BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14261_g1_i1 len=117 path=[1:0-116]

Length=117
                                                                      Score     E

ref|XP_011070339.1|  PREDICTED: cellulose synthase-like protein D...  64.7    2e-10   
ref|XP_011070338.1|  PREDICTED: cellulose synthase-like protein D...  64.7    2e-10   
ref|XP_010087475.1|  Cellulose synthase-like protein D3               63.5    4e-10   
gb|AAO03579.1|  cellulose synthase-like protein D4                    62.8    7e-10   Populus tremuloides
ref|XP_011006034.1|  PREDICTED: cellulose synthase-like protein D2    62.8    7e-10   
ref|XP_009361165.1|  PREDICTED: cellulose synthase-like protein D3    62.8    8e-10   
gb|EPS73002.1|  hypothetical protein M569_01753                       62.8    8e-10   
ref|XP_011069707.1|  PREDICTED: cellulose synthase-like protein D2    62.8    8e-10   
ref|XP_009792052.1|  PREDICTED: cellulose synthase-like protein D3    62.4    1e-09   
ref|XP_002325817.2|  cellulase synthase 3 family protein              62.4    1e-09   Populus trichocarpa [western balsam poplar]
gb|KHG15890.1|  Cellulose synthase-like protein D3                    62.4    1e-09   
ref|XP_010267650.1|  PREDICTED: cellulose synthase-like protein D3    62.0    2e-09   
gb|KHG15286.1|  Cellulose synthase-like protein D3                    62.0    2e-09   
ref|XP_010034946.1|  PREDICTED: cellulose synthase-like protein D3    61.6    2e-09   
ref|XP_004307862.1|  PREDICTED: cellulose synthase-like protein D...  61.6    2e-09   
gb|EYU45259.1|  hypothetical protein MIMGU_mgv1a000454mg              61.2    2e-09   
ref|XP_010671117.1|  PREDICTED: cellulose synthase-like protein D3    60.8    4e-09   
ref|XP_006352916.1|  PREDICTED: cellulose synthase-like protein D...  60.8    4e-09   
ref|XP_008354283.1|  PREDICTED: cellulose synthase-like protein D3    60.8    4e-09   
ref|XP_006361262.1|  PREDICTED: cellulose synthase-like protein D...  60.8    4e-09   
ref|XP_008376925.1|  PREDICTED: cellulose synthase-like protein D3    60.5    4e-09   
ref|XP_011007166.1|  PREDICTED: cellulose synthase-like protein D3    60.5    5e-09   
ref|XP_010549830.1|  PREDICTED: cellulose synthase-like protein D3    60.5    5e-09   
ref|XP_009386238.1|  PREDICTED: cellulose synthase-like protein D2    60.5    5e-09   
ref|XP_009351828.1|  PREDICTED: cellulose synthase-like protein D3    60.5    5e-09   
ref|XP_004245916.1|  PREDICTED: cellulose synthase-like protein D3    60.1    7e-09   
gb|KDO47249.1|  hypothetical protein CISIN_1g001213mg                 59.7    8e-09   
ref|XP_006443224.1|  hypothetical protein CICLE_v10023400mg           59.7    8e-09   
ref|XP_009607206.1|  PREDICTED: cellulose synthase-like protein D3    59.7    8e-09   
ref|XP_009771399.1|  PREDICTED: cellulose synthase-like protein D3    59.3    1e-08   
ref|XP_008234563.1|  PREDICTED: cellulose synthase-like protein D3    58.9    2e-08   
ref|XP_007220589.1|  hypothetical protein PRUPE_ppa000473mg           58.9    2e-08   
ref|XP_010677380.1|  PREDICTED: cellulose synthase-like protein D...  58.9    2e-08   
ref|XP_010677379.1|  PREDICTED: cellulose synthase-like protein D...  58.9    2e-08   
ref|XP_004511422.1|  PREDICTED: cellulose synthase-like protein D...  58.5    2e-08   
ref|XP_010558640.1|  PREDICTED: cellulose synthase-like protein D3    58.2    3e-08   
emb|CBI26518.3|  unnamed protein product                              58.2    3e-08   
ref|XP_002274896.1|  PREDICTED: cellulose synthase-like protein D3    58.2    3e-08   Vitis vinifera
emb|CDY16969.1|  BnaC09g40960D                                        57.8    4e-08   
emb|CDX69410.1|  BnaA10g17590D                                        57.8    4e-08   
ref|XP_009121428.1|  PREDICTED: cellulose synthase-like protein D2    57.8    4e-08   
ref|XP_009788168.1|  PREDICTED: cellulose synthase-like protein D3    57.8    4e-08   
ref|XP_009608734.1|  PREDICTED: cellulose synthase-like protein D3    57.8    4e-08   
ref|XP_003517548.1|  PREDICTED: cellulose synthase-like protein D...  57.8    4e-08   
gb|KHN35142.1|  Cellulose synthase-like protein D3                    57.4    5e-08   
ref|XP_010276804.1|  PREDICTED: cellulose synthase-like protein D3    57.4    5e-08   
gb|KDP21765.1|  hypothetical protein JCGZ_00552                       57.4    5e-08   
ref|XP_002871742.1|  hypothetical protein ARALYDRAFT_488554           57.4    6e-08   
ref|XP_009415293.1|  PREDICTED: cellulose synthase-like protein D2    57.4    6e-08   
ref|XP_007157068.1|  hypothetical protein PHAVU_002G040200g           57.0    7e-08   
ref|XP_002520032.1|  Cellulose synthase A catalytic subunit 3 [UD...  57.0    7e-08   Ricinus communis
ref|XP_010940784.1|  PREDICTED: cellulose synthase-like protein D2    56.6    1e-07   
ref|NP_197193.1|  cellulose synthase-like protein D2                  56.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084614.1|  PREDICTED: cellulose synthase-like protein D3    55.8    2e-07   
ref|XP_008459143.1|  PREDICTED: cellulose synthase-like protein D3    55.8    2e-07   
ref|XP_004148102.1|  PREDICTED: cellulose synthase-like protein D...  55.8    2e-07   
emb|CDY23470.1|  BnaC04g49980D                                        55.8    2e-07   
emb|CDY28732.1|  BnaCnng06180D                                        55.8    2e-07   
emb|CDY43156.1|  BnaA05g32300D                                        55.8    2e-07   
ref|XP_009130327.1|  PREDICTED: cellulose synthase-like protein D3    55.8    2e-07   
ref|XP_006296860.1|  hypothetical protein CARUB_v10012847mg           55.8    2e-07   
ref|XP_010485639.1|  PREDICTED: cellulose synthase-like protein D3    55.8    2e-07   
ref|XP_010463749.1|  PREDICTED: cellulose synthase-like protein D3    55.8    2e-07   
ref|XP_009119010.1|  PREDICTED: cellulose synthase-like protein D3    55.8    2e-07   
ref|XP_006408348.1|  hypothetical protein EUTSA_v10019935mg           55.8    2e-07   
ref|XP_006286350.1|  hypothetical protein CARUB_v10000079mg           55.8    2e-07   
emb|CDY49919.1|  BnaCnng18290D                                        55.8    2e-07   
ref|XP_006347576.1|  PREDICTED: cellulose synthase-like protein D...  55.8    2e-07   
ref|XP_004235281.1|  PREDICTED: cellulose synthase-like protein D3    55.8    2e-07   
gb|EYU19742.1|  hypothetical protein MIMGU_mgv1a017980mg              55.5    2e-07   
ref|XP_003537778.1|  PREDICTED: cellulose synthase-like protein D...  55.5    2e-07   
ref|XP_008786432.1|  PREDICTED: cellulose synthase-like protein D2    55.5    2e-07   
ref|XP_010453867.1|  PREDICTED: cellulose synthase-like protein D2    55.1    3e-07   
ref|XP_008789902.1|  PREDICTED: cellulose synthase-like protein D...  55.5    3e-07   
ref|XP_008789900.1|  PREDICTED: cellulose synthase-like protein D...  55.5    3e-07   
emb|CDP11679.1|  unnamed protein product                              55.1    3e-07   
ref|NP_001056589.1|  Os06g0111800                                     55.1    3e-07   Oryza sativa Japonica Group [Japonica rice]
sp|A2YU42.1|CSLD2_ORYSI  RecName: Full=Cellulose synthase-like pr...  55.1    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_006400233.1|  hypothetical protein EUTSA_v10012495mg           54.7    5e-07   
ref|XP_010420398.1|  PREDICTED: cellulose synthase-like protein D2    54.7    5e-07   
ref|XP_009384732.1|  PREDICTED: cellulose synthase-like protein D2    54.7    5e-07   
ref|XP_006656561.1|  PREDICTED: cellulose synthase-like protein D...  54.3    6e-07   
ref|XP_007131523.1|  hypothetical protein PHAVU_011G020100g           54.3    6e-07   
dbj|BAJ93918.1|  predicted protein                                    54.3    7e-07   
ref|XP_010492624.1|  PREDICTED: cellulose synthase-like protein D2    53.9    8e-07   
ref|XP_010943429.1|  PREDICTED: cellulose synthase-like protein D...  53.9    8e-07   
gb|EMS48924.1|  Cellulose synthase-like protein D2                    53.9    8e-07   
ref|XP_004505600.1|  PREDICTED: cellulose synthase-like protein D...  53.5    1e-06   
ref|NP_186955.1|  cellulose synthase-like protein D3                  53.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KGN63377.1|  hypothetical protein Csa_2G433920                     53.1    2e-06   
ref|XP_008459144.1|  PREDICTED: cellulose synthase-like protein D3    53.1    2e-06   
ref|XP_004156753.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  53.1    2e-06   
ref|XP_004148100.1|  PREDICTED: cellulose synthase-like protein D...  53.1    2e-06   
emb|CDY38080.1|  BnaC02g06930D                                        52.8    2e-06   
ref|XP_010920010.1|  PREDICTED: cellulose synthase-like protein D2    53.1    2e-06   
ref|XP_008658883.1|  PREDICTED: uncharacterized protein LOC100383...  53.1    2e-06   
gb|AFM37967.1|  cellulose synthase-like protein D                     52.8    2e-06   
ref|XP_003607427.1|  Cellulose synthase-like protein                  52.4    3e-06   
ref|XP_003572134.1|  PREDICTED: cellulose synthase-like protein D1    52.4    3e-06   
ref|XP_004964325.1|  PREDICTED: cellulose synthase-like protein D...  52.4    3e-06   
ref|XP_003557145.1|  PREDICTED: cellulose synthase-like protein D2    52.4    3e-06   
ref|XP_008658791.1|  PREDICTED: cellulose synthase-like protein D1    52.0    4e-06   
ref|XP_002467425.1|  hypothetical protein SORBIDRAFT_01g027880        52.0    4e-06   Sorghum bicolor [broomcorn]
ref|XP_002882269.1|  hypothetical protein ARALYDRAFT_477551           52.0    4e-06   
ref|XP_008800063.1|  PREDICTED: cellulose synthase-like protein D2    52.0    4e-06   
ref|XP_011075792.1|  PREDICTED: cellulose synthase-like protein D3    52.0    4e-06   
gb|AES82685.2|  cellulose synthase-like protein                       51.6    5e-06   
ref|XP_003626467.1|  Cellulose synthase-like protein                  51.6    5e-06   
sp|Q8W3F9.1|CSLD1_ORYSJ  RecName: Full=Cellulose synthase-like pr...  51.6    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004983532.1|  PREDICTED: cellulose synthase-like protein D...  51.6    6e-06   
gb|EMT31463.1|  Cellulose synthase-like protein D1                    51.2    8e-06   
gb|EMS51869.1|  Cellulose synthase-like protein D1                    51.2    8e-06   
ref|XP_006854073.1|  hypothetical protein AMTR_s00048p00116140        50.8    9e-06   
emb|CBI33821.3|  unnamed protein product                              50.8    9e-06   
ref|XP_010663029.1|  PREDICTED: cellulose synthase-like protein D2    50.8    1e-05   
emb|CDX85482.1|  BnaA02g03310D                                        50.8    1e-05   
ref|XP_009126147.1|  PREDICTED: cellulose synthase-like protein D...  50.8    1e-05   
emb|CDO97026.1|  unnamed protein product                              50.8    1e-05   
ref|XP_004301655.1|  PREDICTED: cellulose synthase-like protein D...  50.8    1e-05   
emb|CAN70317.1|  hypothetical protein VITISV_038092                   50.4    1e-05   Vitis vinifera
ref|XP_010055254.1|  PREDICTED: cellulose synthase-like protein D2    50.1    2e-05   
ref|XP_004134379.1|  PREDICTED: cellulose synthase-like protein D...  50.1    2e-05   
ref|XP_002436356.1|  hypothetical protein SORBIDRAFT_10g000980        49.3    3e-05   Sorghum bicolor [broomcorn]
ref|XP_008438379.1|  PREDICTED: cellulose synthase-like protein D1    49.3    4e-05   
ref|XP_006845742.1|  hypothetical protein AMTR_s00019p00246190        48.9    4e-05   
ref|XP_003540119.1|  PREDICTED: cellulose synthase-like protein D...  48.5    6e-05   
gb|KHN46458.1|  Cellulose synthase-like protein D3                    48.1    7e-05   
ref|XP_008238167.1|  PREDICTED: cellulose synthase-like protein D3    47.8    1e-04   
ref|XP_007210976.1|  hypothetical protein PRUPE_ppa021772mg           47.8    1e-04   
ref|XP_006662106.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...  47.4    2e-04   
ref|XP_002881261.1|  hypothetical protein ARALYDRAFT_482247           46.6    3e-04   
ref|XP_008235918.1|  PREDICTED: cellulose synthase-like protein D4    46.2    4e-04   
ref|XP_007201219.1|  hypothetical protein PRUPE_ppa000490mg           46.2    4e-04   
ref|XP_006410449.1|  hypothetical protein EUTSA_v10016169mg           46.2    4e-04   
ref|XP_002304709.1|  cellulose synthase family protein                46.2    4e-04   Populus trichocarpa [western balsam poplar]
gb|AFZ78592.1|  cellulose synthase-like protein                       46.2    4e-04   
emb|CBI37716.3|  unnamed protein product                              45.8    5e-04   
ref|XP_010109052.1|  Cellulose synthase-like protein D1               45.8    5e-04   
ref|XP_002280032.1|  PREDICTED: cellulose synthase-like protein D4    45.8    5e-04   Vitis vinifera
ref|XP_006293607.1|  hypothetical protein CARUB_v10022555mg           45.1    8e-04   
ref|XP_007040720.1|  Cellulose synthase-like D3                       45.4    8e-04   
ref|XP_006293608.1|  hypothetical protein CARUB_v10022555mg           45.1    8e-04   
ref|XP_009387033.1|  PREDICTED: cellulose synthase-like protein D4    45.1    8e-04   
ref|NP_180869.1|  cellulose synthase-like protein D1                  45.1    0.001   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006849943.1|  hypothetical protein AMTR_s00022p00129900        45.1    0.001   
ref|XP_007158244.1|  hypothetical protein PHAVU_002G136300g           45.1    0.001   



>ref|XP_011070339.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Sesamum 
indicum]
 ref|XP_011070340.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Sesamum 
indicum]
 ref|XP_011070342.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Sesamum 
indicum]
 ref|XP_011070343.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Sesamum 
indicum]
Length=1149

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKIPA V++PYRLLIFVR+A+LGL 
Sbjct  273  ELLNKPWRPLTRKLKIPAAVLSPYRLLIFVRMAVLGLF  310



>ref|XP_011070338.1| PREDICTED: cellulose synthase-like protein D3 isoform X1 [Sesamum 
indicum]
Length=1152

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKIPA V++PYRLLIFVR+A+LGL 
Sbjct  276  ELLNKPWRPLTRKLKIPAAVLSPYRLLIFVRMAVLGLF  313



>ref|XP_010087475.1| Cellulose synthase-like protein D3 [Morus notabilis]
 gb|EXB29156.1| Cellulose synthase-like protein D3 [Morus notabilis]
Length=1146

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA V++PYRLLIFVR+ ILGL 
Sbjct  268  ELMNKPWRPLTRKLKIPAAVLSPYRLLIFVRVVILGLF  305



>gb|AAO03579.1| cellulose synthase-like protein D4 [Populus tremuloides]
Length=1104

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA VI+PYRLLIFVRI IL L 
Sbjct  226  ELMNKPWRPLTRKLKIPAAVISPYRLLIFVRIVILALF  263



>ref|XP_011006034.1| PREDICTED: cellulose synthase-like protein D2 [Populus euphratica]
 ref|XP_011006035.1| PREDICTED: cellulose synthase-like protein D2 [Populus euphratica]
Length=1143

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA VI+PYRLLIFVRI IL L 
Sbjct  265  ELMNKPWRPLTRKLKIPAAVISPYRLLIFVRIVILALF  302



>ref|XP_009361165.1| PREDICTED: cellulose synthase-like protein D3 [Pyrus x bretschneideri]
 ref|XP_009361166.1| PREDICTED: cellulose synthase-like protein D3 [Pyrus x bretschneideri]
Length=1146

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT K+KIPA +I+PYRLLIFVR+ +LGL 
Sbjct  268  ELLNKPWRPLTRKIKIPAAIISPYRLLIFVRMGVLGLF  305



>gb|EPS73002.1| hypothetical protein M569_01753, partial [Genlisea aurea]
Length=1137

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELL+K WR LT KLKIPA V++PYRLLIFVR+A+LGL 
Sbjct  260  ELLSKPWRPLTRKLKIPAAVLSPYRLLIFVRMAVLGLF  297



>ref|XP_011069707.1| PREDICTED: cellulose synthase-like protein D2 [Sesamum indicum]
 ref|XP_011069708.1| PREDICTED: cellulose synthase-like protein D2 [Sesamum indicum]
 ref|XP_011069709.1| PREDICTED: cellulose synthase-like protein D2 [Sesamum indicum]
 ref|XP_011069710.1| PREDICTED: cellulose synthase-like protein D2 [Sesamum indicum]
Length=1147

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELL+K WR LT KLKIPA V++PYRLLIFVR+A+LGL 
Sbjct  274  ELLSKPWRPLTRKLKIPAAVLSPYRLLIFVRMAVLGLF  311



>ref|XP_009792052.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792111.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792178.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792246.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792313.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792363.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
Length=1139

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKIPA+V++PYRLLI +R+ +LGL 
Sbjct  262  ELLNKPWRPLTRKLKIPAVVLSPYRLLILIRVVVLGLF  299



>ref|XP_002325817.2| cellulase synthase 3 family protein [Populus trichocarpa]
 gb|EEF00199.2| cellulase synthase 3 family protein [Populus trichocarpa]
Length=1143

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +I+PYRLLIFVRI IL L 
Sbjct  265  ELMNKPWRPLTRKLKIPAAIISPYRLLIFVRIVILALF  302



>gb|KHG15890.1| Cellulose synthase-like protein D3 [Gossypium arboreum]
Length=1144

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA V++PYRLLIF+RI +LGL 
Sbjct  266  ELMNKPWRPLTRKLKIPAAVLSPYRLLIFLRIVVLGLF  303



>ref|XP_010267650.1| PREDICTED: cellulose synthase-like protein D3 [Nelumbo nucifera]
 ref|XP_010267651.1| PREDICTED: cellulose synthase-like protein D3 [Nelumbo nucifera]
Length=1147

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRLLIFVR+A LGL 
Sbjct  272  ELMNKPWRPLTRKLKIPAAILSPYRLLIFVRMAALGLF  309



>gb|KHG15286.1| Cellulose synthase-like protein D3 [Gossypium arboreum]
Length=1143

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRLLIF+R+ +LGL 
Sbjct  266  ELMNKPWRPLTRKLKIPAAILSPYRLLIFIRVVVLGLF  303



>ref|XP_010034946.1| PREDICTED: cellulose synthase-like protein D3 [Eucalyptus grandis]
 ref|XP_010034947.1| PREDICTED: cellulose synthase-like protein D3 [Eucalyptus grandis]
 gb|KCW46176.1| hypothetical protein EUGRSUZ_K00085 [Eucalyptus grandis]
Length=1138

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRLLIFVR+ +LGL 
Sbjct  263  ELMNKPWRPLTRKLKIPAAILSPYRLLIFVRMVVLGLF  300



>ref|XP_004307862.1| PREDICTED: cellulose synthase-like protein D3-like [Fragaria 
vesca subsp. vesca]
Length=1149

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRLLIFVR+ +LGL 
Sbjct  266  ELMNKPWRPLTRKLKIPAAILSPYRLLIFVRMVVLGLF  303



>gb|EYU45259.1| hypothetical protein MIMGU_mgv1a000454mg [Erythranthe guttata]
Length=1144

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKI A V++PYRLLIFVR+A+LGL 
Sbjct  269  ELLNKPWRPLTRKLKISAAVLSPYRLLIFVRMAVLGLF  306



>ref|XP_010671117.1| PREDICTED: cellulose synthase-like protein D3 [Beta vulgaris 
subsp. vulgaris]
Length=1143

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA V++PYRLLIFVR+ +LG  
Sbjct  267  ELMNKPWRPLTRKLKIPAAVLSPYRLLIFVRMVVLGFF  304



>ref|XP_006352916.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Solanum tuberosum]
 ref|XP_006352917.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Solanum tuberosum]
Length=1139

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKIPA VI+PYRLLI +R+ +LGL 
Sbjct  262  ELLNKPWRPLTRKLKIPAGVISPYRLLILIRVVVLGLF  299



>ref|XP_008354283.1| PREDICTED: cellulose synthase-like protein D3 [Malus domestica]
Length=1146

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKIPA V++PYRLLIFVR+ +L L 
Sbjct  268  ELLNKPWRPLTRKLKIPAAVLSPYRLLIFVRMVVLALF  305



>ref|XP_006361262.1| PREDICTED: cellulose synthase-like protein D2-like [Solanum tuberosum]
Length=1137

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKIPA V++PYRLLI +R+ +LGL 
Sbjct  262  ELLNKPWRPLTRKLKIPAAVLSPYRLLILIRVVVLGLF  299



>ref|XP_008376925.1| PREDICTED: cellulose synthase-like protein D3 [Malus domestica]
 ref|XP_008376926.1| PREDICTED: cellulose synthase-like protein D3 [Malus domestica]
 ref|XP_008376927.1| PREDICTED: cellulose synthase-like protein D3 [Malus domestica]
Length=1141

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL NK WR LT K+KIPA +I+PYRLLIFVR+ +LG+ 
Sbjct  268  ELFNKPWRPLTRKIKIPAAIISPYRLLIFVRMGVLGMF  305



>ref|XP_011007166.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007167.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007168.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007169.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007170.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007171.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
Length=1143

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA VI+PYRLLI VRI IL L 
Sbjct  265  ELMNKPWRPLTRKLKIPAAVISPYRLLILVRIVILALF  302



>ref|XP_010549830.1| PREDICTED: cellulose synthase-like protein D3 [Tarenaya hassleriana]
Length=1142

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L++K WR LT KLKIPA VI+PYRLLIF+RI +LGL 
Sbjct  268  DLMSKPWRPLTRKLKIPAAVISPYRLLIFIRIVVLGLF  305



>ref|XP_009386238.1| PREDICTED: cellulose synthase-like protein D2 [Musa acuminata 
subsp. malaccensis]
Length=1150

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL NK WR LT KLKIPA V++PYRLLIFVR+A+L L 
Sbjct  272  ELTNKPWRPLTRKLKIPAAVLSPYRLLIFVRMAVLALF  309



>ref|XP_009351828.1| PREDICTED: cellulose synthase-like protein D3 [Pyrus x bretschneideri]
Length=1146

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKIPA V++PYRLLIFVR+ +L L 
Sbjct  268  ELLNKPWRPLTRKLKIPAAVLSPYRLLIFVRMIVLALF  305



>ref|XP_004245916.1| PREDICTED: cellulose synthase-like protein D3 [Solanum lycopersicum]
 ref|XP_010325578.1| PREDICTED: cellulose synthase-like protein D3 [Solanum lycopersicum]
Length=1139

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA VI+PYRLLI +R+ +LGL 
Sbjct  262  ELMNKPWRPLTRKLKIPAGVISPYRLLILIRVVVLGLF  299



>gb|KDO47249.1| hypothetical protein CISIN_1g001213mg [Citrus sinensis]
Length=1122

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +I+PYR++IFVR+A+L L 
Sbjct  264  ELMNKPWRPLTRKLKIPAAIISPYRVIIFVRMAVLSLF  301



>ref|XP_006443224.1| hypothetical protein CICLE_v10023400mg [Citrus clementina]
 ref|XP_006478926.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Citrus sinensis]
 ref|XP_006478927.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Citrus sinensis]
 ref|XP_006478928.1| PREDICTED: cellulose synthase-like protein D3-like isoform X3 
[Citrus sinensis]
 ref|XP_006478929.1| PREDICTED: cellulose synthase-like protein D3-like isoform X4 
[Citrus sinensis]
 gb|ESR56464.1| hypothetical protein CICLE_v10023400mg [Citrus clementina]
Length=1142

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +I+PYR++IFVR+A+L L 
Sbjct  264  ELMNKPWRPLTRKLKIPAAIISPYRVIIFVRMAVLSLF  301



>ref|XP_009607206.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607207.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607208.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607209.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607210.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607211.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
Length=1139

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KLKIPA V++PYRLLI +R+ +LGL 
Sbjct  262  ELLNKPWRPLTRKLKIPAGVLSPYRLLILIRVVVLGLF  299



>ref|XP_009771399.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009771400.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
Length=1137

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELLNK WR LT KL IPA V++PYRLLI +RI +LGL 
Sbjct  262  ELLNKPWRPLTRKLNIPAAVLSPYRLLILIRIVVLGLF  299



>ref|XP_008234563.1| PREDICTED: cellulose synthase-like protein D3 [Prunus mume]
Length=1145

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRLLIF+R+ +L L 
Sbjct  267  ELMNKPWRPLTRKLKIPAAILSPYRLLIFIRMVVLALF  304



>ref|XP_007220589.1| hypothetical protein PRUPE_ppa000473mg [Prunus persica]
 gb|EMJ21788.1| hypothetical protein PRUPE_ppa000473mg [Prunus persica]
Length=1145

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRLLIF+R+ +L L 
Sbjct  267  ELMNKPWRPLTRKLKIPAAILSPYRLLIFIRMVVLALF  304



>ref|XP_010677380.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1128

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E LNK WR LT KLKIPA +I+PYRLL+F+R+ +L L 
Sbjct  249  EFLNKPWRPLTRKLKIPAAIISPYRLLVFIRLVVLALF  286



>ref|XP_010677379.1| PREDICTED: cellulose synthase-like protein D3 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1148

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E LNK WR LT KLKIPA +I+PYRLL+F+R+ +L L 
Sbjct  269  EFLNKPWRPLTRKLKIPAAIISPYRLLVFIRLVVLALF  306



>ref|XP_004511422.1| PREDICTED: cellulose synthase-like protein D3-like [Cicer arietinum]
Length=1136

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRL+IFVR+ +L L 
Sbjct  257  ELMNKPWRPLTRKLKIPAAILSPYRLIIFVRMVVLALF  294



>ref|XP_010558640.1| PREDICTED: cellulose synthase-like protein D3 [Tarenaya hassleriana]
 ref|XP_010558642.1| PREDICTED: cellulose synthase-like protein D3 [Tarenaya hassleriana]
 ref|XP_010558643.1| PREDICTED: cellulose synthase-like protein D3 [Tarenaya hassleriana]
Length=1141

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L++K WR LT KLKIPA VI+PYRLLIF+RI +L L 
Sbjct  268  DLMSKPWRPLTRKLKIPAAVISPYRLLIFIRIVVLALF  305



>emb|CBI26518.3| unnamed protein product [Vitis vinifera]
Length=954

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KLKIPA V++PYRLLIFVR+  LGL 
Sbjct  235  ELVSKPWRPLTRKLKIPAAVLSPYRLLIFVRMVALGLF  272



>ref|XP_002274896.1| PREDICTED: cellulose synthase-like protein D3 [Vitis vinifera]
Length=1149

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KLKIPA V++PYRLLIFVR+  LGL 
Sbjct  271  ELVSKPWRPLTRKLKIPAAVLSPYRLLIFVRMVALGLF  308



>emb|CDY16969.1| BnaC09g40960D [Brassica napus]
Length=1105

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            + +NK WR LT KLKIPA +I+PYRLLIF+R+ +L L 
Sbjct  259  DFMNKPWRPLTRKLKIPAAIISPYRLLIFIRVVVLALF  296



>emb|CDX69410.1| BnaA10g17590D [Brassica napus]
Length=1111

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            + +NK WR LT KLKIPA +I+PYRLLIF+R+ +L L 
Sbjct  259  DFMNKPWRPLTRKLKIPAAIISPYRLLIFIRVVVLALF  296



>ref|XP_009121428.1| PREDICTED: cellulose synthase-like protein D2 [Brassica rapa]
 ref|XP_009121429.1| PREDICTED: cellulose synthase-like protein D2 [Brassica rapa]
Length=1143

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            + +NK WR LT KLKIPA +I+PYRLLIF+R+ +L L 
Sbjct  270  DFMNKPWRPLTRKLKIPAAIISPYRLLIFIRVVVLALF  307



>ref|XP_009788168.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009788172.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
Length=1139

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRLLI VR  +LGL 
Sbjct  265  ELMNKPWRPLTRKLKIPAAILSPYRLLIAVRFVVLGLF  302



>ref|XP_009608734.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009608735.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
Length=1139

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +++PYRLLI VR  +LGL 
Sbjct  265  ELMNKPWRPLTRKLKIPAAILSPYRLLIAVRFVVLGLF  302



>ref|XP_003517548.1| PREDICTED: cellulose synthase-like protein D2-like isoform X1 
[Glycine max]
 ref|XP_006573847.1| PREDICTED: cellulose synthase-like protein D2-like isoform X2 
[Glycine max]
Length=1143

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+N+ WR LT KLKIPA V++PYRL+IF+R+ +L L 
Sbjct  265  ELMNRPWRPLTRKLKIPAAVLSPYRLIIFIRLVVLALF  302



>gb|KHN35142.1| Cellulose synthase-like protein D3 [Glycine soja]
Length=1084

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+N+ WR LT KLKIPA V++PYRL+IF+R+ +L L 
Sbjct  206  ELMNRPWRPLTRKLKIPAAVLSPYRLIIFIRLVVLALF  243



>ref|XP_010276804.1| PREDICTED: cellulose synthase-like protein D3 [Nelumbo nucifera]
 ref|XP_010276805.1| PREDICTED: cellulose synthase-like protein D3 [Nelumbo nucifera]
Length=1151

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK W+ LT K+KIP  +I+PYRLLIF+R+A LGL 
Sbjct  273  ELVNKPWKPLTRKVKIPTAIISPYRLLIFIRMAALGLF  310



>gb|KDP21765.1| hypothetical protein JCGZ_00552 [Jatropha curcas]
Length=1141

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +I+PYRLLI +RI +L L 
Sbjct  264  ELMNKPWRPLTRKLKIPAAIISPYRLLICIRIVVLSLF  301



>ref|XP_002871742.1| hypothetical protein ARALYDRAFT_488554 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48001.1| hypothetical protein ARALYDRAFT_488554 [Arabidopsis lyrata subsp. 
lyrata]
Length=1143

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L++K WR LT KLKIPA VI+PYRLLIF+RI +L L 
Sbjct  271  DLMSKPWRPLTRKLKIPAGVISPYRLLIFIRIVVLALF  308



>ref|XP_009415293.1| PREDICTED: cellulose synthase-like protein D2 [Musa acuminata 
subsp. malaccensis]
Length=1149

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA V++PYRLLI +R+A L L 
Sbjct  271  ELMNKPWRPLTRKLKIPAAVLSPYRLLIVIRMAFLALF  308



>ref|XP_007157068.1| hypothetical protein PHAVU_002G040200g [Phaseolus vulgaris]
 gb|ESW29062.1| hypothetical protein PHAVU_002G040200g [Phaseolus vulgaris]
Length=1144

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+N+ WR LT KLKIPA +++PYRL+IF+R+ +L L 
Sbjct  266  ELMNRPWRPLTRKLKIPAAILSPYRLIIFIRLVVLALF  303



>ref|XP_002520032.1| Cellulose synthase A catalytic subunit 3 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF42356.1| Cellulose synthase A catalytic subunit 3 [UDP-forming], putative 
[Ricinus communis]
Length=1143

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+NK WR LT KLKIPA +I+PYRLLI +R+ +L L 
Sbjct  265  ELMNKPWRPLTRKLKIPAAIISPYRLLICIRVVVLALF  302



>ref|XP_010940784.1| PREDICTED: cellulose synthase-like protein D2 [Elaeis guineensis]
 ref|XP_010940786.1| PREDICTED: cellulose synthase-like protein D2 [Elaeis guineensis]
Length=1154

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KLKIPA +++PYRLLI +R+A LGL 
Sbjct  278  ELMSKPWRPLTRKLKIPAAILSPYRLLIVIRLAALGLF  315



>ref|NP_197193.1| cellulose synthase-like protein D2 [Arabidopsis thaliana]
 sp|Q9LFL0.1|CSLD2_ARATH RecName: Full=Cellulose synthase-like protein D2; Short=AtCslD2 
[Arabidopsis thaliana]
 emb|CAC01704.1| cellulose synthase catalytic subunit-like protein [Arabidopsis 
thaliana]
 gb|AED92357.1| cellulose synthase-like protein D2 [Arabidopsis thaliana]
Length=1145

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KLKIPA VI+PYRLLIF+RI +L L 
Sbjct  273  DLMSRPWRPLTRKLKIPAGVISPYRLLIFIRIVVLALF  310



>ref|XP_011084614.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
Length=1148

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +NK WR LT KLKIPA +I+PYRLLI +R+ +LG  
Sbjct  268  EFMNKPWRPLTRKLKIPAAIISPYRLLIAIRMVVLGFF  305



>ref|XP_008459143.1| PREDICTED: cellulose synthase-like protein D3 [Cucumis melo]
Length=1146

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +NK WR LT KLKIPA V++PYRLLI VR+ +LG  
Sbjct  266  EFMNKPWRPLTRKLKIPAAVLSPYRLLIAVRMVVLGFF  303



>ref|XP_004148102.1| PREDICTED: cellulose synthase-like protein D3-like [Cucumis sativus]
 ref|XP_004156754.1| PREDICTED: cellulose synthase-like protein D3-like [Cucumis sativus]
 gb|KGN63376.1| hypothetical protein Csa_2G433910 [Cucumis sativus]
Length=1146

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +NK WR LT KLKIPA V++PYRLLI VR+ +LG  
Sbjct  266  EFMNKPWRPLTRKLKIPAAVLSPYRLLIAVRMVVLGFF  303



>emb|CDY23470.1| BnaC04g49980D, partial [Brassica napus]
Length=1039

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  207  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  244



>emb|CDY28732.1| BnaCnng06180D [Brassica napus]
Length=1113

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  269  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  306



>emb|CDY43156.1| BnaA05g32300D [Brassica napus]
Length=1125

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  272  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  309



>ref|XP_009130327.1| PREDICTED: cellulose synthase-like protein D3 [Brassica rapa]
Length=1146

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  272  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  309



>ref|XP_006296860.1| hypothetical protein CARUB_v10012847mg [Capsella rubella]
 gb|EOA29758.1| hypothetical protein CARUB_v10012847mg [Capsella rubella]
Length=1147

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  272  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  309



>ref|XP_010485639.1| PREDICTED: cellulose synthase-like protein D3 [Camelina sativa]
Length=1149

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  274  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  311



>ref|XP_010463749.1| PREDICTED: cellulose synthase-like protein D3 [Camelina sativa]
Length=1150

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  275  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  312



>ref|XP_009119010.1| PREDICTED: cellulose synthase-like protein D3 [Brassica rapa]
Length=1151

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  273  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  310



>ref|XP_006408348.1| hypothetical protein EUTSA_v10019935mg [Eutrema salsugineum]
 ref|XP_006408349.1| hypothetical protein EUTSA_v10019935mg [Eutrema salsugineum]
 gb|ESQ49801.1| hypothetical protein EUTSA_v10019935mg [Eutrema salsugineum]
 gb|ESQ49802.1| hypothetical protein EUTSA_v10019935mg [Eutrema salsugineum]
Length=1151

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  276  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  313



>ref|XP_006286350.1| hypothetical protein CARUB_v10000079mg [Capsella rubella]
 ref|XP_006286351.1| hypothetical protein CARUB_v10000079mg [Capsella rubella]
 gb|EOA19248.1| hypothetical protein CARUB_v10000079mg [Capsella rubella]
 gb|EOA19249.1| hypothetical protein CARUB_v10000079mg [Capsella rubella]
Length=1146

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L++K WR LT KLKIPA VI+PYRLLI +RI +L L 
Sbjct  272  DLMSKPWRPLTRKLKIPAAVISPYRLLILIRIVVLALF  309



>emb|CDY49919.1| BnaCnng18290D, partial [Brassica napus]
Length=986

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLIF+RI +L L 
Sbjct  206  DLMSRPWRPLTRKLQIPAAVISPYRLLIFIRIVVLALF  243



>ref|XP_006347576.1| PREDICTED: cellulose synthase-like protein D3-like [Solanum tuberosum]
Length=1141

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KLKIPA +++PYRLLI VR  +LGL 
Sbjct  267  ELMSKPWRPLTRKLKIPASILSPYRLLIVVRFVVLGLF  304



>ref|XP_004235281.1| PREDICTED: cellulose synthase-like protein D3 [Solanum lycopersicum]
Length=1141

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KLKIPA +++PYRLLI +R  +LGL 
Sbjct  267  ELMSKPWRPLTRKLKIPAAILSPYRLLIVIRFVVLGLF  304



>gb|EYU19742.1| hypothetical protein MIMGU_mgv1a017980mg [Erythranthe guttata]
Length=1159

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+ K WR LT KL+IPA +I+PYRLLI VR+ +LGL 
Sbjct  283  ELMTKPWRPLTRKLQIPAAIISPYRLLIAVRMVVLGLF  320



>ref|XP_003537778.1| PREDICTED: cellulose synthase-like protein D2-like [Glycine max]
Length=1143

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+++ WR LT KLKIPA V++PYRL+IF+R+ +L L 
Sbjct  265  ELMSRPWRPLTRKLKIPAAVLSPYRLIIFIRLVVLALF  302



>ref|XP_008786432.1| PREDICTED: cellulose synthase-like protein D2 [Phoenix dactylifera]
 ref|XP_008786433.1| PREDICTED: cellulose synthase-like protein D2 [Phoenix dactylifera]
 ref|XP_008786434.1| PREDICTED: cellulose synthase-like protein D2 [Phoenix dactylifera]
Length=1148

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL +K WR LT KLKIPA V++PYRLLI +R+A LGL 
Sbjct  272  ELTSKPWRPLTRKLKIPAAVLSPYRLLIVIRMAALGLF  309



>ref|XP_010453867.1| PREDICTED: cellulose synthase-like protein D2, partial [Camelina 
sativa]
Length=907

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L++K WR LT KLKIPA VI+PYRLLI +R+ +L L 
Sbjct  271  DLMSKPWRPLTRKLKIPAAVISPYRLLILIRVVVLALF  308



>ref|XP_008789902.1| PREDICTED: cellulose synthase-like protein D2 isoform X2 [Phoenix 
dactylifera]
Length=1134

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KLKIPA V++PYRLLI +R+  LGL 
Sbjct  258  ELMSKPWRPLTRKLKIPAAVLSPYRLLIVIRLVALGLF  295



>ref|XP_008789900.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008789901.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Phoenix 
dactylifera]
Length=1148

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KLKIPA V++PYRLLI +R+  LGL 
Sbjct  272  ELMSKPWRPLTRKLKIPAAVLSPYRLLIVIRLVALGLF  309



>emb|CDP11679.1| unnamed protein product [Coffea canephora]
Length=859

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELL+K WR LT KLKI A VI+PYRLLI VR+A+L L 
Sbjct  265  ELLSKPWRPLTRKLKISAAVISPYRLLIVVRMAVLALF  302



>ref|NP_001056589.1| Os06g0111800 [Oryza sativa Japonica Group]
 sp|Q9LHZ7.1|CSLD2_ORYSJ RecName: Full=Cellulose synthase-like protein D2; AltName: Full=OsCslD2 
[Oryza sativa Japonica Group]
 dbj|BAA93027.1| putative cellulose synthase [Oryza sativa Japonica Group]
 tpg|DAA01753.1| TPA_exp: cellulose synthase-like D2 [Oryza sativa (japonica cultivar-group)]
 dbj|BAF18503.1| Os06g0111800 [Oryza sativa Japonica Group]
 gb|EAZ35581.1| hypothetical protein OsJ_19867 [Oryza sativa Japonica Group]
 dbj|BAG97224.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1170

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E  +K WR LT KLKIPA V++PYRLLI +R+A+LGL 
Sbjct  292  EFTSKPWRPLTRKLKIPAGVLSPYRLLILIRMAVLGLF  329



>sp|A2YU42.1|CSLD2_ORYSI RecName: Full=Cellulose synthase-like protein D2; AltName: Full=OsCslD2 
[Oryza sativa Indica Group]
 gb|EAZ06603.1| hypothetical protein OsI_28847 [Oryza sativa Indica Group]
Length=1170

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E  +K WR LT KLKIPA V++PYRLLI +R+A+LGL 
Sbjct  292  EFTSKPWRPLTRKLKIPAGVLSPYRLLILIRMAVLGLF  329



>ref|XP_006400233.1| hypothetical protein EUTSA_v10012495mg [Eutrema salsugineum]
 gb|ESQ41686.1| hypothetical protein EUTSA_v10012495mg [Eutrema salsugineum]
Length=1152

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L++K WR LT KLKIPA +I+PYRLLI +R+ +L L 
Sbjct  277  DLMSKPWRPLTRKLKIPAAIISPYRLLILIRVVVLALF  314



>ref|XP_010420398.1| PREDICTED: cellulose synthase-like protein D2 [Camelina sativa]
Length=1146

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  LLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            L++K WR LT KLKIPA VI+PYRLLI +R+ +L L 
Sbjct  274  LMSKPWRPLTRKLKIPAAVISPYRLLILIRVVVLALF  310



>ref|XP_009384732.1| PREDICTED: cellulose synthase-like protein D2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384733.1| PREDICTED: cellulose synthase-like protein D2 [Musa acuminata 
subsp. malaccensis]
Length=1159

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E ++K WR LT KLKIPA V++PYRLLI +R+A+L L 
Sbjct  281  EFISKPWRPLTRKLKIPAAVLSPYRLLIVIRMAVLALF  318



>ref|XP_006656561.1| PREDICTED: cellulose synthase-like protein D2-like, partial [Oryza 
brachyantha]
Length=890

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E  +K WR LT KLKIPA V++PYRLLI +R+A+LGL 
Sbjct  12   EFTSKPWRPLTRKLKIPAGVLSPYRLLILIRMAVLGLF  49



>ref|XP_007131523.1| hypothetical protein PHAVU_011G020100g [Phaseolus vulgaris]
 ref|XP_007131524.1| hypothetical protein PHAVU_011G020100g [Phaseolus vulgaris]
 gb|ESW03517.1| hypothetical protein PHAVU_011G020100g [Phaseolus vulgaris]
 gb|ESW03518.1| hypothetical protein PHAVU_011G020100g [Phaseolus vulgaris]
Length=1148

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+N+ WR LT KLKIPA +++PYRL+IF+R+ +L L 
Sbjct  272  DLMNRPWRPLTRKLKIPAAILSPYRLIIFIRLVVLVLF  309



>dbj|BAJ93918.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95261.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1188

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E  +K WR LT KLKIPA +++PYRLL+ +R+A+LGL 
Sbjct  308  EFTSKPWRPLTRKLKIPAGILSPYRLLVLIRLAVLGLF  345



>ref|XP_010492624.1| PREDICTED: cellulose synthase-like protein D2 [Camelina sativa]
Length=1146

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  LLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            L++K WR LT KLKIPA +I+PYRLLI +R+ +L L 
Sbjct  274  LMSKPWRPLTRKLKIPAAIISPYRLLILIRVVVLALF  310



>ref|XP_010943429.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Elaeis 
guineensis]
 ref|XP_010943430.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Elaeis 
guineensis]
 ref|XP_010943431.1| PREDICTED: cellulose synthase-like protein D2 isoform X2 [Elaeis 
guineensis]
Length=1149

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL +K WR LT KLKIPA V++PYRLLI  R+A LGL 
Sbjct  273  ELTSKPWRPLTRKLKIPAAVLSPYRLLIVFRMAALGLF  310



>gb|EMS48924.1| Cellulose synthase-like protein D2 [Triticum urartu]
Length=944

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E  +K WR LT KLKIPA +++PYRLL+ +R+A+LGL 
Sbjct  64   EFTSKPWRPLTRKLKIPAGILSPYRLLVLIRLAVLGLF  101



>ref|XP_004505600.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Cicer arietinum]
 ref|XP_004505601.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Cicer arietinum]
Length=1141

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+N+ WR LT KLKIPA +++PYRL+IF+R+  L L 
Sbjct  265  ELMNRPWRPLTRKLKIPAAILSPYRLIIFIRMIALVLF  302



>ref|NP_186955.1| cellulose synthase-like protein D3 [Arabidopsis thaliana]
 sp|Q9M9M4.1|CSLD3_ARATH RecName: Full=Cellulose synthase-like protein D3; Short=AtCslD3; 
AltName: Full=Protein KOJAK [Arabidopsis thaliana]
 gb|AAF26119.1|AC012328_22 putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAG60543.1|AF232907_1 cellulose synthase-like CSLD3 [Arabidopsis thaliana]
 gb|AAK25890.1|AF360180_1 putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAK64073.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAC82909.1| cellulose synthase-like protein [Arabidopsis thaliana]
 gb|AEE73896.1| cellulose synthase-like protein D3 [Arabidopsis thaliana]
 gb|AHL38784.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1145

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLI +RI +L L 
Sbjct  270  DLMSRPWRPLTRKLQIPAAVISPYRLLILIRIVVLALF  307



>gb|KGN63377.1| hypothetical protein Csa_2G433920 [Cucumis sativus]
Length=968

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +NK WR LT KLKI A V++PYRLLI VR+ +LG  
Sbjct  269  EFMNKPWRPLTRKLKIRAAVLSPYRLLILVRMVVLGFF  306



>ref|XP_008459144.1| PREDICTED: cellulose synthase-like protein D3 [Cucumis melo]
 ref|XP_008459145.1| PREDICTED: cellulose synthase-like protein D3 [Cucumis melo]
Length=1148

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +NK WR LT KLKI A V++PYRLLI VR+ +LG  
Sbjct  269  EFMNKPWRPLTRKLKIRAAVLSPYRLLILVRMVVLGFF  306



>ref|XP_004156753.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
D3-like [Cucumis sativus]
Length=1148

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +NK WR LT KLKI A V++PYRLLI VR+ +LG  
Sbjct  269  EFMNKPWRPLTRKLKIRAAVLSPYRLLILVRMVVLGFF  306



>ref|XP_004148100.1| PREDICTED: cellulose synthase-like protein D3-like [Cucumis sativus]
Length=1148

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +NK WR LT KLKI A V++PYRLLI VR+ +LG  
Sbjct  269  EFMNKPWRPLTRKLKIRAAVLSPYRLLILVRMVVLGFF  306



>emb|CDY38080.1| BnaC02g06930D [Brassica napus]
Length=920

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+NK W+ LT KL IPA V++PYRLLI +R+ +L L 
Sbjct  185  DLMNKPWKPLTRKLNIPAAVLSPYRLLILIRVVVLALF  222



>ref|XP_010920010.1| PREDICTED: cellulose synthase-like protein D2 [Elaeis guineensis]
Length=1150

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+ K WR LT KLKIPA V++PYRLL+F+R+  L L 
Sbjct  272  ELVGKPWRPLTRKLKIPAAVLSPYRLLVFIRLVALVLF  309



>ref|XP_008658883.1| PREDICTED: uncharacterized protein LOC100383550 isoform X1 [Zea 
mays]
 gb|AFW86164.1| putative cellulose synthase-like family protein [Zea mays]
Length=1180

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E   K WR LT KL IPA V++PYRLLI +R+A+LGL 
Sbjct  302  EFTTKPWRPLTRKLSIPAGVLSPYRLLILIRMAVLGLF  339



>gb|AFM37967.1| cellulose synthase-like protein D [Cunninghamia lanceolata]
Length=1131

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L +K WR LT KLKIPA +++PYRLLIF+R+  LGL 
Sbjct  261  DLSDKPWRPLTRKLKIPAGILSPYRLLIFLRMIFLGLF  298



>ref|XP_003607427.1| Cellulose synthase-like protein [Medicago truncatula]
 gb|AES89624.1| cellulose synthase-like protein [Medicago truncatula]
Length=1142

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+++ WR LT KLKIPA V++PYRL+IF+R+  L L 
Sbjct  265  ELMSRPWRPLTRKLKIPAAVLSPYRLIIFIRLVALVLF  302



>ref|XP_003572134.1| PREDICTED: cellulose synthase-like protein D1 [Brachypodium distachyon]
Length=1151

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KLKIPA VI+PYRLL+ +R+  L   
Sbjct  269  ELMSKPWRPLTRKLKIPAAVISPYRLLVLIRLVALAFF  306



>ref|XP_004964325.1| PREDICTED: cellulose synthase-like protein D2-like [Setaria italica]
Length=1175

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E   K WR LT KL IPA +++PYRLLI +R+A+LGL 
Sbjct  297  EFTTKPWRPLTRKLSIPAGILSPYRLLILIRMAVLGLF  334



>ref|XP_003557145.1| PREDICTED: cellulose synthase-like protein D2 [Brachypodium distachyon]
Length=1182

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E  +K WR LT KLKIPA +++PYRLL+ +R+ +LGL 
Sbjct  304  EFTSKPWRPLTRKLKIPAGILSPYRLLVLIRMVVLGLF  341



>ref|XP_008658791.1| PREDICTED: cellulose synthase-like protein D1 [Zea mays]
 tpg|DAA46498.1| TPA: putative cellulose synthase-like family protein [Zea mays]
Length=1159

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELL K WR LT KL+IPA VI+PYRLL+ +R+  L   
Sbjct  276  ELLTKPWRPLTRKLRIPAAVISPYRLLVLIRLVALAFF  313



>ref|XP_002467425.1| hypothetical protein SORBIDRAFT_01g027880 [Sorghum bicolor]
 gb|EER94423.1| hypothetical protein SORBIDRAFT_01g027880 [Sorghum bicolor]
Length=1164

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELL K WR LT KL+IPA VI+PYRLL+ +R+  L   
Sbjct  281  ELLTKPWRPLTRKLRIPAAVISPYRLLVLIRLVALAFF  318



>ref|XP_002882269.1| hypothetical protein ARALYDRAFT_477551 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58528.1| hypothetical protein ARALYDRAFT_477551 [Arabidopsis lyrata subsp. 
lyrata]
Length=1145

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+++ WR LT KL+IPA VI+PYRLLI +RI +L L 
Sbjct  270  DLMSRPWRPLTRKLQIPAGVISPYRLLIVIRIVVLALF  307



>ref|XP_008800063.1| PREDICTED: cellulose synthase-like protein D2 [Phoenix dactylifera]
Length=1147

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL+ K WR LT KLKIP  V++PYRLL+F+R+ +L L 
Sbjct  269  ELVGKPWRPLTRKLKIPPAVLSPYRLLVFIRLVVLILF  306



>ref|XP_011075792.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
 ref|XP_011075793.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
 ref|XP_011075794.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
 ref|XP_011075795.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
Length=1148

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L+ + WR LT KLKIPA +I+PYRLLI +R+ +LG  
Sbjct  270  DLVTRPWRPLTRKLKIPAAIISPYRLLIVLRMVVLGFF  307



>gb|AES82685.2| cellulose synthase-like protein [Medicago truncatula]
Length=864

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++++WR LT K+KIPA V++PYR +IFVR+  L L 
Sbjct  121  ELMSRQWRPLTRKIKIPAAVLSPYRFIIFVRLVALVLF  158



>ref|XP_003626467.1| Cellulose synthase-like protein [Medicago truncatula]
Length=867

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++++WR LT K+KIPA V++PYR +IFVR+  L L 
Sbjct  121  ELMSRQWRPLTRKIKIPAAVLSPYRFIIFVRLVALVLF  158



>sp|Q8W3F9.1|CSLD1_ORYSJ RecName: Full=Cellulose synthase-like protein D1; AltName: Full=OsCslD1 
[Oryza sativa Japonica Group]
 sp|A2ZAK8.2|CSLD1_ORYSI RecName: Full=Cellulose synthase-like protein D1; AltName: Full=OsCslD1 
[Oryza sativa Indica Group]
 gb|AAL58185.1|AC027037_7 putative cellulose synthase [Oryza sativa Japonica Group]
 gb|AAP55168.1| cellulose synthase-like protein D4, putative, expressed [Oryza 
sativa Japonica Group]
 tpg|DAA01752.1| TPA_exp: cellulose synthase-like D1 [Oryza sativa (japonica cultivar-group)]
 gb|EAZ17092.1| hypothetical protein OsJ_32590 [Oryza sativa Japonica Group]
 gb|EEC67503.1| hypothetical protein OsI_34786 [Oryza sativa Indica Group]
Length=1127

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KL+I A VI+PYRLL+ +R+  LGL 
Sbjct  243  ELMSKPWRPLTRKLRIQAAVISPYRLLVLIRLVALGLF  280



>ref|XP_004983532.1| PREDICTED: cellulose synthase-like protein D1-like [Setaria italica]
Length=1157

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            ELL K WR LT KL+IPA VI+PYRLL+ +R+  L   
Sbjct  274  ELLAKPWRPLTRKLRIPAAVISPYRLLVLIRLVALAFF  311



>gb|EMT31463.1| Cellulose synthase-like protein D1 [Aegilops tauschii]
Length=1141

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KL+IPA VI+PYRLL+ +R+  L   
Sbjct  264  ELMSKPWRPLTRKLQIPAAVISPYRLLVLIRLVALAFF  301



>gb|EMS51869.1| Cellulose synthase-like protein D1 [Triticum urartu]
Length=1150

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KL+IPA VI+PYRLL+ +R+  L   
Sbjct  264  ELMSKPWRPLTRKLQIPAAVISPYRLLVLIRLVALAFF  301



>ref|XP_006854073.1| hypothetical protein AMTR_s00048p00116140 [Amborella trichopoda]
 gb|ERN15540.1| hypothetical protein AMTR_s00048p00116140 [Amborella trichopoda]
Length=1141

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL +K WR LT KLKIPA V++PYRLLI VR+  L   
Sbjct  266  ELTSKPWRPLTRKLKIPAAVLSPYRLLILVRMVALSFF  303



>emb|CBI33821.3| unnamed protein product [Vitis vinifera]
Length=927

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +LL+K WR LT KL I A V++PYRLL+ VR+A LGL 
Sbjct  216  KLLSKPWRPLTRKLSIRAAVLSPYRLLVLVRMAFLGLF  253



>ref|XP_010663029.1| PREDICTED: cellulose synthase-like protein D2 [Vitis vinifera]
Length=1114

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +LL+K WR LT KL I A V++PYRLL+ VR+A LGL 
Sbjct  252  KLLSKPWRPLTRKLSIRAAVLSPYRLLVLVRMAFLGLF  289



>emb|CDX85482.1| BnaA02g03310D [Brassica napus]
Length=1031

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L++K W+ LT KL IPA V++PYRLLI +R+ +L L 
Sbjct  266  DLMSKPWKPLTRKLNIPAAVLSPYRLLILIRVVVLALF  303



>ref|XP_009126147.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Brassica 
rapa]
 ref|XP_009126148.1| PREDICTED: cellulose synthase-like protein D2 isoform X2 [Brassica 
rapa]
 ref|XP_009126150.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Brassica 
rapa]
Length=1140

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L++K W+ LT KL IPA V++PYRLLI +R+ +L L 
Sbjct  266  DLMSKPWKPLTRKLNIPAAVLSPYRLLILIRVVVLALF  303



>emb|CDO97026.1| unnamed protein product [Coffea canephora]
Length=1140

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  109  LNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +NK+WR LT KLKIP+ +++PYRLL  +R+ +L L 
Sbjct  268  MNKQWRPLTRKLKIPSAILSPYRLLALIRMVVLALF  303



>ref|XP_004301655.1| PREDICTED: cellulose synthase-like protein D3-like [Fragaria 
vesca subsp. vesca]
Length=1114

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  NKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +K+WR LT KL I A +++PYRLLIF+R+ +LGL 
Sbjct  242  DKQWRPLTRKLNISAAILSPYRLLIFIRMVVLGLF  276



>emb|CAN70317.1| hypothetical protein VITISV_038092 [Vitis vinifera]
Length=1075

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +LL+K WR LT KL I A V++PYRLL+ VR+A LGL 
Sbjct  217  KLLSKPWRPLTRKLSIRAAVLSPYRLLVLVRMAFLGLF  254



>ref|XP_010055254.1| PREDICTED: cellulose synthase-like protein D2 [Eucalyptus grandis]
 ref|XP_010055255.1| PREDICTED: cellulose synthase-like protein D2 [Eucalyptus grandis]
 gb|KCW71715.1| hypothetical protein EUGRSUZ_E00226 [Eucalyptus grandis]
Length=1100

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +L +K+WR LT KL I A +++PYRLLI  R+A+LGL 
Sbjct  220  DLKDKQWRPLTRKLSISAAILSPYRLLILARMAVLGLF  257



>ref|XP_004134379.1| PREDICTED: cellulose synthase-like protein D1-like [Cucumis sativus]
 ref|XP_004166319.1| PREDICTED: cellulose synthase-like protein D1-like [Cucumis sativus]
 gb|KGN56753.1| hypothetical protein Csa_3G132550 [Cucumis sativus]
Length=1047

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            + L+K WR LT K+K+P  V++PYRLL+F+R+ +L   
Sbjct  180  DFLDKPWRPLTRKIKVPPAVLSPYRLLVFIRMVVLAFF  217



>ref|XP_002436356.1| hypothetical protein SORBIDRAFT_10g000980 [Sorghum bicolor]
 gb|EER87723.1| hypothetical protein SORBIDRAFT_10g000980 [Sorghum bicolor]
Length=1179

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E   K WR LT KL IPA +++PYRLLI +R+ +L L 
Sbjct  301  EFTTKPWRPLTRKLSIPAAILSPYRLLILIRMVVLALF  338



>ref|XP_008438379.1| PREDICTED: cellulose synthase-like protein D1 [Cucumis melo]
Length=1047

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            + ++K WR LT K+K+P  V++PYRLL+F+R+ +L   
Sbjct  180  DFMDKPWRPLTRKIKVPPAVLSPYRLLVFIRMVVLAFF  217



>ref|XP_006845742.1| hypothetical protein AMTR_s00019p00246190 [Amborella trichopoda]
 gb|ERN07417.1| hypothetical protein AMTR_s00019p00246190 [Amborella trichopoda]
Length=1056

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            + ++K W+ LT K++IPA V++PYRLLIFVR+ +L
Sbjct  182  DFMDKPWKPLTRKVQIPAAVLSPYRLLIFVRLVVL  216



>ref|XP_003540119.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Glycine max]
 ref|XP_006592015.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Glycine max]
Length=1141

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +N+ WR LT KLKI A V++PYRL+I +R+ +L L 
Sbjct  266  EFMNRPWRPLTRKLKISAAVLSPYRLIILIRMVVLILF  303



>gb|KHN46458.1| Cellulose synthase-like protein D3 [Glycine soja]
Length=1037

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E +N+ WR LT KLKI A V++PYRL+I +R+ +L L 
Sbjct  190  EFMNRPWRPLTRKLKISAAVLSPYRLIILIRMVVLILF  227



>ref|XP_008238167.1| PREDICTED: cellulose synthase-like protein D3 [Prunus mume]
Length=1129

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  NKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +K+WR LT KL I A +++PYR+LI VR+ +LGL 
Sbjct  244  DKQWRPLTRKLNISAAILSPYRILILVRMVVLGLF  278



>ref|XP_007210976.1| hypothetical protein PRUPE_ppa021772mg [Prunus persica]
 gb|EMJ12175.1| hypothetical protein PRUPE_ppa021772mg [Prunus persica]
Length=1129

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  NKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +K+WR LT KL I A +++PYR+LI VR+ +LGL 
Sbjct  244  DKQWRPLTRKLNISAAILSPYRILILVRMVVLGLF  278



>ref|XP_006662106.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
D1-like [Oryza brachyantha]
Length=1125

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            EL++K WR LT KL+I A VI+PYRLL+ +R+  L   
Sbjct  245  ELMSKPWRPLTRKLRIQAAVISPYRLLVVIRLVALAFF  282



>ref|XP_002881261.1| hypothetical protein ARALYDRAFT_482247 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57520.1| hypothetical protein ARALYDRAFT_482247 [Arabidopsis lyrata subsp. 
lyrata]
Length=1036

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            + L+K W+ LT K+K+PA V++PYRLLI +R+ I+
Sbjct  159  DFLDKPWKPLTRKVKVPAKVLSPYRLLIVIRLVIV  193



>ref|XP_008235918.1| PREDICTED: cellulose synthase-like protein D4 [Prunus mume]
Length=1131

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  106  NKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            +K W+ L+ KL IPA +I+PYRLLIFVR  +L
Sbjct  262  DKPWKPLSRKLPIPAAIISPYRLLIFVRFIVL  293



>ref|XP_007201219.1| hypothetical protein PRUPE_ppa000490mg [Prunus persica]
 gb|EMJ02418.1| hypothetical protein PRUPE_ppa000490mg [Prunus persica]
Length=1131

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  106  NKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            +K W+ L+ KL IPA +I+PYRLLIFVR  +L
Sbjct  262  DKPWKPLSRKLPIPAAIISPYRLLIFVRFIVL  293



>ref|XP_006410449.1| hypothetical protein EUTSA_v10016169mg [Eutrema salsugineum]
 gb|ESQ51902.1| hypothetical protein EUTSA_v10016169mg [Eutrema salsugineum]
Length=1039

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            + L+K W+ LT K+K+PA V++PYRLLI +R+ IL
Sbjct  162  DFLDKPWKPLTRKVKVPAKVLSPYRLLIALRLVIL  196



>ref|XP_002304709.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE79688.1| cellulose synthase family protein [Populus trichocarpa]
Length=1025

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            + L+K W+ LT K+K+PA +++PYR+LI +R+ +L
Sbjct  161  DFLDKPWKPLTRKIKVPAAILSPYRILIVIRLIVL  195



>gb|AFZ78592.1| cellulose synthase-like protein [Populus tomentosa]
Length=1025

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            + L+K W+ LT K+K+PA +++PYR+LI +R+ +L
Sbjct  161  DFLDKPWKPLTRKIKVPAAILSPYRILIVIRLIVL  195



>emb|CBI37716.3| unnamed protein product [Vitis vinifera]
Length=935

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E ++K W+ L+ K+ +PA +++PYRLLI VR  +LG  
Sbjct  257  ETMDKPWKPLSRKMPVPAAILSPYRLLIAVRFVVLGFF  294



>ref|XP_010109052.1| Cellulose synthase-like protein D1 [Morus notabilis]
 gb|EXC20804.1| Cellulose synthase-like protein D1 [Morus notabilis]
Length=1039

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            + ++K W+ LT K+K+P+ V++PYRLL+ +R+A+L L 
Sbjct  163  DFMDKPWKPLTRKVKVPSGVLSPYRLLVVIRMAVLVLF  200



>ref|XP_002280032.1| PREDICTED: cellulose synthase-like protein D4 [Vitis vinifera]
Length=1116

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E ++K W+ L+ K+ +PA +++PYRLLI VR  +LG  
Sbjct  257  ETMDKPWKPLSRKMPVPAAILSPYRLLIAVRFVVLGFF  294



>ref|XP_006293607.1| hypothetical protein CARUB_v10022555mg [Capsella rubella]
 gb|EOA26505.1| hypothetical protein CARUB_v10022555mg [Capsella rubella]
Length=585

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            + L+K W+ LT K+ IPA V++PYRLLI +R+ I+
Sbjct  161  DFLDKPWKPLTRKVNIPAKVLSPYRLLIVIRLVIV  195



>ref|XP_007040720.1| Cellulose synthase-like D3 [Theobroma cacao]
 gb|EOY25221.1| Cellulose synthase-like D3 [Theobroma cacao]
Length=1107

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  103  KEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            K+W+ LT K  I A V++PYRLLI +RI +LGL 
Sbjct  235  KQWKPLTQKSNIRAAVLSPYRLLILIRIVVLGLF  268



>ref|XP_006293608.1| hypothetical protein CARUB_v10022555mg [Capsella rubella]
 gb|EOA26506.1| hypothetical protein CARUB_v10022555mg [Capsella rubella]
Length=732

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            + L+K W+ LT K+ IPA V++PYRLLI +R+ I+
Sbjct  161  DFLDKPWKPLTRKVNIPAKVLSPYRLLIVIRLVIV  195



>ref|XP_009387033.1| PREDICTED: cellulose synthase-like protein D4 [Musa acuminata 
subsp. malaccensis]
Length=1148

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            E ++K W+ LT K+ +PA +I+PYRLLI VR+  LG  
Sbjct  274  ENMDKPWKPLTRKIPMPAGIISPYRLLIVVRLVALGFF  311



>ref|NP_180869.1| cellulose synthase-like protein D1 [Arabidopsis thaliana]
 sp|O49323.1|CSLD1_ARATH RecName: Full=Cellulose synthase-like protein D1; Short=AtCslD1 
[Arabidopsis thaliana]
 gb|AAC04910.1| putative cellulose synthase [Arabidopsis thaliana]
 gb|AEC08785.1| cellulose synthase-like protein D1 [Arabidopsis thaliana]
 gb|AHL38816.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1036

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            + L+K W+ LT K++IPA +++PYRLLI +R+ I+
Sbjct  159  DFLDKPWKPLTRKVQIPAKILSPYRLLIVIRLVIV  193



>ref|XP_006849943.1| hypothetical protein AMTR_s00022p00129900 [Amborella trichopoda]
 gb|ERN11524.1| hypothetical protein AMTR_s00022p00129900 [Amborella trichopoda]
Length=1155

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  ELLNKEWRLLTHKLKIPAIVINPYRLLIFVRIAILGLL  2
            +  +K W+ LT  ++IPA +I+PYRLLIF+R  +L L 
Sbjct  288  DFADKPWKPLTRVIQIPAAIISPYRLLIFIRFVVLILF  325



>ref|XP_007158244.1| hypothetical protein PHAVU_002G136300g [Phaseolus vulgaris]
 gb|ESW30238.1| hypothetical protein PHAVU_002G136300g [Phaseolus vulgaris]
Length=1117

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  103  KEWRLLTHKLKIPAIVINPYRLLIFVRIAIL  11
            K+W+ LT KL I A +++PYRL+IFVR+ IL
Sbjct  243  KQWKPLTRKLSISAAILSPYRLIIFVRLVIL  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519686539684