryza sativa Japonica Group]
Length=333

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GEND IF +ELA  MKEQLG K   + I KAGHLVH+ERPCVYN+ LK+FL  +  +  +
Sbjct  271  GENDNIFNIELAMTMKEQLGEKAMLQSISKAGHLVHIERPCVYNQHLKEFLAYVNAESPK  330

Query  181  K  183
            +
Sbjct  331  E  331



>ref|XP_009405657.1| PREDICTED: epoxide hydrolase 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=339

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND IF +ELAK MKEQLG K   + I+KAGHL+H+ERPC YNR LKKFL
Sbjct  279  GENDNIFNLELAKDMKEQLGEKAIVQSIKKAGHLLHVERPCAYNRHLKKFL  329



>ref|XP_009405656.1| PREDICTED: epoxide hydrolase 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=343

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND IF +ELAK MKEQLG K   + I+KAGHL+H+ERPC YNR LKKFL
Sbjct  283  GENDNIFNLELAKDMKEQLGEKAIVQSIKKAGHLLHVERPCAYNRHLKKFL  333



>gb|EMS54456.1| hypothetical protein TRIUR3_25793 [Triticum urartu]
Length=248

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G ND IF +ELAK MKEQLG KT  + I KAGHLVHLERPCVYN+ L +FL
Sbjct  185  GHNDNIFNIELAKTMKEQLGEKTMLQSIDKAGHLVHLERPCVYNQRLMEFL  235



>emb|CDY29230.1| BnaA06g25270D [Brassica napus]
Length=314

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+D++F +E+AK MKEQLG   T + I+KAGHL HLERPCVYN+ LKKFL ++
Sbjct  257  GESDKLFNLEMAKNMKEQLGENATMDSIKKAGHLAHLERPCVYNKRLKKFLTAV  310



>ref|XP_009150734.1| PREDICTED: epoxide hydrolase 4 [Brassica rapa]
Length=314

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GE+D++F +E+AK MKEQLG   T + I+KAGHL HLERPCVYN+ LKKFL ++
Sbjct  257  GESDKLFNLEMAKNMKEQLGENATMDSIKKAGHLAHLERPCVYNKRLKKFLTAV  310



>gb|EPS66257.1| hypothetical protein M569_08525 [Genlisea aurea]
Length=301

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND IFK+E A  +KE+LG K + + I KAGHLVHLERPCVYNRCLK FL S 
Sbjct  244  GENDAIFKLEHAANLKEKLGEKASLKYIDKAGHLVHLERPCVYNRCLKHFLQSF  297



>ref|XP_003576834.1| PREDICTED: uncharacterized protein LOC100838123 isoform X2 [Brachypodium 
distachyon]
Length=333

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE+D  F VE AK +KE+LG K T   I +AGHL HLERPCVYNRCLK+FL 
Sbjct  269  GEDDDFFPVEGAKMLKEELGEKATLRSISRAGHLAHLERPCVYNRCLKEFLA  320



>ref|XP_010238499.1| PREDICTED: uncharacterized protein LOC100838123 isoform X1 [Brachypodium 
distachyon]
Length=335

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE+D  F VE AK +KE+LG K T   I +AGHL HLERPCVYNRCLK+FL
Sbjct  271  GEDDDFFPVEGAKMLKEELGEKATLRSISRAGHLAHLERPCVYNRCLKEFL  321



>gb|KCW63982.1| hypothetical protein EUGRSUZ_G016631, partial [Eucalyptus grandis]
Length=97

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF VE+AK++KE LG   T   I KAGHLV LERP VYN+CLKK L S+
Sbjct  37   GENDRIFPVEVAKSLKENLGDSATLVCIEKAGHLVALERPFVYNKCLKKILASI  90



>gb|KDO47526.1| hypothetical protein CISIN_1g0222531mg, partial [Citrus sinensis]
Length=68

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF +++A+ +KEQ+G   T E I KAGHLV+LERP VYNR LK  L SL
Sbjct  7    GENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASL  60



>ref|XP_006655626.1| PREDICTED: alpha/beta hydrolase domain-containing protein 11-like 
[Oryza brachyantha]
Length=318

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVS  159
            GEND  F +E+AK +KE+LG K T   I KAGHL HLERPCVYNR L +FL S
Sbjct  261  GENDDFFTMEMAKKLKEELGEKATLRSISKAGHLAHLERPCVYNRILMEFLQS  313



>gb|KDO47525.1| hypothetical protein CISIN_1g0222531mg, partial [Citrus sinensis]
Length=98

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF +++A+ +KEQ+G   T E I KAGHLV+LERP VYNR LK  L SL
Sbjct  37   GENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASL  90



>ref|NP_001148540.1| catalytic/ hydrolase [Zea mays]
 gb|ACG31903.1| catalytic/ hydrolase [Zea mays]
Length=362

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            G+ND IF +ELA+++KEQLG K T   I KAGHLV LERP V+NRCL++FL+
Sbjct  307  GDNDSIFNMELARSLKEQLGEKATLRSIAKAGHLVMLERPRVFNRCLREFLL  358



>ref|XP_004953623.1| PREDICTED: uncharacterized protein LOC101758156 [Setaria italica]
Length=333

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D+IF +ELAK MKEQLG      GIRKAGHL+H+ERPC YNR L+++L
Sbjct  270  GEEDKIFDIELAKKMKEQLGDNCFLHGIRKAGHLLHVERPCAYNRQLQRWL  320



>gb|KCW45335.1| hypothetical protein EUGRSUZ_L009972, partial [Eucalyptus grandis]
Length=97

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF  E+AK++KE LG+  T   I KAGH+V LERP VYN+CLKK L S+
Sbjct  37   GENDRIFPAEVAKSVKENLGNSATLVCIEKAGHMVALERPFVYNKCLKKILASI  90



>gb|KCW63983.1| hypothetical protein EUGRSUZ_G01665 [Eucalyptus grandis]
Length=305

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF VE+AK++KE LG   T   I KAGHLV LERP VYN+CLKK L S+
Sbjct  245  GENDRIFPVEVAKSLKENLGDNATLVCIEKAGHLVALERPFVYNKCLKKILASI  298



>ref|XP_003578638.1| PREDICTED: uncharacterized protein LOC100841479 [Brachypodium 
distachyon]
Length=331

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKA  177
            GE+D+ F +E AK ++E+LG K     IRKAGHL HLERPCVYNR LK+FL  +    A
Sbjct  272  GESDKFFPIEDAKRLREELGEKAILRSIRKAGHLAHLERPCVYNRYLKEFLARVNAVSA  330



>gb|AAL87168.1|AF480496_22 putative hydrolase [Oryza sativa Japonica Group]
 dbj|BAD08052.1| putative hydrolase [Oryza sativa Japonica Group]
 dbj|BAD08096.1| putative hydrolase [Oryza sativa Japonica Group]
 gb|EAZ20348.1| hypothetical protein OsJ_35956 [Oryza sativa Japonica Group]
Length=339

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D+IF +ELAK MKEQLG      GI KAGHL+H+ERPC YNR L++FL
Sbjct  273  GEEDKIFDIELAKKMKEQLGDGCFLHGIPKAGHLLHVERPCAYNRQLQRFL  323



>gb|EAY87227.1| hypothetical protein OsI_08629 [Oryza sativa Indica Group]
Length=339

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D+IF +ELAK MKEQLG      GI KAGHL+H+ERPC YNR L++FL
Sbjct  273  GEEDKIFDIELAKKMKEQLGDGCFLHGIPKAGHLLHVERPCAYNRQLQRFL  323



>gb|EMT20986.1| hypothetical protein F775_17841 [Aegilops tauschii]
Length=217

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE+D  F +E AK +KE+LG K     I KAGHL  LERPCVYN CLK+FL ++ 
Sbjct  160  GEDDDFFPIENAKMLKEKLGEKAMLRSISKAGHLAQLERPCVYNHCLKEFLATIS  214



>ref|XP_003578639.1| PREDICTED: epoxide hydrolase 4-like [Brachypodium distachyon]
Length=325

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE+D  F +E AK +KE+LG K T   IRKAGHL  LERP VYNRCLK+FL
Sbjct  269  GESDNFFPIESAKRLKEELGEKVTLRSIRKAGHLAQLERPFVYNRCLKEFL  319



>gb|KCW63989.1| hypothetical protein EUGRSUZ_G016731, partial [Eucalyptus grandis]
Length=125

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF +E+A+++KE LG   T   I KAGH+V +ERP VYN+CLKK L S+
Sbjct  65   GENDRIFPLEVAQSLKENLGDNATLVCIEKAGHIVAVERPFVYNKCLKKILASI  118



>gb|ACF84815.1| unknown [Zea mays]
Length=295

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D+IF +ELA+ MKEQLG      GIRKAGHL+H+ERPC YNR L+++ 
Sbjct  232  GEEDKIFDIELARKMKEQLGDNCFLYGIRKAGHLLHVERPCAYNRQLQRWF  282



>gb|AFW73031.1| hypothetical protein ZEAMMB73_600923 [Zea mays]
Length=303

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D+IF +ELA+ MKEQLG      GIRKAGHL+H+ERPC YNR L+++ 
Sbjct  240  GEEDKIFDIELARKMKEQLGDNCFLYGIRKAGHLLHVERPCAYNRQLQRWF  290



>ref|XP_007156948.1| hypothetical protein PHAVU_002G030900g [Phaseolus vulgaris]
 gb|ESW28942.1| hypothetical protein PHAVU_002G030900g [Phaseolus vulgaris]
Length=284

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE+D+I K+E A+ MK+ +G+  TFEGI+ AGHLVHLERP +YN+ L++FL
Sbjct  225  GEDDKILKLEFAQKMKDMVGNNATFEGIKNAGHLVHLERPWLYNKSLRQFL  275



>ref|XP_006423282.1| hypothetical protein CICLE_v10028935mg [Citrus clementina]
 ref|XP_006469150.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Citrus 
sinensis]
 gb|ESR36522.1| hypothetical protein CICLE_v10028935mg [Citrus clementina]
Length=270

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF +++A+ +KEQ+G   T E I KAGHLV+LERP VYNR LK  L SL
Sbjct  209  GENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASL  262



>tpg|DAA61315.1| TPA: catalytic/ hydrolase [Zea mays]
Length=362

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            G+ND IF +ELA+++KEQLG K T   I KAGHLV LERP V+N CL++FL+
Sbjct  307  GDNDSIFNMELARSLKEQLGEKATLRSIAKAGHLVMLERPRVFNGCLREFLL  358



>ref|NP_001146375.1| uncharacterized protein LOC100279953 [Zea mays]
 gb|ACF84269.1| unknown [Zea mays]
 gb|ACL53819.1| unknown [Zea mays]
 gb|AFW73030.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_600923 [Zea 
mays]
 gb|AFW73037.1| hypothetical protein ZEAMMB73_225947 [Zea mays]
Length=328

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D+IF +ELA+ MKEQLG      GIRKAGHL+H+ERPC YNR L+++ 
Sbjct  265  GEEDKIFDIELARKMKEQLGDNCFLYGIRKAGHLLHVERPCAYNRQLQRWF  315



>ref|XP_010068563.1| PREDICTED: uncharacterized protein LOC104455476 [Eucalyptus grandis]
Length=275

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF  E+AK++KE LG   T   I KAGH+V LERP VYN+CLKK L S+
Sbjct  215  GENDRIFPAEVAKSVKENLGDSATLVCIEKAGHMVALERPFVYNKCLKKILASI  268



>ref|XP_006423281.1| hypothetical protein CICLE_v10028935mg [Citrus clementina]
 ref|XP_006469149.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Citrus 
sinensis]
 gb|ESR36521.1| hypothetical protein CICLE_v10028935mg [Citrus clementina]
Length=300

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF +++A+ +KEQ+G   T E I KAGHLV+LERP VYNR LK  L SL
Sbjct  239  GENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASL  292



>ref|XP_006647769.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Oryza brachyantha]
Length=340

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D+IF +E+AK MKEQLG      GI KAGHL+H+ERPC YNR L++FL
Sbjct  273  GEEDKIFDIEVAKKMKEQLGDGCFLHGIPKAGHLLHVERPCAYNRQLQRFL  323



>ref|XP_008382204.1| PREDICTED: uncharacterized protein LOC103445011 [Malus domestica]
Length=304

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GEND+IF +E AK +K QLG   T + I K GHLVH+E P VYNR LKKFL SL 
Sbjct  243  GENDKIFDMETAKILKNQLGDNATLKSIEKTGHLVHMEGPFVYNRELKKFLSSLS  297



>dbj|BAK00702.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE D++F +ELA  MKEQLG     +GI KAGHL+HLERPC YNR L +FL 
Sbjct  274  GEEDKLFDIELAMKMKEQLGENCYLQGIPKAGHLLHLERPCAYNRQLGRFLA  325



>gb|KCW63984.1| hypothetical protein EUGRSUZ_G01668 [Eucalyptus grandis]
Length=320

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF  E+AK++KE LG   T   I KAGH+V LERP VYN+CLKK L S+
Sbjct  260  GENDRIFPAEVAKSVKENLGDSATLVCIEKAGHMVALERPFVYNKCLKKILASI  313



>ref|XP_003570197.1| PREDICTED: epoxide hydrolase 4 [Brachypodium distachyon]
Length=362

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D++F + LA+ MKEQLG     +GI KAGHL+HLERPC YNR L +FL
Sbjct  279  GEEDKLFDIGLARKMKEQLGENCFLQGIPKAGHLLHLERPCAYNRQLGRFL  329



>ref|XP_004164828.1| PREDICTED: epoxide hydrolase 3-like [Cucumis sativus]
Length=303

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            G ND +F +++A  MKE+ G K T + I KAGH+V +ERP +YN+CL+KFL SL+
Sbjct  244  GRNDNLFDIQIAYNMKEKFGEKATMDCIEKAGHIVAMERPFIYNKCLQKFLHSLE  298



>ref|XP_004148865.1| PREDICTED: epoxide hydrolase 3-like [Cucumis sativus]
 gb|KGN61797.1| hypothetical protein Csa_2G247580 [Cucumis sativus]
Length=303

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            G ND +F +++A  MKE+ G K T + I KAGH+V +ERP +YN+CL+KFL SL+
Sbjct  244  GRNDNLFDIQIAYNMKEKFGEKATMDCIEKAGHIVAMERPFIYNKCLQKFLHSLE  298



>emb|CDY71957.1| BnaUnng04770D [Brassica napus]
Length=83

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GEND  F VE AK ++ +LG  T+ E I+  GHLV L+RP VYN+ L KFL S+ 
Sbjct  29   GENDLFFSVEFAKDLQRKLGEMTSMESIKNGGHLVQLDRPFVYNKLLNKFLASVH  83



>gb|EMT14159.1| hypothetical protein F775_05095 [Aegilops tauschii]
Length=445

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKK  147
            GE D++F +ELAK MKEQLG     +GI KAGHL+HLERPC YNR L +
Sbjct  283  GEEDKLFDIELAKKMKEQLGENCYLQGIPKAGHLLHLERPCAYNRQLGR  331



>ref|XP_009109326.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Brassica rapa]
Length=296

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GEND  F VE AK ++ +LG  T+ E I+  GHLV L+RP VYN+ L KFLVS+ 
Sbjct  242  GENDLFFSVEFAKDLQPKLGEMTSMESIKNGGHLVQLDRPFVYNKLLNKFLVSVH  296



>ref|XP_002462333.1| hypothetical protein SORBIDRAFT_02g023970 [Sorghum bicolor]
 gb|EER98854.1| hypothetical protein SORBIDRAFT_02g023970 [Sorghum bicolor]
Length=328

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE+D IF +ELA+++KEQLG K T   I KAGHLV LERP  +NR L +FL+
Sbjct  269  GEDDSIFNMELARSLKEQLGEKATLRSIAKAGHLVMLERPRAFNRRLMEFLL  320



>emb|CDX69235.1| BnaC01g02180D [Brassica napus]
Length=290

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GENDQ F +E  K ++ +LG  T+ E I+  GHLV LERP VYN+ L KFL S++
Sbjct  234  GENDQFFSLEFVKDLRVKLGEMTSMESIKNGGHLVQLERPFVYNKLLNKFLASVE  288



>ref|XP_004230956.1| PREDICTED: monoacylglycerol lipase abhd6-A [Solanum lycopersicum]
Length=295

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVS  159
            G++D+IF    +  MKE+LG  TT + I+ AGHLV LERPC YN  LKKFL S
Sbjct  242  GDDDKIFNKTFSDDMKEKLGKNTTIQYIKNAGHLVQLERPCTYNHYLKKFLSS  294



>ref|XP_009762310.1| PREDICTED: uncharacterized protein LOC104214353 [Nicotiana sylvestris]
Length=309

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G++D+IF V ++  MK++LG   T + I+KAGHLV LERPC YN  LKKFL
Sbjct  256  GDDDKIFNVAVSDNMKQKLGENATIDYIKKAGHLVQLERPCSYNNYLKKFL  306



>gb|EMT25786.1| hypothetical protein F775_21288 [Aegilops tauschii]
Length=368

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDK  174
            GEND  F +E A+ +K +LG K     I KAGHL HLERPCVYNR LK+FL    VD+
Sbjct  310  GENDNYFIIEDAERLKRELGEKAMLRTISKAGHLAHLERPCVYNRYLKEFLA--HVDR  365



>gb|KCW63978.1| hypothetical protein EUGRSUZ_G01660 [Eucalyptus grandis]
Length=240

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G +D IF V L K +K +LG+K T E I KAGHL  LERP VYN+CLK+ L S+
Sbjct  181  GADDNIFNVGLVKDIKGKLGNKATMECIEKAGHLAMLERPFVYNKCLKRILASI  234



>ref|XP_006365115.1| PREDICTED: uncharacterized protein LOC102589861 [Solanum tuberosum]
Length=301

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVS  159
            G++D+IF    +  MKE+LG  TT + I+ AGHLV LERPC YN  LKK L S
Sbjct  248  GDDDKIFNTTFSDYMKEKLGKNTTIQYIKNAGHLVQLERPCTYNHYLKKLLSS  300



>ref|XP_010066157.1| PREDICTED: uncharacterized protein LOC104453330 [Eucalyptus grandis]
Length=300

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G +D IF V L K +K +LG+K T E I KAGHL  LERP VYN+CLK+ L S+
Sbjct  241  GADDNIFNVGLVKDIKGKLGNKATMECIEKAGHLAMLERPFVYNKCLKRILASI  294



>ref|XP_009143626.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Brassica rapa]
Length=290

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GENDQ F  E AK ++ +LG  T+ E I+  GHLV LERP VYN+ L KFL S++
Sbjct  234  GENDQFFSHEFAKDLRIKLGEMTSMEIIKNGGHLVQLERPFVYNKLLNKFLASVE  288



>emb|CDY64608.1| BnaA01g34530D [Brassica napus]
Length=290

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GENDQ F  E AK ++ +LG  T+ E I+  GHLV LERP VYN+ L KFL S++
Sbjct  234  GENDQFFSHEFAKDLRIKLGEMTSMEIIKNGGHLVQLERPFVYNKLLNKFLASVE  288



>ref|XP_009788105.1| PREDICTED: uncharacterized protein LOC104235966 [Nicotiana sylvestris]
Length=309

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G++D+IF   ++  MK++LG   T + I+KAGHLV LERPC YN  LKKFL
Sbjct  256  GDDDKIFNTAVSDNMKQKLGENVTIDYIKKAGHLVQLERPCSYNHYLKKFL  306



>gb|KHG01877.1| Monoacylglycerol lipase abhd6-A [Gossypium arboreum]
Length=78

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G+ND+IF+VE  + +++Q+G K + E I  +GH+V LERP  YN CL K L SL
Sbjct  22   GKNDKIFEVENGQYLQQQIGEKASVEYIENSGHIVQLERPFKYNSCLNKILPSL  75



>gb|KDO47521.1| hypothetical protein CISIN_1g0210701mg, partial [Citrus sinensis]
Length=102

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+I  ++ A+  KEQ+G   T   I KAGHL ++ERP VYNR LK+ L SL
Sbjct  40   GENDKILDMQTARNCKEQVGENATLVSIEKAGHLPNVERPFVYNRKLKRILASL  93



>ref|XP_009587042.1| PREDICTED: uncharacterized protein LOC104084799 isoform X1 [Nicotiana 
tomentosiformis]
Length=309

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G++D+IF + ++  MK++LG   T E I++AGHLV LERPC YN  LKKFL
Sbjct  256  GDDDKIFNMAVSDNMKQKLGENGTIEYIKEAGHLVQLERPCSYNNYLKKFL  306



>ref|XP_008377296.1| PREDICTED: uncharacterized protein LOC103440399 [Malus domestica]
Length=289

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+IF +E AK +K QLG   T + I K GHLV +E P VYN  LK+FL SL
Sbjct  228  GENDKIFDMETAKNLKNQLGDNATLKSIEKTGHLVQVEGPFVYNGELKRFLSSL  281



>ref|XP_010068572.1| PREDICTED: uncharacterized protein LOC104455485 [Eucalyptus grandis]
Length=289

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKA  177
            G++D++  VE A+ +KE+LG+K T + I KAGH+  +ERP V+NRCLK+ L S+  +++
Sbjct  225  GKDDKVLSVERARELKEKLGNKATLQCIEKAGHIALIERPFVFNRCLKRILASIYDERS  283



>gb|KCW63990.1| hypothetical protein EUGRSUZ_G01677 [Eucalyptus grandis]
Length=304

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKA  177
            G++D++  VE A+ +KE+LG+K T + I KAGH+  +ERP V+NRCLK+ L S+  +++
Sbjct  240  GKDDKVLSVERARELKEKLGNKATLQCIEKAGHIALIERPFVFNRCLKRILASIYDERS  298



>gb|KHG10485.1| Epoxide hydrolase 4 [Gossypium arboreum]
Length=228

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G+ND+IF+VE A  +++QLG K + E I  +GH+V LERP  YN CL K L SL
Sbjct  172  GKNDKIFEVENAHYLQQQLGEKASVEYIENSGHIVQLERPFKYNSCLNKILPSL  225



>ref|XP_008236906.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Prunus mume]
Length=308

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GEND+IF +E A+ ++ QLG     E I +AGHLV +ERP VYN+ LK+ L S   D
Sbjct  248  GENDKIFNMETARNLRMQLGGGAKLESIEEAGHLVQMERPFVYNKQLKEILASFSED  304



>ref|XP_010088927.1| hypothetical protein L484_018554 [Morus notabilis]
 gb|EXB37131.1| hypothetical protein L484_018554 [Morus notabilis]
Length=301

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE D++F +E+ +  KEQLG K T   I+KAGH+ H+ERP VYNR LK  L
Sbjct  247  GEEDKLFNLEIVQKTKEQLGEKATLYYIKKAGHIAHVERPFVYNRLLKDIL  297



>ref|XP_006365111.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Solanum tuberosum]
Length=298

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G++D+IF   ++  MK +LG  T+ + I+KAGHLV LERP  YNRCLK +L
Sbjct  239  GDDDKIFNHTVSDIMKAKLGENTSMKYIKKAGHLVQLERPYTYNRCLKNYL  289



>gb|EMS66424.1| hypothetical protein TRIUR3_08137 [Triticum urartu]
Length=311

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND ++ +E A+ +K +LG K     I KAGHLV LERPCV+NR L +FL
Sbjct  253  GENDNMWPIEDAECLKHKLGEKANLRRISKAGHLVQLERPCVFNRNLIEFL  303



>gb|EMT31254.1| hypothetical protein F775_17120 [Aegilops tauschii]
Length=311

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND ++ +E A+ +K +LG K     I KAGHLV LERPCV+NR L +FL
Sbjct  253  GENDNMWPIEDAECLKHKLGEKANLRRISKAGHLVQLERPCVFNRNLIEFL  303



>gb|KDP46260.1| hypothetical protein JCGZ_10100 [Jatropha curcas]
Length=297

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL-VSLQV  168
            GEND+IF +E A  +KEQL  K T   I KAGHLV LERP  YNR L K L + LQV
Sbjct  241  GENDKIFNLEDAYNLKEQLKGKATLHYIEKAGHLVPLERPFAYNRQLNKILALQLQV  297



>ref|XP_003631665.1| PREDICTED: epoxide hydrolase 4-like [Vitis vinifera]
 emb|CBI32598.3| unnamed protein product [Vitis vinifera]
Length=304

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G+ D++F +E+A  +KEQLG K   + I KAGHL   ERPC YN  LK+ L SL
Sbjct  244  GDGDKLFDLEVAHNLKEQLGDKAKLQCIEKAGHLSQFERPCAYNAHLKRILASL  297



>emb|CDO97042.1| unnamed protein product [Coffea canephora]
Length=299

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G ND+I  +E A  +K++LG K     I  AGHLV ++RP +YNRCLKK L S+
Sbjct  242  GANDRILSLEFAWMLKKKLGDKARLVWIEGAGHLVQMDRPYLYNRCLKKILASV  295



>ref|XP_007042181.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX98012.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 
[Theobroma cacao]
Length=286

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G+ND+IF +  A+ +K+Q+  K + E I K+GHLV LERP VYN  LKK L SL
Sbjct  215  GQNDKIFDLGTARNLKQQIREKASLEYIEKSGHLVQLERPFVYNSHLKKILASL  268



>ref|XP_007199433.1| hypothetical protein PRUPE_ppa026591mg [Prunus persica]
 gb|EMJ00632.1| hypothetical protein PRUPE_ppa026591mg [Prunus persica]
Length=308

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GEND+IF +E A+ ++ QLG     + I +AGHLV +ERP VYN+ LK+ L S   D
Sbjct  248  GENDKIFNMETARNLRMQLGGSAKLQCIEEAGHLVQMERPFVYNKQLKEILASFSED  304



>ref|XP_007200797.1| hypothetical protein PRUPE_ppa024898mg [Prunus persica]
 gb|EMJ01996.1| hypothetical protein PRUPE_ppa024898mg [Prunus persica]
Length=308

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GEND+IF +E A+ ++ QLG     + I +AGHL+H+E+P V+N+ LK+ L S   D
Sbjct  248  GENDKIFNMETARNLRMQLGGSAKLQSIEEAGHLLHIEKPFVFNKQLKEILASFSED  304



>ref|XP_006469148.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Citrus sinensis]
Length=317

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            GEND+I  ++ A+  KEQ+G   T   I KAGHL ++ERP VYNR LK+ L SL
Sbjct  255  GENDKILDMQTARNCKEQVGENATLVSIEKAGHLPNVERPFVYNRKLKRILASL  308



>ref|XP_011048375.1| PREDICTED: epoxide hydrolase 3-like [Populus euphratica]
Length=336

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQL-GSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GE D IF  E+A+ +KE+L G K T   + KAGH+V  ERPC YNR LKK L SL  +
Sbjct  279  GEEDVIFTKEIARNLKERLLGGKATLHYVEKAGHVVQSERPCAYNRQLKKILASLYAN  336



>ref|XP_011037515.1| PREDICTED: epoxide hydrolase 4-like [Populus euphratica]
 ref|XP_011037517.1| PREDICTED: epoxide hydrolase 4-like [Populus euphratica]
Length=307

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            G ND IF +E A+ +KEQL  K T + I  AGHLV  ERP  YN+ LKK L SL  D   
Sbjct  247  GGNDLIFNMEEARNLKEQLEGKATLQFIENAGHLVQSERPSAYNKHLKKILASLHEDGKT  306

Query  181  K  183
            K
Sbjct  307  K  307



>ref|XP_010690865.1| PREDICTED: uncharacterized protein LOC104904342 [Beta vulgaris 
subsp. vulgaris]
Length=302

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G  D+IF +E+A ++ E+LG K   + + KAGHL  LERPC +N+CLK+ L S 
Sbjct  247  GNEDKIFTLEVANSLNERLGGKIELQVVPKAGHLALLERPCAFNKCLKEMLNSF  300



>ref|XP_002305433.1| hypothetical protein POPTR_0004s16310g [Populus trichocarpa]
 gb|EEE85944.1| hypothetical protein POPTR_0004s16310g [Populus trichocarpa]
Length=307

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            G +D IF +E A+ +KEQL  K T + I  AGHLV  ERP  YN+ LKK L SL  D  +
Sbjct  247  GGDDIIFNMEEARNLKEQLEGKATLQFIENAGHLVQSERPSAYNKHLKKILASLHEDGKK  306

Query  181  K  183
            K
Sbjct  307  K  307



>dbj|BAJ85024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=318

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G++D  F VE AK +KE+LG K   + I KAGHL  LERPCVYNRCLK+FL
Sbjct  258  GDDDDFFPVENAKKLKEKLGKKAMLQSISKAGHLAQLERPCVYNRCLKEFL  308



>ref|XP_006379247.1| hypothetical protein POPTR_0009s11980g [Populus trichocarpa]
 gb|ERP57044.1| hypothetical protein POPTR_0009s11980g [Populus trichocarpa]
Length=309

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQL-GSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GE D  F +E+A+ +KE+L G K T   + KAGH+V  ERPC YN  LKK L SL  +
Sbjct  252  GEEDVFFTMEIARNLKERLLGGKATLHYVEKAGHVVPSERPCAYNGQLKKILASLYAN  309



>ref|XP_002313792.2| hypothetical protein POPTR_0009s11970g [Populus trichocarpa]
 gb|EEE87747.2| hypothetical protein POPTR_0009s11970g [Populus trichocarpa]
Length=314

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQL-GSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE D IF +E+A+ ++E+L   K     I KAGH V LERP  YNR LKK LVSL 
Sbjct  257  GEEDIIFNMEVARNLQEKLLAGKAPLHYIEKAGHAVPLERPFAYNRQLKKILVSLH  312



>ref|XP_007042178.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 
[Theobroma cacao]
 ref|XP_007042179.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX98009.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX98010.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 
[Theobroma cacao]
Length=317

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            G++D++  ++ A+ MK+Q+G   T   + KAGHL H+ERP + NR +KK L SL
Sbjct  245  GKDDKLIDLDAARNMKKQIGENATLHCMEKAGHLAHMERPFMCNRFIKKILASL  298



>ref|XP_011048355.1| PREDICTED: epoxide hydrolase 4-like isoform X1 [Populus euphratica]
Length=314

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQL-GSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            GE D IF +E+A+ ++E+L   K     I K GH V LERP  YNR LKK LVSL 
Sbjct  257  GEEDIIFNMEVARNLQEKLLAGKAPLHYIEKGGHAVPLERPFAYNRQLKKILVSLH  312



>ref|XP_006423280.1| hypothetical protein CICLE_v10029764mg [Citrus clementina]
 gb|ESR36520.1| hypothetical protein CICLE_v10029764mg [Citrus clementina]
Length=55

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  25   VELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSL  162
            ++ A+  KEQ+G   T   I KAGHL ++ERP VYNR LK+ L SL
Sbjct  1    MQTARNCKEQVGENATLVSIEKAGHLPNVERPFVYNRKLKRILASL  46



>ref|XP_006379243.1| hypothetical protein POPTR_0009s11960g [Populus trichocarpa]
 gb|ERP57040.1| hypothetical protein POPTR_0009s11960g [Populus trichocarpa]
Length=287

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            G +D IF  E  + +KE L  K T   I +AGHLV LERP  YNR LK+ L SL  D
Sbjct  227  GVDDIIFDKEEVRNLKELLEGKATVHCIERAGHLVELERPFAYNRQLKQILASLYED  283



>ref|XP_011048411.1| PREDICTED: uncharacterized protein LOC105142459 isoform X2 [Populus 
euphratica]
Length=271

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            G +D IF  E  + +KE L  K T   I +AGHLV LERP  YNR LK+ L SL  D
Sbjct  211  GVDDIIFDKEEVRNLKELLEGKATVHCIERAGHLVELERPFAYNRQLKQILASLYED  267



>ref|XP_011048404.1| PREDICTED: uncharacterized protein LOC105142459 isoform X1 [Populus 
euphratica]
Length=302

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            G +D IF  E  + +KE L  K T   I +AGHLV LERP  YNR LK+ L SL  D
Sbjct  242  GVDDIIFDKEEVRNLKELLEGKATVHCIERAGHLVELERPFAYNRQLKQILASLYED  298



>gb|EMT17909.1| hypothetical protein F775_17771 [Aegilops tauschii]
Length=54

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  16   IFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            ++ +E A+++K +LG K     I K GHLV LERPCV+N  L +FL 
Sbjct  1    MWPIEDAESLKNKLGEKAILRRISKGGHLVQLERPCVFNSNLIEFLA  47



>ref|XP_006645536.1| PREDICTED: uncharacterized protein LOC102703741 [Oryza brachyantha]
Length=221

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVS  159
            GE DQIF VE A  +KE LG K T + I   GHL H E P ++N  L KFL+ 
Sbjct  161  GEFDQIFPVEKAHKVKEILGEKATLKIIPNTGHLAHQEDPKMFNDILLKFLLP  213



>ref|NP_001042132.1| Os01g0168800 [Oryza sativa Japonica Group]
 dbj|BAB39918.1| P0028E10.22 [Oryza sativa Japonica Group]
 dbj|BAB92508.1| hydrolase -like protein [Oryza sativa Japonica Group]
 dbj|BAF04046.1| Os01g0168800 [Oryza sativa Japonica Group]
Length=336

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE DQIF VE A  +KE LG K T + I   GHL H E P ++N  L KFL+
Sbjct  275  GEFDQIFPVEKAHKVKEMLGEKATVKIIPNTGHLAHQEDPKMFNDILLKFLL  326



>gb|EAY72695.1| hypothetical protein OsI_00563 [Oryza sativa Indica Group]
Length=336

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVS  159
            GE DQIF VE A  +KE LG K T + I   GHL H E P ++N  L KFL+ 
Sbjct  275  GEFDQIFPVEKAHKVKEMLGEKATVKIIPNTGHLAHQEDPKMFNDILLKFLLP  327



>gb|EEE53941.1| hypothetical protein OsJ_00529 [Oryza sativa Japonica Group]
Length=268

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE DQIF VE A  +KE LG K T + I   GHL H E P ++N  L KFL+
Sbjct  207  GEFDQIFPVEKAHKVKEMLGEKATVKIIPNTGHLAHQEDPKMFNDILLKFLL  258



>ref|XP_004968331.1| PREDICTED: uncharacterized protein LOC101759345 [Setaria italica]
Length=328

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE DQIF VE A  MKE+LG K T + I  AGHL   E P ++N+ L  FL+
Sbjct  265  GEFDQIFPVEKAHKMKEKLGEKATVKVIPNAGHLPQQEDPKLFNQILLDFLL  316



>gb|AFK39625.1| unknown [Lotus japonicus]
Length=127

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND+IF V++A  +KE +  K   E I+ A H+  LE+P  +N  +  FL
Sbjct  73   GENDRIFPVQMAHELKEAISQKARLELIKDASHVPQLEKPVEFNNIILNFL  123



>ref|XP_009362895.1| PREDICTED: uncharacterized protein LOC103952919 [Pyrus x bretschneideri]
Length=308

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE DQIF +E+A  +KE LG KT  E I+   H+  +E P  +N  +K +L
Sbjct  255  GEKDQIFPLEMATELKELLGPKTKLEVIKNTSHVPQVENPAQFNNIVKSYL  305



>ref|XP_007223174.1| hypothetical protein PRUPE_ppa009136mg [Prunus persica]
 gb|EMJ24373.1| hypothetical protein PRUPE_ppa009136mg [Prunus persica]
Length=305

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G+ DQIF +E+A  +KE LGSKT  E I+   H+  +E P  +N  ++ FL
Sbjct  251  GDKDQIFPLEMATELKELLGSKTRLEVIKNTSHVPQVENPIQFNNIVESFL  301



>ref|XP_006379242.1| hypothetical protein POPTR_0009s11950g [Populus trichocarpa]
 gb|ERP57039.1| hypothetical protein POPTR_0009s11950g [Populus trichocarpa]
Length=328

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            G +D IF  E  + +KE L  K T   I +AGHLV LE P  YNR LK+ L SL  D   
Sbjct  268  GGDDIIFDKEEVRNLKELLEGKATVHCIERAGHLVELECPLAYNRTLKQILASLYEDGKE  327

Query  181  K  183
            K
Sbjct  328  K  328



>ref|XP_010680530.1| PREDICTED: uncharacterized protein LOC104895664 [Beta vulgaris 
subsp. vulgaris]
Length=311

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE DQIF VELA  +K  +G       I+KAGH +++E+P V  + +K FL+
Sbjct  247  GEQDQIFPVELAHRLKRHIGESAQLVIIKKAGHAINIEKPKVLYKTMKSFLI  298



>ref|XP_008393578.1| PREDICTED: monoacylglycerol lipase ABHD6 [Malus domestica]
Length=308

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GE DQIF +E+A  + E LG KT  E I+   H+  +E P  +N  +K FL
Sbjct  255  GEKDQIFPLEMATELNELLGPKTKLEVIKNTAHVPQVENPAQFNNIVKSFL  305



>ref|XP_002305432.2| hypothetical protein POPTR_0004s16300g [Populus trichocarpa]
 gb|EEE85943.2| hypothetical protein POPTR_0004s16300g [Populus trichocarpa]
Length=303

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            G +D IF ++  + + + L  K T   I +AGHL  LERP VYNR LKK L SL  D
Sbjct  243  GGDDIIFDMKECRNLIDLLQGKATLHCIERAGHLAELERPFVYNRQLKKILASLYED  299



>ref|XP_007046921.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91078.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=619

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = -3

Query  216  LGRDGTEALLSLSGFIYLEGNKELLETPVVDARSLQVNQVTCLPYAFECCLAS  58
             GRD    +L +  F + +G+++ L+ P+V  RSLQVNQV  L YAFECC+ S
Sbjct  566  FGRDSV--ILQIKMF-FTQGSQKTLKAPIVHTRSLQVNQVASLLYAFECCITS  615



>emb|CBI32599.3| unnamed protein product [Vitis vinifera]
Length=364

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +1

Query  49   EQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKARK  183
            +QLG K   + I KAGHL   ERPCVYN  LK+ L SL  DK  K
Sbjct  20   KQLGEKAKLQYIEKAGHLAQSERPCVYNAHLKQILASLTTDKQLK  64



>ref|XP_011037514.1| PREDICTED: epoxide hydrolase 4-like [Populus euphratica]
Length=303

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            G +D IF +   + + + L  K T   I +AGHL  LERP VYNR LKK L SL  D
Sbjct  243  GGDDIIFDMTECRNLIDLLQGKATLHCIERAGHLAELERPFVYNRQLKKILASLYED  299



>ref|XP_010049288.1| PREDICTED: uncharacterized protein LOC104437938 [Eucalyptus grandis]
 gb|KCW81812.1| hypothetical protein EUGRSUZ_C03169 [Eucalyptus grandis]
Length=316

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            GEND+IF VE+A  +KE LG K   E I+  GH+  LE    +N+ ++ FL
Sbjct  258  GENDRIFPVEMAHELKELLGKKVRLEVIKDTGHVPQLEDTAQFNKIVESFL  308



>gb|KDO73661.1| hypothetical protein CISIN_1g0219212mg, partial [Citrus sinensis]
Length=61

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G+ DQIF +++A  +KE LG K   E I    H+  +E P ++N  +K FL
Sbjct  7    GDQDQIFPLKMATELKELLGKKARLEIIENTSHVPQIENPGLFNSIVKNFL  57



>gb|KDP41386.1| hypothetical protein JCGZ_15793 [Jatropha curcas]
Length=330

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQV  168
            GEND+IF +EL   +K  LG       I+ AGH  ++E+P  + + LK FLV L+V
Sbjct  248  GENDRIFPLELGHRLKRHLGDNAHLAVIKNAGHAFNVEKPKEFIKLLKAFLVDLRV  303



>ref|XP_002455119.1| hypothetical protein SORBIDRAFT_03g004630 [Sorghum bicolor]
 gb|EES00239.1| hypothetical protein SORBIDRAFT_03g004630 [Sorghum bicolor]
Length=338

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVD  171
            GE DQIF +E A  +KE+LG K T + I  +GHL   E P ++NR L +FL+   + 
Sbjct  272  GEFDQIFPLEKAYKVKEKLGEKATVKVIPNSGHLPSQEEPKLFNRVLLEFLLQPSIS  328



>ref|XP_008220584.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Prunus mume]
Length=306

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G+ DQIF +E+A  +KE LG KT  E I+   H+  +E P  +N  ++ FL
Sbjct  252  GDKDQIFPLEMATELKELLGPKTRLEVIKNTSHVPQVENPIQFNNIVESFL  302



>ref|XP_006826568.1| hypothetical protein AMTR_s01033p00010870, partial [Amborella 
trichopoda]
 gb|ERM93805.1| hypothetical protein AMTR_s01033p00010870, partial [Amborella 
trichopoda]
Length=62

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE+DQIF ++L   +K  LG       I  AGH V+LE+P  + + LK FL+
Sbjct  7    GEHDQIFPLDLGHRLKRHLGENAKLVVIPSAGHAVNLEKPKAFCKHLKAFLI  58



>gb|KDO73660.1| hypothetical protein CISIN_1g0219212mg, partial [Citrus sinensis]
Length=93

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G+ DQIF +++A  +KE LG K   E I    H+  +E P ++N  +K FL
Sbjct  39   GDQDQIFPLKMATELKELLGKKARLEIIENTSHVPQIENPGLFNSIVKNFL  89



>ref|XP_002455118.1| hypothetical protein SORBIDRAFT_03g004620 [Sorghum bicolor]
 gb|EES00238.1| hypothetical protein SORBIDRAFT_03g004620 [Sorghum bicolor]
Length=339

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE DQIF V+ A  +KE+LG K T + I K GHL   E P ++N+ L  FL+
Sbjct  274  GEFDQIFPVDKAHKVKEKLGEKATVKVIPKTGHLPQQEDPKLFNQILLDFLL  325



>ref|XP_010098384.1| 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10), 2-diene-4-oate 
hydrolase [Morus notabilis]
 gb|EXB74908.1| 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10), 2-diene-4-oate 
hydrolase [Morus notabilis]
Length=305

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFL  153
            G++D IF  E+A  +KE LG K   E ++  GH+   E+P ++N  + KFL
Sbjct  251  GDHDMIFPFEMAAELKELLGKKVRLEVMKNTGHIPQTEKPALFNEIVNKFL  301



>ref|XP_002465758.1| hypothetical protein SORBIDRAFT_01g045310 [Sorghum bicolor]
 gb|EER92756.1| hypothetical protein SORBIDRAFT_01g045310 [Sorghum bicolor]
Length=335

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            G++DQIF +E A A+K  LG   T E + KAGH+  +E P  +N+ +  FL++ Q
Sbjct  272  GDHDQIFPLEKAFAVKRCLGENVTLEIVEKAGHVPQMEDPDRFNKVVLDFLLASQ  326



>ref|XP_007222763.1| hypothetical protein PRUPE_ppa008754mg [Prunus persica]
 gb|EMJ23962.1| hypothetical protein PRUPE_ppa008754mg [Prunus persica]
Length=320

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GE+DQ+F +E A  +K  LG       I+ AGH +++++P  Y   +K FL+ +Q   A 
Sbjct  248  GEHDQVFPLEFAYKLKRHLGENAELVVIKDAGHAINVQKPKEYYNHIKSFLLDMQQPSAN  307

Query  181  K  183
            K
Sbjct  308  K  308



>gb|ABR18124.1| unknown [Picea sitchensis]
Length=298

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            GE+DQIF +EL   +K  LG +      + AGH VH+E+   +N  LKKFL+
Sbjct  246  GEHDQIFPLELGNRLKRHLGDRAELVLFKDAGHGVHVEKSTKFNSQLKKFLL  297



>ref|XP_008219440.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Prunus mume]
Length=320

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GE+DQ+F +E A  +K  LG       I+ AGH +++++P  Y   +K FL+ +Q   A 
Sbjct  248  GEHDQVFPLEFAYKLKRHLGENAELVVIKDAGHAINVQKPKEYYNHIKSFLLDMQQPSAN  307

Query  181  K  183
            K
Sbjct  308  K  308



>ref|XP_008219441.1| PREDICTED: valacyclovir hydrolase isoform X2 [Prunus mume]
Length=289

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GE+DQ+F +E A  +K  LG       I+ AGH +++++P  Y   +K FL+ +Q   A 
Sbjct  217  GEHDQVFPLEFAYKLKRHLGENAELVVIKDAGHAINVQKPKEYYNHIKSFLLDMQQPSAN  276

Query  181  K  183
            K
Sbjct  277  K  277



>ref|XP_010526035.1| PREDICTED: monoacylglycerol lipase ABHD6 [Tarenaya hassleriana]
Length=304

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQ  165
            G+ DQIF V++A  +KE LG KT  E I+   H+  LER   +N  + +FL S++
Sbjct  250  GDQDQIFPVKMAYELKEILGPKTRLEIIKDTSHIPQLERSQEFNDAVLEFLNSME  304



>ref|XP_006400700.1| hypothetical protein EUTSA_v10014154mg [Eutrema salsugineum]
 gb|ESQ42153.1| hypothetical protein EUTSA_v10014154mg [Eutrema salsugineum]
Length=313

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYN  132
            GE DQ+F +++A  +KE LG K T + I+K  H+ H E+P ++N
Sbjct  256  GEQDQVFPLKMAYDLKEMLGKKATLKVIQKTSHIPHTEKPKIFN  299



>ref|XP_010531367.1| PREDICTED: monoacylglycerol lipase ABHD6 [Tarenaya hassleriana]
Length=312

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDK  174
            GE DQ+F VELA  +K  LG       I+K GH V+LE+P    + +K FL     DK
Sbjct  254  GEEDQVFPVELAHRLKSHLGENAQLSLIKKTGHAVNLEKPKEMYKRMKSFLAVPPKDK  311



>ref|XP_002974805.1| hypothetical protein SELMODRAFT_101938 [Selaginella moellendorffii]
 gb|EFJ24325.1| hypothetical protein SELMODRAFT_101938 [Selaginella moellendorffii]
Length=303

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLV  156
            G +D+IF +ELAK +K  LG       I K GH+  +ERP  +N+ L+ FL+
Sbjct  243  GSHDRIFDLELAKQLKAHLGENAMLVVIEKTGHVPQVERPKEFNKHLQAFLI  294



>gb|EYU18474.1| hypothetical protein MIMGU_mgv1a010034mg [Erythranthe guttata]
Length=324

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVSLQVDKAR  180
            GE D+IF +EL   +K  +G     E I+ AGH V++E+P  + + LK FLV       R
Sbjct  256  GEQDKIFPLELGHRLKSHIGDNAKLEVIKNAGHAVNIEKPKDFAKHLKSFLVGSNSSSQR  315



>gb|KFK42211.1| hypothetical protein AALP_AA2G225700 [Arabis alpina]
Length=319

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    GENDQIFKVELAKAMKEQLGSKTTFEGIRKAGHLVHLERPCVYNRCLKKFLVS  159
            GE+DQ+F +E+ K +++ LG K     I++ GH+ + ERP  + + LK FL+ 
Sbjct  255  GEHDQVFPLEMGKRLEKHLGDKGRLVIIKRTGHIFNFERPKTFVKLLKSFLLD  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508381126058