BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1424_g1_i1 len=1649 path=[1:0-489 491:490-1648]

Length=1649
                                                                      Score     E

ref|XP_011096288.1|  PREDICTED: uncharacterized protein LOC105175521    243   4e-69   
ref|XP_009591281.1|  PREDICTED: uncharacterized protein LOC104088327    217   6e-60   
ref|XP_009599457.1|  PREDICTED: uncharacterized protein LOC104095114    216   8e-60   
ref|XP_011074959.1|  PREDICTED: uncharacterized protein LOC105159552    216   1e-59   
ref|XP_006473884.1|  PREDICTED: uncharacterized protein LOC102618133    217   1e-59   
gb|KDP35105.1|  hypothetical protein JCGZ_10947                         213   4e-58   
ref|XP_009781129.1|  PREDICTED: uncharacterized protein LOC104230092    210   4e-57   
gb|KFK41626.1|  hypothetical protein AALP_AA2G152200                    206   4e-56   
ref|XP_006434684.1|  hypothetical protein CICLE_v10001073mg             206   5e-56   
ref|XP_006302242.1|  hypothetical protein CARUB_v10020268mg             205   1e-55   
ref|XP_010063755.1|  PREDICTED: uncharacterized protein LOC104450764    204   4e-55   
ref|XP_006356548.1|  PREDICTED: uncharacterized protein LOC102585078    202   1e-54   
ref|NP_177355.1|  late embryogenesis abundant domain-containing p...    202   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42139.1|  unknown protein                                         202   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887412.1|  hypothetical protein ARALYDRAFT_476340             202   2e-54   
ref|XP_010322771.1|  PREDICTED: uncharacterized protein LOC101255207    200   4e-54   
ref|XP_010415942.1|  PREDICTED: uncharacterized protein LOC104701...    197   1e-52   
ref|XP_010415941.1|  PREDICTED: uncharacterized protein LOC104701...    197   1e-52   
ref|XP_010428064.1|  PREDICTED: uncharacterized protein LOC104712790    196   2e-52   
ref|XP_009362438.1|  PREDICTED: uncharacterized protein LOC103952558    196   1e-51   
ref|XP_007131293.1|  hypothetical protein PHAVU_011G001700g             191   3e-51   
ref|XP_009765498.1|  PREDICTED: uncharacterized protein LOC104217042    191   3e-50   
emb|CDY03662.1|  BnaA02g15750D                                          189   6e-50   
ref|XP_009127895.1|  PREDICTED: uncharacterized protein LOC103852751    189   7e-50   
ref|XP_006390707.1|  hypothetical protein EUTSA_v10018523mg             187   5e-49   
ref|XP_010645833.1|  PREDICTED: uncharacterized protein LOC100256187    186   1e-48   
ref|XP_006367365.1|  PREDICTED: uncharacterized protein LOC102584616    184   2e-48   
emb|CDX82188.1|  BnaC02g21020D                                          184   5e-48   
ref|XP_004162866.1|  PREDICTED: uncharacterized protein LOC101231534    182   5e-48   
ref|XP_008459625.1|  PREDICTED: uncharacterized protein LOC103498695    183   7e-48   
emb|CDP10676.1|  unnamed protein product                                181   2e-47   
gb|KEH29295.1|  late embryogenesis abundant protein (LEA) family ...    180   8e-47   
ref|XP_004250627.1|  PREDICTED: uncharacterized protein LOC101264586    177   5e-46   
ref|XP_010521159.1|  PREDICTED: uncharacterized protein LOC104800...    178   1e-45   
ref|XP_006585749.1|  PREDICTED: uncharacterized protein LOC100808861    174   3e-45   
gb|EYU22790.1|  hypothetical protein MIMGU_mgv1a011924mg                171   4e-45   
gb|KHG00926.1|  Transmembrane protein                                   171   4e-45   
gb|KHM98827.1|  Transmembrane protein 205                               173   8e-45   
ref|NP_001236456.1|  seed maturation protein PM27 precursor             171   1e-44   
gb|KHN32470.1|  Transmembrane protein 205                               171   2e-44   
gb|ACU20077.1|  unknown                                                 171   2e-44   Glycine max [soybeans]
ref|XP_010244844.1|  PREDICTED: uncharacterized protein LOC104588560    174   5e-44   
ref|XP_007224898.1|  hypothetical protein PRUPE_ppa022136mg             170   1e-42   
ref|XP_006591921.1|  PREDICTED: seed maturation protein PM27 isof...    165   4e-42   
ref|XP_008219004.1|  PREDICTED: uncharacterized protein LOC103319269    166   4e-41   
ref|XP_004141640.1|  PREDICTED: uncharacterized protein LOC101208468    162   6e-41   
ref|XP_010431488.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    155   9e-39   
ref|XP_004516134.1|  PREDICTED: uncharacterized protein LOC101512941    156   2e-38   
ref|XP_010912527.1|  PREDICTED: uncharacterized protein LOC105038415    155   5e-38   
ref|XP_010521158.1|  PREDICTED: uncharacterized protein LOC104800...    156   6e-38   
ref|XP_008807668.1|  PREDICTED: uncharacterized protein LOC103719958    154   1e-37   
ref|XP_003579779.1|  PREDICTED: uncharacterized protein LOC100835682    155   1e-37   
gb|KGN52683.1|  hypothetical protein Csa_5G650480                       149   2e-36   
ref|XP_010682507.1|  PREDICTED: uncharacterized protein LOC104897327    150   2e-36   
ref|XP_002446504.1|  hypothetical protein SORBIDRAFT_06g017050          152   2e-36   Sorghum bicolor [broomcorn]
gb|AFW58284.1|  hypothetical protein ZEAMMB73_800275                    150   5e-36   
ref|XP_008663208.1|  PREDICTED: transmembrane protein 205-like          144   6e-36   
emb|CAD41023.1|  OSJNBb0086G13.7                                        149   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008339201.1|  PREDICTED: uncharacterized protein LOC103402237    149   2e-35   
ref|XP_008352801.1|  PREDICTED: uncharacterized protein LOC103416320    149   2e-35   
emb|CAH66906.1|  H0823A09.7                                             148   3e-35   Oryza sativa [red rice]
gb|EAY94192.1|  hypothetical protein OsI_15966                          148   3e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010431487.1|  PREDICTED: uncharacterized protein LOC104715812    148   4e-35   
ref|XP_008368140.1|  PREDICTED: uncharacterized protein LOC103431746    147   5e-35   
emb|CBI35529.3|  unnamed protein product                                144   1e-34   
emb|CAN77279.1|  hypothetical protein VITISV_037453                     143   2e-34   Vitis vinifera
ref|XP_006859142.1|  hypothetical protein AMTR_s00070p00109270          145   2e-34   
ref|XP_002521819.1|  conserved hypothetical protein                     144   5e-34   Ricinus communis
ref|XP_004299879.1|  PREDICTED: uncharacterized protein LOC101292414    143   2e-33   
ref|XP_010474290.1|  PREDICTED: uncharacterized protein LOC104753790    140   3e-33   
gb|AHF21579.1|  late embryogenesis abundant protein                     141   3e-33   
ref|XP_002893240.1|  hypothetical protein ARALYDRAFT_472499             137   3e-32   
emb|CBI35531.3|  unnamed protein product                                134   4e-31   
ref|XP_006305902.1|  hypothetical protein CARUB_v10011076mg             132   2e-30   
ref|NP_173674.1|  Late embryogenesis abundant protein (LEA) famil...    131   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KDO38275.1|  hypothetical protein CISIN_1g037813mg                   130   4e-30   
ref|XP_010460015.1|  PREDICTED: uncharacterized protein LOC104740962    129   2e-29   
ref|XP_010095892.1|  hypothetical protein L484_008289                   129   6e-29   
ref|XP_008361625.1|  PREDICTED: seed biotin-containing protein SB...    127   2e-28   
gb|EMS55518.1|  hypothetical protein TRIUR3_20741                       128   3e-28   
ref|XP_006416182.1|  hypothetical protein EUTSA_v10008247mg             124   3e-28   
emb|CDY69861.1|  BnaCnng65680D                                          124   1e-27   
ref|XP_010498737.1|  PREDICTED: uncharacterized protein LOC104776381    122   4e-27   
gb|KFK44353.1|  hypothetical protein AALP_AA1G246500                    122   4e-27   
emb|CDY25745.1|  BnaA07g10370D                                          122   4e-27   
ref|XP_009103229.1|  PREDICTED: uncharacterized protein LOC103829321    122   5e-27   
dbj|BAJ91683.1|  predicted protein                                      123   1e-26   
ref|XP_009414887.1|  PREDICTED: uncharacterized protein LOC103995882    119   2e-25   
ref|XP_008368141.1|  PREDICTED: transmembrane protein 205-like          112   7e-25   
gb|EMT04172.1|  hypothetical protein F775_30700                         116   3e-24   
ref|XP_010477518.1|  PREDICTED: uncharacterized protein LOC104756605    111   1e-23   
gb|EPS65890.1|  hypothetical protein M569_08895                       99.4    6e-19   
gb|EAZ30809.1|  hypothetical protein OsJ_14876                        98.2    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008361622.1|  PREDICTED: uncharacterized protein LOC103425319  92.4    1e-17   
gb|KDO36882.1|  hypothetical protein CISIN_1g043201mg                 82.4    9e-15   
gb|EYU22791.1|  hypothetical protein MIMGU_mgv11b021530mg             82.0    2e-14   
ref|XP_002968913.1|  hypothetical protein SELMODRAFT_440470           85.5    3e-14   
ref|XP_002989961.1|  hypothetical protein SELMODRAFT_428422           84.0    1e-13   
ref|XP_006875194.1|  PREDICTED: transmembrane protein 205             76.3    2e-12   
ref|NP_001240796.1|  transmembrane protein 205 isoform 1              75.5    8e-12   
ref|NP_848692.2|  transmembrane protein 205 isoform 2                 74.3    1e-11   Mus musculus [mouse]
dbj|BAA92764.1|  unnamed protein product                              72.4    4e-11   Mus musculus [mouse]
ref|XP_007993494.1|  PREDICTED: transmembrane protein 205             72.0    5e-11   
ref|XP_003914966.1|  PREDICTED: transmembrane protein 205             72.0    5e-11   
ref|NP_001181752.1|  transmembrane protein 205                        72.0    6e-11   
ref|XP_004748447.1|  PREDICTED: transmembrane protein 205 isoform X1  72.0    6e-11   
ref|XP_004824423.1|  PREDICTED: transmembrane protein 205 isoform X1  72.0    7e-11   
emb|CAN72243.1|  hypothetical protein VITISV_022622                   73.9    1e-10   Vitis vinifera
ref|XP_004060075.1|  PREDICTED: transmembrane protein 205 isoform 1   71.2    1e-10   
ref|XP_001754410.1|  predicted protein                                70.5    1e-10   
ref|NP_212133.1|  transmembrane protein 205                           70.9    1e-10   Homo sapiens [man]
ref|XP_005346982.1|  PREDICTED: transmembrane protein 205             70.5    2e-10   
ref|XP_010372011.1|  PREDICTED: transmembrane protein 205             70.5    2e-10   
ref|NP_001124814.1|  transmembrane protein 205                        70.5    2e-10   Pongo abelii [orang utan]
ref|XP_001773290.1|  predicted protein                                73.6    2e-10   
ref|XP_002967473.1|  hypothetical protein SELMODRAFT_169057           70.5    3e-10   
ref|XP_007629766.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  70.9    3e-10   
ref|XP_006744351.1|  PREDICTED: transmembrane protein 205 isoform X1  70.1    3e-10   
ref|XP_004398961.1|  PREDICTED: transmembrane protein 205 isoform 1   69.7    3e-10   
ref|XP_002960240.1|  hypothetical protein SELMODRAFT_139492           70.1    4e-10   
gb|EGV96173.1|  Transmembrane protein 205                             69.7    4e-10   
ref|XP_005405712.1|  PREDICTED: transmembrane protein 205 isoform X1  69.3    4e-10   
ref|XP_007460759.1|  PREDICTED: transmembrane protein 205             69.3    5e-10   
ref|XP_003123224.2|  PREDICTED: transmembrane protein 205 isoform 3   69.3    5e-10   
ref|XP_003981931.2|  PREDICTED: transmembrane protein 205 isoform X1  69.3    5e-10   
ref|XP_006928487.1|  PREDICTED: transmembrane protein 205 isoform X2  69.3    5e-10   
ref|XP_008385637.1|  PREDICTED: uncharacterized protein LOC103448159  67.8    5e-10   
ref|XP_006928488.1|  PREDICTED: transmembrane protein 205 isoform X3  68.9    6e-10   
ref|XP_007079370.1|  PREDICTED: transmembrane protein 205 isoform X2  68.9    7e-10   
ref|XP_003797991.1|  PREDICTED: transmembrane protein 205             68.9    7e-10   
ref|XP_007079369.1|  PREDICTED: transmembrane protein 205 isoform X1  68.9    7e-10   
ref|XP_002761800.1|  PREDICTED: transmembrane protein 205             68.9    7e-10   Callithrix jacchus [common marmoset]
ref|XP_003123222.1|  PREDICTED: transmembrane protein 205 isoform 1   68.9    7e-10   
ref|XP_007079371.1|  PREDICTED: transmembrane protein 205 isoform X3  68.6    8e-10   
ref|XP_007488571.1|  PREDICTED: transmembrane protein 205 isoform X1  68.6    9e-10   
ref|XP_533912.2|  PREDICTED: transmembrane protein 205                68.2    1e-09   Canis lupus familiaris [dogs]
ref|XP_005861438.1|  PREDICTED: transmembrane protein 205             68.2    1e-09   
ref|XP_007265995.1|  hypothetical protein FOMMEDRAFT_19631            67.8    1e-09   
ref|XP_010976605.1|  PREDICTED: transmembrane protein 205             67.8    2e-09   
ref|XP_010633032.1|  PREDICTED: transmembrane protein 205             67.4    2e-09   
ref|XP_007168997.1|  PREDICTED: transmembrane protein 205 isoform X1  67.4    2e-09   
ref|XP_006161572.1|  PREDICTED: transmembrane protein 205 isoform X1  67.4    2e-09   
ref|XP_006905911.1|  PREDICTED: transmembrane protein 205             67.0    3e-09   
ref|XP_006184934.1|  PREDICTED: transmembrane protein 205             67.0    3e-09   
gb|EQB78321.1|  transmembrane protein 205                             67.0    3e-09   
ref|XP_006206363.1|  PREDICTED: transmembrane protein 205             67.0    3e-09   
ref|XP_006104631.1|  PREDICTED: transmembrane protein 205             67.0    3e-09   
ref|XP_006063973.1|  PREDICTED: transmembrane protein 205 isoform X1  67.0    3e-09   
ref|XP_007106730.1|  PREDICTED: transmembrane protein 205 isoform X1  66.6    3e-09   
ref|NP_001032688.1|  transmembrane protein 205                        66.6    3e-09   Bos taurus [bovine]
ref|XP_005890840.1|  PREDICTED: transmembrane protein 205             66.6    4e-09   
ref|XP_007307589.1|  hypothetical protein STEHIDRAFT_101745           66.6    4e-09   
ref|XP_008706293.1|  PREDICTED: transmembrane protein 205             66.2    5e-09   
ref|XP_004277434.1|  PREDICTED: transmembrane protein 205             66.2    5e-09   
ref|XP_006982404.1|  PREDICTED: transmembrane protein 205 isoform X1  66.2    5e-09   
ref|XP_001490060.1|  PREDICTED: transmembrane protein 205 isoform X1  65.9    6e-09   Equus caballus [domestic horse]
ref|XP_008051446.1|  PREDICTED: transmembrane protein 205             65.9    7e-09   
ref|XP_004632884.1|  PREDICTED: transmembrane protein 205             65.9    7e-09   
ref|XP_002921398.1|  PREDICTED: transmembrane protein 205-like is...  65.9    7e-09   
ref|XP_004716881.1|  PREDICTED: transmembrane protein 205             65.9    7e-09   
ref|NP_001100274.1|  transmembrane protein 205                        65.5    8e-09   Rattus norvegicus [brown rat]
gb|EDL25229.1|  cDNA sequence BC010787, isoform CRA_c                 64.3    8e-09   
ref|XP_004378381.1|  PREDICTED: transmembrane protein 205             65.5    8e-09   
ref|XP_008831793.1|  PREDICTED: transmembrane protein 205             65.5    9e-09   
ref|XP_004008585.1|  PREDICTED: transmembrane protein 205 isoform 1   65.5    9e-09   
ref|XP_005682437.1|  PREDICTED: transmembrane protein 205 isoform X1  65.5    1e-08   
ref|XP_004616637.1|  PREDICTED: transmembrane protein 205             65.1    1e-08   
ref|XP_005970320.1|  PREDICTED: ras-related protein Rab-3D-like i...  65.1    1e-08   
ref|XP_004689065.1|  PREDICTED: transmembrane protein 205             64.7    1e-08   
ref|XP_007951790.1|  PREDICTED: transmembrane protein 205             64.3    2e-08   
ref|XP_001828635.2|  hypothetical protein CC1G_10507                  64.3    2e-08   Coprinopsis cinerea okayama7#130
ref|XP_003941832.1|  PREDICTED: transmembrane protein 205             63.9    3e-08   
ref|XP_004667532.1|  PREDICTED: transmembrane protein 205             63.9    3e-08   
ref|XP_007058305.1|  PREDICTED: transmembrane protein 205             64.3    3e-08   
ref|XP_008031847.1|  hypothetical protein TRAVEDRAFT_25694            63.2    5e-08   
ref|XP_004900414.1|  PREDICTED: transmembrane protein 205 isoform X1  63.2    5e-08   
ref|XP_005336217.1|  PREDICTED: transmembrane protein 205 isoform X1  63.2    5e-08   
dbj|BAE87170.1|  unnamed protein product                              61.6    7e-08   
gb|KDR84846.1|  hypothetical protein GALMADRAFT_233266                62.8    7e-08   
ref|XP_004495913.1|  PREDICTED: transmembrane protein 205-like        62.4    9e-08   
ref|XP_003413409.1|  PREDICTED: transmembrane protein 205             62.4    9e-08   
ref|XP_006898852.1|  PREDICTED: transmembrane protein 205             62.0    1e-07   
ref|XP_004442704.1|  PREDICTED: transmembrane protein 205             62.0    1e-07   
gb|AFK35536.1|  unknown                                               62.4    1e-07   
ref|XP_007638645.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...  63.9    2e-07   
ref|XP_003591427.1|  Transmembrane protein                            61.6    2e-07   
gb|EAW84194.1|  MBC3205, isoform CRA_b                                60.5    2e-07   
ref|XP_010038276.1|  PREDICTED: transmembrane protein 205-like        61.6    2e-07   
ref|XP_003461291.1|  PREDICTED: transmembrane protein 205             61.2    2e-07   
ref|XP_004595566.1|  PREDICTED: transmembrane protein 205             61.2    2e-07   
ref|XP_007359865.1|  hypothetical protein DICSQDRAFT_46861            61.2    2e-07   
ref|XP_005970319.1|  PREDICTED: ras-related protein Rab-3D-like i...  62.4    3e-07   
ref|XP_010827125.1|  PREDICTED: transmembrane protein 205-like        59.7    3e-07   
ref|XP_003760487.1|  PREDICTED: transmembrane protein 205             60.5    4e-07   
gb|EMP37259.1|  hypothetical protein UY3_05573                        60.5    5e-07   
ref|XP_006023565.1|  PREDICTED: transmembrane protein 205-like        59.3    5e-07   
ref|XP_006262415.1|  PREDICTED: transmembrane protein 205             59.7    6e-07   
ref|XP_007842458.1|  hypothetical protein Moror_273                   59.7    6e-07   
emb|CCM01621.1|  predicted protein                                    59.7    6e-07   
ref|XP_010038275.1|  PREDICTED: transmembrane protein 205-like        59.7    7e-07   
ref|XP_006631556.1|  PREDICTED: transmembrane protein 205-like        59.7    7e-07   
gb|EMD41633.1|  hypothetical protein CERSUDRAFT_90206                 59.3    9e-07   
ref|XP_005310207.1|  PREDICTED: transmembrane protein 205             58.9    1e-06   
ref|XP_006124822.1|  PREDICTED: transmembrane protein 205             57.4    2e-06   
ref|XP_008156250.1|  PREDICTED: transmembrane protein 205             58.5    2e-06   
ref|XP_007423085.1|  PREDICTED: transmembrane protein 205 isoform X1  58.5    2e-06   
ref|XP_003577242.1|  PREDICTED: transmembrane protein 205-like        58.9    2e-06   
ref|XP_007325253.1|  hypothetical protein AGABI1DRAFT_81244           58.2    2e-06   
ref|XP_002724192.1|  PREDICTED: transmembrane protein 205             57.8    3e-06   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008378789.1|  PREDICTED: uncharacterized protein LOC103441857  58.2    3e-06   
ref|XP_003216825.1|  PREDICTED: transmembrane protein 205             57.8    3e-06   
ref|XP_007145160.1|  hypothetical protein PHAVU_007G215400g           57.8    3e-06   
ref|XP_004300464.1|  PREDICTED: transmembrane protein 205-like        57.8    4e-06   
ref|XP_001516741.3|  PREDICTED: transmembrane protein 205             57.4    4e-06   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_004084163.1|  PREDICTED: transmembrane protein 205-like is...  57.4    4e-06   
ref|XP_001775467.1|  predicted protein                                57.4    5e-06   
ref|NP_001068440.1|  Os11g0673100                                     57.4    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005802843.1|  PREDICTED: transmembrane protein 205-like        57.0    5e-06   
ref|NP_001235713.1|  uncharacterized protein LOC100305973             57.0    6e-06   
ref|XP_003275696.2|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  57.0    6e-06   
ref|XP_006663101.1|  PREDICTED: transmembrane protein 205-like        56.6    7e-06   
ref|XP_007526029.1|  PREDICTED: transmembrane protein 205             56.2    8e-06   
ref|XP_008235189.1|  PREDICTED: transmembrane protein 205             56.6    8e-06   
ref|XP_008510119.1|  PREDICTED: transmembrane protein 205             55.5    9e-06   
ref|XP_007200488.1|  hypothetical protein PRUPE_ppa011378mg           56.6    9e-06   
ref|XP_004458246.1|  PREDICTED: transmembrane protein 205 isoform 1   56.2    1e-05   
gb|ETE69392.1|  Transmembrane protein                                 55.8    1e-05   
gb|KDP28239.1|  hypothetical protein JCGZ_14010                       55.8    1e-05   
ref|XP_002275502.1|  PREDICTED: transmembrane protein 205             55.8    1e-05   Vitis vinifera
gb|EPS99083.1|  hypothetical protein FOMPIDRAFT_1037137               55.5    1e-05   
ref|XP_009541459.1|  hypothetical protein HETIRDRAFT_469713           55.1    2e-05   
ref|XP_010095303.1|  hypothetical protein L484_001912                 55.5    2e-05   
ref|XP_008572016.1|  PREDICTED: transmembrane protein 205 isoform X1  55.5    2e-05   
ref|XP_007051074.1|  Late embryogenesis abundant protein (LEA) fa...  55.5    2e-05   
ref|XP_006765857.1|  PREDICTED: transmembrane protein 205             55.1    2e-05   
ref|XP_008386731.1|  PREDICTED: transmembrane protein 205             55.5    2e-05   
gb|AFK37222.1|  unknown                                               55.1    2e-05   
ref|XP_002302753.1|  hypothetical protein POPTR_0002s19890g           55.1    3e-05   Populus trichocarpa [western balsam poplar]
gb|AFK41050.1|  unknown                                               55.5    3e-05   
ref|XP_004229403.1|  PREDICTED: transmembrane protein 205             55.1    3e-05   
ref|XP_006444466.1|  hypothetical protein CICLE_v10022218mg           55.1    3e-05   
gb|KHF99197.1|  Transmembrane protein                                 55.1    3e-05   
ref|XP_010259357.1|  PREDICTED: transmembrane protein 205             55.1    3e-05   
ref|XP_008501066.1|  PREDICTED: transmembrane protein 205             54.3    3e-05   
ref|XP_007378569.1|  hypothetical protein PUNSTDRAFT_117368           54.3    4e-05   
ref|XP_009339789.1|  PREDICTED: transmembrane protein 205             54.7    4e-05   
ref|XP_008572017.1|  PREDICTED: transmembrane protein 205 isoform X2  54.3    4e-05   
ref|XP_009788476.1|  PREDICTED: transmembrane protein 205             54.7    4e-05   
ref|XP_009594998.1|  PREDICTED: transmembrane protein 205             54.7    4e-05   
ref|XP_002515303.1|  conserved hypothetical protein                   54.7    4e-05   Ricinus communis
gb|KFO96458.1|  Transmembrane protein 205                             53.9    4e-05   
ref|NP_001085593.1|  transmembrane protein 205                        54.3    4e-05   Xenopus laevis [clawed frog]
ref|XP_009378694.1|  PREDICTED: transmembrane protein 205-like is...  54.3    5e-05   
ref|XP_008345233.1|  PREDICTED: transmembrane protein 205-like        54.3    5e-05   
gb|AHF21581.1|  late embryogenesis abundant protein                   54.3    5e-05   
ref|XP_010931739.1|  PREDICTED: transmembrane protein 205-like        54.3    5e-05   
emb|CAB83108.1|  putative protein                                     53.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006349201.1|  PREDICTED: transmembrane protein 205-like        54.3    5e-05   
gb|KCW50100.1|  hypothetical protein EUGRSUZ_K03533                   54.3    6e-05   
ref|XP_008369056.1|  PREDICTED: transmembrane protein 205-like        54.3    6e-05   
ref|XP_008297418.1|  PREDICTED: transmembrane protein 205             53.5    7e-05   
ref|XP_008797440.1|  PREDICTED: transmembrane protein 205-like        53.5    8e-05   
ref|XP_008923476.1|  PREDICTED: transmembrane protein 205             53.1    9e-05   
gb|KFW82049.1|  Transmembrane protein 205                             53.1    9e-05   
ref|XP_005050720.1|  PREDICTED: transmembrane protein 205-like        53.1    9e-05   
ref|XP_004979942.1|  PREDICTED: transmembrane protein 205-like is...  53.5    1e-04   
ref|XP_008451494.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  53.5    1e-04   
ref|XP_004163148.1|  PREDICTED: transmembrane protein 205-like is...  53.5    1e-04   
ref|XP_009087166.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  52.8    1e-04   
ref|XP_004163149.1|  PREDICTED: transmembrane protein 205-like is...  53.1    1e-04   
gb|ABK26434.1|  unknown                                               53.5    1e-04   Picea sitchensis
ref|XP_009378695.1|  PREDICTED: transmembrane protein 205-like is...  52.8    1e-04   
ref|XP_009402510.1|  PREDICTED: transmembrane protein 205-like        53.1    1e-04   
ref|XP_010544979.1|  PREDICTED: transmembrane protein 205             53.1    1e-04   
ref|XP_010407732.1|  PREDICTED: transmembrane protein 205             52.8    1e-04   
ref|XP_010038277.1|  PREDICTED: transmembrane protein 205-like        53.1    1e-04   
ref|XP_010521444.1|  PREDICTED: transmembrane protein 205-like        53.1    1e-04   
gb|EPS63239.1|  hypothetical protein M569_11548                       53.1    1e-04   
ref|XP_010559194.1|  PREDICTED: transmembrane protein 205-like        53.1    1e-04   
ref|XP_002287805.1|  predicted protein                                52.0    1e-04   
ref|XP_006855302.1|  hypothetical protein AMTR_s00057p00058340        52.8    2e-04   
gb|AAL06485.1|AF411796_1  AT3g62580/T12C14_280                        52.8    2e-04   
ref|NP_567130.1|  Late embryogenesis abundant protein (LEA) famil...  52.8    2e-04   
gb|KHG21214.1|  Transmembrane protein                                 52.8    2e-04   
ref|XP_010679353.1|  PREDICTED: transmembrane protein 205             52.8    2e-04   
emb|CDX76644.1|  BnaC08g32300D                                        52.8    2e-04   
ref|XP_005482352.1|  PREDICTED: transmembrane protein 205-like        52.0    2e-04   
ref|XP_008631326.1|  PREDICTED: transmembrane protein 205             52.4    2e-04   
ref|XP_002876679.1|  hypothetical protein ARALYDRAFT_486758           52.8    2e-04   
emb|CDP17085.1|  unnamed protein product                              52.8    2e-04   
ref|XP_011079574.1|  PREDICTED: transmembrane protein 205             52.8    2e-04   
ref|XP_010748490.1|  PREDICTED: transmembrane protein 205             52.0    2e-04   
ref|XP_009976137.1|  PREDICTED: transmembrane protein 205             52.4    2e-04   
ref|XP_009116920.1|  PREDICTED: transmembrane protein 205             52.4    2e-04   
ref|XP_009883117.1|  PREDICTED: transmembrane protein 205             52.0    2e-04   
ref|XP_010468945.1|  PREDICTED: transmembrane protein 205-like        52.4    2e-04   
ref|XP_009558984.1|  PREDICTED: transmembrane protein 205             51.6    3e-04   
gb|KFO58631.1|  Transmembrane protein 205                             51.6    3e-04   
ref|XP_003443109.1|  PREDICTED: transmembrane protein 205-like        51.6    3e-04   
ref|XP_009505811.1|  PREDICTED: transmembrane protein 205             51.6    3e-04   
ref|XP_006025882.1|  PREDICTED: transmembrane protein 205-like        51.6    3e-04   
ref|XP_010914547.1|  PREDICTED: transmembrane protein 205             52.0    3e-04   
gb|EYU46797.1|  hypothetical protein MIMGU_mgv1a013677mg              52.0    3e-04   
ref|XP_006402366.1|  hypothetical protein EUTSA_v10006236mg           52.0    3e-04   
gb|KGL92914.1|  Transmembrane protein 205                             51.2    3e-04   
ref|XP_004979943.1|  PREDICTED: transmembrane protein 205-like is...  51.6    4e-04   
ref|XP_008797225.1|  PREDICTED: transmembrane protein 205-like        51.6    4e-04   
gb|EMS50621.1|  hypothetical protein TRIUR3_30946                     51.6    4e-04   
ref|XP_010413270.1|  PREDICTED: transmembrane protein 205-like is...  51.6    5e-04   
ref|XP_009412120.1|  PREDICTED: transmembrane protein 205-like        51.2    5e-04   
gb|KFK35427.1|  hypothetical protein AALP_AA5G283100                  51.2    6e-04   
ref|XP_006291839.1|  hypothetical protein CARUB_v10018012mg           51.2    6e-04   
ref|XP_010512647.1|  PREDICTED: transmembrane protein 205-like        51.2    6e-04   
gb|EMT31562.1|  hypothetical protein F775_26736                       50.4    0.001   



>ref|XP_011096288.1| PREDICTED: uncharacterized protein LOC105175521 [Sesamum indicum]
Length=520

 Score =   243 bits (619),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 199/525 (38%), Positives = 275/525 (52%), Gaps = 90/525 (17%)
 Frame = -3

Query  1536  PAPEKK--QEDVIVKDGHRVVVVEYEKEHGNTKVLISPHES-------------------  1420
             P+PEK+  +EDVIVK+GHRVVVVEYEK+ GNTKVLISP ES                   
Sbjct  22    PSPEKQVSKEDVIVKEGHRVVVVEYEKDDGNTKVLISPQESLISHKFAETGFAANAKDKL  81

Query  1419  -------------SSEDVAAEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRT  1279
                           S  V  + G   + +   H R + GELVCDA+G+C+R IAG   +T
Sbjct  82    SEKMEDAKEKIKEVSSSVVPDVGKVGNQEEEIHHRFSPGELVCDAYGKCKRIIAGAVGKT  141

Query  1278  KDTAPEMA-----------EGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVS  1132
             K+   E             EGA+ AVSE +GKV+DT      K ++            + 
Sbjct  142   KEAVAETGHEAADKVYSSKEGAKEAVSEAVGKVKDTATHAAHKVSDK-----------IQ  190

Query  1131  EGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaek  952
             E    V+D+ ++  +KA ++  +   G ++   +   ++  +        ++  +E + K
Sbjct  191   EAKANVKDSASEISSKAKQEAAQKARGVKEQAEKVKRHVYDAVDAAKKVKEDTERETSRK  250

Query  951   aKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILRSA---------------  817
              +G +   S K E   E  S RA++      E +  +   ILR+A               
Sbjct  251   MEGAKEMVSEKAEEWMENASGRARETIRVKKERQKELS-EILRNAREVAVDVFNYMLPPE  309

Query  816   --GRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
                   G+ +L+G A A+GM VW+TF SS+VLA ALPRQQFA+ QSKIYPVYFKAMAYS+
Sbjct  310   RVASFMGILHLMGFAAAYGMCVWITFASSHVLAGALPRQQFAMVQSKIYPVYFKAMAYSV  369

Query  642   GTAFLGHI-LSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIE  466
             G A  GH+ +S +Q +     +   F GFN+++SL M+LVNLL++EPRA+KVM ERMK E
Sbjct  370   GMALFGHLMMSLSQRKGFVPVSGGMFQGFNIMASLAMILVNLLFMEPRASKVMLERMKKE  429

Query  465   KEEGRGK-GSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERA  289
             KEEG GK G  TE          R A       + G V  GGT      + A        
Sbjct  430   KEEGSGKEGQATE-------PTGRVADSDSTAAAAGRVTTGGTTTKENPDAA-------L  475

Query  288   EKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
              K++++RL+  L++LNSYSSFLNV+TL  LT +LA L Q LH AC
Sbjct  476   AKAQIIRLTATLERLNSYSSFLNVLTLTSLTWHLAQLGQHLHTAC  520



>ref|XP_009591281.1| PREDICTED: uncharacterized protein LOC104088327 [Nicotiana tomentosiformis]
Length=478

 Score =   217 bits (552),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 180/501 (36%), Positives = 255/501 (51%), Gaps = 87/501 (17%)
 Frame = -3

Query  1536  PAPEKKQEDVIVKDGHRVVVVEYEKEHGNTKVLISPHESSSEDVAA--------------  1399
             P PEKK+E VIVK+GHRVVVVEYE   GNTKV ISP E+  +  A               
Sbjct  22    PIPEKKEE-VIVKEGHRVVVVEYEPNDGNTKVSISPQETDQKATAGVVSDVKDKISDTAE  80

Query  1398  -------------EKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAP--  1264
                          E G EN   G  H+  TA ELVCDAFG+C+ +IA     TK++    
Sbjct  81    AVKDKIKEATSFGEGGKEN---GGVHK-PTARELVCDAFGKCKHRIASALGGTKESISGK  136

Query  1263  --EMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKG  1090
               E+ E A+  V     KV+DTVV K  +A+E            VSE   K +D+V +  
Sbjct  137   MHEIEEDAKATVENVYEKVKDTVVGKAHEASEK-----------VSEVKEKTKDSVKEMV  185

Query  1089  NKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEH  910
              + AK+  E  +G    + +  + L+                       M+ +AS  ++ 
Sbjct  186   KEGAKETVEKVKGKAKDVADTTKTLKG---------------------DMKRNASADLDI  224

Query  909   MKEELSDRakkaeekvgeakd--avKHNILRSAGRA------FGMANLIGLAVAFGMSVW  754
             ++E+        +E     K      + I+R    A       GM +L+G A+++G+ +W
Sbjct  225   IEEKAKAAKDAVKEDAHRLKVEGKRDYQIIRRFLSAKNFRSLMGMIHLLGFALSYGVCIW  284

Query  753   VTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQ  574
             VTFISS +LA+ALP+QQFA+ QSKIYPVYFK +AY I TAFLGH +SQ   +  ++   +
Sbjct  285   VTFISSNILARALPKQQFAMVQSKIYPVYFKTLAYGITTAFLGHFMSQRH-RYYYANRAE  343

Query  573   HflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG--STTETEHGDGVTKD  400
                GF  L+++ M L+N   LEPRA+KVM ERMK+EKEEG+G+   S   +       KD
Sbjct  344   TIQGFLCLATICMALINSFVLEPRASKVMRERMKLEKEEGKGEDIFSVEPSTSSVDALKD  403

Query  399   RsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLN  220
                                  A    E++E+  R    K ++ RLS+KLKKLN  SSF N
Sbjct  404   -----PTGIKIGKQATSSQGPAETHRELSEEAARM---KPQVERLSQKLKKLNFVSSFFN  455

Query  219   VVTLMCLTLYLAHLAQRLHVA  157
             V+TL+ L+ +L +L+Q +H +
Sbjct  456   VLTLVALSYHLVYLSQLVHAS  476



>ref|XP_009599457.1| PREDICTED: uncharacterized protein LOC104095114 [Nicotiana tomentosiformis]
Length=469

 Score =   216 bits (551),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 199/505 (39%), Positives = 281/505 (56%), Gaps = 69/505 (14%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPE--KKQEDVIVKDGHRVVVVEYEKEHGNTKVLISPH  1426
             MMN LA+SLVLTTL TAG  +P PE  KK+EDVI+K+G RVVVVE++KE G TK+LISP 
Sbjct  1     MMNFLAISLVLTTLVTAGFFNPNPENNKKKEDVILKEGPRVVVVEFDKEDG-TKILISPQ  59

Query  1425  ESSSEDVAAEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGA  1246
             + + E    + G  +D     H +      V    G+    I+  +   ++        A
Sbjct  60    QEA-EIPKGKSGYVSDLKDKLHEKAEEASSVLPNIGQ---GISSPYVNQENGEIVTKPSA  115

Query  1245  RGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVY  1066
             +  V +  GK ++                        +  LGK +D V++K ++ A KV 
Sbjct  116   KDVVCDAFGKCKEKF----------------------ASALGKTKDKVSEKAHETADKVD  153

Query  1065  EMEEGARDA---ITERLENLRasaagtassakeaakeaaekaKG-MRTDASRKMEHMKE-  901
             E++EGA+ A   + E +++  + A+       +   +  ++ KG + ++ S K + +KE 
Sbjct  154   EVKEGAKGAAEKVKESIKDAYSEASDKVKEKAKDVIDTTKRKKGEVESEISEKAKELKEK  213

Query  900   --ELSDRakkaeekvgeakdavKHNILRSAGRA-----------FGMANL---------I  787
               ++ D  K+  +KV E       +IL   GR            F + NL         +
Sbjct  214   SEQVKDSVKEGAKKVKEEGKKELKDIL---GRGREFFYDVFAYIFSLENLRTVMLLVHFL  270

Query  786   GLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQN  607
             G AVA+GM +WVTF+SSYVLA+ALPRQQFA+ QSKIY VYFKAMAY +G AFLGH+LSQ 
Sbjct  271   GFAVAYGMCIWVTFVSSYVLARALPRQQFALVQSKIYLVYFKAMAYCVGAAFLGHLLSQK  330

Query  606   QTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTET  427
               +RL++ + +   GFNLL+S+ M+LVNLLYLEPRATKVMFER+K+EKEEGRG+      
Sbjct  331   --RRLYASSAEAVQGFNLLASIAMLLVNLLYLEPRATKVMFERLKLEKEEGRGRDIFNVE  388

Query  426   EHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKK  247
                 GV  D          ++         A  + E+      E   K +++RLS+KLKK
Sbjct  389   PSSRGV--DSVLDPTCTKITSQTTTTTSKPAEKSPEV------EAVVKPQVVRLSQKLKK  440

Query  246   LNSYSSFLNVVTLMCLTLYLAHLAQ  172
             LNSYSSFLNV+TLM L+ +L HL Q
Sbjct  441   LNSYSSFLNVLTLMALSHHLVHLTQ  465



>ref|XP_011074959.1| PREDICTED: uncharacterized protein LOC105159552 [Sesamum indicum]
Length=493

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 212/553 (38%), Positives = 275/553 (50%), Gaps = 131/553 (24%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEK--KQEDVIVKDGHRV----VVVEYEKEHGNTKVL  1438
             MMN LAL LV T+L  AGVL+P PE    ++DV VK GH      +V+E+EK+ GNTKV 
Sbjct  1     MMNALALFLVFTSLVRAGVLTPTPENHNSKDDVAVKQGHTNTGDGLVIEFEKDDGNTKVS  60

Query  1437  ISPHES----------------------SSEDV--AAEKGGENDGDGSYHRRTTAGELVC  1330
             ISP +S                      + E +  AA      DG+ + H+R    EL+C
Sbjct  61    ISPKDSHPPHDGVDTANLEEKLYGKMEEAKEKIKEAASTVLSQDGEET-HQRLRPRELIC  119

Query  1329  DAFGRCRRKIAGVFDRTKDTAPE-----------MAEGARGAVSEGLGKVRDTVVDKGSK  1183
             DA+G+C+ KIA    + K+   E           M E  + AV E +GKV+DTV DK  +
Sbjct  120   DAYGKCKHKIASAMGKAKEVVVETAHEAAEKVYAMEEETKEAVGEAVGKVKDTVTDKAHQ  179

Query  1182  aaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasa  1003
                         + A +E   K +D       KA +K  EM++GA + + + ++    + 
Sbjct  180   -----------VKDAATEVSSKAKD-------KAVEKASEMKQGAEEGVYDVIDTTTKA-  220

Query  1002  agtassakeaakeaaekaKGMRTDASRKMEHMKE------EL----SDRakkaeekvgea  853
                                  +  A +KME  KE      EL    SDRAKK   K  + 
Sbjct  221   ---------------------KDKAFKKMEGAKEKAKEAQELVGSASDRAKKQGHKGLKG  259

Query  852   kdavKHNILRSAGRAF------GMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVA  691
                    +L   G         G+ +L+G A A+GM +WVTF S+YVLA +LPR QFA+ 
Sbjct  260   IFQRGGGVLGYIGLPVRMDSVAGVLHLLGFAAAYGMGLWVTFASNYVLAGSLPRYQFAMV  319

Query  690   QSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyL  511
             QSKIYPVYFKAMAYS+GTA LGH++SQ + +            FNL++SLLM LVNLLYL
Sbjct  320   QSKIYPVYFKAMAYSVGTALLGHLMSQ-RIKLSPLSMGMLLAAFNLMASLLMTLVNLLYL  378

Query  510   EPRATKVMFERMKIEKEEGRGKG--------------STTETEHGDGVTKDRsaagavvd  373
             EPRATKVMFERMK EKEEGRG+               STTET  G G             
Sbjct  379   EPRATKVMFERMKKEKEEGRGRAKEGQATGPSGRVVESTTETAAGRG-------------  425

Query  372   gstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTL  193
                G       A     + A  K   R + SE++     L++LNSYSS LNVVTLM LT 
Sbjct  426   PIGGGATTTEEATQEKLDDAVAKPEIRTKSSEIL-----LRRLNSYSSLLNVVTLMSLTG  480

Query  192   YLAHLAQRLHVAC  154
             +L  L QRLH  C
Sbjct  481   HLVCLGQRLHAVC  493



>ref|XP_006473884.1| PREDICTED: uncharacterized protein LOC102618133 [Citrus sinensis]
Length=524

 Score =   217 bits (553),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 207/570 (36%), Positives = 290/570 (51%), Gaps = 135/570 (24%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAP-----EKKQEDVIVKDGHRVVVVEYEKEHG--NTKV  1441
             MMN++A+ LV ++LA AGV SP+P       K+E +++K+GHRVVVVEY+ EHG  NTKV
Sbjct  1     MMNLVAICLVASSLAAAGVWSPSPSLEKENNKEEVIVMKEGHRVVVVEYD-EHGRHNTKV  59

Query  1440  LISPHE----------SSSEDV------AAEKGGEN----------------DGDGSYHR  1357
              ISP +          S + D+      AA     N                 G   Y +
Sbjct  60    SISPPDHDRYHIPKTASPASDIEQKIFSAATDALNNAEDTIKQASSLLPDIGQGSKPYDK  119

Query  1356  RTTAGELVCDAFGRCRRKIAGVFDRTK---------------------------------  1276
              T  GEL+CDA+G+C+ KIAG  ++ K                                 
Sbjct  120   GTGPGELICDAYGKCKHKIAGALEKAKGSLSGASHEVPAPHKGMAHEAKEVLSKTGHEFI  179

Query  1275  DTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVAD  1096
             DT  +M   A+ AV +  GK ++T  +K  +           A+ A  + LGK +DT   
Sbjct  180   DTKKQMDHEAKDAVRDAYGKAKETASEKAHR-----------AKEAAKDALGKAKDT---  225

Query  1095  KGNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKM  916
                 A++K +E +E A+DA+ +  +     A     + K+A          +  + S ++
Sbjct  226   ----ASEKAHEAKEAAKDALGKAKDTASQKAYEAKENLKDARAIGTTIRGDIARNVSEQV  281

Query  915   EHMKEELSDRakka---eekvgeakdavKHNILRSAG------RAFGMANLIGLAVAFGM  763
             E++ E + ++AK+A    E   +      +  LR  G         G+ NL+G + A+GM
Sbjct  282   ENVCESVEEKAKEARQGTEHAAKWIGQYSYGFLRYLGIPETLNALMGVINLLGFSTAYGM  341

Query  762   SVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSK  583
             SVWVTFISSYVLA ALPR QF + QSKIYPVYF+A+A SIG A LGH+       +L S 
Sbjct  342   SVWVTFISSYVLAGALPRHQFGMVQSKIYPVYFRAIACSIGWALLGHM------PQLFSS  395

Query  582   TTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGS-------TTETE  424
                 F GFNLL+S+LMVL+N +YLEP ATKVMFERMK+EKEEG+G+ S        TETE
Sbjct  396   KAGMFQGFNLLASILMVLINSIYLEPLATKVMFERMKVEKEEGKGRESQIGETSRVTETE  455

Query  423   HGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKL  244
              G   T+ R+   A V                        Q E   +++M++LS +LK L
Sbjct  456   QGTA-TERRAEGPAPVP-------------------VNPGQEEL--RTKMVKLSGRLKTL  493

Query  243   NSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             N+YSS LN++TLM LT +L +L Q LH  C
Sbjct  494   NTYSSVLNLITLMSLTWHLVYLGQSLHTTC  523



>gb|KDP35105.1| hypothetical protein JCGZ_10947 [Jatropha curcas]
Length=497

 Score =   213 bits (541),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 179/508 (35%), Positives = 261/508 (51%), Gaps = 78/508 (15%)
 Frame = -3

Query  1536  PAP-----EKKQEDVIVKDGHRVVVVE-YEKEHG--NTKVLISPHESSSEDV-----AAE  1396
             P+P      +K+EDVIVK+GHRV+VVE ++ E G  NTK+ ISP + S   V     A E
Sbjct  21    PSPTGKHQNQKEEDVIVKEGHRVIVVETFDDEGGQHNTKIRISPPQDSISSVGVIENAKE  80

Query  1395  K-----------------GGENDGDGSYHRRTTAG--ELVCDAFGRCRRKIAGVFDRTKD  1273
             K                  G     GSY  + T G  EL+CDAFG+CR KIA V D+ K 
Sbjct  81    KVKQAAHVLPNLGQGLSSSGYGPDSGSYQDKITTGPGELICDAFGKCRHKIAKVIDKAK-  139

Query  1272  TAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADK  1093
                E  E A G  +    ++     +   +          EA+  V +   K ++TV+ K
Sbjct  140   ---EKVEDAYGGATHQTKEIIHEAKEIAQEGIIRKKRIAHEAKDKVEDACEKTKETVSHK  196

Query  1092  GNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKME  913
              ++A + V +  E A+D+ T++ + ++ SA  +                    D ++ + 
Sbjct  197   AHEAKEVVEDAYEKAKDSGTQKAQEVKESAKES-------------------LDKAKDIA  237

Query  912   HMKEELSDRakkaeekvgeakdavKHNIL-RSAGRAF-------------GMANLIGLAV  775
                ++L         K    K     NI+  S  RAF             G+ NL+G ++
Sbjct  238   KDAKDLGKTIGVDSVKNVSEKTGQATNIVYNSLNRAFRFMGSQKGIHFLMGVINLLGFSI  297

Query  774   AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
             A+GM  WVTFISSYVLA AL RQQF + QSKIYPVYF+AM + I  A  GH++ + +   
Sbjct  298   AYGMCFWVTFISSYVLANALNRQQFGLVQSKIYPVYFRAMGFCIAVALFGHLIGRMKFS-  356

Query  594   LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK-GSTTETEHG  418
               +   + F   NLL S+L+VL+N LYLEP ATKVMF+++KIEKEEGRG+  STTE+   
Sbjct  357   -FTSKAEVFQAINLLLSVLLVLINALYLEPLATKVMFDKLKIEKEEGRGRETSTTESNRA  415

Query  417   DGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNS  238
             +     +         +        T ++A T++ E ++ E   +S ++R++ +LKKLNS
Sbjct  416   E-----QEPVADASPATALGSTATTTGSSAPTKVPENRKEEEI-RSRIVRVNERLKKLNS  469

Query  237   YSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
              SSFLN++ LM LT +L +L Q LH  C
Sbjct  470   CSSFLNILILMALTWHLVYLGQWLHGTC  497



>ref|XP_009781129.1| PREDICTED: uncharacterized protein LOC104230092 [Nicotiana sylvestris]
Length=490

 Score =   210 bits (534),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 193/518 (37%), Positives = 271/518 (52%), Gaps = 71/518 (14%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEKKQEDVIVKDGHRVVVVEYEKEHGNTKVLISPHES  1420
             MMN+ A+ LVLTTL TAGV SP  EKK+E VIVK+GHRVVVVEYE   GNTKV ISP E+
Sbjct  1     MMNIFAIFLVLTTLLTAGVFSPILEKKEE-VIVKEGHRVVVVEYEPNDGNTKVSISPQET  59

Query  1419  SSEDVAAEKGGEND-------------------------GDGSYHRRTTAGELVCDAFGR  1315
               +       G  D                          +G  H+  TA ELVCDAFG+
Sbjct  60    DQKATVGVVSGLKDRISDTAGTVKDKIKEAASFVEGGGKENGGIHK-PTARELVCDAFGK  118

Query  1314  CRRKIAGVFDRTKDTAP----EMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeA  1147
             C+ +IA     TKDT      E+ E A+  V     KV+DTVV K  +A+E A E +E+A
Sbjct  119   CKHRIASALGGTKDTLSGKMHEIEEDAKETVESAYEKVKDTVVGKAHEASEKASEVKEKA  178

Query  1146  RGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLE-----NLRasaagtassa  982
             + +V E + +V++   +   K   K  ++ +     ITE L+     N           A
Sbjct  179   KDSVKEIVEEVKEGAKETAEKVRGKAKDVAD-----ITETLKGDVKRNASEDLYYIEEKA  233

Query  981   keaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILRSAGRAFG  802
             K A     E AK ++ +  R  + ++    D +                   RS     G
Sbjct  234   KAAKDAVKEDAKRLKVEGKRDYQVIRRFFLDASAYIFSTKN----------FRSL---MG  280

Query  801   MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
             M + +G A+++G+ +WVTFISS +LA A+P+QQFA+ QSKIYP+YFK MAY + TAF GH
Sbjct  281   MIHFLGFALSYGVCIWVTFISSNILAGAMPKQQFAMVQSKIYPLYFKTMAYGVATAFFGH  340

Query  621   ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
              +SQ   +  ++   +   GF   +++ M L+NL  LEPRA+KVM ER+K+EKEEG+G+ 
Sbjct  341   FMSQRH-RYYYANRAETIQGFLFFATICMTLINLFVLEPRASKVMRERIKLEKEEGKGED  399

Query  441   STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAE-----KSE  277
               +      GV           D               ++E   + +RE +E     K +
Sbjct  400   IFSVEPSTSGV-----------DALIDPTGIKTGKQATSSEGPAETRRELSEEAVKMKPQ  448

Query  276   MMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLH  163
             + RLS+KLKKLN  SSF NV+TLM L+ +L +L+Q +H
Sbjct  449   VERLSQKLKKLNFVSSFFNVLTLMALSYHLVYLSQLVH  486



>gb|KFK41626.1| hypothetical protein AALP_AA2G152200 [Arabis alpina]
Length=470

 Score =   206 bits (525),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 174/489 (36%), Positives = 238/489 (49%), Gaps = 90/489 (18%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAA-------------EKGGE---  1384
             DVIVKDGHRVVVVEY+++   NT+V  SP  +   +                EK  E   
Sbjct  36    DVIVKDGHRVVVVEYDRDGKTNTRVSFSPPSADQGEEEQKEEKGGDLLRNVKEKAKETAS  95

Query  1383  ---NDGDGSY----------HRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGAR  1243
                N G G            H  TTAGE++CDAFG+CR+KIA V  + KD   +      
Sbjct  96    YLPNVGQGISQPKVTEESRDHHHTTAGEVICDAFGKCRQKIASVVGKGKDRTAKTV----  151

Query  1242  GAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYE  1063
             G   E +    DT  +K  +  + A E   + +  V+     V D VADK N A +KV  
Sbjct  152   GDAGETISDAGDTAAEKAYEVRDAAAEKAYDVKEKVARAARDVEDRVADKANFAKEKVTG  211

Query  1062  MEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRa  883
                  ++++  + ++ +      A   KE+    A ++K    +  R+  H   EL D+A
Sbjct  212   KAHDVKESVVHKAQDAKEKVKEKAHEVKESVAHKAHESKEAAKERVREKAH---ELKDKA  268

Query  882   kkaeekvgeakdavKHNILRSAGRAFG---MANLIGL---AVAFGMSVWVTFISSYVLAK  721
                 E V +      H     A +A     +A++IGL   A AFG  VWVTF+SSYVLA 
Sbjct  269   GHTYENVWDRVKTAAHGYGSMAAKALSPTKVASVIGLTAIAAAFGSCVWVTFVSSYVLAS  328

Query  720   ALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssl  541
              L RQQF V QSK+YPVYFKA++  I    LGH+LS+   ++L +  T+ + G NLL+S 
Sbjct  329   VLGRQQFGVVQSKLYPVYFKAISVGILVGLLGHVLSRR--RKLLTDATEMWQGVNLLASF  386

Query  540   lmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstg  361
              M+  N  ++EPRATK MFERMK EKEEGRG   T+E E                     
Sbjct  387   FMIEANKSFVEPRATKAMFERMKAEKEEGRGGERTSEQE---------------------  425

Query  360   avvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAH  181
                                      + ++  LS +L KLN+YSS+LN++TLM LT +  H
Sbjct  426   ------------------------VRRKLENLSERLSKLNTYSSWLNILTLMSLTWHFVH  461

Query  180   LAQRLHVAC  154
             L QRL  AC
Sbjct  462   LGQRLGTAC  470



>ref|XP_006434684.1| hypothetical protein CICLE_v10001073mg [Citrus clementina]
 gb|ESR47924.1| hypothetical protein CICLE_v10001073mg [Citrus clementina]
Length=465

 Score =   206 bits (524),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 183/507 (36%), Positives = 255/507 (50%), Gaps = 100/507 (20%)
 Frame = -3

Query  1503  VKDGHRVVVVEYEKEHG--NTKVLISPHE----------SSSEDV------AAEKGGEN-  1381
             +K+GHRVVVVEY+ EHG  NTKV ISP +          S + D+      AA     N 
Sbjct  1     MKEGHRVVVVEYD-EHGRHNTKVSISPPDHDRYHIPKTASPASDIEEKMFSAAADALNNA  59

Query  1380  ---------------DGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDT-------A  1267
                             G   Y +    GEL+CDA+G+C+ KIAG  ++ K +        
Sbjct  60    EDTIKQASSLLPDIGQGSKPYDKGAGPGELICDAYGKCKHKIAGALEKAKGSLSGASHEV  119

Query  1266  PEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGN  1087
             P   +G      E L K     +D   K        + EA+ AV +  GK ++T +DK  
Sbjct  120   PAPHKGTAHEAKEVLSKTGHDFIDTKKK-------MDCEAKDAVRDAYGKAKETASDKA-  171

Query  1086  KAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHM  907
                   +E +E A+DA+ +  E     A     + K+A          +  + S ++E++
Sbjct  172   ------HEAKEAAKDALGKAKETASQKAYEARENLKDARAIGTTIRGDIARNVSEQVENV  225

Query  906   KEELSDRakkaeekvgeakd---avKHNILRSAG------RAFGMANLIGLAVAFGMSVW  754
              E + ++AK+A +    A        +  LR  G         G+ NL+G + A+GMSVW
Sbjct  226   CESVEEKAKEARQGTEHAAKWIGQYSYGFLRYLGIPETLNALMGVINLLGFSTAYGMSVW  285

Query  753   VTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQ  574
             VTFISSYVLA ALPR QF + QSKIYPVYF+ +A SIG A LGH+       +L S    
Sbjct  286   VTFISSYVLAGALPRHQFGMVQSKIYPVYFRDIACSIGWALLGHM------PQLFSTKAG  339

Query  573   HflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGS-------TTETEHGD  415
              F GFNLL+S+LMVL+N +YLEP ATKVMFERMK+EKEEG+G+ S        TETE G 
Sbjct  340   MFQGFNLLASILMVLINSIYLEPLATKVMFERMKVEKEEGKGRESQIGETSRVTETEQGT  399

Query  414   GVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSY  235
                +                        A   ++  ++  R   ++M++LS +LK LN+Y
Sbjct  400   ATER-------------------RAEGPAPVPVSPGQEELR---TKMVKLSERLKTLNTY  437

Query  234   SSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             SS LN++TLM LT +L +L Q LH  C
Sbjct  438   SSILNLITLMSLTWHLVYLGQSLHTTC  464



>ref|XP_006302242.1| hypothetical protein CARUB_v10020268mg [Capsella rubella]
 gb|EOA35140.1| hypothetical protein CARUB_v10020268mg [Capsella rubella]
Length=458

 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 173/506 (34%), Positives = 243/506 (48%), Gaps = 124/506 (25%)
 Frame = -3

Query  1530  PEKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGE----------  1384
             P   + DVIVKDGHRVVVVEY+++   NT+V ISP  S+ ++   EKG            
Sbjct  30    PTASEGDVIVKDGHRVVVVEYDRDGKTNTRVSISP-PSADQEGEEEKGSSLFKHAKERVK  88

Query  1383  -------NDGDG--------------SYHRRTTAGELVCDAFGRCRRKIAGVF----DRT  1279
                    + G G              +    +TAGE++CDAFG+CR+KIA V     DRT
Sbjct  89    ETASYFPHVGQGISQPVITTEEETEEARDHHSTAGEVICDAFGKCRQKIASVVGRAKDRT  148

Query  1278  KDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVA  1099
              DT  E A     A +     V++TV        +   +    A+  V+E    VR +VA
Sbjct  149   ADTVGETASDVEDAAARKAHDVKETVTHAARDVEDEVADKAHYAKEKVTEKAHDVRQSVA  208

Query  1098  DKGNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRK  919
              K + A +KV +     +D +T++    R  A                       D  R+
Sbjct  209   HKAHDAKEKVTDKAHDVKDTVTQKAYETRERAK----------------------DRVRE  246

Query  918   MEH-MKEELSDRakkaeekvgeakdavKHNILRSAGRAFG-------MANLIGL---AVA  772
               H +K+ ++ +++ A  +V         N LR  G A         +A+++GL   + A
Sbjct  247   KAHDLKDSVAHKSQNAWVRVK--------NALREFGTAAAGMLSPTKIASVVGLTAISAA  298

Query  771   FGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRL  592
             FG  VWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I     GH+LS+   ++L
Sbjct  299   FGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLFGHVLSRR--RKL  356

Query  591   HSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDG  412
              +  T+ + G NLL+S  M+  N  ++EPRATK MFERMK EKEEGRG   T+       
Sbjct  357   LTDATEMWQGVNLLASFFMIEANKSFVEPRATKAMFERMKAEKEEGRGGERTS-------  409

Query  411   VTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYS  232
                                             +E++ R + EK     LS +L KLN+YS
Sbjct  410   --------------------------------SEQELRRKLEK-----LSERLSKLNTYS  432

Query  231   SFLNVVTLMCLTLYLAHLAQRLHVAC  154
             S+LN++TLM LT +  +L QRL  AC
Sbjct  433   SWLNILTLMSLTWHFVYLGQRLGAAC  458



>ref|XP_010063755.1| PREDICTED: uncharacterized protein LOC104450764 [Eucalyptus grandis]
 gb|KCW71010.1| hypothetical protein EUGRSUZ_F04115 [Eucalyptus grandis]
Length=469

 Score =   204 bits (518),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 198/536 (37%), Positives = 272/536 (51%), Gaps = 121/536 (23%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEK-----KQEDVIVKDGHRVVVVEYEKE-HGNTKVL  1438
             MMN +A+ LV+T+ A AGV SPAPEK     K EDVI+K+GHRVVVVEY+++   NTKV 
Sbjct  1     MMNAVAICLVVTSFAAAGVWSPAPEKQGSHRKDEDVILKEGHRVVVVEYDQDGQPNTKVS  60

Query  1437  ISPH---------------------------------ESSSEDVAAEKGGENDGDGSYHR  1357
             ISP                                  + ++  VA E+    + DG Y R
Sbjct  61    ISPEHDHIPIKPASVSNLEGDLYRGAKDVLERSKDKVKEAASSVAPER---KEDDGGY-R  116

Query  1356  RTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEM-------AEGARGAVSEGLGKVRDTVV  1198
                A EL+CDAFG+CR +IA    + K+   E        A  A+ A  E L +  + V 
Sbjct  117   YIGAKELICDAFGKCRHRIASGLGKAKEEVTEKVYEVEEDARQAKDAAEEKLRRAGEAVA  176

Query  1197  DKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITER---  1027
              K                    E   K R+   + G K  ++ +E   GA     E    
Sbjct  177   RKAH------------------EAGEKAREAAHEAGEKT-RETFESTRGAMQHAKEEGKT  217

Query  1026  -LENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeak  850
              +E+++ + +  A +AKE AKE AE+AK    D   ++  +KE +               
Sbjct  218   MVEDVQRNVSEAAGAAKERAKEKAEEAKEAARDVGSRLHRLKEAV---------------  262

Query  849   davKHNILRSAGRAF-GMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYP  673
                +H   R  GR   G+ +L+G A A+G  VWVTF+SSYVLA A+PRQQF + QSK+YP
Sbjct  263   --RRHVASRFDGRTLAGLVHLLGFATAYGTCVWVTFVSSYVLAGAMPRQQFGMVQSKVYP  320

Query  672   VYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATK  493
             VYF+AM  SI  + LGH+L Q   + L +   +   G NLL+SL +VL N+LYLEPRATK
Sbjct  321   VYFRAMFTSIALSLLGHLLGQG--RHLFANKPEMLQGLNLLASLPLVLANMLYLEPRATK  378

Query  492   VMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIA  313
             +MFE+MK+EKEEGRG+  T  T     VT+ R                         E A
Sbjct  379   IMFEKMKLEKEEGRGREPTETTR----VTEPR---------------------PTPGETA  413

Query  312   EKKQRER---AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
                Q +R   A ++ + RL+ +L+KLNS+SS LN+ TLM LT +L +LAQR+   C
Sbjct  414   ALVQEDREGDALRARVTRLNERLRKLNSHSSLLNIATLMALTWHLVYLAQRISTPC  469



>ref|XP_006356548.1| PREDICTED: uncharacterized protein LOC102585078 [Solanum tuberosum]
Length=443

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 184/500 (37%), Positives = 260/500 (52%), Gaps = 82/500 (16%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEKKQEDVIVKDGHRVVVVEYEKEHGNTKVLISPHES  1420
             MMNV A+SLVLTTL TAGV SP PEKK +DVIVKDGHRVVVVEYE   G TKV ISP E+
Sbjct  1     MMNVFAISLVLTTLVTAGVFSPNPEKK-DDVIVKDGHRVVVVEYEPNDGQTKVSISPPET  59

Query  1419  ---------SSEDV----AAEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRT  1279
                      S  DV    + +     +  G +H    A ELVCDA+G+C+ KIA      
Sbjct  60    EHKEKTGHVSVSDVKNKLSEKAEEIEEKIGRFHG-MNARELVCDAYGKCKHKIASAL---  115

Query  1278  KDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVA  1099
                     EG + +V+E + ++++                         EG  KV     
Sbjct  116   --------EGTKDSVTEKMHEIQEDA----------------------KEGFEKVTGKAH  145

Query  1098  DKGNKAAKKVYEMEEGARDAITE-RLENLRasaagtassakeaakeaaekaKGMRTDASR  922
             +      KKV E+++GA++   + +++ +  ++       K A+++     + ++ DA R
Sbjct  146   EAKETVGKKVDEVKQGAKETAEKVKIKAVDTTSTLKNHLMKNASEDLDLIEEKVKEDAQR  205

Query  921   -KMEHMKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMANLIGLAVAFGMSVWVTF  745
              K+E  ++    R   +                +S     G+ +L+G A+++G+SVW+TF
Sbjct  206   LKVEVKRDYHVGRRFLSAYIFSA----------KSFRSLMGIIHLLGFALSYGVSVWMTF  255

Query  744   ISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHfl  565
             ISS +LA+ALP+QQFA+ QSKIYP YFK M Y I TAFLGH+LS  Q    ++  T+   
Sbjct  256   ISSNILARALPKQQFAMVQSKIYPAYFKTMYYGIATAFLGHMLS--QMLPYYANRTEKIQ  313

Query  564   gfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG------STTETEHGDGVTK  403
             G   L+   M L N  YLEPRATKVM ERMKIEKEEG+GK       ST+  +  +  T 
Sbjct  314   GLIFLAIFSMTLFNCFYLEPRATKVMRERMKIEKEEGKGKDVFNVEPSTSSVDAFEDPTG  373

Query  402   DRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFL  223
              +                         E++E+  R    K ++ RLS++LKK N  SS L
Sbjct  374   IK-----------TGKSTTHEPLETQQELSEETAR---LKPQVERLSQRLKKFNVISSLL  419

Query  222   NVVTLMCLTLYLAHLAQRLH  163
             N +TLM L+ +L +L+Q LH
Sbjct  420   NSLTLMGLSYHLVYLSQLLH  439



>ref|NP_177355.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG51136.1|AC069273_7 hypothetical protein [Arabidopsis thaliana]
 gb|AEE35273.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
Length=480

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 167/507 (33%), Positives = 237/507 (47%), Gaps = 118/507 (23%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGENDGDGSYHRRT-----  1351
             +VIVKDGH VVVVEY+++   NT+V ISP    S D   EK  E +   S  R       
Sbjct  38    EVIVKDGHHVVVVEYDRDGKTNTRVSISP---PSADQGEEKENEVEMGTSMFRNVKEKAK  94

Query  1350  ---------------------------TAGELVCDAFGRCRRKIAGVF----DRTKDTAP  1264
                                        TAGE++CDAFG+CR+KIA V     DRT D+  
Sbjct  95    ETASYLPHVGQGISQPVMTDEARDHHATAGEVICDAFGKCRQKIASVVGRAKDRTVDSVG  154

Query  1263  EMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNK  1084
             E A   R A +     V++TV        +   +  + A+G V+E     ++ VA K + 
Sbjct  155   ETASDVREAAAHKAHDVKETVTHAARDVEDTVADQAQYAKGRVTEKAHDPKEGVAHKAHD  214

Query  1083  AAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMK  904
             A + V +    A++++ ++  + +      A                ++   ++K    K
Sbjct  215   AKESVADKAHDAKESVAQKAHDAKEKVREKAH--------------DVKETVAQKAHESK  260

Query  903   EELSDRakkaeekvgeakdavKHNI---LRSAGRAFGMAN--------------LIGLAV  775
             E   DR ++  +++ E       N    +++  R FG A               L G+A 
Sbjct  261   ERAKDRVREKAQELKETATHKSKNAWERVKNGAREFGSATAATLSPTKVASIVGLTGIAA  320

Query  774   AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
             AFG SVWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I     GH+LS+   ++
Sbjct  321   AFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLFGHVLSRR--RK  378

Query  594   LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGD  415
             L +  T+ + G NLLSS  M+  N  ++EPRATK MFERMK EKEEGRG   T+E E   
Sbjct  379   LLTDATEMWQGVNLLSSFFMIEANKSFVEPRATKAMFERMKAEKEEGRGGERTSEQE---  435

Query  414   GVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSY  235
                                                        + ++ +LS +L KLN+Y
Sbjct  436   ------------------------------------------LRRKLEQLSERLSKLNTY  453

Query  234   SSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             SS+LN++TLM LT +  +L QRL  AC
Sbjct  454   SSWLNILTLMSLTWHFVYLGQRLGAAC  480



>gb|AAO42139.1| unknown protein [Arabidopsis thaliana]
Length=480

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 166/507 (33%), Positives = 237/507 (47%), Gaps = 118/507 (23%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGENDGDGSYHRRT-----  1351
             +VIVKDGH VVVVEY+++   NT+V ISP    S D   EK  E +   S  R       
Sbjct  38    EVIVKDGHHVVVVEYDRDGKTNTRVSISP---PSADQGEEKENEVEMGTSMFRNVKEKAK  94

Query  1350  ---------------------------TAGELVCDAFGRCRRKIAGVF----DRTKDTAP  1264
                                        TAGE++CDAFG+CR+KIA V     DRT D+  
Sbjct  95    ETASYLPHVGQGISQPVMTDEARDHHATAGEVICDAFGKCRQKIASVVGRAKDRTVDSVG  154

Query  1263  EMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNK  1084
             E A   R A +     V++TV        +   +  + A+G V+E     ++ VA K + 
Sbjct  155   ETASDVREAAAHKAHDVKETVTHAARDVEDTVADQAQYAKGRVTEKAHDPKEGVAHKAHD  214

Query  1083  AAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMK  904
             A + V +    A++++ ++  + +      A                ++   ++K    K
Sbjct  215   AKESVADKAHDAKESVAQKAHDAKEKVREKAH--------------DVKETVAQKAHESK  260

Query  903   EELSDRakkaeekvgeakdavKHNI---LRSAGRAFGMAN--------------LIGLAV  775
             E   DR ++  +++ E       N    +++  R FG A               L G+A 
Sbjct  261   ERAKDRVREKAQELKETATHKSKNAWERVKNGAREFGSATAATLSPTKVASIVGLTGIAA  320

Query  774   AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
             AFG SVWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I     GH+LS+   ++
Sbjct  321   AFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLFGHVLSRR--RK  378

Query  594   LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGD  415
             L +  T+ + G N+LSS  M+  N  ++EPRATK MFERMK EKEEGRG   T+E E   
Sbjct  379   LLTDATEMWQGVNILSSFFMIEANKSFVEPRATKAMFERMKAEKEEGRGGERTSEQE---  435

Query  414   GVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSY  235
                                                        + ++ +LS +L KLN+Y
Sbjct  436   ------------------------------------------LRRKLEQLSERLSKLNTY  453

Query  234   SSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             SS+LN++TLM LT +  +L QRL  AC
Sbjct  454   SSWLNILTLMSLTWHFVYLGQRLGAAC  480



>ref|XP_002887412.1| hypothetical protein ARALYDRAFT_476340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63671.1| hypothetical protein ARALYDRAFT_476340 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 166/504 (33%), Positives = 242/504 (48%), Gaps = 124/504 (25%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAA--------------EKGGEND  1378
             DVIVKDGHRVVVVEY+++   NT+V ISP  +   +                 EK  E  
Sbjct  37    DVIVKDGHRVVVVEYDRDGKTNTRVSISPPSADQGEEKENEEEKGTSLIRNVKEKAKETA  96

Query  1377  ------GDG---------SYHRRTTAGELVCDAFGRCRRKIAGVF----DRTKDTAPEMA  1255
                   G G         +     TAGE++CDAFG+CR+KIA V     DRT D+  E A
Sbjct  97    SYLPHVGQGISQPVMTEEARDHHATAGEVICDAFGKCRQKIASVVGRAKDRTADSVGETA  156

Query  1254  EGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAK  1075
                  A ++    V++TV        +   +  + A+G VSE    V+++VA K + A +
Sbjct  157   SDVGEAAAQKAHDVKETVTHAARDVEDRVADQAQYAKGKVSEKAQDVKESVAHKAHDAKE  216

Query  1074  KVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEEL  895
              V      A++ + E+  +++ +                          ++K    KE  
Sbjct  217   SVAHKAHDAKEKVREKAHDVKET-------------------------VAQKAHESKERA  251

Query  894   SDRakkaeekvgeakdavKHNI---LRSAGRAFG-----------MANLIGL---AVAFG  766
              DR +   +++ E       N+   +++  R FG           +A+++GL   A AFG
Sbjct  252   KDRVRDKAQELKETAAHKSKNVWERVKNVAREFGSVTAATLSPTKVASILGLTAIAAAFG  311

Query  765   MSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHS  586
              +VWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I     GH+LS+   ++L +
Sbjct  312   TTVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLFGHVLSRR--RKLLT  369

Query  585   KTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVT  406
               T+ + G NLLS+  M+  N  ++EPRATK MFERMK EKEEGRG+ ++          
Sbjct  370   DATEMWQGVNLLSAFFMIESNKSFVEPRATKAMFERMKAEKEEGRGERTS----------  419

Query  405   KDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSF  226
                                            E++ R + E+     LS +L KLN+YSS+
Sbjct  420   -------------------------------EQELRRKLEQ-----LSERLSKLNTYSSW  443

Query  225   LNVVTLMCLTLYLAHLAQRLHVAC  154
             LN++TLM LT +  +L QRL  AC
Sbjct  444   LNILTLMSLTWHFVYLGQRLGTAC  467



>ref|XP_010322771.1| PREDICTED: uncharacterized protein LOC101255207 [Solanum lycopersicum]
Length=447

 Score =   200 bits (509),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 178/492 (36%), Positives = 259/492 (53%), Gaps = 61/492 (12%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEKKQEDVIVKDGHRVVVVEYE-KEHGNTKVLISP--  1429
             MMNV A+SLVLT L TAGV SP PEKK +DVIVK+GHRVVVVEYE  +HG TKV ISP  
Sbjct  1     MMNVFAISLVLTALVTAGVFSPNPEKK-DDVIVKEGHRVVVVEYEPNDHGQTKVSISPPE  59

Query  1428  --------HESSSEDVAAEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKD  1273
                     H S S+ ++A+  G  +  G +H    A ELVCDA+G+C+ KIA   + TK+
Sbjct  60    TEHKAKAEHVSVSDKISAKAEGVEEKIGGFHG-LNARELVCDAYGKCKHKIASALEGTKE  118

Query  1272  TAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADK  1093
             +  E     +    EG  KV                       G   E   K ++TV   
Sbjct  119   SVSEKMHEIQEDAKEGFEKVT----------------------GKAHEATEKAKETVG--  154

Query  1092  GNKAAKKVYEMEEGARDAITE-RLENLRasaagtassakeaakeaaekaKGMRTDA-SRK  919
                  KKV E+++GA++   + +++ +  +        K A+++     + ++ DA S K
Sbjct  155   -----KKVDEVKQGAKETAEKVKIKAVDTTNTLKRHLLKNASEDLDLIEEKVKEDAESLK  209

Query  918   MEHMKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMANLIGLAVAFGMSVWVTFIS  739
             +E +++    R   ++            +++       G+ +L+G A+++G+S W+TF+S
Sbjct  210   VEGIRDYNVGRRFFSDVSAYIFSAESFRSLM-------GIFHLMGFALSYGVSFWMTFVS  262

Query  738   SYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgf  559
             S V+A+ALP+QQFA+AQSKIYP YFK + Y I +AFLGH+ SQN     ++   +   G 
Sbjct  263   SNVMARALPKQQFAMAQSKIYPAYFKTVCYGIASAFLGHMWSQNPP--YYANIGETIQGL  320

Query  558   nllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagav  379
               +  L   L N  YLEPRA+K M ER+K+EKEEG+G+           V   +   G  
Sbjct  321   IFVLILSATLFNCFYLEPRASKAMRERIKLEKEEGKGRDVFDVEPSTSSVDAFKDPTGVD  380

Query  378   vdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCL  199
             +  +T                 E  Q+    K E+ RLS +LKKLN  SS LN+ TLM L
Sbjct  381   IGKTTTHEPLENQR--------ELSQQTAKLKPEVERLSLRLKKLNVISSVLNIFTLMGL  432

Query  198   TLYLAHLAQRLH  163
             + +L +L+Q LH
Sbjct  433   SYHLVYLSQLLH  444



>ref|XP_010415942.1| PREDICTED: uncharacterized protein LOC104701885 isoform X2 [Camelina 
sativa]
Length=462

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 187/540 (35%), Positives = 251/540 (46%), Gaps = 136/540 (25%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPE-------KKQEDVIVKDGHRVVVVEYEKE-HGNTK  1444
             MMN+LALSLVL+TL  A V SP+P          Q D+IVKDGHRVVVVEY+++   NT+
Sbjct  1     MMNLLALSLVLSTLLAAEVWSPSPAMTTNHGAASQGDIIVKDGHRVVVVEYDRDGKTNTR  60

Query  1443  VLISPHESSSEDVAAE--KGG-------ENDGDGSYH-----------------------  1360
             V ISP  +   +   E  KGG       E   + + H                       
Sbjct  61    VSISPPSADQGEGDNEEGKGGSLFKNAKERVKETASHLPHVGQGISQPVIETKEETEEVR  120

Query  1359  -RRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSK  1183
                 TAGEL+CDAFG+CR+KIA V  R KD                  +  DTV +  S 
Sbjct  121   DHHATAGELICDAFGKCRQKIASVVGRAKD------------------RTADTVGETSSD  162

Query  1182  aaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasa  1003
               + A     + +  V+     + DTVADK   A +KV E     R+++     + +   
Sbjct  163   VEDAAGRKAHDMKETVTHAARDLEDTVADKARYAKEKVTEKAHDVRESVGHIAHDAKDKV  222

Query  1002  agtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNI--  829
                A                ++   ++K    KE   DR +    ++ E       N   
Sbjct  223   RDKAYD--------------VKETVAQKAHESKERAKDRVRGKAHELKETVAHKSQNAWE  268

Query  828   -LRSAGRAFGMA--------------NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAV  694
              +++  R FG A               L G+A AFG  VWVTF+SSYVLA  L RQQF V
Sbjct  269   RVKNGVREFGSAAVGALSPTKVASVVGLTGIAAAFGTCVWVTFVSSYVLASVLGRQQFGV  328

Query  693   AQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnlly  514
              QSK+YPVYFKA +  I    LGH+LS+   ++L +  T+ + G NLLSS  M+  N  +
Sbjct  329   VQSKLYPVYFKATSVGILVGLLGHVLSRR--RKLLTDATEMWQGVNLLSSFFMIEANKSF  386

Query  513   LEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaa  334
             +EPRATK MFERMK EKEEGRG   T+                                 
Sbjct  387   VEPRATKAMFERMKAEKEEGRGGERTS---------------------------------  413

Query  333   taaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
                   +E++ R + EK     LS +L KLN+YSS+LN++TLM LT +  +L QRL  AC
Sbjct  414   ------SEQELRRKLEK-----LSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGTAC  462



>ref|XP_010415941.1| PREDICTED: uncharacterized protein LOC104701885 isoform X1 [Camelina 
sativa]
Length=462

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 187/540 (35%), Positives = 251/540 (46%), Gaps = 136/540 (25%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPE-------KKQEDVIVKDGHRVVVVEYEKE-HGNTK  1444
             MMN+LALSLVL+TL  A V SP+P          Q D+IVKDGHRVVVVEY+++   NT+
Sbjct  1     MMNLLALSLVLSTLLAAEVWSPSPAMTTNHGAASQGDIIVKDGHRVVVVEYDRDGKTNTR  60

Query  1443  VLISPHESSSEDVAAE--KGG-------ENDGDGSYH-----------------------  1360
             V ISP  +   +   E  KGG       E   + + H                       
Sbjct  61    VSISPPSADQGEGDNEEGKGGSLFKNAKERVKETASHLPHVGQGISQPVIETKEETEEVR  120

Query  1359  -RRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSK  1183
                 TAGEL+CDAFG+CR+KIA V  R KD                  +  DTV +  S 
Sbjct  121   DHHATAGELICDAFGKCRQKIASVVGRAKD------------------RTADTVGETSSD  162

Query  1182  aaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasa  1003
               + A     + +  V+     + DTVADK   A +KV E     R+++     + +   
Sbjct  163   VEDAAGRKAHDMKETVTHAARDLEDTVADKARYAKEKVTEKAHDVRESVGHIAHDAKDKV  222

Query  1002  agtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNI--  829
                A                ++   ++K    KE   DR +    ++ E       N   
Sbjct  223   RDKAYD--------------VKETVAQKAHESKERAKDRVRGKAHELKETVAHKSQNAWE  268

Query  828   -LRSAGRAFGMA--------------NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAV  694
              +++  R FG A               L G+A AFG  VWVTF+SSYVLA  L RQQF V
Sbjct  269   RVKNGVREFGSAAVGALSPTKVASVVGLTGIAAAFGTCVWVTFVSSYVLASVLGRQQFGV  328

Query  693   AQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnlly  514
              QSK+YPVYFKA +  I    LGH+LS+   ++L +  T+ + G NLLSS  M+  N  +
Sbjct  329   VQSKLYPVYFKATSVGILVGLLGHVLSRR--RKLLTDATEMWQGVNLLSSFFMIEANKSF  386

Query  513   LEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaa  334
             +EPRATK MFERMK EKEEGRG   T+                                 
Sbjct  387   VEPRATKAMFERMKAEKEEGRGGERTS---------------------------------  413

Query  333   taaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
                   +E++ R + EK     LS +L KLN+YSS+LN++TLM LT +  +L QRL  AC
Sbjct  414   ------SEQELRRKLEK-----LSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGAAC  462



>ref|XP_010428064.1| PREDICTED: uncharacterized protein LOC104712790 [Camelina sativa]
Length=462

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 174/511 (34%), Positives = 233/511 (46%), Gaps = 143/511 (28%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSE---DVAAEKGG--------------  1387
             DVIVKDGHRVVVVEY+++   NT+V ISP  S+ E   D    KGG              
Sbjct  37    DVIVKDGHRVVVVEYDRDGKTNTRVSISP-PSADEGEGDNEEGKGGSLFKNAKERVKETA  95

Query  1386  -------------------ENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVF----DRTK  1276
                                E +    +H   TAGEL+CDAFG+CR+KIA V     DRT 
Sbjct  96    SHLPHVGQGISQPLVETKEETEEAPDHH--ATAGELICDAFGKCRQKIASVVGRAKDRTA  153

Query  1275  DTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVAD  1096
             DT  E      GA       V++TV                      +     V DTVA 
Sbjct  154   DTVGETVSDVEGAAGRKAHDVKETV----------------------THAARDVEDTVAG  191

Query  1095  KGNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKM  916
             K   A +KV E     R+++  +  + +      A                ++   ++K 
Sbjct  192   KARYAKEKVTEKAHDVRESVAHKAHDAKDKVRDKAYD--------------VKETVAQKA  237

Query  915   EHMKEELSDRakkaeekvgeakdavKHNI---LRSAGRAFG-----------MANLIGL-  781
                KE   DR +    ++ E       N    +++  R FG           +A+++GL 
Sbjct  238   HESKERAKDRVRGKAHELKETVAHKSQNAWERVKNGVREFGSAAVGWLSPTKVASVMGLT  297

Query  780   --AVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQN  607
               A AFG  VWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I    LGH+LS+ 
Sbjct  298   AIAAAFGTCVWVTFVSSYVLASVLRRQQFGVVQSKLYPVYFKATSVGILVGLLGHVLSRR  357

Query  606   QTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTET  427
               ++L +  T+ + G NLLSS  M+  N  ++EPRATK MFERMK EKEEGRG   T+  
Sbjct  358   --RKLLTDATEMWQGVNLLSSFFMIEANKSFVEPRATKAMFERMKAEKEEGRGGERTS--  413

Query  426   EHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKK  247
                                                  +E++ R + EK     LS +L K
Sbjct  414   -------------------------------------SEQELRRKLEK-----LSERLSK  431

Query  246   LNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             LN+YSS+LN++TLM LT +  +L QRL  AC
Sbjct  432   LNTYSSWLNILTLMSLTWHFVYLGQRLGTAC  462



>ref|XP_009362438.1| PREDICTED: uncharacterized protein LOC103952558 [Pyrus x bretschneideri]
Length=535

 Score =   196 bits (497),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 178/514 (35%), Positives = 257/514 (50%), Gaps = 100/514 (19%)
 Frame = -3

Query  1515  EDVIVKDGHRVVVVEYEKEHGN--TKVLISPH---------------------------E  1423
             ++VIVK+GHRVVVVEY+ EHG+  TKV ISP                            E
Sbjct  61    QEVIVKNGHRVVVVEYD-EHGHHKTKVSISPEHGHPPRRESSSLSENEVSSPSKISRAFE  119

Query  1422  SSSEDVA-AEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGA  1246
             +S E++  A  G  N G G +    +  EL+CDA+G+C+ KIA   +  K+   E A GA
Sbjct  120   NSMENIKEAASGLANSGQG-HGEGHSPKELMCDAYGKCKHKIASAIETKKEICKETAHGA  178

Query  1245  RGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVY  1066
             +    E   KV +     G                AV     + +DTV+DK        +
Sbjct  179   K----EAAHKVGEAAHRVGE---------------AVENVYERAKDTVSDKA-------H  212

Query  1065  EMEEGARDAITERLEN-----------LRasaagtassakeaakeaaekaKGMRTDASRK  919
             E+EE ARD  TE+ +N           L   A     +A+E A +     + +++D + K
Sbjct  213   EVEETARDP-TEKAKNASKTAKDMGDTLAEKAKEAKETAEETAFKVKAGTEELKSDLAEK  271

Query  918   MEHMKEELSDRakkaeekvgeakdavKHNILRSAGRAF------------------GMAN  793
              +   EE + + K   E++        H  LR   R F                   +A+
Sbjct  272   AKETAEEAAGKVKAGAEEIKSGTQKRLHQ-LRDKEREFWYGAFRSIASGDLLEGLMSVAH  330

Query  792   LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILS  613
             L GLA A+GM +W+TF SS+VLA +LP QQF + QSKIY VYFKAMAYS+G A LGH L 
Sbjct  331   LFGLATAYGMCMWITFASSHVLAGSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGH-LW  389

Query  612   QNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTT  433
             ++++     K+      +NL+ +L M+L N++YLEPR+TKVMFERMKIEKEEGRG+    
Sbjct  390   RHRSSLFRGKSADMLQNYNLIVALSMILFNMMYLEPRSTKVMFERMKIEKEEGRGR----  445

Query  432   ETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSR-K  256
                  + V  D   +            +G  + T   +++ ++Q+      E +   R +
Sbjct  446   -----ERVHVDARISREAGQQQQRTTTEGEPSITTLPQLSRREQQVVEPDIERLNEMRER  500

Query  255   LKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             LKKLN+YSSFLN+ +LM L+ +L +LAQ L  +C
Sbjct  501   LKKLNTYSSFLNIASLMALSWHLVYLAQHLPCSC  534



>ref|XP_007131293.1| hypothetical protein PHAVU_011G001700g [Phaseolus vulgaris]
 gb|ESW03287.1| hypothetical protein PHAVU_011G001700g [Phaseolus vulgaris]
Length=412

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 171/506 (34%), Positives = 242/506 (48%), Gaps = 118/506 (23%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAP---EKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLIS  1432
             MMNVLA++L  T+LA + + SP P    K+  + IVK+GHRVVVVEY+++ H NTK+ IS
Sbjct  1     MMNVLAVTLFFTSLAASAIFSPPPPTHHKQGANTIVKEGHRVVVVEYDQDGHHNTKISIS  60

Query  1431  PHESSSED--VAAEKGGE----------NDGDGSYHRRTTA-----GELVCDAFGRCRRK  1303
             P + +        E G +          N G G    +  A      EL+CDA+G+C+  
Sbjct  61    PDQPTHHHHHQVPENGHDRIREAASVLPNLGQGISQPQDAAFLHAPKELICDAYGKCKH-  119

Query  1302  IAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGL  1123
                   R  D   +  E A+    E L K ++     G                 V++ L
Sbjct  120   ------RVADAMEKTKEKAQ----EVLQKKKEVARHVGDN---------------VADAL  154

Query  1122  GKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKG  943
              + +++V DK     +   +  E A++ +   +   R                       
Sbjct  155   KETKESVHDKARDVHEYAQDTVETAKNHVNSNVSEAR-----------------------  191

Query  942   MRTDASRKMEH-MKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMANLIGLAVAFG  766
                D  R+++H +K                         L S     G+A+L+G A ++G
Sbjct  192   ---DYLRRLKHTLKLSFGS--------------------LESLNSVMGVAHLLGFATSYG  228

Query  765   MSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHS  586
             M VWVTFISSYV ++A+ R QFAV QSKIYPVYF+AMAYS G A  GH+     T  L S
Sbjct  229   MCVWVTFISSYVQSRAMARHQFAVMQSKIYPVYFRAMAYSTGVALFGHVFGNTNT--LLS  286

Query  585   KTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTET-EHG-DG  412
               +     +NLL+SL  +  N LYLEPRATK+MFER+KIEKEEGRG+   T + E G  G
Sbjct  287   NKSHALQTYNLLASLATLFFNSLYLEPRATKLMFERIKIEKEEGRGREDVTVSGERGRTG  346

Query  411   VTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYS  232
             V + +          +                        A +S +++L+ KLKKLNSYS
Sbjct  347   VREPQRTPDGTGPSISTD--------------------HDAVRSRIIKLNDKLKKLNSYS  386

Query  231   SFLNVVTLMCLTLYLAHLAQRLHVAC  154
             S LN++ L+ LT +L +LAQRLH  C
Sbjct  387   SVLNILNLISLTWHLVYLAQRLHRTC  412



>ref|XP_009765498.1| PREDICTED: uncharacterized protein LOC104217042 [Nicotiana sylvestris]
Length=475

 Score =   191 bits (484),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 155/223 (70%), Gaps = 9/223 (4%)
 Frame = -3

Query  828  LRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            LR+  R   + + +G AVA+GM +WVTF+SSYVLA+ALPRQQFA+ QSKIYPVYFKAMAY
Sbjct  260  LRTVMR---LVHFLGFAVAYGMCIWVTFVSSYVLARALPRQQFALVQSKIYPVYFKAMAY  316

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
             +G AF+GH+LSQ   +RLH+ + +   GFNLLSS+ M+LVNL+YLEPRATKVMFER+K+
Sbjct  317  CVGAAFVGHMLSQK--RRLHTNSAEVVQGFNLLSSIAMLLVNLIYLEPRATKVMFERLKL  374

Query  468  EKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERA  289
            EKEEGRG+       +  GV  D          ++       T  +   E++   + E  
Sbjct  375  EKEEGRGRDIFNVEPNSRGV--DSVLDPTGTKTTSQKTAAATTTTSKPAEVS--PEVEAV  430

Query  288  EKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV  160
             K +++RLS+KLKKLNSYSSFLNV+TLM L+ +L HL Q + +
Sbjct  431  VKPQVVRLSQKLKKLNSYSSFLNVLTLMALSHHLVHLTQLVDI  473


 Score = 80.9 bits (198),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 111/219 (51%), Gaps = 54/219 (25%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPE--KKQEDVIVKDGHRVVVVEYEKEHGNTKVLISPH  1426
             MMN LA+SLVLTTL TAG  +P PE  KKQ+DVI+K+G RVVVVE++KE G TKVLISP 
Sbjct  1     MMNFLAISLVLTTLVTAGFFNPNPENNKKQDDVILKEGPRVVVVEFDKEDG-TKVLISPQ  59

Query  1425  E------------SSSEDVAAEKGGE-----------------NDGDGSYHRRTTAGELV  1333
             +            S  +D   EK  E                 N  +G    + +A ++V
Sbjct  60    QEAEIPKGKSGYVSDLKDKLYEKAEEASSVLPNIGQGISSPYVNQENGEIDTKPSAKDVV  119

Query  1332  CDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaee  1153
             CDAFG+C+ KIA  F +TK    E A      V E         V++G+K          
Sbjct  120   CDAFGKCKEKIATAFGKTKAKVSEKAHETVDKVDE---------VEEGAK----------  160

Query  1152  eARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAI  1036
                GA  +    V+D  ++  +KA +KV E++E  +D I
Sbjct  161   ---GAAEKVKESVKDAYSEATDKAKEKVDEVKEKTKDLI  196



>emb|CDY03662.1| BnaA02g15750D [Brassica napus]
Length=462

 Score =   189 bits (480),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 179/512 (35%), Positives = 249/512 (49%), Gaps = 141/512 (28%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISP-------------HESSSEDVAAEKGGE-  1384
             ++DVIVKDGHRVVVVEY+++   NT+V ISP              E++    A EK  E 
Sbjct  35    EDDVIVKDGHRVVVVEYDRDGKTNTRVSISPPSADEGEQKQEVEKETTLFRHAKEKAKET  94

Query  1383  -----NDGDG---------SYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGA  1246
                  N G G         +     TAGE++CDAFG+CR+KIA V  R KD A +     
Sbjct  95    ASYFPNVGQGISQPVVTEEARDHHATAGEVICDAFGKCRQKIASVVGRAKDRASDRV---  151

Query  1245  RGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKV-  1069
                         D V +K S A + A     + +  V+ G   + +TV DK   A +KV 
Sbjct  152   ------------DDVGEKISDAGDAAAGKAYDVKETVARGARDIEETVTDKAGYAKEKVG  199

Query  1068  ---YEMEEG-------ARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRK  919
                ++++EG        RD +T++  N++ +                     M   A   
Sbjct  200   ETAHDVKEGMAHKAHDVRDKVTKKAHNVKET---------------------MAHKAHES  238

Query  918   MEHMKEELSDRakkaeekvgeakdavKHNI---LRSAGRAFG-----------MANLIGL  781
              E +K+E+ D+A++ +EK         HN    ++ A R  G           +A+++GL
Sbjct  239   KERVKDEVRDKARELKEKAAHKS----HNAWERVKLAARGLGSATAKALSPTKVASVVGL  294

Query  780   ---AVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQ  610
                A AFG SVWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I    LGH+LS+
Sbjct  295   TAIAAAFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLLGHVLSR  354

Query  609   NQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTE  430
                ++L +  T+ + G NLLS+  M+  N  ++EPRATK MFERMK EKEEGRG G    
Sbjct  355   R--RKLLTDATEMWQGVNLLSAFFMIEANKSFVEPRATKAMFERMKAEKEEGRGGGGGER  412

Query  429   TEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLK  250
             T                                     +E++ R + EK     LS +L 
Sbjct  413   T-------------------------------------SEQEVRRKLEK-----LSERLS  430

Query  249   KLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             KLN+YSS+LN++ LM LT +  +L QRL  AC
Sbjct  431   KLNTYSSWLNIMMLMSLTWHFVYLGQRLGAAC  462



>ref|XP_009127895.1| PREDICTED: uncharacterized protein LOC103852751 [Brassica rapa]
Length=462

 Score =   189 bits (480),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 179/512 (35%), Positives = 248/512 (48%), Gaps = 141/512 (28%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISP-------------HESSSEDVAAEKGGE-  1384
             ++DVIVKDGHRVVVVEY+++   NT+V ISP              E++    A EK  E 
Sbjct  35    EDDVIVKDGHRVVVVEYDRDGKTNTRVSISPPSADEGEQKQEVEKETTLFRHAKEKAKET  94

Query  1383  -----NDGDG---------SYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGA  1246
                  N G G         +     TAGE++CDAFG+CR+KIA V  R KD A +     
Sbjct  95    ASYFPNVGQGISQPVVTEEARDHHATAGEVICDAFGKCRQKIASVVGRAKDRASDRV---  151

Query  1245  RGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKV-  1069
                         D V +K S A + A     + +  V+ G   + +TV DK   A +KV 
Sbjct  152   ------------DDVGEKISDAGDAAAGKAYDVKETVARGARDIEETVTDKAGYAKEKVG  199

Query  1068  ---YEMEEG-------ARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRK  919
                ++++EG        RD +T++  N++ +                     M   A   
Sbjct  200   ETAHDVKEGMAHKAHDVRDKVTKKAHNVKET---------------------MAHKAHES  238

Query  918   MEHMKEELSDRakkaeekvgeakdavKHNI---LRSAGRAFG-----------MANLIGL  781
              E +K+E+ D+A + +EK         HN    ++ A R  G           +A+++GL
Sbjct  239   KERVKDEVRDKAHELKEKAAHKS----HNAWERVKLAARGLGSATAKALSPTKVASVVGL  294

Query  780   ---AVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQ  610
                A AFG SVWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I    LGH+LS+
Sbjct  295   TAIAAAFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLLGHVLSR  354

Query  609   NQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTE  430
                ++L +  T+ + G NLLS+  M+  N  ++EPRATK MFERMK EKEEGRG G    
Sbjct  355   R--RKLLTDATEMWQGVNLLSAFFMIEANKSFVEPRATKAMFERMKAEKEEGRGGGGGER  412

Query  429   TEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLK  250
             T                                     +E++ R + EK     LS +L 
Sbjct  413   T-------------------------------------SEQEVRRKLEK-----LSERLS  430

Query  249   KLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             KLN+YSS+LN++ LM LT +  +L QRL  AC
Sbjct  431   KLNTYSSWLNIMMLMSLTWHFVYLGQRLGAAC  462



>ref|XP_006390707.1| hypothetical protein EUTSA_v10018523mg [Eutrema salsugineum]
 gb|ESQ27993.1| hypothetical protein EUTSA_v10018523mg [Eutrema salsugineum]
Length=456

 Score =   187 bits (474),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 170/498 (34%), Positives = 237/498 (48%), Gaps = 123/498 (25%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISP-----------HESSSEDVAAEKGGE-----  1384
             D+IVKDGHRVVVVEY+++   NT+V ISP            E + E     K  E     
Sbjct  37    DIIVKDGHRVVVVEYDRDGKTNTRVSISPPSADQGQGEQKQEENEETTLFRKAKERAKEA  96

Query  1383  -----NDGDGSYHRR---TTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSE  1228
                  N G G    R    TAGE++CDAFG+CR+KIA V  R KD               
Sbjct  97    ASYLPNVGQGISEARDHHATAGEVICDAFGKCRQKIASVVGRAKD---------------  141

Query  1227  GLGKVRDTVVDKGSKaaemayeaeee---ARGAVSEGLGKVRDTVADKGNKAAKKVYEME  1057
                +  DTV D G K ++    A  +    +  V+ G   V +TVADK   A +KV E  
Sbjct  142   ---RTGDTVGDVGEKISDAGDAAAGKAYDVKETVARGARDVEETVADKAQYAKEKVAEKA  198

Query  1056  EGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakk  877
                +++++ + ++ +      A                ++   + K    KE   DR ++
Sbjct  199   HDVKESVSHKAQDAKEKVTEKAH--------------NVKDTVAHKAHESKERAKDRVRE  244

Query  876   aeekvgeakdavKHNIL---RSAGRAFG-----------MANLIGL---AVAFGMSVWVT  748
               +++ E       N     ++A R FG           +A+++GL   A AFG  VWVT
Sbjct  245   KAQELKETAVHKSRNAWERAKTAARGFGSATANVLSPKKVASVVGLTAIAAAFGSCVWVT  304

Query  747   FISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHf  568
             F+SSYVLA  L RQQF V QSK+YPVYFK  +  I    LGH++S+    +L +  T+ +
Sbjct  305   FVSSYVLASVLGRQQFGVVQSKLYPVYFKTTSVGILVGLLGHVVSRR--MKLLTDATEMW  362

Query  567   lgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaa  388
              G NLL+S  M+  N  ++EPRATK MFERMK EKEEG+G G  T               
Sbjct  363   QGVNLLASFFMIEANKSFVEPRATKAMFERMKAEKEEGKGGGERT---------------  407

Query  387   gavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTL  208
                                     +E++ R + EK     LS +L KLN+YSS+LN++TL
Sbjct  408   ------------------------SEQEVRRKLEK-----LSERLSKLNTYSSWLNILTL  438

Query  207   MCLTLYLAHLAQRLHVAC  154
             M LT +  +L QRL  AC
Sbjct  439   MSLTWHFVYLGQRLGAAC  456



>ref|XP_010645833.1| PREDICTED: uncharacterized protein LOC100256187 [Vitis vinifera]
Length=491

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 180/533 (34%), Positives = 263/533 (49%), Gaps = 93/533 (17%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEKKQED------VIVKDGHRVVVVEYEKE-HGNTKV  1441
             MMN  AL L +++L  A + SP P++KQ+D      VIVK+G RVVVVEY+KE  GNTKV
Sbjct  1     MMNGFALFLAVSSLVAASIWSPNPDQKQKDYPGAEEVIVKEGTRVVVVEYDKEGPGNTKV  60

Query  1440  LISPHES--------SSEDVAAEKGGE------NDGDG--------SYHRRTTAGELVCD  1327
              IS  E+          ED   EK  E      N G G        +  + +T  EL+CD
Sbjct  61    SISTQEAHHVFQNAPKGEDKFKEKVKEAFEVLPNMGQGLSRDQHPQNGQKPSTPKELICD  120

Query  1326  AFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeA  1147
             AFG+C+ KIA    R++    E     +    E  GK ++ V+                 
Sbjct  121   AFGKCKEKIATKIGRSEQKVSEKVHEIQEGAKETYGKAKEKVI-----------------  163

Query  1146  RGAVSEGLGK----VRDTVADKGNKAAKKVYEMEEGARDAITERLE----------NLRa  1009
              G V E L +    ++D V D   K  +KV E     ++ + + +E          +L  
Sbjct  164   -GNVEEKLSQKVHDIQDEVKDAYTKTKEKVSEKTHMVQEGVKDAVEKAKHAAKPTCDLSK  222

Query  1008  saagtassakeaakeaaekaKGMRTDASRKMEH------MKEELSDRakkaeekvgeakd  847
             +     +      + A+ +  G R    R+ E       +K  L +  KK +        
Sbjct  223   TIVEDVAGNISKIEAASREQMGQRGRGERQGEEKDGVDTVKSTLHEFQKKGQHDFINRVY  282

Query  846   avKHNILRS--AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYP  673
              V + +L +   G    + +++G A A+G+ VWVTF SS+VLA ALP QQFA+ QSKIYP
Sbjct  283   DVVNYMLSTDAIGSLTCVIHILGFATAYGVRVWVTFFSSFVLAGALPNQQFAIVQSKIYP  342

Query  672   VYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATK  493
              YFK MA  +G A LGH LSQ +   L       F G  LL++L ++L+NLLYLEPRATK
Sbjct  343   FYFKTMASCVGLALLGHALSQGEKVLLGKPDL--FQGHALLATLHIILINLLYLEPRATK  400

Query  492   VMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIA  313
             VMFER+++E EE +G+ S+      +G                       T   +  ++ 
Sbjct  401   VMFERIRVENEERKGQESSRVEPGKEG---------------------EPTTGASDPQVM  439

Query  312   EKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
              +  +E    ++++ L+  LKKLN+YSS LN++TLM L L+L +LA RL++ C
Sbjct  440   GRLDQETV-NNQILELNEMLKKLNAYSSLLNILTLMVLKLHLVYLAHRLYMTC  491



>ref|XP_006367365.1| PREDICTED: uncharacterized protein LOC102584616 [Solanum tuberosum]
Length=402

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 165/466 (35%), Positives = 236/466 (51%), Gaps = 94/466 (20%)
 Frame = -3

Query  1530  PEKKQEDVIVKDGHRVVVVEYEKEHGNTKVLISPHESSSEDVAAEKGGENDGDGSYHRRT  1351
             P KK EDV       V+VVE+++  G TKVLISP ++   +  ++    +D     + + 
Sbjct  22    PNKK-EDV-------VLVVEFDQNEG-TKVLISPQQAQIPNQNSKSSYVSDLKDKLYEKA  72

Query  1350  TAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAE----GARGAVSEGLGKVRDTVVDKGSK  1183
                  V    G+      G+      ++P + +     A+  V +  GK ++ +     K
Sbjct  73    EEATSVLPNIGQ------GI------SSPYVNQHQQNSAKDVVCDAFGKCKEKITTVFGK  120

Query  1182  aaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasa  1003
                         +  V EG+ +  + V +K    AK V +  +  +D + +++E ++   
Sbjct  121   T-----------KDKVEEGVTEASEKVKEK----AKDVVDKTKSKKDEVEQKVEQVKG--  163

Query  1002  agtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILR  823
                                    + S K E  K++L D   +  +             LR
Sbjct  164   -----------------------EISEKAEEGKKDLKDIIVRGRDVFTYIFSLGN---LR  197

Query  822   SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
                R   + +L+G AVA+GM +WVTF+SSYVLA+ALPRQQFAV QSKIYPVYFKAMAY +
Sbjct  198   HVMR---LMHLLGFAVAYGMCIWVTFVSSYVLARALPRQQFAVVQSKIYPVYFKAMAYCV  254

Query  642   GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
             G AF+GH LSQ   +  ++   +   GFNLL+S+ M+LVNLLYLEPRATKVMFER+K+EK
Sbjct  255   GPAFIGHFLSQK--RWFYANLGEAVQGFNLLASISMLLVNLLYLEPRATKVMFERLKLEK  312

Query  462   EEGRGKG-STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAE  286
             EEGRG+     E     GV                         T  T+ AEK   + A 
Sbjct  313   EEGRGRHIFNVEPSSTRGV-----------------ESVLDPTKTTTTKPAEKSPEQSAA  355

Query  285   ---KSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVA  157
                K ++++LS+KLKKLNSYSSFLNV+TLM LT +L HL Q L+ A
Sbjct  356   EVVKPQVVKLSQKLKKLNSYSSFLNVLTLMALTHHLVHLTQLLNAA  401



>emb|CDX82188.1| BnaC02g21020D [Brassica napus]
Length=460

 Score =   184 bits (467),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 241/501 (48%), Gaps = 121/501 (24%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISP-------------HESSSEDVAAEKGGE-  1384
             +EDVIVKDGHRVVVVEY+++   NT+V ISP              E++    A EK  E 
Sbjct  35    EEDVIVKDGHRVVVVEYDRDGKTNTRVSISPPSADEGEQKQEVEKETTLFRHAKEKAKET  94

Query  1383  -----NDGDG---------SYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGA  1246
                  N G G         +     TAGE++CDAFG+CR+KI+ V  R KD A +     
Sbjct  95    ASYFPNVGQGISQPVVTEEARDHHATAGEVICDAFGKCRQKISSVVGRAKDRASDTV---  151

Query  1245  RGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVY  1066
                         D V +K S   + A     + +  V+     + +TVADK   A +KV 
Sbjct  152   ------------DDVGEKISDTGDAAAGKAYDVKETVTRVARDLEETVADKAGYAKEKVG  199

Query  1065  EMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDR  886
             E    A++ +  + ++++      A+               ++   + K    KE + D 
Sbjct  200   ETAHDAKEGMAHKAQDVKDKVTRKAN--------------NVKETMAHKPHESKERVKDE  245

Query  885   akkaeekvgeakdavKHNI---LRSAGRAFG-----------MANLIGL---AVAFGMSV  757
              ++   ++ E      HN    ++ A R  G           +A+++GL   A AFG SV
Sbjct  246   VREKAHELKEKAAHKSHNAWERVKFAARGLGSATAKALSPTKVASVVGLTAIAAAFGTSV  305

Query  756   WVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTT  577
             WVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I    LGH+LS+   ++L +  T
Sbjct  306   WVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLLGHVLSRR--RKLLTDAT  363

Query  576   QHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDR  397
             + + G NLLS+  M+  N  ++EPRATK MFERMK EKEEGRG G  T            
Sbjct  364   EMWQGVNLLSAFFMIEANKSFVEPRATKAMFERMKAEKEEGRGGGERT------------  411

Query  396   saagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNV  217
                                        +E++ R + E     RLS +L KLN+YSS+LN+
Sbjct  412   ---------------------------SEQEVRRKLE-----RLSERLSKLNTYSSWLNI  439

Query  216   VTLMCLTLYLAHLAQRLHVAC  154
             + LM LT +  +L QRL  AC
Sbjct  440   MMLMSLTWHFVYLGQRLGAAC  460



>ref|XP_004162866.1| PREDICTED: uncharacterized protein LOC101231534 [Cucumis sativus]
Length=407

 Score =   182 bits (463),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 159/464 (34%), Positives = 228/464 (49%), Gaps = 75/464 (16%)
 Frame = -3

Query  1533  APEKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGENDGDGSYHR  1357
             +P    ++VIVK+GHR+VVVEY+ +   NTKV IS               E D D     
Sbjct  15    SPPPPPQNVIVKEGHRMVVVEYDDQGQHNTKVSIS--------------SEPDQDAKNSE  60

Query  1356  RTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDK---GS  1186
             R    +L+CD +G+C+ K+A   ++ K    E A+ A   V E +    D   DK   G+
Sbjct  61    RHRTKDLICDVYGKCKHKVASAVEKAKVMVTETAQEAHD-VGESVTDAFDGAKDKLKEGA  119

Query  1185  KaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRas  1006
             K            +G + EG  +  D    K  + AK+  EM +   + + +  E +   
Sbjct  120   KETFDEA------KGKLKEGAKETFDEAKGKLKEGAKETLEMAKSREEKVVKGAERVAKK  173

Query  1005  aagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNIL  826
                                  ++T  ++  E++   L DR  K  +            + 
Sbjct  174   TGEK-----------------IKTGENKLKENLMG-LVDRGFKVIDY-----------LF  204

Query  825   RSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYS  646
             R  G       L+G  +A GM VWVTFISSYVLA  LPRQQ  V QSKIYPVYFKAMA  
Sbjct  205   RHLGFGMDALGLLGFTMALGMGVWVTFISSYVLASVLPRQQLGVVQSKIYPVYFKAMASC  264

Query  645   IGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIE  466
             IG A LGH+ S+ +      K ++   G+ L+++LLM+  N LY+EPRATKVMFER+KIE
Sbjct  265   IGMALLGHLFSRTEWTFPIPKNSEVVQGYVLVAALLMIFANSLYMEPRATKVMFERLKIE  324

Query  465   KEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAE  286
             KEEGRG       E G+ +                        ++  T++ +++      
Sbjct  325   KEEGRGIEDIAREETGNVI-----------------DSSPAITSSTPTQVVDRE----VV  363

Query  285   KSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             KS ++ L+++LKKLNSYSS LN++TLM LT +L +L+QRL   C
Sbjct  364   KSRIVGLNKRLKKLNSYSSLLNLLTLMALTWHLVYLSQRLCNPC  407



>ref|XP_008459625.1| PREDICTED: uncharacterized protein LOC103498695 [Cucumis melo]
Length=432

 Score =   183 bits (464),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 165/466 (35%), Positives = 237/466 (51%), Gaps = 76/466 (16%)
 Frame = -3

Query  1533  APEKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGENDGDGSYHR  1357
             +P    ++VIVK+GHRVVVVEY+ +   NTKV IS               E D D     
Sbjct  37    SPPPPPQNVIVKEGHRVVVVEYDDQGQHNTKVSIS--------------SEPDLDAKNSE  82

Query  1356  RTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaa  1177
             R    +L+CD +G+C+ K+A   ++ K    E A+ A   V E +    D   DK     
Sbjct  83    RHRTKDLICDVYGKCKHKVASAVEKAKVMVTETAQEAHD-VGESVAGAFDEAKDK-----  136

Query  1176  emayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVY-----EMEEGARDAITERLENLR  1012
                       +    E  G+ +D + + G K AK+ +     +++EGA+       E L 
Sbjct  137   ---------LKEGAKETFGEAKDKLKE-GAKGAKETFGEAKDKLKEGAK-------ETLE  179

Query  1011  asaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHN  832
              + +      K A + A E  + ++T  ++  E++   L DR  K             + 
Sbjct  180   MAKSREEKVVKGAERVAKETGEKIQTGENKLKENLMG-LVDRGFKVM-----------NY  227

Query  831   ILRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMA  652
             + R  G       L+G A+A GM VWVTFISSYVLA  LPRQQ  V QSKIYPVYFKAMA
Sbjct  228   LFRHLGVGMDALGLLGFAMALGMGVWVTFISSYVLASVLPRQQLGVVQSKIYPVYFKAMA  287

Query  651   YSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMK  472
               IG A LGH+ S+ + +    K ++   G+ L+++LLM+  N LY+EPRATKVMFER+K
Sbjct  288   SCIGMALLGHLFSRTEWKFPIPKNSEVVQGYVLVAALLMIFANSLYMEPRATKVMFERLK  347

Query  471   IEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
             IEKEEGRG       E  + +                        ++  T+I +++    
Sbjct  348   IEKEEGRGIEDIGREETVNVIDNS-----------------PAITSSTPTQIVDRE----  386

Query  291   AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
               KS ++ L+++LKKLNSYSS LN++TLM LT +L +L+QRL   C
Sbjct  387   VVKSRIVGLNKRLKKLNSYSSLLNLLTLMALTWHLVYLSQRLCNPC  432



>emb|CDP10676.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 147/217 (68%), Gaps = 11/217 (5%)
 Frame = -3

Query  810  AFGM--ANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGT  637
            AFGM    L+GLA A+GMS+WVTFISSYVLA+ALPRQQFA+ QSKIYPVYF+AMAYS+G 
Sbjct  224  AFGMRILQLLGLAGAYGMSIWVTFISSYVLARALPRQQFAILQSKIYPVYFQAMAYSVGL  283

Query  636  AFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEE  457
              +GH+LS+   +R+ S       GFNLL+SLLM+ +NL YLEP ATKVMFERMK+EKEE
Sbjct  284  VLVGHLLSRR--KRVSSSAGDTLQGFNLLASLLMLSINLKYLEPLATKVMFERMKLEKEE  341

Query  456  GRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSE  277
            GRG  S+ E E  DGV         + + S+       T    ++    +     A + E
Sbjct  342  GRGVESSKE-EQSDGVVDS------ITEPSSVKASSTATKTCPSSSTPHESPEAAASQCE  394

Query  276  MMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
            ++RLS  L+KLN+ SSFLNV+TLM LT +L HL Q L
Sbjct  395  IVRLSEALRKLNTISSFLNVLTLMALTWHLVHLGQLL  431


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 85/158 (54%), Gaps = 34/158 (22%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEK---KQEDVIVKDGHRVVVVEYEKEHGNTKVLISP  1429
             MMN++AL LVLTTLATAGV SP PEK    +EDVI+K+GHR VVVE+EK+ GNTKV ISP
Sbjct  1     MMNIVALCLVLTTLATAGVWSPTPEKVNNDKEDVILKEGHRTVVVEFEKDDGNTKVSISP  60

Query  1428  HES------------------------------SSEDVAAEKGGENDGDGSYHRRTTAGE  1339
              E+                              S E+V      E +  G  H + T  E
Sbjct  61    QEAVHEGFVHKPSSSRVDEKGPHDSSIKGKVSDSVENVKENLKDEQEEAGDPH-KATPRE  119

Query  1338  LVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEG  1225
             LVCDA GRC+ KIA    +TK+   E A  A   V EG
Sbjct  120   LVCDALGRCKHKIASAIGKTKEMVSENAHEAADKVYEG  157



>gb|KEH29295.1| late embryogenesis abundant protein (LEA) family protein [Medicago 
truncatula]
 gb|KEH29297.1| late embryogenesis abundant protein (LEA) family protein [Medicago 
truncatula]
Length=441

 Score =   180 bits (457),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 260/514 (51%), Gaps = 105/514 (20%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHE  1423
             MMN+LALSL +T+L TA + SP P K+Q + IVK+GH+VVVVEY+++ + NTK+ I P +
Sbjct  1     MMNLLALSLFITSLTTASIFSPNP-KQQPNTIVKEGHKVVVVEYDQDGYQNTKISILPEQ  59

Query  1422  S----------------SSEDVAAE---------KGGENDGDGSYHRRTT-----AGELV  1333
                              +++D   E         +G   D   S++   T     A EL+
Sbjct  60    QQTHQQDYTNMDSGFIENTKDRIKEAASVLPNMGQGISQDASSSHYNLHTPNAKNAKELI  119

Query  1332  CDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaee  1153
             CDA+G+C+     V ++ KD A           SE + K RD V                
Sbjct  120   CDAYGKCKH----VMEKAKDKA-----------SETIDKKRDIV----------------  148

Query  1152  eARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLE-NLRasaagtassake  976
                 +  E + +V + V D  + A ++VY+      D + E  + +L        +  + 
Sbjct  149   ---NSNKEAVKEVGNNVVDAVDNAKERVYDKANDVYDNVQEYTKGSLEKGKEMGQTFKEH  205

Query  975   aakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMA  796
                   E   G++   S  ME ++  +S                              + 
Sbjct  206   VVHNVTEAKDGVKKFMSLSMERVESLMS------------------------------LL  235

Query  795   NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
             NL+G +  +GM+VW+TF+SSYVL++ +PRQQFAV QSKIYPVYF+AM Y +  A LGH+ 
Sbjct  236   NLLGFSSGYGMNVWITFVSSYVLSRVMPRQQFAVVQSKIYPVYFRAMGYCLLVALLGHVF  295

Query  615   SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGST  436
                          Q    +NLL+SLL V VN +YLEPRATK+MFERMKIEKEEGRG+   
Sbjct  296   GHGMRNNNGGGVMQ---SWNLLASLLTVFVNSVYLEPRATKLMFERMKIEKEEGRGREDV  352

Query  435   TETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRK  256
             T T       + +++       +T  V   GT +       ++K+ + A ++++M+L+ K
Sbjct  353   TTTTERSRTEEHQNSPDPKKTSTTTTVAAEGTESQ-----TQRKEHDDAVRAKIMKLNNK  407

Query  255   LKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             LKKLNSYSSFLN++ LM LT +L +LAQ +H +C
Sbjct  408   LKKLNSYSSFLNILNLMSLTWHLVYLAQNVHQSC  441



>ref|XP_004250627.1| PREDICTED: uncharacterized protein LOC101264586 [Solanum lycopersicum]
Length=407

 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 144/216 (67%), Gaps = 23/216 (11%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+G +VA+GM +WVTFISSYVLA+ LPRQQFAV QSKIYPVYFKAMAY +G AF+GH
Sbjct  207  LMHLLGFSVAYGMCIWVTFISSYVLARVLPRQQFAVVQSKIYPVYFKAMAYCVGLAFVGH  266

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG-K  445
             LSQ   +  ++   +   GFNLL+S+ M+LVN LYLEPRATKVMFER+K+EKEEGRG +
Sbjct  267  FLSQK--RWFYTNLGEAVQGFNLLASISMLLVNSLYLEPRATKVMFERLKLEKEEGRGTR  324

Query  444  GSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAE---KSEM  274
                E     GV                         T AT+ AEK Q + A    K ++
Sbjct  325  IFNVEPSGTMGV-----------------ESVLDPTKTTATKPAEKSQEQSAPEVVKPQV  367

Query  273  MRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
            ++LS+KLKKLNSYSSFLNV+TLM LT +  HL Q L
Sbjct  368  VKLSQKLKKLNSYSSFLNVLTLMALTHHHVHLTQLL  403



>ref|XP_010521159.1| PREDICTED: uncharacterized protein LOC104800129 isoform X2 [Tarenaya 
hassleriana]
Length=489

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 163/526 (31%), Positives = 245/526 (47%), Gaps = 126/526 (24%)
 Frame = -3

Query  1536  PAP-----EKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGE---  1384
             P+P      + + D+IVKDGHR+VVVEYEKE   NTK++ISP E+   +  AE+G     
Sbjct  22    PSPAMTHSNEPEADIIVKDGHRLVVVEYEKEGKTNTKIVISPPETKPGE--AEEGDNRGV  79

Query  1383  ----------------NDGDG------------SYHRRTTAGELVCDAFGRCRRKIAGVF  1288
                             N G G            +  R  T GEL+CDAFG+CR KIA   
Sbjct  80    LRNVKDRVKETTTYLPNVGQGISRPETNGEDGEARGRHATPGELICDAFGKCRHKIASTL  139

Query  1287  DRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKG----SKaaemayeaeeeARGAVSEGLG  1120
              + KD    + E      SE     R+TV + G    +KA E         RG V E +G
Sbjct  140   GKAKDRISRVQEEP----SELGETARETVDESGESTAAKADEAKETVARMTRG-VKESMG  194

Query  1119  -------------------KVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasaag  997
                                K+++T+A    +A  K   + + A+D   +  + ++  AA 
Sbjct  195   HKAQDTMDKISETAHDSAHKLKETMAHIAQEAKDKAAHIAQEAKDKAADTAQEVKDKAAQ  254

Query  996   tassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNI----  829
              A  +K+ A   A++   M+  A  K+    E+  + A    +            +    
Sbjct  255   KAQESKDKAAHKAQE---MKDKAKMKLSEKAEDAKNSAVPKAQTAWGKVKTAAKEVKTAA  311

Query  828   --LRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAM  655
               + S  +  G+  L  LA+A+G  +WVTF+SSYVLA  L R QF + QSK+YPVYFK +
Sbjct  312   KEVMSPAKVGGVVGLTALAMAYGTCIWVTFVSSYVLAGVLGRNQFGLVQSKVYPVYFKTV  371

Query  654   AYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERM  475
             +  I    +GH++   ++++L + +   +   NLL+S LMV  N   L+PRAT+ MFERM
Sbjct  372   SLGILVGLVGHVI--GRSRKLLTDSADMWQAMNLLTSFLMVEGNGSILDPRATRAMFERM  429

Query  474   KIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRE  295
             K+EKEEGRG                                             E++ R+
Sbjct  430   KVEKEEGRGAD-------------------------------------------EEETRQ  446

Query  294   RAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVA  157
             +     + +LS +L+KLN+YSS++N++TLM LT +L ++ QRL  A
Sbjct  447   K-----LRKLSERLQKLNTYSSWINILTLMSLTWHLVYIGQRLTAA  487



>ref|XP_006585749.1| PREDICTED: uncharacterized protein LOC100808861 [Glycine max]
Length=383

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 134/225 (60%), Gaps = 37/225 (16%)
 Frame = -3

Query  828  LRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            + S     G+ANL+G A A+G+ VWVTFISSYV ++ +PRQQFAV QSKIYPVYF+AMAY
Sbjct  196  MESLNSLMGVANLLGFATAYGICVWVTFISSYVQSRTMPRQQFAVVQSKIYPVYFRAMAY  255

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
            SI  AFL H L+   T       +     +NLL+SL  + +N LYLEPRATK+M ER+KI
Sbjct  256  SIALAFLAHFLAHRNT------NSDMLQSYNLLASLATLFLNYLYLEPRATKLMLERIKI  309

Query  468  EKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERA  289
            EKEEGRG+     +      T D                             E   +E A
Sbjct  310  EKEEGRGRSQDMMSSR----TVDPK---------------------------EPADQEDA  338

Query  288  EKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             +S +++L+ KLKK NSYSSFLN++ LM LT +L +LAQRLH  C
Sbjct  339  LRSRIIKLNDKLKKFNSYSSFLNILNLMSLTWHLVYLAQRLHHIC  383


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 50/115 (43%), Gaps = 27/115 (23%)
 Frame = -3

Query  1536  PAPEKKQEDVIVKDGHRVVVVEYEK-EHGNTKVLISPHE---------------------  1423
             P  EK     IVK+GHRVVVVEY++  H  TK+ ISP +                     
Sbjct  25    PRTEKHGASTIVKEGHRVVVVEYDQGGHQKTKISISPEQPTHHHDHDDDLIKEAASVLPN  84

Query  1422  -----SSSEDVAAEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKD  1273
                  SSS   + +     D            EL+CDA+G+C+ KI+   ++ ++
Sbjct  85    LCQGISSSSQYSHQPQNHMDHGPLNLHAPNPKELICDAYGKCKHKISDAMEKAQE  139



>gb|EYU22790.1| hypothetical protein MIMGU_mgv1a011924mg [Erythranthe guttata]
Length=266

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 137/215 (64%), Gaps = 21/215 (10%)
 Frame = -3

Query  804  GMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLG  625
            G+ +L+G A A+GM VWVTF SSYVLA ALPR QFA  QSKIYPVYFKAMAYS+G A  G
Sbjct  71   GILHLMGFAAAYGMCVWVTFASSYVLAGALPRNQFANVQSKIYPVYFKAMAYSVGLALFG  130

Query  624  HILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
            H++S   T+RL   +   F GFNL++SL M+LVNLLYLEPRATKVM ERMK EKEEG   
Sbjct  131  HLMSH--TKRLSPTSVGMFQGFNLMTSLAMILVNLLYLEPRATKVMLERMKKEKEEG---  185

Query  444  GSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRL  265
              T +     G+   R            +              + +K  E   KS+++RL
Sbjct  186  --TVKEGQASGLPSGRVVDSTAETVGRVS--------------STEKSEEAVAKSQIIRL  229

Query  264  SRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV  160
            S+ L++LNSYSS LNV TLM LT +L HL QRLH+
Sbjct  230  SQMLQRLNSYSSLLNVFTLMSLTWHLVHLGQRLHI  264



>gb|KHG00926.1| Transmembrane protein [Gossypium arboreum]
Length=271

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 144/227 (63%), Gaps = 17/227 (7%)
 Frame = -3

Query  810  AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAF  631
              G+ANL+GLA A+GMSVWVTFISSY+LA  LPR QF V QSKIYPVYF+AMAYSIG A 
Sbjct  54   VMGIANLLGLATAYGMSVWVTFISSYILAGQLPRLQFGVVQSKIYPVYFRAMAYSIGMAL  113

Query  630  LGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
            LGH+L     +R  S   + F   NLLS+L MVLVN LYLEP+ATKVMFERMK+EKEEGR
Sbjct  114  LGHLLWHR--KRSISSPPEVFQAINLLSTLFMVLVNGLYLEPKATKVMFERMKMEKEEGR  171

Query  450  GK------GS-TTETEH-GDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRE  295
            G+      GS  TE+    D V K+     +       A       A  ++E       +
Sbjct  172  GRHDFVAEGSRVTESPSVADPVAKNSRKGPSTAPAPAPAPEPAPAVAPTSSE-------Q  224

Query  294  RAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
               K  M RL+ +LKKLN+ SS LN++TLM LT +L +L QRL + C
Sbjct  225  EVIKRTMGRLNERLKKLNTNSSMLNILTLMALTWHLVYLGQRLTLNC  271



>gb|KHM98827.1| Transmembrane protein 205 [Glycine soja]
Length=383

 Score =   173 bits (439),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 134/225 (60%), Gaps = 37/225 (16%)
 Frame = -3

Query  828  LRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            + S     G+ANL+G A A+G+ VWVTFISSYV ++ +PRQQFAV QSKIYPVYF+AMAY
Sbjct  196  MESLNSLMGVANLLGFATAYGICVWVTFISSYVQSRTMPRQQFAVVQSKIYPVYFRAMAY  255

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
            SI  AFL H L+   +       +     +NLL+SL  + +N LYLEPRATK+M ER+KI
Sbjct  256  SIALAFLAHFLAHRNS------NSDMLQSYNLLASLATLFLNYLYLEPRATKLMLERIKI  309

Query  468  EKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERA  289
            EKEEGRG+     +      T D                             E   +E A
Sbjct  310  EKEEGRGRSQDMMSSR----TVDPK---------------------------EPADQEDA  338

Query  288  EKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             +S +++L+ KLKK NSYSSFLN++ LM LT +L +LAQRLH  C
Sbjct  339  LRSRIIKLNDKLKKFNSYSSFLNILNLMSLTWHLVYLAQRLHHIC  383


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 50/115 (43%), Gaps = 27/115 (23%)
 Frame = -3

Query  1536  PAPEKKQEDVIVKDGHRVVVVEYEK-EHGNTKVLISPHE---------------------  1423
             P  EK     IVK+GHRVVVVEY++  H  TK+ ISP +                     
Sbjct  25    PRTEKHGASTIVKEGHRVVVVEYDQGGHQKTKISISPEQPTHHHDHDDDLIKEAASVLPN  84

Query  1422  -----SSSEDVAAEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKD  1273
                  SSS   + +     D            EL+CDA+G+C+ KI+   ++ ++
Sbjct  85    LCQGISSSSQYSHQPQNHMDHGPLNLHAPNPKELICDAYGKCKHKISDAMEKAQE  139



>ref|NP_001236456.1| seed maturation protein PM27 precursor [Glycine max]
 gb|AAD30426.1|AF117723_1 seed maturation protein PM27 [Glycine max]
Length=339

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 138/226 (61%), Gaps = 38/226 (17%)
 Frame = -3

Query  825  RSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYS  646
            +S     G+AN++G + A+GM VWVTFISSYV ++A+ RQQFAV QSKIYPVYF+AM+YS
Sbjct  150  QSLNSLMGVANMLGFSTAYGMCVWVTFISSYVQSRAMARQQFAVVQSKIYPVYFRAMSYS  209

Query  645  IGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIE  466
            IG A   H+L+   T  L S  +     +NLL+SL+ +  N LYLEPRATK+MFER+KIE
Sbjct  210  IGVALFAHVLAHRNT--LLSNKSDLLQAYNLLASLVTLFFNSLYLEPRATKLMFERIKIE  267

Query  465  KEEGRGKGS--TTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
            KEEGRG+    ++ T+     T D                                  + 
Sbjct  268  KEEGRGRSEDVSSRTKEPASTTAD----------------------------------QD  293

Query  291  AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            A ++ +++L+ KLKKLNSYSSFLN++ LM LT +L +LAQRL   C
Sbjct  294  AVRTRIIKLNDKLKKLNSYSSFLNILNLMSLTWHLVYLAQRLPHIC  339


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (51%), Gaps = 24/110 (22%)
 Frame = -3

Query  1506  IVKDGHRVVVVEYEK-EHGNTKVLISPHESSSEDVAAEKGGENDGDGSYHRRTTAGELVC  1330
             IVK+GHRVVVVEY++  H NTK+ ISP + +  ++                     + +C
Sbjct  21    IVKEGHRVVVVEYDQGGHQNTKISISPEQPTHANL--------------------KDPIC  60

Query  1329  DAFGRCRRKIAGVFDRTKDTAPEMAE---GARGAVSEGLGKVRDTVVDKG  1189
             DA+G+C+ KI    +++++   E  +     + A  +  GK ++ V DK 
Sbjct  61    DAYGKCKHKIVDAMEKSQEVIHEKKDEIAANKEAARQVAGKTKERVYDKA  110



>gb|KHN32470.1| Transmembrane protein 205 [Glycine soja]
Length=341

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 138/226 (61%), Gaps = 38/226 (17%)
 Frame = -3

Query  825  RSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYS  646
            +S     G+AN++G + A+GM VWVTFISSYV ++A+ RQQFAV QSKIYPVYF+AM+YS
Sbjct  152  QSLNSLMGVANMLGFSTAYGMCVWVTFISSYVQSRAMARQQFAVVQSKIYPVYFRAMSYS  211

Query  645  IGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIE  466
            IG A   H+L+   T  L S  +     +NLL+SL+ +  N LYLEPRATK+MFER+KIE
Sbjct  212  IGVALFAHVLAHRNT--LLSNKSDLLQAYNLLASLVTLFFNSLYLEPRATKLMFERIKIE  269

Query  465  KEEGRGKGS--TTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
            KEEGRG+    ++ T+     T D                                  + 
Sbjct  270  KEEGRGRSEDVSSRTKEPASTTAD----------------------------------QD  295

Query  291  AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            A ++ +++L+ KLKKLNSYSSFLN++ LM LT +L +LAQRL   C
Sbjct  296  AVRTRIIKLNDKLKKLNSYSSFLNILNLMSLTWHLVYLAQRLPHIC  341


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 24/110 (22%)
 Frame = -3

Query  1506  IVKDGHRVVVVEYEK-EHGNTKVLISPHESSSEDVAAEKGGENDGDGSYHRRTTAGELVC  1330
             IVK+GHRVVVVEY++  H NTK+ ISP + +           N  D            +C
Sbjct  23    IVKEGHRVVVVEYDQGGHQNTKISISPEQPTH---------ANPKDP-----------IC  62

Query  1329  DAFGRCRRKIAGVFDRTKDTAPEMAE---GARGAVSEGLGKVRDTVVDKG  1189
             DA+G+C+ KI    +++++   E  +     + A  +  GK ++ V DK 
Sbjct  63    DAYGKCKHKIVDAMEKSQEVIHEKKDEIAANKEAARQVAGKTKERVYDKA  112



>gb|ACU20077.1| unknown [Glycine max]
Length=341

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 138/226 (61%), Gaps = 38/226 (17%)
 Frame = -3

Query  825  RSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYS  646
            +S     G+AN++G + A+GM VWVTFISSYV ++A+ RQQFAV QSKIYPVYF+AM+YS
Sbjct  152  QSLNSLMGVANMLGFSTAYGMCVWVTFISSYVQSRAMARQQFAVVQSKIYPVYFRAMSYS  211

Query  645  IGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIE  466
            IG A   H+L+   T  L S  +     +NLL+SL+ +  N LYLEPRATK+MFER+KIE
Sbjct  212  IGVALFAHVLAHRNT--LLSNKSDLLQAYNLLASLVTLFFNSLYLEPRATKLMFERIKIE  269

Query  465  KEEGRGKGS--TTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
            KEEGRG+    ++ T+     T D                                  + 
Sbjct  270  KEEGRGRSEDVSSRTKEPASTTAD----------------------------------QD  295

Query  291  AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            A ++ +++L+ KLKKLNSYSSFLN++ LM LT +L +LAQRL   C
Sbjct  296  AVRTRIIKLNDKLKKLNSYSSFLNILNLMSLTWHLVYLAQRLPHIC  341


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (51%), Gaps = 24/110 (22%)
 Frame = -3

Query  1506  IVKDGHRVVVVEYEK-EHGNTKVLISPHESSSEDVAAEKGGENDGDGSYHRRTTAGELVC  1330
             IVK+GHRVVVVEY++  H NTK+ ISP + +  ++                     + +C
Sbjct  23    IVKEGHRVVVVEYDQGGHQNTKISISPEQPTHANL--------------------KDPIC  62

Query  1329  DAFGRCRRKIAGVFDRTKDTAPEMAE---GARGAVSEGLGKVRDTVVDKG  1189
             DA+G+C+ KI    +++++   E  +     + A  +  GK ++ V DK 
Sbjct  63    DAYGKCKHKIVDAMEKSQEVIHEKKDEIAANKEAARQVAGKTKERVYDKA  112



>ref|XP_010244844.1| PREDICTED: uncharacterized protein LOC104588560 [Nelumbo nucifera]
Length=543

 Score =   174 bits (441),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 149/422 (35%), Positives = 205/422 (49%), Gaps = 87/422 (21%)
 Frame = -3

Query  1356  RTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaa  1177
             R+   ELVCDAFG+C+ KIA                      E +GK ++ V DK     
Sbjct  188   RSGTRELVCDAFGKCKHKIA----------------------EAMGKTKEKVADKAH---  222

Query  1176  emayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasaag  997
                         AV EG     +TV   G  A ++     E     + +++++       
Sbjct  223   ------------AVEEGAKGTVETVKHAGETAVERTKSAGEDLASNLADKMKSAGQEV--  268

Query  996   tassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILR--  823
                                  D + K E   EE++++ K + +            I R  
Sbjct  269   --------------------ADKAMKAEEKTEEVAEQVKTSVDLTKRRAQQNLTEIFRRG  308

Query  822   ---------------SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQ  688
                            +     G+  LIG A A+GM VWVTF+SS+VLA ALPRQQF V Q
Sbjct  309   REVAYDAAMYAVSPETVSSLMGLLELIGFATAYGMCVWVTFVSSHVLAGALPRQQFGVVQ  368

Query  687   SKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLE  508
             SKIYPVYF+AMAYSIGTA + H L +    R+ S   +    +NLL  L+MVLVNLLYLE
Sbjct  369   SKIYPVYFRAMAYSIGTALVAHFLGRQ--GRVVSGPAETLQAYNLLGYLVMVLVNLLYLE  426

Query  507   PRATKVMFERMKIEKEEGRGKGSTT--ETEHGDGVTKDRsaagavvdgstgavvdggtaa  334
             P+ATKVMFERMK EKEEGRG+   T  E     G+T       A             T  
Sbjct  427   PQATKVMFERMKAEKEEGRGRDVDTVAEPPPVSGLTTTT-TPTASGGAKPIGTTGTTTTT  485

Query  333   taaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQR--LHV  160
             ++  ++AE+++     K+ + +L+++LK+LN+YSSFLNV+TLM LT +L +L QR  LH 
Sbjct  486   SSRAKLAEQEE----AKTRLGKLNQRLKQLNTYSSFLNVLTLMGLTWHLVYLGQRLQLHR  541

Query  159   AC  154
             +C
Sbjct  542   SC  543



>ref|XP_007224898.1| hypothetical protein PRUPE_ppa022136mg [Prunus persica]
 gb|EMJ26097.1| hypothetical protein PRUPE_ppa022136mg [Prunus persica]
Length=496

 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 181/500 (36%), Positives = 254/500 (51%), Gaps = 81/500 (16%)
 Frame = -3

Query  1527  EKKQED----VIVKDGHRVVVVEYEKEHGN--TKVLISPHES---------SSEDV----  1405
             EKKQ D    VIVK+GHRVVVVEY+ EHG+  TKV IS  +          S  DV    
Sbjct  32    EKKQGDHQREVIVKNGHRVVVVEYD-EHGHPITKVSISSEQDRQADKDSSISDNDVSSPS  90

Query  1404  ----AAEKGGENDGDGSY------HRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMA  1255
                 A +K  +N  + +           +  EL+CDA+G+C+ +IA   +  K       
Sbjct  91    MVSRAFDKAMDNMKEATSALPNLGQEGHSPKELICDAYGKCKHQIARDLEMKKKIVKGTV  150

Query  1254  EGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVAD---KGNK  1084
              GA+    E   KV + V     K  E      E+A+  VS+   +V +T  D   K   
Sbjct  151   HGAK----ETAHKVGEAVESAYEKTGEAVGNVYEKAKEMVSDKAHEVEETAKDSVGKAKG  206

Query  1083  AAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMK  904
             AAK   EM E     I     NL    A  A  AKE A+            A+ K++   
Sbjct  207   AAKTAREMGETLAADIKSNASNLCEDLASKAQEAKETAE-----------HAAAKVKTGA  255

Query  903   EELSDRakkaeekvgeakdavKHNILRSAGRA------FGMANLIGLAVAFGMSVWVTFI  742
             EEL    +K   ++G     + +  LRS G +        +ANL GLA A+G  +W+TF+
Sbjct  256   EELESGTQKRFHELGRKGREIWYGALRSTGLSDALDALMSVANLFGLATAYGTCMWITFV  315

Query  741   SSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflg  562
             SS+VL   L  QQF + QSKIY VYF+AMA S+G A LGH L ++  ++      Q    
Sbjct  316   SSHVLLGNLAPQQFGMVQSKIYRVYFRAMASSVGMALLGH-LWRHGNKKFTGNMLQ-LQN  373

Query  561   fnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR-----GKGSTTETEHGDGVTKDR  397
             FNL+++LLM+ VN+LYLEPR+TKVMFERMK+EKEEGR     G   ++E+E         
Sbjct  374   FNLMAALLMIFVNMLYLEPRSTKVMFERMKMEKEEGRERVHVGTRVSSESEQ--------  425

Query  396   saagavvdgstgavvdggtaataaTEIAEKKQRE--RAEKSEMMRLSRKLKKLNSYSSFL  223
                            +     T A+++ E++++E  +A+   +  +  +LKKLNSYSS L
Sbjct  426   ----------QRITAEVEPTTTVASQVTERREQEVAQADTDRLDEMRERLKKLNSYSSLL  475

Query  222   NVVTLMCLTLYLAHLAQRLH  163
             NV++LM L+ +L +LAQRLH
Sbjct  476   NVMSLMSLSWHLVYLAQRLH  495



>ref|XP_006591921.1| PREDICTED: seed maturation protein PM27 isoform X1 [Glycine max]
Length=347

 Score =   165 bits (417),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 138/232 (59%), Gaps = 44/232 (19%)
 Frame = -3

Query  825  RSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYS  646
            +S     G+AN++G + A+GM VWVTFISSYV ++A+ RQQFAV QSKIYPVYF+AM+YS
Sbjct  152  QSLNSLMGVANMLGFSTAYGMCVWVTFISSYVQSRAMARQQFAVVQSKIYPVYFRAMSYS  211

Query  645  IGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATK------VMF  484
            IG A   H+L+   T  L S  +     +NLL+SL+ +  N LYLEPRATK      +MF
Sbjct  212  IGVALFAHVLAHRNT--LLSNKSDLLQAYNLLASLVTLFFNSLYLEPRATKKLWFIQLMF  269

Query  483  ERMKIEKEEGRGKGS--TTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAE  310
            ER+KIEKEEGRG+    ++ T+     T D                              
Sbjct  270  ERIKIEKEEGRGRSEDVSSRTKEPASTTAD------------------------------  299

Query  309  KKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
                + A ++ +++L+ KLKKLNSYSSFLN++ LM LT +L +LAQRL   C
Sbjct  300  ----QDAVRTRIIKLNDKLKKLNSYSSFLNILNLMSLTWHLVYLAQRLPHIC  347


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (51%), Gaps = 24/110 (22%)
 Frame = -3

Query  1506  IVKDGHRVVVVEYEK-EHGNTKVLISPHESSSEDVAAEKGGENDGDGSYHRRTTAGELVC  1330
             IVK+GHRVVVVEY++  H NTK+ ISP + +  ++                     + +C
Sbjct  23    IVKEGHRVVVVEYDQGGHQNTKISISPEQPTHANL--------------------KDPIC  62

Query  1329  DAFGRCRRKIAGVFDRTKDTAPEMAE---GARGAVSEGLGKVRDTVVDKG  1189
             DA+G+C+ KI    +++++   E  +     + A  +  GK ++ V DK 
Sbjct  63    DAYGKCKHKIVDAMEKSQEVIHEKKDEIAANKEAARQVAGKTKERVYDKA  112



>ref|XP_008219004.1| PREDICTED: uncharacterized protein LOC103319269 [Prunus mume]
Length=534

 Score =   166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 185/539 (34%), Positives = 275/539 (51%), Gaps = 97/539 (18%)
 Frame = -3

Query  1602  KMMNvlalslvlttlatagvlSPAPE-------KKQED----VIVKDGHRVVVVEYEKEH  1456
             KMMN +A+ LV+++LA+AG+ SP+P+       KKQ D    VIVK+GHRVVVVEY+ EH
Sbjct  33    KMMNFVAVFLVVSSLASAGMWSPSPQNDNQNQQKKQGDHQREVIVKNGHRVVVVEYD-EH  91

Query  1455  GN--TKVLISPHES---------SSEDVA------------------AEKGGENDGDG-S  1366
             G+  TKV IS  +          S  DV+                  A     N G G S
Sbjct  92    GHPVTKVSISSDQDRQADKDSSISDNDVSSPSMVSRAFDKAMDNMKEAASALPNLGQGIS  151

Query  1365  YHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGS  1186
                  +  EL+CDA+G+C+ +IA   +  K        GA+   +  +G+  ++  +K  
Sbjct  152   NGEGYSPKELICDAYGKCKHQIARDLEMKKKIVKGTVHGAK-ETAHKVGEAVESAYEKTG  210

Query  1185  KaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAI----------  1036
             +              AV     K ++TV+DK        +E+EE A+D++          
Sbjct  211   E--------------AVGNVYEKAKETVSDKA-------HEVEEIAKDSVGKAKGAAKTA  249

Query  1035  TERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvge  856
              E  E L       AS+  E     A++AK     A+ K++   EEL    +K   ++G 
Sbjct  250   REMGETLAGDIKSNASNLCEDLASKAQEAKETAEHAAEKVKTGAEELESGTQKRFHELGR  309

Query  855   akdavKHNILRSAGRA------FGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAV  694
                 + +  LRS G +        +ANL GLA A+G  +W+TF+SS+VL   L  QQF +
Sbjct  310   KGREIWYGALRSTGLSDALDTLMSVANLFGLATAYGTCMWITFVSSHVLLGNLAPQQFGM  369

Query  693   AQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnlly  514
              QSKIY VYF+AMA S+G A LGH L ++  ++      Q    FNL+++LLM+  N+LY
Sbjct  370   VQSKIYRVYFRAMASSVGMALLGH-LWRHGNKKFTGNMLQ-LQNFNLMAALLMIFANMLY  427

Query  513   LEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaa  334
             LEPR+TKVMFERMK+EKEEGR +   +                +          +     
Sbjct  428   LEPRSTKVMFERMKMEKEEGRERVHVS-------------TRVSSEAEQQPITAEVEPTT  474

Query  333   taaTEIAEKKQR--ERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLH  163
             T A+++ E++++   +A+   +  +  +LKKLNSYSS LNV++LM L+ +L +LAQRLH
Sbjct  475   TVASQVTERREQAVAQADNDRLDEMRERLKKLNSYSSLLNVMSLMSLSWHLVYLAQRLH  533



>ref|XP_004141640.1| PREDICTED: uncharacterized protein LOC101208468 [Cucumis sativus]
Length=392

 Score =   162 bits (411),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 157/466 (34%), Positives = 224/466 (48%), Gaps = 94/466 (20%)
 Frame = -3

Query  1533  APEKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGENDGDGSYHR  1357
             +P    ++VIVK+GHR+VVVEY+ +   NTKV IS               E D D     
Sbjct  15    SPPPPPQNVIVKEGHRMVVVEYDDQGQHNTKVSIS--------------SEPDQDAKNSE  60

Query  1356  RTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaa  1177
             R    +L+CD           V+ + K       E A+  V+E   +  D          
Sbjct  61    RHRTKDLICD-----------VYGKCKHKVASAVEKAKVMVTETAQEAHD----------  99

Query  1176  emayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYE-----MEEGARDAITERLENLR  1012
                          V E +    D   DK  + AK+ ++     ++EGA+       E L 
Sbjct  100   -------------VGESVTDAFDGAKDKLKEGAKETFDEAKGKLKEGAK-------ETLE  139

Query  1011  asaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHN  832
              + +      K A + A E  + ++T  ++  E++   L DR  K  +            
Sbjct  140   MAKSREEKVVKGAERVAKETGEKIKTGENKLKENLMG-LVDRGFKVIDY-----------  187

Query  831   ILRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMA  652
             + R  G       L+G  +A GM VWVTFISSYVLA  LPRQQ  V QSKIYPVYFKAMA
Sbjct  188   LFRHLGFGMDALGLLGFTMALGMGVWVTFISSYVLASVLPRQQLGVVQSKIYPVYFKAMA  247

Query  651   YSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMK  472
               IG A LGH+ S+ +      K ++   G+ L+++LLM+  N LY+EPRATKVMFER+K
Sbjct  248   SCIGMALLGHLFSRTEWTFPIPKNSEVVQGYVLVAALLMIFANSLYMEPRATKVMFERLK  307

Query  471   IEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
             IEKEEGRG       E G+ +                        ++  T++ +++    
Sbjct  308   IEKEEGRGIEDIAREETGNVIDNS-----------------PAITSSTPTQVVDRE----  346

Query  291   AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
               KS ++ L+++LKKLNSYSS LN++TLM LT +L +L+QRL   C
Sbjct  347   VVKSRIVGLNKRLKKLNSYSSLLNLLTLMALTWHLVYLSQRLCNPC  392



>ref|XP_010431488.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104715813 
[Camelina sativa]
Length=345

 Score =   155 bits (392),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 139/413 (34%), Positives = 186/413 (45%), Gaps = 108/413 (26%)
 Frame = -3

Query  1323  FGRCRRKIAGVF----DRTKDTAPEMAEGARGAV-----------SEGLGKVRDTVVDKG  1189
             FG+CR+KIA V     DRT DT  E A     AV           +     V DTV DK 
Sbjct  18    FGKCRQKIASVVGRAKDRTADTVGETASDVEDAVGRKAHDMKKTVTHAARDVEDTVADKA  77

Query  1188  SKaaemayeaeeeARGAVSEGLG--------KVRDTVADKGNKAAKKVYEMEEGARDAIT  1033
                     + +   +  V E +         KVRD   D     A+K +E +E A+D + 
Sbjct  78    -----RYVKEKVTEKAQVXESVAHKAHDAKDKVRDKAHDVKETVAQKAHESKERAKDRVR  132

Query  1032  ERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgea  853
              +   L+ + A  +                   DA  ++++   E    A  A       
Sbjct  133   GKAHELKETVAHKSQ------------------DAWERVKNGVREFGSAAVGAL------  168

Query  852   kdavKHNILRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYP  673
                       S  +   +  L  +A AFG  VWVTF+SSYVLA  L RQQF V QSK+YP
Sbjct  169   ----------SPTKVASVVGLTAIAAAFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYP  218

Query  672   VYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATK  493
             VYFKA +  I    LGH+LS+   ++L +  T+ + G NLLSS  M+  N  ++EPRATK
Sbjct  219   VYFKATSVGILVGLLGHVLSRR--RKLLTDATEMWQGVNLLSSFFMIEANKSFVEPRATK  276

Query  492   VMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIA  313
              MFERMK EKEEGRG   TT                                       +
Sbjct  277   AMFERMKAEKEEGRGGERTT---------------------------------------S  297

Query  312   EKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             E++ R + EK     LS +L KLN+YSS+LN++TLM LT +  +L QRL  AC
Sbjct  298   EQELRRKLEK-----LSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGNAC  345



>ref|XP_004516134.1| PREDICTED: uncharacterized protein LOC101512941 [Cicer arietinum]
Length=433

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 130/402 (32%), Positives = 193/402 (48%), Gaps = 81/402 (20%)
 Frame = -3

Query  1350  TAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaem  1171
              A EL+CDA+G+C+  +    ++ KD A E  E  +  +                     
Sbjct  110   NAKELICDAYGKCKNAM----EKAKDKAQETMEKKKDIIHSN------------------  147

Query  1170  ayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasaagta  991
                          E   +V +TV D  +KA +KVY+    A D      E++        
Sbjct  148   ------------KEAAKEVGNTVVDAVDKAKEKVYD---KANDVQGYTKESMEKGKEMGQ  192

Query  990   ssakeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILRSAGR  811
             +  +   +   E   G++   S  ME                              S   
Sbjct  193   TFKEHVVRNVTEAKDGVKKFVSLSME------------------------------SVAN  222

Query  810   AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAF  631
                +ANL+G A  +GM+VW+TF+SSYVL++ +PRQQFAV QSKIYPVYF+AM Y +  A 
Sbjct  223   LMSVANLLGFASGYGMNVWITFVSSYVLSRVMPRQQFAVVQSKIYPVYFRAMGYCLVIAL  282

Query  630   LGHILSQNQTQR---LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             LGH+    +  +   L +           L+SLL V VN +YLEPRATK+MFERMKIEKE
Sbjct  283   LGHVFGHGRKHKGGVLQASNL--------LASLLTVFVNSVYLEPRATKLMFERMKIEKE  334

Query  459   EGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKS  280
             EGRG+      E      + +++       +T         A +   + ++K+ + A ++
Sbjct  335   EGRGREDIINAERSRTTEEHQNSPDPKKTSTTTTSNLAAERAES---LLQRKEHDDAVRA  391

Query  279   EMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
              +++L+ KLKKLNSYSSFLN++ LM LT +L +LAQ +H +C
Sbjct  392   RIVKLNNKLKKLNSYSSFLNILNLMSLTWHLVYLAQNVHHSC  433



>ref|XP_010912527.1| PREDICTED: uncharacterized protein LOC105038415 [Elaeis guineensis]
Length=441

 Score =   155 bits (392),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 129/397 (32%), Positives = 198/397 (50%), Gaps = 65/397 (16%)
 Frame = -3

Query  1335  VCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeae  1156
             +CDA+G C+ K++ +  ++KD            V+E   ++ DT  D   K         
Sbjct  107   ICDAYGACKDKLSNLVGKSKDK-----------VAEKAFQLEDTAKDTTKKV--------  147

Query  1155  eeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasaagtassake  976
                       + K +D   DK         E++E A+D   + +++ + +    AS+   
Sbjct  148   ----------MDKSKDITTDKA-------LELKETAKDTAKKTVDSYKEAGQDMASNISS  190

Query  975   aakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMA  796
              A++   + +   ++  R +  +     D A  A   VG            +A     +A
Sbjct  191   IAEKVVNETEAAASELRRNLTDIIRRARDVAYDATVYVGAP---------ETASTVAAVA  241

Query  795   NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
              L+G A A+G  VWVTF+SS+VLA ALPRQQF + QSK+YPVYF+ +AY +G A+L H L
Sbjct  242   QLLGFATAYGTCVWVTFVSSHVLATALPRQQFGLVQSKLYPVYFRVVAYGVGVAWLAHFL  301

Query  615   SQN---QTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
              Q+     +RL            LL S ++VLVN+L+LEP+ATKVMFERMK+EKEEGRG+
Sbjct  302   GQDGRAVAERLQGYN--------LLGSFVLVLVNMLFLEPKATKVMFERMKVEKEEGRGR  353

Query  444   GSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRL  265
                   E  D + +  S        +            A + +A  ++     K  M +L
Sbjct  354   ------EMADVLVEPASTTTTATTTTAATTPTSTAFGVARSTVAVDQE---VVKGRMAKL  404

Query  264   SRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             + +LK LN+YSSF+NV++LM LT +L HLA R+  +C
Sbjct  405   NERLKVLNNYSSFINVLSLMGLTWHLVHLAHRVRTSC  441



>ref|XP_010521158.1| PREDICTED: uncharacterized protein LOC104800129 isoform X1 [Tarenaya 
hassleriana]
Length=493

 Score =   156 bits (394),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 154/552 (28%), Positives = 232/552 (42%), Gaps = 174/552 (32%)
 Frame = -3

Query  1536  PAP-----EKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGE---  1384
             P+P      + + D+IVKDGHR+VVVEYEKE   NTK++ISP E+   +  AE+G     
Sbjct  22    PSPAMTHSNEPEADIIVKDGHRLVVVEYEKEGKTNTKIVISPPETKPGE--AEEGDNRGV  79

Query  1383  ---------------------------NDGDGSYH-RRTTAGELVCDA-----------F  1321
                                        N  DG    R  T GEL+CDA            
Sbjct  80    LRNVKDRVKETTTYLPNVGQGISRPETNGEDGEARGRHATPGELICDAFGKCRHKIASTL  139

Query  1320  GRCRRKIAGV-------------------------FDRTKDTAPEMAEGARGAV----SE  1228
             G+ + +I+ V                          D  K+T   M  G + ++     +
Sbjct  140   GKAKDRISRVQEEPSELGETARETVDESGESTAAKADEAKETVARMTRGVKESMGHKAQD  199

Query  1227  GLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKG--------------  1090
              + K+ +T  D   K  E      +EA+   +    + +D  AD                
Sbjct  200   TMDKISETAHDSAHKLKETMAHIAQEAKDKAAHIAQEAKDKAADTAQEVKDKAAQKAQES  259

Query  1089  -NKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKME  913
              +KAA K  EM++ A+  ++E+ E                             DA     
Sbjct  260   KDKAAHKAQEMKDKAKMKLSEKAE-----------------------------DAKNVAG  290

Query  912   HMKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMANLIGLAVAFGMSVWVTFISSY  733
              M EE    A    +            ++ S  +  G+  L  LA+A+G  +WVTF+SSY
Sbjct  291   GMAEEAKKSAVPKAQTAWGKVKTAAKEVM-SPAKVGGVVGLTALAMAYGTCIWVTFVSSY  349

Query  732   VLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnl  553
             VLA  L R QF + QSK+YPVYFK ++  I    +GH++   ++++L + +   +   NL
Sbjct  350   VLAGVLGRNQFGLVQSKVYPVYFKTVSLGILVGLVGHVI--GRSRKLLTDSADMWQAMNL  407

Query  552   lssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvd  373
             L+S LMV  N   L+PRAT+ MFERMK+EKEEGRG                         
Sbjct  408   LTSFLMVEGNGSILDPRATRAMFERMKVEKEEGRGAD-----------------------  444

Query  372   gstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTL  193
                                 E++ R++     + +LS +L+KLN+YSS++N++TLM LT 
Sbjct  445   --------------------EEETRQK-----LRKLSERLQKLNTYSSWINILTLMSLTW  479

Query  192   YLAHLAQRLHVA  157
             +L ++ QRL  A
Sbjct  480   HLVYIGQRLTAA  491



>ref|XP_008807668.1| PREDICTED: uncharacterized protein LOC103719958 [Phoenix dactylifera]
Length=436

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (61%), Gaps = 16/223 (7%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            +A  A  +A L+G A A+G  VWVTF+SS+VLA ALPRQQF + QSK+YPVYF+ +AY +
Sbjct  230  TASTAAAVAQLLGFATAYGTCVWVTFVSSHVLAAALPRQQFGLMQSKLYPVYFRVVAYGV  289

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G A+L H   Q +         +   G+NLL S ++VL N+L+LEP+ATK MFERMK+ K
Sbjct  290  GVAWLAHFFGQGR-----GAVAERLQGYNLLGSFVLVLANMLFLEPKATKAMFERMKVMK  344

Query  462  EEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEK  283
            EEGRG+      +  D + +  SA       +          A     + ++       K
Sbjct  345  EEGRGR------DMADVLVEPASATATTTTAAATPTSTAFGVARTTVTVDQE-----VVK  393

Query  282  SEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            S M++L+++LK LN+YSSFLNV+TLM LT +L HLA R+  +C
Sbjct  394  SRMVKLNKRLKMLNNYSSFLNVLTLMGLTWHLVHLAHRVQTSC  436



>ref|XP_003579779.1| PREDICTED: uncharacterized protein LOC100835682 [Brachypodium 
distachyon]
Length=588

 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 150/436 (34%), Positives = 213/436 (49%), Gaps = 49/436 (11%)
 Frame = -3

Query  1419  SSEDVAAEKGGEND---GDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEG  1249
             S++D  +E  GE      DG+     +A   V +A G  + K +    R KD A E    
Sbjct  188   SAKDRVSEAAGEAKEKIKDGAAETAKSAKHKVSEAAGEAKEKAS----RAKDVAAETVTS  243

Query  1248  ARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKV  1069
             A G VSE  G+ ++    K S+A ++A E    A G VSE     +D+  +    A  KV
Sbjct  244   ATGKVSEAAGEAKE----KASRAKDVAAETVTSATGKVSEAARNAKDSAKETAMNAKDKV  299

Query  1068  YEM----EEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKE  901
               M    E+ A+DA     E +  +                         A  K   + +
Sbjct  300   SGMAERAEDYAQDAAGTAAEKVAHAEEV----------------------AKAKAGEVSK  337

Query  900   ELSDRakkaeekvgeakdavKHNILRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAK  721
              L+D  ++A +   +A   +    + +A  A  + +L+G A A+G  VWVTF+SS+VLA 
Sbjct  338   NLTDIVRRARDVASDAAVYLLGAPMEAARTATAVMHLLGFATAYGACVWVTFVSSHVLAA  397

Query  720   ALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssl  541
             ALPRQQ  V QSK+YPVYF+AMAY +G A   H+L      R  S        FNLL +L
Sbjct  398   ALPRQQLGVLQSKLYPVYFRAMAYGVGLALAAHLLG-----RERSSLASRAQSFNLLGAL  452

Query  540   lmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstg  361
              +VL N+L LEP+ATKVMFERMK+EKEEGRG+  +   +         +        +  
Sbjct  453   GLVLANMLLLEPKATKVMFERMKVEKEEGRGRDMSDVVDTPAVTVATTAPTTTTTTATAT  512

Query  360   avvdggtaataaTEIAEKKQRERAEKSEM-----MRLSRKLKKLNSYSSFLNVVTLMCLT  196
              +    T        A K  +  A  +EM     +RL+++LK+LNSYSS  NV++LM LT
Sbjct  513   PMSAAATRVLLDDARAAKAAKATAGDAEMAKSKVVRLNKRLKQLNSYSSLCNVLSLMALT  572

Query  195   LYLAHLAQRLH--VAC  154
              +L HLA+RL    AC
Sbjct  573   WHLVHLARRLQTSTAC  588



>gb|KGN52683.1| hypothetical protein Csa_5G650480 [Cucumis sativus]
Length=377

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 136/226 (60%), Gaps = 21/226 (9%)
 Frame = -3

Query  831  ILRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMA  652
            + R  G       L+G  +A GM VWVTFISSYVLA  LPRQQ  V QSKIYPVYFKAMA
Sbjct  173  LFRHLGFGMDALGLLGFTMALGMGVWVTFISSYVLASVLPRQQLGVVQSKIYPVYFKAMA  232

Query  651  YSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMK  472
              IG A LGH+ S+ +      K ++   G+ L+++LLM+  N LY+EPRATKVMFER+K
Sbjct  233  SCIGMALLGHLFSRTEWTFPIPKNSEVVQGYVLVAALLMIFANSLYMEPRATKVMFERLK  292

Query  471  IEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
            IEKEEGRG       E G+ +                        ++  T++ +++    
Sbjct  293  IEKEEGRGIEDIAREETGNVIDNS-----------------PAITSSTPTQVVDRE----  331

Query  291  AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
              KS ++ L+++LKKLNSYSS LN++TLM LT +L +L+QRL   C
Sbjct  332  VVKSRIVGLNKRLKKLNSYSSLLNLLTLMALTWHLVYLSQRLCNPC  377


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (52%), Gaps = 15/97 (15%)
 Frame = -3

Query  1533  APEKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGENDGDGSYHR  1357
             +P    ++VIVK+GHR+VVVEY+ +   NTKV IS               E D D     
Sbjct  15    SPPPPPQNVIVKEGHRMVVVEYDDQGQHNTKVSIS--------------SEPDQDAKNSE  60

Query  1356  RTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGA  1246
             R    +L+CD +G+C+ K+A   ++ K    E A+ A
Sbjct  61    RHRTKDLICDVYGKCKHKVASAVEKAKVMVTETAQEA  97



>ref|XP_010682507.1| PREDICTED: uncharacterized protein LOC104897327 [Beta vulgaris 
subsp. vulgaris]
Length=423

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 143/213 (67%), Gaps = 3/213 (1%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            ++ LIG+++A+G+ +WVTF+ S+VLA  LPRQQF + QSKIYPVYFK M  SIG + +G+
Sbjct  208  VSELIGMSIAYGVGIWVTFVMSHVLAGVLPRQQFGIVQSKIYPVYFKVMIGSIGLSLVGY  267

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
            ++ + + + L+SK       +NLLSSLL+VL NLL+LEPRATK MF+RMK+EKEEGRG+ 
Sbjct  268  MMGE-KGKMLNSK-GHMVQFYNLLSSLLLVLGNLLFLEPRATKAMFDRMKLEKEEGRGRD  325

Query  441  STT-ETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRL  265
              +  T   D V  D +        +T     GGT    A+    +   + A K+++ +L
Sbjct  326  RVSAPTRVIDTVVDDSTGPIPTTTTTTTTTAAGGTTTAPASTAPARTPEDDAAKTKLAKL  385

Query  264  SRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
              +LKKLNSYSS LN++TLM LT +L +L+QRL
Sbjct  386  DNRLKKLNSYSSLLNIMTLMGLTWHLVYLSQRL  418


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 76/128 (59%), Gaps = 26/128 (20%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEK---KQEDVIVKDGHRVVVVEY--EKEHGNTKVLI  1435
             MMN++A+SL+ T+L  +G+ SP PEK   KQE VI+K+GHR VVVEY  +   GNTKVLI
Sbjct  1     MMNLIAISLITTSLVVSGLFSPNPEKNGGKQEQVIIKEGHRSVVVEYGDDISDGNTKVLI  60

Query  1434  S---PH-----ESSSEDVAAEKGGENDG-----------DGSYHRRTTAGELVCDAFGRC  1312
             S   P+     E+ S   A+  G   D            +G +  R    EL+CDA+G+C
Sbjct  61    SSPQPNKGPIDETLSHATASVAGKAQDMKEKAQDIVHGLNGPHGARPR--ELICDAYGKC  118

Query  1311  RRKIAGVF  1288
             + KIAGV+
Sbjct  119   KHKIAGVW  126



>ref|XP_002446504.1| hypothetical protein SORBIDRAFT_06g017050 [Sorghum bicolor]
 gb|EES10832.1| hypothetical protein SORBIDRAFT_06g017050 [Sorghum bicolor]
Length=574

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 142/238 (60%), Gaps = 19/238 (8%)
 Frame = -3

Query  825  RSAGR-AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            R A R A  + +L+G A A+G  VWVTF+SS+VLA ALPRQQ  + QSK++PVYF+AMAY
Sbjct  342  RDAARTATAVMHLLGFATAYGACVWVTFVSSHVLAAALPRQQLGLLQSKLFPVYFRAMAY  401

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
             +G A   H+L +     L S  ++    FNLL++L +V+ N+L LEP+ATKVMFERMK+
Sbjct  402  GVGLALAAHLLGRE----LRSVASR-AQSFNLLAALGLVVANMLLLEPKATKVMFERMKV  456

Query  468  EKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEK--KQRE  295
            EKEEGRG+    +      VT     AG     +           TA  + A    KQ +
Sbjct  457  EKEEGRGRDMVDDIVDPPVVTVATPGAGTTTTTTVPTAAAAARTGTAPVDGAGAGGKQAK  516

Query  294  RA---------EKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLH--VAC  154
             A          KS  +RLSR+LK+LN YSS  NV++LM LT +L HLA+RLH   AC
Sbjct  517  PATATAGDAEMSKSRAVRLSRRLKQLNGYSSLCNVLSLMSLTWHLVHLARRLHAGTAC  574



>gb|AFW58284.1| hypothetical protein ZEAMMB73_800275 [Zea mays]
Length=579

 Score =   150 bits (380),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 136/233 (58%), Gaps = 15/233 (6%)
 Frame = -3

Query  825  RSAGR-AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            R A R A  + +L+G A A+G  VWVTF+SS+VLA ALPRQQ  V QSK++PVYF+A+AY
Sbjct  353  REAARTATAVMHLLGFATAYGACVWVTFVSSHVLAAALPRQQLGVVQSKLFPVYFRALAY  412

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
             +G A   H+L      R            NLL++L +VL N+L LEP+AT+VMFERMK+
Sbjct  413  GVGLALAAHLLG-----RERGSLASRAQSLNLLAALGLVLANMLLLEPKATRVMFERMKV  467

Query  468  EKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERA  289
            EKEEGRG+    +      VT     AG     +  A         A T I ++ +   A
Sbjct  468  EKEEGRGR-DMADIVDPPVVTVATPTAGTTTVPTAAAAARTAPGDGAGTGIGKQSKPATA  526

Query  288  ------EKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLH--VAC  154
                   KS  +RLSR+LK+LN YSS  NV+ LM LT +L HLA+RLH   AC
Sbjct  527  TADAEMSKSRAVRLSRRLKQLNGYSSLCNVLCLMSLTWHLVHLARRLHAGTAC  579



>ref|XP_008663208.1| PREDICTED: transmembrane protein 205-like [Zea mays]
Length=217

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 132/222 (59%), Gaps = 14/222 (6%)
 Frame = -3

Query  795  NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
            +L+G A A+G  VWVTF+SS+VLA ALPRQQ  V QSK++PVYF+A+AY +G A   H+L
Sbjct  2    HLLGFATAYGACVWVTFVSSHVLAAALPRQQLGVVQSKLFPVYFRALAYGVGLALAAHLL  61

Query  615  SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGST  436
             + +               NLL++L +VL N+L LEP+AT+VMFERMK+EKEEGRG+   
Sbjct  62   GRER-----GSLASRAQSLNLLAALGLVLANMLLLEPKATRVMFERMKVEKEEGRGR-DM  115

Query  435  TETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERA------EKSEM  274
             +      VT     AG     +  A         A T I ++ +   A       KS  
Sbjct  116  ADIVDPPVVTVATPTAGTTTVPTAAAAARTAPGDGAGTGIGKQSKPATATADAEMSKSRA  175

Query  273  MRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLH--VAC  154
            +RLSR+LK+LN YSS  NV+ LM LT +L HLA+RLH   AC
Sbjct  176  VRLSRRLKQLNGYSSLCNVLCLMSLTWHLVHLARRLHAGTAC  217



>emb|CAD41023.1| OSJNBb0086G13.7 [Oryza sativa Japonica Group]
 emb|CAE03212.2| OSJNBa0088K19.14 [Oryza sativa Japonica Group]
Length=524

 Score =   149 bits (376),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 136/225 (60%), Gaps = 7/225 (3%)
 Frame = -3

Query  825  RSAGR-AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            R A R A  + +L+G A A+G S+WVTF+SSYVLA ALPRQQ A+ QSK++P+YF+A+AY
Sbjct  302  REAARTATAVMHLLGFAAAYGASLWVTFVSSYVLAAALPRQQLAMVQSKLFPMYFRAVAY  361

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
             +G A   H+L + +     S         NLL++L +VL N+L LEP+ATKVMFERMK+
Sbjct  362  GVGLALAAHLLGRER-----SSLAARAQSVNLLAALALVLANMLLLEPKATKVMFERMKV  416

Query  468  EKEEGRGKGSTTETEHGD-GVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
            EKEEGRG+      +     V    +A    V  +      G     A +  A     E+
Sbjct  417  EKEEGRGRDMADIVDPPTVTVAAGNTATTTTVPTAAARKPAGNNNMAAKSAAAAAPVDEQ  476

Query  291  AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVA  157
              KS +  L+++LKKLN YSS  NV+ LM LT +L HLA+RL +A
Sbjct  477  TSKSRVATLNQRLKKLNGYSSLCNVLCLMALTWHLVHLARRLQIA  521



>ref|XP_008339201.1| PREDICTED: uncharacterized protein LOC103402237 [Malus domestica]
Length=527

 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 139/217 (64%), Gaps = 10/217 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L GLA A+GM +W+TF+SS+VLA +LP QQF + QSKIY VYFKAMAYS+G A LGH
Sbjct  319  VAHLFGLATAYGMCMWITFVSSHVLAWSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGH  378

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
             L ++++     K       +NL+++L M+L N++YLEPR+TKVMFERMKIEKEEGRG+ 
Sbjct  379  -LWRHRSSLFRGKAADMLQNYNLIAALSMILFNMMYLEPRSTKVMFERMKIEKEEGRGR-  436

Query  441  STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLS  262
               E  H D     R +  A          +G  + T   ++  ++Q+      E +   
Sbjct  437  ---ERVHVDA----RISREAGQQQQQQTTTEGEPSITTPPQVXRREQQVVEPDIERLNEM  489

Query  261  RK-LKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            R+ LKKLN+ SSFLN+ +LM L+ +L +LAQ L  +C
Sbjct  490  REXLKKLNTCSSFLNIASLMALSWHLVYLAQHLPSSC  526


 Score = 52.4 bits (124),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 81/190 (43%), Gaps = 58/190 (31%)
 Frame = -3

Query  1515  EDVIVKDGHRVVVVEYEKEHGN--TKVLISPH---------------------------E  1423
             ++VIVK+GHRVVVVEY+ EHG+  TKV ISP                            +
Sbjct  49    QEVIVKNGHRVVVVEYD-EHGHHXTKVSISPEHGHPPXRESSSXSENEVSSPSKISRAFD  107

Query  1422  SSSEDVA-AEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGA  1246
             +S E++  A  G  N G G +    +  E + DA+  C+  IA   +  K+   E A GA
Sbjct  108   NSMENIKEAASGLANFGQG-HGEGHSPKEXMXDAYXXCKHNIASAIETKKEICKETAHGA  166

Query  1245  RGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVY  1066
             +    E   KV +     G                AV     + +DTV+DK        +
Sbjct  167   K----EAAHKVGEAAHRAGE---------------AVENVYERAKDTVSDKA-------H  200

Query  1065  EMEEGARDAI  1036
             E+EE ARD +
Sbjct  201   EVEETARDPM  210



>ref|XP_008352801.1| PREDICTED: uncharacterized protein LOC103416320 [Malus domestica]
Length=555

 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 140/218 (64%), Gaps = 11/218 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L GLA A+GM +W+TF+SS+VLA +LP QQF + QSKIY VYFKAMAYS+G A LGH
Sbjct  319  VAHLFGLATAYGMCMWITFVSSHVLAWSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGH  378

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
             L ++++     K       +NL+++L M+  N++YLEPR+TKVMFERMKIEKEEGRG+ 
Sbjct  379  -LWRHRSSLFRGKAADMLQNYNLIAALSMIXXNMMYLEPRSTKVMFERMKIEKEEGRGR-  436

Query  441  STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLS  262
               E  H D     R +  A          +G  + T   +++ ++Q+      E +   
Sbjct  437  ---ERVHVDA----RISREAGQQQQQQTTTEGEPSITTPPQVSRREQQVVEPDIERLNEM  489

Query  261  RK-LKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV-AC  154
            R+ LKKLN+ SSFLN+ +LM L+ +L +LAQ L + AC
Sbjct  490  RESLKKLNTCSSFLNIASLMALSWHLVYLAQHLPIHAC  527


 Score = 65.1 bits (157),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 87/192 (45%), Gaps = 58/192 (30%)
 Frame = -3

Query  1521  KQEDVIVKDGHRVVVVEYEKEHGN--TKVLISPH-------ESSS---------------  1414
             + ++VIVK+GHRVVVVEY+ EHG+  TKV ISP        ESSS               
Sbjct  47    RDQEVIVKNGHRVVVVEYD-EHGHHKTKVSISPEHGHPPRRESSSFSENEVSSPSKISRA  105

Query  1413  -----EDVA-AEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAE  1252
                  E++  A  G  N G G +    +  EL+CDA+GRC+  IA   +  K+   E A 
Sbjct  106   FDNSMENIKEAASGLANFGQG-HGEGHSPKELMCDAYGRCKHNIASAIETKKEICKETAH  164

Query  1251  GARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKK  1072
             GA+    E   KV +     G                AV     + +DTV+DK       
Sbjct  165   GAK----EAAHKVGEAAHRAGE---------------AVENVYERAKDTVSDKA------  199

Query  1071  VYEMEEGARDAI  1036
              +E+EE ARD +
Sbjct  200   -HEVEETARDPM  210



>emb|CAH66906.1| H0823A09.7 [Oryza sativa Indica Group]
 emb|CAH67298.1| OSIGBa0102D10.1 [Oryza sativa Indica Group]
Length=524

 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 136/225 (60%), Gaps = 7/225 (3%)
 Frame = -3

Query  825  RSAGR-AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            R A R A  + +L+G A A+G S+WVTF+SSYVLA ALPRQQ A+ QSK++P+YF+A+AY
Sbjct  302  REAARTATAVMHLLGFAAAYGASLWVTFVSSYVLAAALPRQQLAMVQSKLFPMYFRAVAY  361

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
             +G A   H+L + +     S         NLL++L +VL N+L LEP+ATKVMFERMK+
Sbjct  362  GVGLALAAHLLGRER-----SSLAARAQSVNLLAALALVLANMLLLEPKATKVMFERMKV  416

Query  468  EKEEGRGKGSTTETEHGD-GVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
            EKEEGRG+      +     V    +A    V  +      G     A +  A     E+
Sbjct  417  EKEEGRGRDMADIVDPPTVTVAAGNTATTTTVPTAAARKPAGNNNMAAKSAAAAAPVDEQ  476

Query  291  AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVA  157
              KS +  L+++LKKLN YSS  NV+ LM LT +L HLA+RL +A
Sbjct  477  TSKSRVATLNQRLKKLNGYSSLCNVLCLMALTWHLVHLARRLQMA  521



>gb|EAY94192.1| hypothetical protein OsI_15966 [Oryza sativa Indica Group]
Length=524

 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 136/225 (60%), Gaps = 7/225 (3%)
 Frame = -3

Query  825  RSAGR-AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            R A R A  + +L+G A A+G S+WVTF+SSYVLA ALPRQQ A+ QSK++P+YF+A+AY
Sbjct  302  REAARTATAVMHLLGFAAAYGASLWVTFVSSYVLAAALPRQQLAMVQSKLFPMYFRAVAY  361

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
             +G A   H+L + +     S         NLL++L +VL N+L LEP+ATKVMFERMK+
Sbjct  362  GVGLALAAHLLGRER-----SSLAARAQSVNLLAALALVLANMLLLEPKATKVMFERMKV  416

Query  468  EKEEGRGKGSTTETEHGD-GVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRER  292
            EKEEGRG+      +     V    +A    V  +      G     A +  A     E+
Sbjct  417  EKEEGRGRDMADIVDPPTVTVAAGNTATTTTVPTAAARKPAGNNNMAAKSAAAAAPVDEQ  476

Query  291  AEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVA  157
              KS +  L+++LKKLN YSS  NV+ LM LT +L HLA+RL +A
Sbjct  477  TSKSRVATLNQRLKKLNGYSSLCNVLCLMALTWHLVHLARRLQMA  521



>ref|XP_010431487.1| PREDICTED: uncharacterized protein LOC104715812 [Camelina sativa]
Length=516

 Score =   148 bits (373),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 133/397 (34%), Positives = 182/397 (46%), Gaps = 92/397 (23%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSE-DVAAEKGG----------------  1387
             D+IVKDGHRVVVVEY+++   NT+V ISP  +  E D    KGG                
Sbjct  37    DIIVKDGHRVVVVEYDRDGKTNTRVSISPPSADQEGDNEEGKGGSLFKNAKERVKETASH  96

Query  1386  ---------------ENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVF----DRTKDTAP  1264
                            +++ + S     TAGEL+CDAFG+CR+KIA V     DRT DT  
Sbjct  97    LPHVGQGISQPVITTKDETEESRDHHATAGELICDAFGKCRQKIASVVGRAKDRTDDTVG  156

Query  1263  EMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNK  1084
             E A     AV+     +++T                      ++     V DTVA K   
Sbjct  157   ETASDVEDAVARKAHDMKET----------------------ITHAARDVEDTVAGKARY  194

Query  1083  AAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMK  904
             A  KV       R+++  +  + +    G A                ++   ++K    K
Sbjct  195   AKDKVTGKAYDVRESVAHKAHDAKDKVRGKAYD--------------VKETVAQKAHESK  240

Query  903   EELSDRakkaeekvgeakdavKHNI---LRSAGRAFGMA--------------NLIGLAV  775
             E   DR +    ++ E       N    +++  R FG A               L G+A 
Sbjct  241   ERAKDRVRGKAHELKETVAHKSQNAWERVKNGVREFGSAAVGALSPTKVASVVGLTGIAA  300

Query  774   AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
             AFG  VWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I    LGH+LS+   ++
Sbjct  301   AFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLLGHVLSRR--RK  358

Query  594   LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMF  484
             L +  T+ + G NLLSS  M+  N  ++EPRATKVMF
Sbjct  359   LLTDATEMWQGVNLLSSFFMIEANKSFVEPRATKVMF  395



>ref|XP_008368140.1| PREDICTED: uncharacterized protein LOC103431746 [Malus domestica]
Length=536

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 139/215 (65%), Gaps = 10/215 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L GLA A+GM +W+TF+SS+VLA +LP QQF + QSKIY VYFKAMAYS+G A LGH
Sbjct  319  VAHLFGLATAYGMCMWITFVSSHVLAWSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGH  378

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
             L ++++     K       +NL+++L M+L N++YLEPR+TKVMFERMKIEKEEGRG+ 
Sbjct  379  -LWRHRSSLFRGKAADMLQNYNLIAALSMILFNMMYLEPRSTKVMFERMKIEKEEGRGR-  436

Query  441  STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLS  262
               E  H D     R +  A          +G  + T   +++ ++Q+      E +   
Sbjct  437  ---ERVHVDA----RISREAGQQQQQQTTTEGEPSITTPPQVSRREQQVVEPDIERLNEM  489

Query  261  RK-LKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV  160
            R+ LKKLN+ SSFLN+ +LM L+ +L +LAQ L +
Sbjct  490  RESLKKLNTCSSFLNIASLMALSWHLVYLAQHLPI  524



>emb|CBI35529.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 132/228 (58%), Gaps = 34/228 (15%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    + +++G A A+G+ VWVTF SS+VLA ALP QQFA+ QSKIYP YFK MA  +
Sbjct  163  AIGSLTCVIHILGFATAYGVRVWVTFFSSFVLAGALPNQQFAIVQSKIYPFYFKTMASCV  222

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G A LGH LSQ +   L       F G  LL++L ++L+NLLYLEPRATKVMFER+++E 
Sbjct  223  GLALLGHALSQGEKVLLGKPDL--FQGHALLATLHIILINLLYLEPRATKVMFERIRVEN  280

Query  462  EEGRGKGST-----TETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQR  298
            EE +G+ S+      E E   G +  +                              +  
Sbjct  281  EERKGQESSRVEPGKEGEPTTGASDPQVMG---------------------------RLD  313

Query  297  ERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            +    ++++ L+  LKKLN+YSS LN++TLM L L+L +LA RL++ C
Sbjct  314  QETVNNQILELNEMLKKLNAYSSLLNILTLMVLKLHLVYLAHRLYMTC  361


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 73/141 (52%), Gaps = 27/141 (19%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEKKQED------VIVKDGHRVVVVEYEKE-HGNTKV  1441
             MMN  AL L +++L  A + SP P++KQ+D      VIVK+G RVVVVEY+KE  GNTKV
Sbjct  1     MMNGFALFLAVSSLVAASIWSPNPDQKQKDYPGAEEVIVKEGTRVVVVEYDKEGPGNTKV  60

Query  1440  LISPHESSSEDVAAEKGGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPE  1261
              IS  E+                       T  EL+CDAFG+C+ KIA    R++    E
Sbjct  61    SISTQEA--------------------HHVTPKELICDAFGKCKEKIATKIGRSEQKVSE  100

Query  1260  MAEGARGAVSEGLGKVRDTVV  1198
                  +    E  GK ++ V+
Sbjct  101   KVHEIQEGAKETYGKAKEKVI  121



>emb|CAN77279.1| hypothetical protein VITISV_037453 [Vitis vinifera]
Length=345

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 133/223 (60%), Gaps = 24/223 (11%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    + +++G A A+G+ VWVTF SS+VLA ALP QQF + QSKIYP YFK MA  +
Sbjct  147  AIGSLTCVIHILGFATAYGVCVWVTFFSSFVLAGALPNQQFGIVQSKIYPFYFKIMASCV  206

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G A LGH LSQ +   L       F G  LL++L ++L+NLLYLEPRATKVMFER+++E 
Sbjct  207  GLALLGHALSQGEKVLLGKPDL--FQGHALLATLHIILINLLYLEPRATKVMFERIRVEN  264

Query  462  EEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEK  283
            EE +G+ S+      +G                       T   +  ++  +  +E    
Sbjct  265  EERKGQESSRVEPGKEG---------------------EPTTGASGPQVMGRLDQETV-N  302

Query  282  SEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            ++++ L+  LKKLN+YSSFLN++TLM L L+L +L  RL++ C
Sbjct  303  NQILELNEMLKKLNAYSSFLNILTLMVLKLHLVYLVHRLYMTC  345



>ref|XP_006859142.1| hypothetical protein AMTR_s00070p00109270 [Amborella trichopoda]
 gb|ERN20609.1| hypothetical protein AMTR_s00070p00109270 [Amborella trichopoda]
Length=472

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 147/482 (30%), Positives = 227/482 (47%), Gaps = 63/482 (13%)
 Frame = -3

Query  1533  APEKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGE---------  1384
             +P   Q +  VK+GHRV+VVEYE+E   +T+    P + S  + +A  G E         
Sbjct  21    SPPPPQPNT-VKEGHRVIVVEYERELPQHTQQHKIPADYSDREKSALLGKEKGVAEKLKE  79

Query  1383  ----------NDGDG-------SYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMA  1255
                       N G G       +  R + A + +CDA+G C+ +I+ +F   KD   +  
Sbjct  80    KYRDAACVLPNLGQGLSSSAESNAPRASNAKDKLCDAYGVCKDRISDIFGAAKDKVAQKV  139

Query  1254  EGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAK  1075
               +   V++ + + +D + DK S A E A    E+   +  E +GK +  +A  G +   
Sbjct  140   SESGERVADKVFETKDAIADKLSDAEESAKHGAEKLVHSGEELIGKAKTEIAHSGEEVNG  199

Query  1074  KVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRT------DASRKME  913
             K     + A ++I +  EN+               K   +   GMRT       + R + 
Sbjct  200   KAKNAGKMASESIKKTGENV----------FDNITKGGNKIKGGMRTAKKTIDTSQRDVR  249

Query  912   HMKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMANLIGLAVAFGMSVWVTFISSY  733
             H   ++  R  +          + +  +         + + +   VA+G+ VWVTF+ S+
Sbjct  250   HNLTDIIHRGWEVIPDAWLYAISPETLV-----SYMVVIHTLSFGVAYGVCVWVTFVLSH  304

Query  732   VLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnl  553
             VL++ALPRQQFA+ QSKIYPVYF+ M YS+G  FL H          +S   +     NL
Sbjct  305   VLSQALPRQQFALVQSKIYPVYFRTMMYSLGLCFLTHFFRHPWR---NSSIAEKLQSHNL  361

Query  552   lssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvd  373
             L+ L +VLVN+LYLEP+ATKVMFER+K+EKEEGRG+              D         
Sbjct  362   LACLGLVLVNMLYLEPQATKVMFERLKMEKEEGRGRD-----------IADIDERQMTNT  410

Query  372   gstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTL  193
              +T A   G +  +             A  S++ ++S++LK LN YSS LN+V LM LT 
Sbjct  411   TTTTATTSGASGLSTTGTTISGGAPHVAMTSKLEKMSKRLKSLNGYSSLLNLVALMGLTW  470

Query  192   YL  187
             ++
Sbjct  471   HV  472



>ref|XP_002521819.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40629.1| conserved hypothetical protein [Ricinus communis]
Length=494

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 141/399 (35%), Positives = 207/399 (52%), Gaps = 39/399 (10%)
 Frame = -3

Query  1344  GELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemay  1165
             GEL+CDAFG+C  K+A V  + KD   E A  A   + E   +V+    +   K   M +
Sbjct  127   GELICDAFGKCTHKLAKVIGKAKDQVSEKAHEAVSLMKEEAHEVKGVAQEMIHKKKRMEH  186

Query  1164  eaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEMEEGARDAITERLENLRasaagtass  985
             +AEE+    V +   K +D  + K ++A + V +  E  +++   + ++++  A  ++S 
Sbjct  187   QAEEK----VHDAYEKAKDMASQKAHEAKEVVEDAYEKTKESAARKAQDVKECAKESSSK  242

Query  984   akeaakeaaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNI-----LRS  820
             A+E AK A +     +T  S    ++ E+  +     +E     + +  H +        
Sbjct  243   AEETAKSAKDLG---KTIGSHIAANVSEQFENVKAGTQETRERVRRSFSHGVGYMGSTEG  299

Query  819   AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
                  G+ NL+G A A+GMSVWVTFISSYVLA AL R QF V QSKIYPVYF+AMAYSIG
Sbjct  300   VKSLMGVINLLGFATAYGMSVWVTFISSYVLANALTRHQFGVVQSKIYPVYFRAMAYSIG  359

Query  639   TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
              A LGH++         S+  + F  FNL++S+  VL N +YLEP AT          KE
Sbjct  360   VALLGHLVGHRNLA--FSRKAEMFQVFNLIASISAVLTNAIYLEPLAT----------KE  407

Query  459   EGRGKGS-TTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEK  283
             EGRG+ +   E+  G+     R    A   G+  A                +   ++  K
Sbjct  408   EGRGRENLAAESNKGEQEQLLRDVPAATAAGAAEATTA-----------TRENTEQQETK  456

Query  282   SEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
             S M+RL+   ++LNS SSFLNVVTLM LT +L +L+Q L
Sbjct  457   SRMVRLN---ERLNSCSSFLNVVTLMSLTWHLVYLSQCL  492



>ref|XP_004299879.1| PREDICTED: uncharacterized protein LOC101292414 [Fragaria vesca 
subsp. vesca]
Length=573

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 135/235 (57%), Gaps = 26/235 (11%)
 Frame = -3

Query  831  ILRSAGRAFGMAN-------LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYP  673
            +LRS G  F   +       L G A A+GMS+W+TF SSYVL++ L   QF + QSKIY 
Sbjct  355  MLRSTGALFQAVDPLFLGLSLFGFATAYGMSMWITFASSYVLSRVLSPYQFGMVQSKIYK  414

Query  672  VYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATK  493
            VYF AMA ++G A LGH+L  N  ++L  +       +NL+   LMVL N+ YLEP++TK
Sbjct  415  VYFAAMANTVGMALLGHLL--NPRRKLTGRNVDALQNYNLMLVELMVLFNMFYLEPKSTK  472

Query  492  VMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIA  313
            VMFE++K+EKEEGRG+        G+                    +      T  +E+ 
Sbjct  473  VMFEKLKLEKEEGRGREHVGTRTRGEA---------------ERQPLTAEPPTTTPSEVP  517

Query  312  EKKQR--ERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            E ++R   + +  ++    +KLKKLNSYSS LNV++LM LT +L +LA++L  +C
Sbjct  518  EGRERVMVQPQVDKLNEAHQKLKKLNSYSSILNVLSLMALTWHLVYLAKQLQSSC  572



>ref|XP_010474290.1| PREDICTED: uncharacterized protein LOC104753790, partial [Camelina 
sativa]
Length=362

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 156/357 (44%), Gaps = 90/357 (25%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSE-DVAAEKGG--------------  1387
             Q D+IVKDGHRVVVVEY+++   NT+V ISP  +  E D    KGG              
Sbjct  35    QGDIIVKDGHRVVVVEYDRDGKTNTRVSISPPSADQEGDNEEGKGGSLFKNAKERVKETA  94

Query  1386  -----------------ENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVF----DRTKDT  1270
                              +++ + S     TAGEL+CDAFG+CR+KIA V     DRT DT
Sbjct  95    SHLPHVGQGISQPVITTKDETEESRDHHATAGELICDAFGKCRQKIASVVGRAKDRTDDT  154

Query  1269  APEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKG  1090
               E A     AV+     +++T                      ++     V DTVA K 
Sbjct  155   VGETASDVEDAVARKAHDMKET----------------------ITHAARDVEDTVAGKA  192

Query  1089  NKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEH  910
               A  KV       R+++  +  + +    G A                ++   ++K   
Sbjct  193   RYAKDKVTGKAYDVRESVAHKAHDAKDKVRGKAYD--------------VKETVAQKAHE  238

Query  909   MKEELSDRakkaeekvgeakdavKHNI---LRSAGRAFGMA--------------NLIGL  781
              KE   DR +    ++ E       N    +++  R FG A               L G+
Sbjct  239   SKERAKDRVRGKAHELKETVAHKSQNAWERVKNGVREFGSAAVGALSPTKVASVVGLTGI  298

Query  780   AVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQ  610
             A AFG  VWVTF+SSYVLA  L RQQF V QSK+YPVYFKA +  I    LGH+LS+
Sbjct  299   AAAFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKATSVGILVGLLGHVLSR  355



>gb|AHF21579.1| late embryogenesis abundant protein [Tamarix hispida]
Length=434

 Score =   141 bits (355),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 142/405 (35%), Positives = 194/405 (48%), Gaps = 70/405 (17%)
 Frame = -3

Query  1536  PAPEKKQEDVIVKDGHRVVVVEYE-----KEHGNTKVLIS---PH-ESSSEDVAAEKGGE  1384
             PAP K+ +D+I K GHR V+VEY      +E G TKVLIS   P+ + + E V  E    
Sbjct  25    PAP-KQDQDMIHKGGHRAVLVEYADTTGGREGGETKVLISRSTPNTKHTIETVEDEVSSV  83

Query  1383  NDGDGSYHRRTTAGE--LVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAV--------  1234
                      + T G   L+CD +G+C+  IA V    +D   E  EG   AV        
Sbjct  84    AASVAGIAEKATGGPKGLICDVYGKCKHTIADVLRNGEDKVAE--EGTEEAVYKTKDAAH  141

Query  1233  --SEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVYEM  1060
                E +G V     D  SK               V E + +    + +K  +AA+   + 
Sbjct  142   VAKEAVGGVAQEAKDAASK---------------VKETMEESAAKMGEKARRAAQATVDK  186

Query  1059  EEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEELSD--R  886
              +   + +++++ +++  A                     + +A R  +  K+ELSD  R
Sbjct  187   SKRTGEHVSDKIGDMKDEA---------------------KEEAKRLGKKGKKELSDIAR  225

Query  885   akkaeekvgeakdavKHNI--LRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALP  712
               K               +  L +  +  G+A   G+      S+WVTF+ S+VLA  LP
Sbjct  226   RGKEVIYDIFGYIFSIETVDSLTNVVQLMGLATAYGV------SIWVTFVMSHVLASVLP  279

Query  711   RQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmv  532
             RQQF V QSKIYPVYFK MA  IG A  GH+L Q +     S       G+NLLSSLL V
Sbjct  280   RQQFGVVQSKIYPVYFKVMASGIGAALAGHLLGQRKKLFDDSNRAGLVQGYNLLSSLLFV  339

Query  531   lvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDR  397
             L NLL LEPRATKVMFERMK+EKEEGRG+ S++ T H  G  + R
Sbjct  340   LANLLILEPRATKVMFERMKLEKEEGRGRESSSFTGHRQGKNQPR  384



>ref|XP_002893240.1| hypothetical protein ARALYDRAFT_472499 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69499.1| hypothetical protein ARALYDRAFT_472499 [Arabidopsis lyrata subsp. 
lyrata]
Length=379

 Score =   137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 125/216 (58%), Gaps = 26/216 (12%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +  ++G+A A+GM VWVTF+S YVLA  L  QQF V QSK+YPVYFKA+   I    LGH
Sbjct  190  VVGIVGIAAAYGMCVWVTFVSGYVLASVLGEQQFGVVQSKMYPVYFKAVTVGILVGLLGH  249

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
            ++S+   +++ +     +   NLL+S+LMV  N  +++PRATK MFE +K EKEEGRG  
Sbjct  250  VISRR--RKVFTDAVDMWQAVNLLASILMVEANASFVDPRATKAMFELIKAEKEEGRGL-  306

Query  441  STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLS  262
             T+ET+  +   + R                         ++ EK  ++ A K  +  LS
Sbjct  307  DTSETQSSETAARTR----------------------GKKKVTEKMDQD-AVKQRLTNLS  343

Query  261  RKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             ++ +LN+YSS LN++TLM LT +  +L  RL + C
Sbjct  344  ERMYRLNAYSSRLNLLTLMSLTWHFVYLGDRLSLTC  379


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 55/99 (56%), Gaps = 12/99 (12%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISP---HESSSEDVAAEKGGENDGDGSY------  1363
             D+IVKDGHRVVVVEY+ +   NT+VLISP    E    D     G E     S       
Sbjct  26    DIIVKDGHRVVVVEYDGDVETNTRVLISPPGKEEEKRRDEGEVFGNEKKETASSLPEEEE  85

Query  1362  -HRRTTAGELVCDAFGRCRRKIAGVFDRTKD-TAPEMAE  1252
                  + GEL+CDA G+C+ K+A V  R KD TA +++E
Sbjct  86    REHHASPGELICDAIGKCKHKMATVLGRVKDRTASDLSE  124



>emb|CBI35531.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   134 bits (336),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 128/215 (60%), Gaps = 24/215 (11%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    + +++G A A+G+ VWVTF SS+VLA ALP QQF + QSKIYP YFK MA  +
Sbjct  96   AIGSLTCVIHILGFATAYGVCVWVTFFSSFVLAGALPNQQFGIVQSKIYPFYFKIMASCV  155

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G A LGH LSQ +   L       F G  LL++L ++L+NLLYLEPRATKVMFER+++E 
Sbjct  156  GLALLGHALSQGEKVLLGKPDL--FQGHALLATLHIILINLLYLEPRATKVMFERIRVEN  213

Query  462  EEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEK  283
            EE +G+ S+      +G                       T   +  ++  +  +E    
Sbjct  214  EERKGQESSRVEPGKEG---------------------EPTTGASGPQVMGRLDQETV-N  251

Query  282  SEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHL  178
            ++++ L+  LKKLN+YSSFLN++TLM L L+L +L
Sbjct  252  NQILELNEMLKKLNAYSSFLNILTLMVLKLHLVYL  286



>ref|XP_006305902.1| hypothetical protein CARUB_v10011076mg [Capsella rubella]
 gb|EOA38800.1| hypothetical protein CARUB_v10011076mg [Capsella rubella]
Length=382

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 123/228 (54%), Gaps = 32/228 (14%)
 Frame = -3

Query  819  AGRAFGMAN------LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKA  658
             G A G+        L+G+A A+GM VWVTF+S YVLA  L RQQF V QSK+YPVYFKA
Sbjct  181  VGTALGLTKIGSVMGLVGIAAAYGMCVWVTFVSGYVLASVLGRQQFDVVQSKMYPVYFKA  240

Query  657  MAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFER  478
            ++  I    LGH++S+   +++ +     +   NLLSS+LMV  N  +++PR TK MFER
Sbjct  241  VSVGILIGLLGHVISRR--RKVFTDAVDMWQAVNLLSSILMVEANASFVDPRVTKAMFER  298

Query  477  MKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQR  298
            +K EKEEGRG   T+E+   +   +                       T   ++ EK   
Sbjct  299  IKAEKEEGRGL-DTSESHSSETAAR-----------------------TIGKKVREKMDE  334

Query  297  ERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
                   + +LS +   LN+YSS LN++T M LT +  +L  RL + C
Sbjct  335  AGGVNQRLRKLSERHCTLNAYSSLLNLLTFMSLTWHFVYLGHRLSLTC  382


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 55/100 (55%), Gaps = 14/100 (14%)
 Frame = -3

Query  1533  APEKKQEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGENDGDG----  1369
             + E   E+VIVKDGHRVVVVEY+ +   NT+VLI P     E+   +KG E  G+     
Sbjct  20    STESDSEEVIVKDGHRVVVVEYDADGKTNTRVLIQP-PGKEEEKRIDKGEEVFGNAKRET  78

Query  1368  --------SYHRRTTAGELVCDAFGRCRRKIAGVFDRTKD  1273
                        R  + GELVCDA G+C+ K+A V  + KD
Sbjct  79    ASSLSEEKELERHLSPGELVCDALGKCKHKMATVLGKVKD  118



>ref|NP_173674.1| Late embryogenesis abundant protein (LEA) family protein [Arabidopsis 
thaliana]
 gb|AAF18519.1|AC006551_5 Similar to seed maturation protein PM27 [Arabidopsis thaliana]
 gb|AAX23755.1| hypothetical protein At1g22600 [Arabidopsis thaliana]
 gb|AAZ52683.1| hypothetical protein At1g22600 [Arabidopsis thaliana]
 gb|AEE30259.1| Late embryogenesis abundant protein (LEA) family protein [Arabidopsis 
thaliana]
Length=385

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 123/216 (57%), Gaps = 25/216 (12%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +  ++G+A A+GM VWVTF+S YVLA  L  QQF V QSK+YPVYFKA++  I    LGH
Sbjct  195  VVGIVGIAAAYGMCVWVTFVSGYVLASVLGEQQFGVVQSKMYPVYFKAVSVGILVGLLGH  254

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
            ++ +   +++ +     +   NLLSS+LMV  N  ++  RATK MFE +K EKE+GRG  
Sbjct  255  VIGRR--RKVFTDAVDMWQSVNLLSSILMVEANASFVYTRATKAMFELIKAEKEDGRGFD  312

Query  441  STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLS  262
            ++ +++  +   + R                         ++ EK   E   K  + +LS
Sbjct  313  TSDQSQSSESAGRTR----------------------GKKKVTEKTD-EDVVKQRLTKLS  349

Query  261  RKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             +++KLN+YSS LN++TLM LT +  +L  RL + C
Sbjct  350  ERMRKLNAYSSRLNLLTLMSLTWHFVYLGYRLSLTC  385


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 19/105 (18%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEKGGENDGDGSYHRRT---  1351
             ++D+IV+DGHRVVVVEY+++   NT+VLISP     ++V  +   E +  G+  R T   
Sbjct  24    EDDIIVRDGHRVVVVEYDRDGETNTRVLISP---PGKEVDQKSRDEGEVFGNEKRETASS  80

Query  1350  -----------TAGELVCDAFGRCRRKIAGVFDRTKD-TAPEMAE  1252
                        T GEL+CDA G+C+ K+  V  R KD TA ++++
Sbjct  81    LPEEEEREHHATPGELICDAIGKCKHKLGTVLGRVKDRTASDLSD  125



>gb|KDO38275.1| hypothetical protein CISIN_1g037813mg, partial [Citrus sinensis]
Length=371

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 186/390 (48%), Gaps = 100/390 (26%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAP----EKKQEDVIV-KDGHRVVVVEYEKEHG--NTKV  1441
             MMN++A+ LV ++LA AGV SP+P    E  +E+VIV K+GHRVVVVEY+ EHG  NTKV
Sbjct  1     MMNLVAICLVASSLAAAGVWSPSPSLEKENNKEEVIVMKEGHRVVVVEYD-EHGRHNTKV  59

Query  1440  LISPHE----------SSSEDV------AAEKGGEN----------------DGDGSYHR  1357
              ISP +          S + D+      AA     N                 G   Y +
Sbjct  60    SISPPDHDRYHIPKTASPASDIEQKIFSAATDALNNAEDTIKQASSLLPDIGQGSKPYDK  119

Query  1356  RTTAGELVCDAFGRCRRKIAGVFDRTK---------------------------------  1276
              T  GEL+CDA+G+C+ KIAG  ++ K                                 
Sbjct  120   GTGPGELICDAYGKCKHKIAGALEKAKGSLSGASHEVPAPHKGMAHEAKEVLSKTGHEFI  179

Query  1275  DTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVAD  1096
             DT  +M   A+ AV +  GK ++T  +K  +           A+ A  + LGK +DT   
Sbjct  180   DTKKQMDHEAKDAVRDAYGKAKETASEKAHR-----------AKEAAKDALGKAKDT---  225

Query  1095  KGNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKM  916
                 A++K +E +E A+DA+ +  +     A     + K+A          +  + S ++
Sbjct  226   ----ASEKAHEAKEAAKDALGKAKDTASQKAYEAKENLKDARAIGTTIRGDIARNVSEQV  281

Query  915   EHMKEELSDRakkaeekvgeakd---avKHNILRSAG------RAFGMANLIGLAVAFGM  763
             E++ E + ++AK+A +    A        +  LR  G         G+ NL+G + A+GM
Sbjct  282   ENVCESVEEKAKEARQGTEHAAKWIGQYSYGFLRYLGIPETLNALMGVINLLGFSTAYGM  341

Query  762   SVWVTFISSYVLAKALPRQQFAVAQSKIYP  673
             SVWVTFISSYVLA ALPR QF + QSKIYP
Sbjct  342   SVWVTFISSYVLAGALPRHQFGMVQSKIYP  371



>ref|XP_010460015.1| PREDICTED: uncharacterized protein LOC104740962 [Camelina sativa]
Length=379

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 129/226 (57%), Gaps = 33/226 (15%)
 Frame = -3

Query  819  AGRAFGM------ANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKA  658
             G+A G+        L+G+A A+GM VWVTF+S YVL   L RQQ+ V QSK+YPVYFKA
Sbjct  180  VGKALGLTKIGSVVGLVGIAAAYGMCVWVTFVSGYVLGSVLGRQQYDVVQSKMYPVYFKA  239

Query  657  MAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFER  478
            ++  I  A LGH++S+   +++ +     +   NLLSS+LMV  N  +++PR TK MFER
Sbjct  240  VSVGILIALLGHVISRR--RKVFTDAVDMWQAVNLLSSILMVEANASFVDPRVTKAMFER  297

Query  477  MKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQR  298
            +K EKE+GRG   T+E++  +   K                       T   +I EK   
Sbjct  298  IKAEKEDGRGL-DTSESQSSETAAK-----------------------TIGKKIREKMD-  332

Query  297  ERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV  160
            E   K  + +LS +  +LN+YSS LN++TL+ LT +  +L  RL++
Sbjct  333  EDGVKQRLKKLSERHCRLNAYSSRLNLLTLISLTWHFVYLGHRLNL  378


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 50/97 (52%), Gaps = 12/97 (12%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSE-----------DVAAEKGGENDG  1375
             + +VIVKDGHRVVVVEY+++   NT+V I P     E           +   E    +  
Sbjct  24    ESEVIVKDGHRVVVVEYDRDGKTNTRVSIQPPGKQEEKRRDKGEVLFGNAKRETSSSHSE  83

Query  1374  DGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAP  1264
             +       + GELVCDA G+C+ K+A V  R KD  P
Sbjct  84    EKEREHHVSPGELVCDALGKCKHKMATVLGRFKDLTP  120



>ref|XP_010095892.1| hypothetical protein L484_008289 [Morus notabilis]
 gb|EXB62486.1| hypothetical protein L484_008289 [Morus notabilis]
Length=486

 Score =   129 bits (323),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 134/215 (62%), Gaps = 27/215 (13%)
 Frame = -3

Query  804  GMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLG  625
            G+  L+  + A+G +VW TFI SYVLA ALPRQQF V QSKIYPVYF+ MA+ IGTA LG
Sbjct  297  GVVYLVTFSTAYGTAVWETFILSYVLAGALPRQQFGVVQSKIYPVYFRTMAWGIGTAVLG  356

Query  624  HILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
             +++     +  S   + F  FNLL+SL++V VN+LYLEPRATKVMFERM++EKEEGRG+
Sbjct  357  LLVTGR--GKAFSSMAEKFQIFNLLASLVLVFVNMLYLEPRATKVMFERMRVEKEEGRGR  414

Query  444  GSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRL  265
                  +                             ++   E AE    + A ++ ++ L
Sbjct  415  EELPAEQPSAA---------------------EPAVSSMPAETAE----QEAVRNRILSL  449

Query  264  SRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV  160
            + +LKKLN++SSFLN+++LM L+ ++ +L QRLH+
Sbjct  450  NGRLKKLNTWSSFLNILSLMSLSWHVYYLGQRLHM  484


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 84/155 (54%), Gaps = 22/155 (14%)
 Frame = -3

Query  1599  MMNvlalslvlttlatagvlSPAPEKKQ--EDVIVKDGHRVVVVEYEKE-HGNTKVLISP  1429
             MMNV++L LV+T+L TAGVLSP P+K+   +D+IVK+GHRVVVVEY++E    TKV ISP
Sbjct  1     MMNVVSLCLVVTSLVTAGVLSPTPKKQNNGDDLIVKEGHRVVVVEYDQEGQPITKVSISP  60

Query  1428  HESSSEDVAAEKGGE------NDGDGSYHRRT-------------TAGELVCDAFGRCRR  1306
              + + +   ++K  E      N G G    +              +  EL+CDA+G+C+ 
Sbjct  61    EDKTRQRFNSDKLKEAASVLPNLGQGLSTPKADGGGEGEGDGEWRSPKELICDAYGKCKH  120

Query  1305  KIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTV  1201
             KI     RTK+   E A        E   K  D V
Sbjct  121   KIVDAIGRTKEAVSEKAHDVAEKTKEMKEKAEDVV  155



>ref|XP_008361625.1| PREDICTED: seed biotin-containing protein SBP65-like [Malus domestica]
Length=486

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L GLA A+GM +W+TF+SS+VLA +LP QQF + QSKIY VYFKAMAYS+G A LGH
Sbjct  319  VAHLFGLATAYGMCMWITFVSSHVLAWSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGH  378

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
             L ++++     K       +NL+++L M+L N++YLEPR+TKVMFERMKIEKEEGRG+
Sbjct  379  -LWRHRSSLFRGKAADMLQNYNLIAALSMILFNMMYLEPRSTKVMFERMKIEKEEGRGR  436



>gb|EMS55518.1| hypothetical protein TRIUR3_20741 [Triticum urartu]
Length=612

 Score =   128 bits (322),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 133/397 (34%), Positives = 178/397 (45%), Gaps = 71/397 (18%)
 Frame = -3

Query  1281  TKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTV  1102
              KD A E    A+G VSE  G+ ++    K S   + A E    A+G VSE  G  +D V
Sbjct  266   VKDKAAETVTNAKGKVSEAAGEAKE----KASHVKDRAAETVTSAKGKVSEAAGNAKDKV  321

Query  1101  AD------------KGNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaakeaa  958
             +D             GN AA+KV   EE A+    E  +NL                   
Sbjct  322   SDIAERAEDYAGDAAGN-AAEKVARAEEVAKAKAGEGTKNL-------------------  361

Query  957   ekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMANLIGLA  778
                    TD +R+    +E  SD A                  + +A  A  + +L+G A
Sbjct  362   -------TDIARRA---REVASDAAGYLLGAP-----------MEAARTATAVMHLLGFA  400

Query  777   VAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQ  598
              A+G  VWVTF+SS+VLA +LPRQQ  V QSK+YPVYF+AMAY +G A   H+L      
Sbjct  401   TAYGACVWVTFVSSHVLAASLPRQQLGVVQSKLYPVYFRAMAYCVGLALAAHLLG-----  455

Query  597   RLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETEHG  418
             R  S        FNLLS+L +VL N+L LEP+ATKVMFERMK+EKEEGRG+  +   +  
Sbjct  456   RERSSFAARAQTFNLLSALGLVLANMLLLEPKATKVMFERMKVEKEEGRGRDMSDIIDPP  515

Query  417   DGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNS  238
                    +        + GA                          +      K+ +LN 
Sbjct  516   AVTVATAATTTTAAPTAAGARSPVDGTTGTVRAAKTTTTTTSVTAPDAEMAKSKVVRLNK  575

Query  237   YSSFLN-------VVTLMCLTLYLAHLAQRLHV--AC  154
                 LN       V++LM LT +L HLA+RL +  AC
Sbjct  576   RLKQLNGYSSLCNVLSLMALTWHLVHLARRLQMSTAC  612



>ref|XP_006416182.1| hypothetical protein EUTSA_v10008247mg [Eutrema salsugineum]
 gb|ESQ34535.1| hypothetical protein EUTSA_v10008247mg [Eutrema salsugineum]
Length=315

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 122/212 (58%), Gaps = 26/212 (12%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +LIG+A A+GM VWVT +S YV+   L R+QF V Q+K+Y VYFKA++ +I    LGH
Sbjct  126  VVSLIGIAAAYGMCVWVTVVSRYVMVSVLGRKQFGVVQTKVYAVYFKAISVAILIGLLGH  185

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
            ++ +   +++ +   + +   NL SS+L+V  N  ++EPRA K MFER+K+EKEEGRG  
Sbjct  186  VIGRR--RKVITDAVEMWQVVNLFSSILLVEANASFVEPRAIKTMFERIKVEKEEGRGV-  242

Query  441  STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLS  262
             T+E+   +   +                       T   ++ EK   E     ++ +L+
Sbjct  243  DTSESHSSEAAAQ-----------------------TCGKKVREKTMDEDGVNHKLTKLN  279

Query  261  RKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
             +L +LN+YSS LN++TLM LT +  +L  RL
Sbjct  280  ERLSRLNAYSSRLNLLTLMSLTWHFVYLGHRL  311



>emb|CDY69861.1| BnaCnng65680D [Brassica napus]
Length=392

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 122/216 (56%), Gaps = 35/216 (16%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +LIG+A AFGM VWVT +S Y+LA  L R +F+VAQSK+Y VYFKA++  +    LGH
Sbjct  196  VVSLIGIAAAFGMCVWVTVVSKYLLASVLGRHRFSVAQSKVYSVYFKAISVGLLVGLLGH  255

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
            ++S+   +++ +   + +   NLLSS+LMV  N  ++EPRA K MFER+K+EKEEGRG  
Sbjct  256  VISRR--RKVLTDAVEMWQAVNLLSSILMVEANASFVEPRAIKAMFERIKVEKEEGRGLD  313

Query  441  STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQR----ERAEKSEM  274
              +E+   +   +                               KK R    E A    +
Sbjct  314  K-SESHSSEAAART----------------------------CGKKVRYNMDEDAVNRRL  344

Query  273  MRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
             +L+ +L +LN+YSS LN++TLM LT +  +L  RL
Sbjct  345  KKLNERLSRLNAYSSRLNLLTLMSLTWHFVYLGHRL  380


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 22/100 (22%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEK-------------------  1393
             ++IVKDGHRVVVVEY+ +   NT+VL+SP E   E +  ++                   
Sbjct  27    EIIVKDGHRVVVVEYDADGKTNTRVLMSPPERGQEQIGDQREMFRNVKRKVIETPSSLPV  86

Query  1392  GGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKD  1273
               + + +   H   +AGE++CDA G+C+ K+A V  R  D
Sbjct  87    SDQVEEERELH--ASAGEIICDAIGKCKNKVASVLGRVDD  124



>ref|XP_010498737.1| PREDICTED: uncharacterized protein LOC104776381 [Camelina sativa]
Length=379

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 129/231 (56%), Gaps = 41/231 (18%)
 Frame = -3

Query  822  SAGRAFGM------ANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK  661
            + G+A G+        L+G+A A+GM VWVTF+S YVL   L RQQ+ V QSK+YPVYFK
Sbjct  179  TVGKALGLTKIGSVVGLVGIAAAYGMCVWVTFVSGYVLGSVLGRQQYDVVQSKMYPVYFK  238

Query  660  AMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFE  481
            A++  I  A LGH++S+   +++ +     +   NLLSS+LMV  N  +++PR TK +FE
Sbjct  239  AVSVGILIALLGHVISRR--RKVFTDAVDMWQAVNLLSSILMVEANASFVDPRVTKAIFE  296

Query  480  RMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQ  301
            R+K  KE+GRG   T +++  +                             A +   KK 
Sbjct  297  RIKAGKEDGRGL-DTPDSQSSE----------------------------TAAQTIGKKI  327

Query  300  RERAE----KSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV  160
            RE+ +    K  + +LS +  +LN+YSS LN++TL+ LT +  +L  RL++
Sbjct  328  REKMDEDGVKQRLKKLSERHCRLNAYSSRLNLLTLISLTWHFVYLGHRLNL  378


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 52/97 (54%), Gaps = 12/97 (12%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISP----HESSSEDVAAEKGGENDGDGSYH--  1360
             + +VIVKDGHRVVVVEY+++   NT+V I P     E   +      G  N    S+H  
Sbjct  24    ESEVIVKDGHRVVVVEYDRDGKTNTRVSIQPPGKEEEKRRDKGEVLFGNANRETSSFHSE  83

Query  1359  -----RRTTAGELVCDAFGRCRRKIAGVFDRTKDTAP  1264
                     + GELVCDA G+C+ K+A V  R KD  P
Sbjct  84    EKEREHHVSPGELVCDALGKCKLKMATVLGRFKDLTP  120



>gb|KFK44353.1| hypothetical protein AALP_AA1G246500 [Arabis alpina]
Length=369

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 121/221 (55%), Gaps = 37/221 (17%)
 Frame = -3

Query  804  GMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLG  625
             + +L+G+A A+GM VWVT +S Y+LA  L RQQ  V QSK+YPVYFKA++ +I    LG
Sbjct  182  SVVSLMGIATAYGMCVWVTVVSRYLLASVLGRQQSDVVQSKVYPVYFKAISVAILLGLLG  241

Query  624  HILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
            H++S+   +++ +   + +   NLLSS+LMV  N  ++E RA K +FE +K EKE+GRG 
Sbjct  242  HVISRR--RKVLTDALEMWQAVNLLSSILMVEANASFVESRAIKTLFELIKAEKEDGRGL  299

Query  444  GSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAE----KSE  277
            G +  +E                                    + KK  E+ E    K  
Sbjct  300  GGSESSETA-------------------------------ARTSAKKVLEKTEDVTVKQR  328

Query  276  MMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            + +L+ +L +LNSYS  LN++TLM LT +  +L  RL + C
Sbjct  329  LAKLTERLSRLNSYSWRLNILTLMSLTWHFVYLGHRLSLTC  369


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 18/118 (15%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDV-----------AAEKGGENDG  1375
             + DVIVKDGHRVVVVEY+++   NT+VLI+P E  +E+V           A+    E + 
Sbjct  24    ESDVIVKDGHRVVVVEYDQDGKTNTRVLITPPEKEAEEVFGNAKKRAIETASYLPAEEER  83

Query  1374  DGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTV  1201
             +G    R    E + DA  +C+ K+A V     D  P  +E A+ AVS     V +T+
Sbjct  84    EGHVSPR----EFIRDAIRKCKHKMASVLRVVND--PTASETAQEAVSRAARDVEETL  135



>emb|CDY25745.1| BnaA07g10370D [Brassica napus]
Length=384

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 120/217 (55%), Gaps = 35/217 (16%)
 Frame = -3

Query  804  GMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLG  625
             + +LIG+A AFGM VWVT ++ Y+LA  L R +F VAQSK+Y VYFKA++  +    LG
Sbjct  195  SVVSLIGIAAAFGMCVWVTVVTKYLLASVLGRHRFGVAQSKVYSVYFKAISVGLLVGLLG  254

Query  624  HILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
            H++SQ   +++ +   + +   NLLSS+LMV  N  ++EPR  K MFER+K+EKEEGRG 
Sbjct  255  HVISQR--RKVLTDAVEMWQAVNLLSSILMVEANASFVEPRVIKAMFERIKVEKEEGRGL  312

Query  444  GSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQR----ERAEKSE  277
               +E+   +   +                               KK R    E A    
Sbjct  313  DK-SESHSSEAAART----------------------------CGKKVRYNMDEDAVNRR  343

Query  276  MMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
            + +L+ +L +LN+YSS LN++TLM LT +  +L  RL
Sbjct  344  LKKLNERLSRLNAYSSRLNLLTLMSLTWHFVYLGHRL  380


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 22/100 (22%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEK-------------------  1393
             ++IVKDGHRVVVVEY+ +   NT+VLISP E   E +  ++                   
Sbjct  27    EIIVKDGHRVVVVEYDADGKTNTRVLISPPERGQEQIGDQREMFRNVKRKVIETPSSLPV  86

Query  1392  GGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKD  1273
               + + +   H   + GEL+CDA G+C+ K+A V  R  D
Sbjct  87    SDQVEEERELH--ASPGELICDAIGKCKHKVASVLGRVDD  124



>ref|XP_009103229.1| PREDICTED: uncharacterized protein LOC103829321 [Brassica rapa]
Length=384

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 120/217 (55%), Gaps = 35/217 (16%)
 Frame = -3

Query  804  GMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLG  625
             + +LIG+A AFGM VWVT ++ Y+LA  L R +F VAQSK+Y VYFKA++  +    LG
Sbjct  195  SVVSLIGIAAAFGMCVWVTVVTKYLLASVLGRHRFGVAQSKVYSVYFKAISVGLLVGLLG  254

Query  624  HILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
            H++SQ   +++ +   + +   NLLSS+LMV  N  ++EPR  K MFER+K+EKEEGRG 
Sbjct  255  HVISQR--RKVLTDAVEMWQAVNLLSSILMVEANASFVEPRVIKAMFERIKVEKEEGRGL  312

Query  444  GSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQR----ERAEKSE  277
               +E+   +   +                               KK R    E A    
Sbjct  313  DK-SESHSSEAAART----------------------------CGKKVRYNMDEDAVNRR  343

Query  276  MMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
            + +L+ +L +LN+YSS LN++TLM LT +  +L  RL
Sbjct  344  LKKLNERLSRLNAYSSRLNLLTLMSLTWHFVYLGHRL  380


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 22/100 (22%)
 Frame = -3

Query  1512  DVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSEDVAAEK-------------------  1393
             ++IVKDGHRVVVVEY+ +   NT+VLISP E   E +  ++                   
Sbjct  27    EIIVKDGHRVVVVEYDADGKTNTRVLISPPERGQEQIGDQREMFRNVKRKVIETPSSLPV  86

Query  1392  GGENDGDGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKD  1273
               + + +   H   + GEL+CDA G+C+ K+A V  R  D
Sbjct  87    SDQVEEERELH--ASPGELICDAIGKCKHKVASVLGRVDD  124



>dbj|BAJ91683.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=584

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 90/128 (70%), Gaps = 5/128 (4%)
 Frame = -3

Query  828  LRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            + +A  A  + +L+G A A+G  VWVTF+SS+VLA +LPRQQ  V QSK+YPVYF+AMAY
Sbjct  356  MEAARTATAVMHLLGFATAYGACVWVTFVSSHVLAASLPRQQLGVVQSKLYPVYFRAMAY  415

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKI  469
             +G A   H+L      R  S        FNLLS+L +VL N+L LEP+ATKVMFERMK+
Sbjct  416  CVGLALAAHLLG-----RERSSFAARAQSFNLLSALGLVLANMLLLEPKATKVMFERMKV  470

Query  468  EKEEGRGK  445
            EKEEGRG+
Sbjct  471  EKEEGRGR  478


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = -3

Query  285  KSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV--AC  154
            KS+++RL+++LK+LNSYSS  NV++LM LT +L HLA+RL +  AC
Sbjct  539  KSKVVRLNKRLKQLNSYSSLCNVLSLMALTWHLVHLARRLQMSAAC  584



>ref|XP_009414887.1| PREDICTED: uncharacterized protein LOC103995882 [Musa acuminata 
subsp. malaccensis]
Length=487

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 134/219 (61%), Gaps = 19/219 (9%)
 Frame = -3

Query  810  AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAF  631
            A  + +L+G A A+G SVWVTF+S  VLA ALPRQQF + QSK+YPVYF+ +AYS     
Sbjct  288  AAAILHLLGFATAYGASVWVTFVSGNVLATALPRQQFGLVQSKLYPVYFRLVAYSTALTL  347

Query  630  LGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
            + H   ++  +R+ ++  Q   G+NL  +L++VL+N+ +LEP+ATKVMFERMKIEKEEGR
Sbjct  348  VAHFFGRD--RRILAERVQ---GYNLFGALVLVLINMFFLEPKATKVMFERMKIEKEEGR  402

Query  450  GKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMM  271
            G              +D +   A       A V   T AT           +   K  ++
Sbjct  403  G--------------RDMADVMAEPPVMASAPVGTTTTATKTARATSASVEQDGVKCGLV  448

Query  270  RLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
             L+R+LKKLN+YSS LN++TLM L+ +L HLA++  V+C
Sbjct  449  HLNRRLKKLNTYSSLLNLLTLMSLSWHLVHLARQSQVSC  487



>ref|XP_008368141.1| PREDICTED: transmembrane protein 205-like [Malus domestica]
Length=211

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L GLA A+GM +W+T +SS+VLA +LP QQF + QSKIY VYFKAMAYS+  A LGH
Sbjct  99   VAHLFGLATAYGMCMWITLVSSHVLAGSLPPQQFGMVQSKIYKVYFKAMAYSVRMALLGH  158

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             L ++++     K+      +NL+++L M+L N++YLEPR+TKVMFERMKIEKE
Sbjct  159  -LWRHRSSLFRGKSADMLHNYNLIAALSMILFNMMYLEPRSTKVMFERMKIEKE  211



>gb|EMT04172.1| hypothetical protein F775_30700 [Aegilops tauschii]
Length=558

 Score =   116 bits (291),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 90/135 (67%), Gaps = 12/135 (9%)
 Frame = -3

Query  828  LRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAY  649
            + +A  A  + +L+G A A+G  VWVTF+SS+VLA +LPRQQ  V QSK+YPVYF+AMAY
Sbjct  322  MEAARTATAVMHLLGFATAYGACVWVTFVSSHVLAASLPRQQLGVVQSKLYPVYFRAMAY  381

Query  648  SIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATK-------V  490
             +G A   H+L      R  S        FNLLS+L +VL N+L LEP+ATK       V
Sbjct  382  CVGLALAAHLLG-----RERSSFAARAQSFNLLSALGLVLANMLLLEPKATKIYSSSSQV  436

Query  489  MFERMKIEKEEGRGK  445
            MFERMK+EKEEGRG+
Sbjct  437  MFERMKVEKEEGRGR  451


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = -3

Query  285  KSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV--AC  154
            KS+++RL+++LK+LNSYSS  NV++LM LT +L HLA+RL +  AC
Sbjct  513  KSKVVRLNKRLKQLNSYSSLCNVLSLMALTWHLVHLARRLQMSTAC  558



>ref|XP_010477518.1| PREDICTED: uncharacterized protein LOC104756605 [Camelina sativa]
Length=341

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 87/130 (67%), Gaps = 8/130 (6%)
 Frame = -3

Query  819  AGRAFGMAN------LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKA  658
             G+A G++       L+G+A A+GM VWVTF+S YVL   L R QF V QSK+YPVYFKA
Sbjct  180  VGKALGLSKIGSVVGLVGIAAAYGMCVWVTFVSGYVLGSVLGRHQFGVVQSKMYPVYFKA  239

Query  657  MAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFER  478
            ++  I  A LGH++S+   +++ +     +   NLLSS+LMV  N  +++PR TK MFER
Sbjct  240  VSVGILIALLGHVISRR--RKVFTDAVDMWQAVNLLSSILMVEANASFVDPRVTKAMFER  297

Query  477  MKIEKEEGRG  448
            +K EKE+GRG
Sbjct  298  IKAEKEDGRG  307


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 51/97 (53%), Gaps = 12/97 (12%)
 Frame = -3

Query  1518  QEDVIVKDGHRVVVVEYEKE-HGNTKVLISPHESSSE-----------DVAAEKGGENDG  1375
             + +VIVKDGHRVVVVEY+++   NT+V I P     E           +   E    +  
Sbjct  24    ESEVIVKDGHRVVVVEYDRDGKTNTRVSIQPPGKEEEKRRDKGEIVFGNAKRETSSSHSE  83

Query  1374  DGSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAP  1264
             +       +AGELVCDA G+C+ K+A V  R KD  P
Sbjct  84    EKEREHHVSAGELVCDALGKCKHKMATVLRRLKDLTP  120



>gb|EPS65890.1| hypothetical protein M569_08895 [Genlisea aurea]
Length=433

 Score = 99.4 bits (246),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 99/342 (29%), Positives = 149/342 (44%), Gaps = 69/342 (20%)
 Frame = -3

Query  1536  PAPEKKQ--ED-VIVKDGHRVVVVEYEKEHG---NTKVLISPHES---------------  1420
             P P +KQ  ED +++K+GHRVVVVEYE +     +TKV ISPH S               
Sbjct  27    PTPPEKQNKEDFLVIKEGHRVVVVEYENDDAAGKSTKVSISPHHSAHKASDDELRHEAKE  86

Query  1419  SSEDVAAEKGGENDGDGSYH--RRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGA  1246
             SS+        +N      H  + ++  E   D+  +   K+    +  K+ A + A  A
Sbjct  87    SSDKEEKASDADNKAPEKLHEAKESSVKEKASDSAHKASEKLHDAKETVKEKASDSAHKA  146

Query  1245  RGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGKVRDTVADKGNKAAKKVY  1066
              G + E     ++TV +K S+               + E  G +++TV+D  +KA+ K+ 
Sbjct  147   SGKLHEA----KETVKEKASEK--------------LHEAKGSLKETVSDAAHKASVKLQ  188

Query  1065  EMEEGA--RDAITERLENLRasaagtassakeaakeaaekaKGMRTDASRKMEHMKEELS  892
             E +E      A  E+LE                    + K KG R +    +   +E  S
Sbjct  189   EAKESVVKEKAADEKLET----------------AAESVKKKGKR-ELKEILNRFRELAS  231

Query  891   DRakkaeekvgeakdavKHNILRSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALP  712
             D     E     +  +   ++L       G +   G  V      WVTF SS VL+ ALP
Sbjct  232   D---VYEYAAAPSSPSAAFDLLTGTLNLVGFSAAYGACV------WVTFASSCVLSGALP  282

Query  711   RQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHS  586
             RQ FA AQ KIYP YFK  AY +  A  GH++++N   +L +
Sbjct  283   RQHFAAAQGKIYPAYFKFQAYGVAAALSGHLMNRNVGAKLQT  324


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  288  EKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLH  163
            +++E+M+L+  +++LNSYSS LNVV L+ LT YL HLAQRL+
Sbjct  380  QEAEVMKLNEDMRRLNSYSSMLNVVNLVSLTWYLLHLAQRLN  421



>gb|EAZ30809.1| hypothetical protein OsJ_14876 [Oryza sativa Japonica Group]
Length=497

 Score = 98.2 bits (243),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 105/192 (55%), Gaps = 16/192 (8%)
 Frame = -3

Query  714  PRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllm  535
            P  Q A+ QSK++P+YF+A+AY +G A   H+L      R  S         NLL++L +
Sbjct  313  PAGQLAMVQSKLFPMYFRAVAYGVGLALAAHLLG-----RERSSLAARAQSVNLLAALAL  367

Query  534  vlvnllyLEPRATKVMFERMKIEKEEGRGK------GSTTETEHGDGVTKDRsaagavvd  373
            VL N+L LEP+ATKVMFERMK+EKEEGRG+         T T          +   A   
Sbjct  368  VLANMLLLEPKATKVMFERMKVEKEEGRGRDMADIVDPPTVTVAAGNTATTTTVPTAAAR  427

Query  372  gstgavvdggtaataaTEIAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTL  193
               G       +A AA  + E+  + R     +  L+++LKKLN YSS  NV+ LM LT 
Sbjct  428  KPAGNNNMAAKSAAAAAPVDEQTSKSR-----VATLNQRLKKLNGYSSLCNVLCLMALTW  482

Query  192  YLAHLAQRLHVA  157
            +L HLA+RL +A
Sbjct  483  HLVHLARRLQIA  494



>ref|XP_008361622.1| PREDICTED: uncharacterized protein LOC103425319 [Malus domestica]
Length=218

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L GLA A+GM +W+T +SS+VLA +LP QQF + QSKIY VYFKAMAYS+  A LGH
Sbjct  113  VAHLFGLATAYGMCMWITLVSSHVLAGSLPPQQFGMVQSKIYKVYFKAMAYSVRMALLGH  172

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMF  484
             L ++++     K+      +NL+++L M+L N++YLEPR+TK++ 
Sbjct  173  -LWRHRSSLFRGKSADMLHNYNLIAALSMILFNMMYLEPRSTKIVL  217



>gb|KDO36882.1| hypothetical protein CISIN_1g043201mg, partial [Citrus sinensis]
Length=148

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 100/175 (57%), Gaps = 35/175 (20%)
 Frame = -3

Query  657  MAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFER  478
            +A SIG A LGH+       +L S     F GFNLL+S+LMVL+N +YLEP ATKVMFER
Sbjct  1    IACSIGWALLGHM------PQLFSSKAGMFQGFNLLASILMVLINSIYLEPLATKVMFER  54

Query  477  MKIEKEEGRGKGS-------TTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTE  319
            MK+EKEEG+G+ S        TETE G   T+ R+   A V                   
Sbjct  55   MKVEKEEGKGRESQIGETSRVTETEQGTA-TERRAEGPAPVP------------------  95

Query  318  IAEKKQRERAEKSEMMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
                 Q E   +++M++LS +LK LN+YSS LN++TLM LT +L +L Q LH  C
Sbjct  96   -VSPGQEEL--RTKMVKLSERLKTLNTYSSILNLITLMSLTWHLVYLGQSLHTTC  147



>gb|EYU22791.1| hypothetical protein MIMGU_mgv11b021530mg [Erythranthe guttata]
Length=171

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 68/138 (49%), Gaps = 37/138 (27%)
 Frame = -3

Query  1536  PAPE--KKQEDVIVKDGHRVVVVEYEKEHGNTKVLISPHESSSEDVAAEKG---------  1390
             P+PE  K ++DVIVK+GHRV+VVEYEK+ GNTKV ISP +S +     EKG         
Sbjct  22    PSPENQKLKDDVIVKEGHRVIVVEYEKDDGNTKVSISPQDSQAPHKVGEKGFASNVLDKM  81

Query  1389  ----------------------GENDGDGSY----HRRTTAGELVCDAFGRCRRKIAGVF  1288
                                   GE D + +     H R  A ELVCDA+G+C+ KI    
Sbjct  82    SERMENAKEGIKEASSSIIPEVGEADRNQNQEEENHHRFNARELVCDAYGKCKHKIVSAL  141

Query  1287  DRTKDTAPEMAEGARGAV  1234
              +TK+   E A  A   V
Sbjct  142   GKTKEAVAETAHEAADKV  159



>ref|XP_002968913.1| hypothetical protein SELMODRAFT_440470 [Selaginella moellendorffii]
 gb|EFJ30029.1| hypothetical protein SELMODRAFT_440470 [Selaginella moellendorffii]
Length=544

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 123/296 (42%), Gaps = 59/296 (20%)
 Frame = -3

Query  1311  RRKIAGVFDRTKDTAPEMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAV-  1135
             +R++   +D+ K  + E  E  +    E LG + D V  K               RGAV 
Sbjct  239   KRRVEAYYDKAKQASLESLENQK----EKLGHIVDVVRLK-----------LNAGRGAVF  283

Query  1134  SEGLGKV---RDTVADKGNKAAKKVYEMEEGARDAITERLENLRasaagtassakeaake  964
             + G+  +   +D V D+ NK   KV+E EE A      R  N                  
Sbjct  284   NYGMSTIQSGKDAVVDEKNKLCLKVHEAEEEA-----ARWGN------------------  320

Query  963   aaekaKGMRTDASRKMEHMKEELSDRakkaeekvgeakdavKHNILRSAGRAFGMANLIG  784
                     R   +R          D+  K  +    A    K  + +S      + +L  
Sbjct  321   ------SAREKVNRTWNQAGAWAHDKMAKLNQSEEMALRICKQWVHKSVATFIRLMHLFL  374

Query  783   LAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQ  604
              +  FG ++WVTFIS +VL+  + R QFA+ QSKI+PVYF+ +   I      HIL    
Sbjct  375   FSSTFGSALWVTFISGFVLSNNISRHQFALVQSKIFPVYFRIVGSGIALLLATHIL----  430

Query  603   TQRLHSKTTQHflgfnllssll----mvlvnllyLEPRATKVMFERMKIEKEEGRG  448
                LHS    H        +L     + L+N   LEPR TK +F++++IEKEEGR 
Sbjct  431   ---LHSPPGAHLSELLQCYNLAGCLVVTLLNTFLLEPRLTKCVFDKVRIEKEEGRA  483



>ref|XP_002989961.1| hypothetical protein SELMODRAFT_428422 [Selaginella moellendorffii]
 gb|EFJ08974.1| hypothetical protein SELMODRAFT_428422 [Selaginella moellendorffii]
Length=544

 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 68/122 (56%), Gaps = 11/122 (9%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L   +  FG ++WVTFIS +VL+  + R QFA+ QSKI+PVYF+ +   I      H
Sbjct  369  LMHLFLFSSTFGSALWVTFISGFVLSNNISRHQFALVQSKIFPVYFRIVGSGIALLLATH  428

Query  621  ILSQNQTQRLHSKTTQHflgfnllssll----mvlvnllyLEPRATKVMFERMKIEKEEG  454
            IL       LHS    H        +L     + L+N   LEPR TK +F++++IEKEEG
Sbjct  429  IL-------LHSPPGAHLSELLQCYNLAGCLVVTLLNTFLLEPRLTKCVFDKVRIEKEEG  481

Query  453  RG  448
            R 
Sbjct  482  RA  483



>ref|XP_006875194.1| PREDICTED: transmembrane protein 205 [Chrysochloris asiatica]
Length=189

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 67/119 (56%), Gaps = 3/119 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++PVYF+    S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPVYFRI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
             +   Q    H    +      LL  L +  +N  +LEPR T  M+    +EKE G G+
Sbjct  70   CILAPQHAWAHLTFWETSQLCLLLLCLTLAAINAQWLEPRTTDAMWALQTLEKERGLGR  128



>ref|NP_001240796.1| transmembrane protein 205 isoform 1 [Mus musculus]
Length=245

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 68/124 (55%), Gaps = 3/124 (2%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
             G    + +L+ L+ A+GM VWVTFIS ++L ++LPR  F + QSK++PVYF     S+G
Sbjct  63   PGSLIKVIHLLVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHV---SLG  119

Query  639  TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             AF+   +   Q   +H    +      LL SL +  +N  +LE R T VM     IEKE
Sbjct  120  CAFINLCILAPQRAWIHLTLWEVSQLSLLLLSLTLATINARWLEARTTAVMRALQSIEKE  179

Query  459  EGRG  448
             G G
Sbjct  180  RGLG  183



>ref|NP_848692.2| transmembrane protein 205 isoform 2 [Mus musculus]
 ref|NP_001240797.1| transmembrane protein 205 isoform 2 [Mus musculus]
 ref|NP_001240798.1| transmembrane protein 205 isoform 2 [Mus musculus]
 ref|NP_001240799.1| transmembrane protein 205 isoform 2 [Mus musculus]
 sp|Q91XE8.1|TM205_MOUSE RecName: Full=Transmembrane protein 205 [Mus musculus]
 gb|AAH10787.1| Transmembrane protein 205 [Mus musculus]
 gb|EDL25225.1| cDNA sequence BC010787, isoform CRA_a [Mus musculus]
 gb|EDL25226.1| cDNA sequence BC010787, isoform CRA_a [Mus musculus]
 gb|EDL25228.1| cDNA sequence BC010787, isoform CRA_a [Mus musculus]
Length=189

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 68/124 (55%), Gaps = 3/124 (2%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
             G    + +L+ L+ A+GM VWVTFIS ++L ++LPR  F + QSK++PVYF     S+G
Sbjct  7    PGSLIKVIHLLVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHV---SLG  63

Query  639  TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             AF+   +   Q   +H    +      LL SL +  +N  +LE R T VM     IEKE
Sbjct  64   CAFINLCILAPQRAWIHLTLWEVSQLSLLLLSLTLATINARWLEARTTAVMRALQSIEKE  123

Query  459  EGRG  448
             G G
Sbjct  124  RGLG  127



>dbj|BAA92764.1| unnamed protein product [Mus musculus]
Length=189

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 67/124 (54%), Gaps = 3/124 (2%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
             G    + +L+ L+ A+GM VWVTFIS ++  ++LPR  F + QSK++PVYF     S+G
Sbjct  7    PGSLIKVIHLLVLSGAWGMQVWVTFISGFLFFRSLPRHTFGLVQSKVFPVYFHV---SLG  63

Query  639  TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             AF+   +   Q   +H    +      LL SL +  +N  +LE R T VM     IEKE
Sbjct  64   CAFINLCILAPQRAWIHLTLWEVSQLSLLLLSLTLATINARWLEARTTAVMRALQSIEKE  123

Query  459  EGRG  448
             G G
Sbjct  124  RGLG  127



>ref|XP_007993494.1| PREDICTED: transmembrane protein 205 [Chlorocebus sabaeus]
 ref|XP_007993495.1| PREDICTED: transmembrane protein 205 [Chlorocebus sabaeus]
 ref|XP_007993496.1| PREDICTED: transmembrane protein 205 [Chlorocebus sabaeus]
Length=189

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L + LPR  F +AQSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    + L  SL++  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHAWAQLTFWEASQLYLLFLSLMLATVNARWLEPRTTAAMWALQTVEKERGLG  127



>ref|XP_003914966.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_003914967.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_003914968.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_009191795.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_009191797.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_009191798.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_009191799.1| PREDICTED: transmembrane protein 205 [Papio anubis]
Length=189

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L + LPR  F +AQSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    + L  SL +  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLG  127



>ref|NP_001181752.1| transmembrane protein 205 [Macaca mulatta]
 ref|XP_001104593.1| PREDICTED: transmembrane protein 205-like isoform 3 [Macaca mulatta]
 ref|XP_001104673.1| PREDICTED: transmembrane protein 205-like isoform 4 [Macaca mulatta]
 ref|XP_001104745.1| PREDICTED: transmembrane protein 205-like isoform 5 [Macaca mulatta]
 ref|XP_001104890.1| PREDICTED: transmembrane protein 205-like isoform 7 [Macaca mulatta]
 ref|XP_005588079.1| PREDICTED: transmembrane protein 205 isoform X1 [Macaca fascicularis]
 ref|XP_005588080.1| PREDICTED: transmembrane protein 205 isoform X2 [Macaca fascicularis]
 ref|XP_005588081.1| PREDICTED: transmembrane protein 205 isoform X3 [Macaca fascicularis]
 ref|XP_005588082.1| PREDICTED: transmembrane protein 205 isoform X4 [Macaca fascicularis]
 ref|XP_005588083.1| PREDICTED: transmembrane protein 205 isoform X5 [Macaca fascicularis]
 ref|XP_005588084.1| PREDICTED: transmembrane protein 205 isoform X6 [Macaca fascicularis]
 ref|XP_005588085.1| PREDICTED: transmembrane protein 205 isoform X7 [Macaca fascicularis]
 ref|XP_005588086.1| PREDICTED: transmembrane protein 205 isoform X8 [Macaca fascicularis]
 gb|EHH29645.1| Transmembrane protein 205 [Macaca mulatta]
 gb|EHH59216.1| Transmembrane protein 205 [Macaca fascicularis]
Length=189

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L + LPR  F +AQSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    + L  SL +  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLG  127



>ref|XP_004748447.1| PREDICTED: transmembrane protein 205 isoform X1 [Mustela putorius 
furo]
 ref|XP_004748448.1| PREDICTED: transmembrane protein 205 isoform X2 [Mustela putorius 
furo]
 ref|XP_004748449.1| PREDICTED: transmembrane protein 205 isoform X3 [Mustela putorius 
furo]
 ref|XP_004748450.1| PREDICTED: transmembrane protein 205 isoform X4 [Mustela putorius 
furo]
 ref|XP_004748451.1| PREDICTED: transmembrane protein 205 isoform X5 [Mustela putorius 
furo]
 ref|XP_004748452.1| PREDICTED: transmembrane protein 205 isoform X6 [Mustela putorius 
furo]
 ref|XP_004824424.1| PREDICTED: transmembrane protein 205 isoform X2 [Mustela putorius 
furo]
 ref|XP_004824425.1| PREDICTED: transmembrane protein 205 isoform X3 [Mustela putorius 
furo]
 ref|XP_004824426.1| PREDICTED: transmembrane protein 205 isoform X4 [Mustela putorius 
furo]
 ref|XP_004824427.1| PREDICTED: transmembrane protein 205 isoform X5 [Mustela putorius 
furo]
 ref|XP_004824428.1| PREDICTED: transmembrane protein 205 isoform X6 [Mustela putorius 
furo]
 ref|XP_004824429.1| PREDICTED: transmembrane protein 205 isoform X7 [Mustela putorius 
furo]
Length=189

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTFIS ++L ++LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFISGFLLFRSLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      +L SL M  VN  +LEPR T  M+   ++EKE G G
Sbjct  70   CILASQHAWTQLTFWEAIQLCLMLLSLSMAAVNARWLEPRTTAAMWALHRVEKERGLG  127



>ref|XP_004824423.1| PREDICTED: transmembrane protein 205 isoform X1 [Mustela putorius 
furo]
Length=197

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTFIS ++L ++LPR  F + QSK++P YF     S+G AF+  
Sbjct  21   MVHLLVLSGAWGMQMWVTFISGFLLFRSLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  77

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      +L SL M  VN  +LEPR T  M+   ++EKE G G
Sbjct  78   CILASQHAWTQLTFWEAIQLCLMLLSLSMAAVNARWLEPRTTAAMWALHRVEKERGLG  135



>emb|CAN72243.1| hypothetical protein VITISV_022622 [Vitis vinifera]
Length=402

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 92/204 (45%), Gaps = 55/204 (27%)
 Frame = -3

Query  1536  PAPEKKQED------VIVKDGHRVVVVEYEKE-HGNTKVLISPHES--------SSEDVA  1402
             P P++KQ+D      VIVK+G RVVVVEY+KE  GNTKV IS  E+          ED  
Sbjct  22    PNPDQKQKDYPGAEEVIVKEGTRVVVVEYDKEGPGNTKVSISTQEAHHVFQKAPKGEDKF  81

Query  1401  AEKGGE------NDGDG--------SYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAP  1264
              EK  E      N G G        +  + +T  EL+CDAFG+C+ KIA    R++    
Sbjct  82    KEKVKEAFEVLPNMGQGLSRXQHPQNGQKPSTPKELICDAFGKCKEKIATKIGRSEQKVS  141

Query  1263  EMAEGARGAVSEGLGKVRDTVVDKGSKaaemayeaeeeARGAVSEGLGK--------VRD  1108
             E     +    E  GK ++ V+                  G V E L +        V+D
Sbjct  142   EKVHEIQEGAKETYGKAKENVI------------------GNVEEKLSQKAHDIQEEVKD  183

Query  1107  TVADKGNKAAKKVYEMEEGARDAI  1036
                    K ++K + ++EG +DA+
Sbjct  184   AYTKTKEKVSEKTHMVQEGVKDAV  207


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  276  MMRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
            ++ L+  LKKLN+YSSFLN++TLM L L+L +LA RL++ C
Sbjct  362  ILELNEMLKKLNAYSSFLNILTLMVLKLHLVYLAHRLYMTC  402



>ref|XP_004060075.1| PREDICTED: transmembrane protein 205 isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004060076.1| PREDICTED: transmembrane protein 205 isoform 2 [Gorilla gorilla 
gorilla]
Length=189

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    + L  SL +  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLG  127



>ref|XP_001754410.1| predicted protein [Physcomitrella patens]
 gb|EDQ80860.1| predicted protein [Physcomitrella patens]
Length=152

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = -3

Query  792  LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILS  613
            L+  AV FG ++W+TFIS  +L++ +PR+QF   Q+K++P Y K++        L  +L+
Sbjct  1    LLTYAVTFGSAIWMTFISGRILSRTIPREQFRNVQTKMFPYYLKSLVAGQSALALFSVLT  60

Query  612  QNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTT  433
            +  ++         +     +  +     N   LEP+ TKV  ER+++EKEEGRG  +++
Sbjct  61   RGSSK---------WSLLGFVLLIGSAAYNAFVLEPKTTKVYHERLRVEKEEGRGLHTSS  111

Query  432  E  430
            +
Sbjct  112  D  112



>ref|NP_212133.1| transmembrane protein 205 [Homo sapiens]
 ref|NP_940938.1| transmembrane protein 205 [Homo sapiens]
 ref|NP_001138888.1| transmembrane protein 205 [Homo sapiens]
 ref|XP_003316118.1| PREDICTED: transmembrane protein 205 [Pan troglodytes]
 ref|XP_003316120.1| PREDICTED: transmembrane protein 205 [Pan troglodytes]
 ref|XP_003316121.1| PREDICTED: transmembrane protein 205 [Pan troglodytes]
 ref|XP_005259955.1| PREDICTED: transmembrane protein 205 isoform X1 [Homo sapiens]
 ref|XP_005259956.1| PREDICTED: transmembrane protein 205 isoform X2 [Homo sapiens]
 ref|XP_005259957.1| PREDICTED: transmembrane protein 205 isoform X3 [Homo sapiens]
 ref|XP_005259958.1| PREDICTED: transmembrane protein 205 isoform X4 [Homo sapiens]
 ref|XP_005259959.1| PREDICTED: transmembrane protein 205 isoform X5 [Homo sapiens]
 ref|XP_008954203.1| PREDICTED: transmembrane protein 205 [Pan paniscus]
 ref|XP_008954204.1| PREDICTED: transmembrane protein 205 [Pan paniscus]
 ref|XP_008954205.1| PREDICTED: transmembrane protein 205 [Pan paniscus]
 ref|XP_008954206.1| PREDICTED: transmembrane protein 205 [Pan paniscus]
 ref|XP_009433004.1| PREDICTED: transmembrane protein 205 [Pan troglodytes]
 sp|Q6UW68.1|TM205_HUMAN RecName: Full=Transmembrane protein 205 [Homo sapiens]
 gb|AAQ89308.1| MBC3205 [Homo sapiens]
 gb|AAH64948.1| Transmembrane protein 205 [Homo sapiens]
 gb|AAH91472.1| TMEM205 protein [Homo sapiens]
 gb|EAW84191.1| MBC3205, isoform CRA_a [Homo sapiens]
 gb|EAW84192.1| MBC3205, isoform CRA_a [Homo sapiens]
 gb|EAW84193.1| MBC3205, isoform CRA_a [Homo sapiens]
 gb|EAW84197.1| MBC3205, isoform CRA_a [Homo sapiens]
 dbj|BAF84668.1| unnamed protein product [Homo sapiens]
 gb|ADQ32606.1| MBC3205 [synthetic construct]
 gb|AIC53724.1| TMEM205, partial [synthetic construct]
Length=189

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    + L  SL +  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLG  127



>ref|XP_005346982.1| PREDICTED: transmembrane protein 205 [Microtus ochrogaster]
Length=189

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (55%), Gaps = 3/124 (2%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
             G    + +L+ L+ A+GM +WVTF S ++L ++LPR  F + QSK++PVYF     S+G
Sbjct  7    PGSLIKVVHLLVLSGAWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPVYFHV---SLG  63

Query  639  TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             AF+   +   Q   +H    +      LL SL +  +N  +LE R T VM+    +EK+
Sbjct  64   CAFINLCILAPQRAWIHLSFWEASQLALLLLSLTLATINARWLEARTTAVMWALQTVEKD  123

Query  459  EGRG  448
             G G
Sbjct  124  RGLG  127



>ref|XP_010372011.1| PREDICTED: transmembrane protein 205 [Rhinopithecus roxellana]
 ref|XP_010372013.1| PREDICTED: transmembrane protein 205 [Rhinopithecus roxellana]
 ref|XP_010372014.1| PREDICTED: transmembrane protein 205 [Rhinopithecus roxellana]
Length=189

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    + L  SL++  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHAWAQLTFWEASQLYLLFLSLMLATVNARWLEPRTTAAMWALQTVEKERGLG  127



>ref|NP_001124814.1| transmembrane protein 205 [Pongo abelii]
 sp|Q5REM8.1|TM205_PONAB RecName: Full=Transmembrane protein 205 [Pongo abelii]
 emb|CAH89779.1| hypothetical protein [Pongo abelii]
Length=189

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    + L  SL +  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLG  127



>ref|XP_001773290.1| predicted protein [Physcomitrella patens]
 gb|EDQ61828.1| predicted protein [Physcomitrella patens]
Length=575

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 101/218 (46%), Gaps = 67/218 (31%)
 Frame = -3

Query  795  NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGT-AFLGHI  619
            +L+   V+FG +VW+TF+S  VL++++P +QF   Q+K++P Y + +  + G+  FL  +
Sbjct  419  HLLTWGVSFGTAVWMTFMSGRVLSQSMPGEQFRQVQTKMFPSYLRFLTSAEGSLTFLYML  478

Query  618  LS-QNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
            +S  ++ Q L+    + TT +               N   LEP  TK+  ERMK+EKEEG
Sbjct  479  MSIASKWQILNLLILTSTTAY---------------NAYVLEPETTKLYLERMKLEKEEG  523

Query  453  RGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEM  274
            +G    T TE+  G                              E+A K +R        
Sbjct  524  KG---LTSTENNVG-----------------------------KELAGKNKR--------  543

Query  273  MRLSRKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHV  160
                   K+L+ YS+ LN+++L  L  +  +L  +LH 
Sbjct  544  ------FKELHGYSASLNLLSLAGLAYHAWNLLSKLHT  575



>ref|XP_002967473.1| hypothetical protein SELMODRAFT_169057 [Selaginella moellendorffii]
 gb|EFJ32072.1| hypothetical protein SELMODRAFT_169057 [Selaginella moellendorffii]
Length=216

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 11/123 (9%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+G A A+G S+WVTFI   ++ K LPR QF   QSK++PVYF+ +A    TA +G 
Sbjct  46   MVHLLGFATAWGTSLWVTFIGGIIMFKHLPRHQFGNLQSKLFPVYFEMLAVC-STACIG-  103

Query  621  ILSQNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
                     LH    S + +      L+ SL+  L+NLL  EP   K M ER KIE+EE 
Sbjct  104  -----AFSLLHPWGSSTSAEKMQLGALVFSLMATLLNLLVFEPMTIKTMKERHKIEREES  158

Query  453  RGK  445
             G+
Sbjct  159  IGE  161



>ref|XP_007629766.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane protein 205 isoform 
X2 [Cricetulus griseus]
Length=256

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF S +VL ++LPR  F + QSK++PVYF     S+G A +  
Sbjct  80   VVHLLVLSGAWGMQMWVTFASGFVLFRSLPRHTFGLVQSKLFPVYFHV---SLGCALINL  136

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q   +H    +      LL SL +  +N  +LE R T VM+    +EK+ G G
Sbjct  137  CILAPQRAWIHLSLWEASQLALLLLSLTLATINARWLEARTTAVMWALQTVEKDRGLG  194



>ref|XP_006744351.1| PREDICTED: transmembrane protein 205 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006744352.1| PREDICTED: transmembrane protein 205 isoform X2 [Leptonychotes 
weddellii]
Length=189

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTFIS ++L ++LPR  F   QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFISGFLLFRSLPRHTFGFVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +      LL S  +  VN  +LEPR T  M+   ++EKE G G
Sbjct  70   CILAPQHAWAQLTFWEASQLGLLLLSFTLSTVNARWLEPRTTAAMWALHRVEKERGLG  127



>ref|XP_004398961.1| PREDICTED: transmembrane protein 205 isoform 1 [Odobenus rosmarus 
divergens]
 ref|XP_004398962.1| PREDICTED: transmembrane protein 205 isoform 2 [Odobenus rosmarus 
divergens]
 ref|XP_004398963.1| PREDICTED: transmembrane protein 205 isoform 3 [Odobenus rosmarus 
divergens]
Length=189

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTFIS ++L ++LPR  F   QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFISGFLLFRSLPRHTFGFVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +      LL S  +  +N  +LEPR T  M+   ++EKE G G
Sbjct  70   CVLAPQHAWAQLTFWEASQLGLLLLSFALSTINARWLEPRTTAAMWALHRVEKERGLG  127



>ref|XP_002960240.1| hypothetical protein SELMODRAFT_139492 [Selaginella moellendorffii]
 gb|EFJ37779.1| hypothetical protein SELMODRAFT_139492 [Selaginella moellendorffii]
Length=216

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 11/123 (9%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+G A A+G S+WVTFI   ++ K LPR QF   QSK++PVYF+ +A    TA +G 
Sbjct  46   MVHLLGFATAWGTSLWVTFIGGIIMFKHLPRHQFGNLQSKLFPVYFELLAVC-STACIG-  103

Query  621  ILSQNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
                     LH    S + +      L+ SL+  L+NLL  EP   K M ER KIE+EE 
Sbjct  104  -----AFSLLHPWGSSTSAEKMQLGALVFSLVGTLLNLLVFEPMTIKTMKERHKIEREES  158

Query  453  RGK  445
             G+
Sbjct  159  IGE  161



>gb|EGV96173.1| Transmembrane protein 205 [Cricetulus griseus]
Length=189

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 3/124 (2%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
             G    + +L+ L+ A+GM +WVTF S +VL ++LPR  F + QSK++PVYF     S+G
Sbjct  7    PGSFIKVVHLLVLSGAWGMQMWVTFASGFVLFRSLPRHTFGLVQSKLFPVYFHV---SLG  63

Query  639  TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             A +   +   Q   +H    +      LL SL +  +N  +LE R T VM+    +EK+
Sbjct  64   CALINLCILAPQRAWIHLSLWEASQLALLLLSLTLATINARWLEARTTAVMWALQTVEKD  123

Query  459  EGRG  448
             G G
Sbjct  124  RGLG  127



>ref|XP_005405712.1| PREDICTED: transmembrane protein 205 isoform X1 [Chinchilla lanigera]
 ref|XP_005405713.1| PREDICTED: transmembrane protein 205 isoform X2 [Chinchilla lanigera]
 ref|XP_005405714.1| PREDICTED: transmembrane protein 205 isoform X3 [Chinchilla lanigera]
 ref|XP_005405715.1| PREDICTED: transmembrane protein 205 isoform X4 [Chinchilla lanigera]
 ref|XP_005405716.1| PREDICTED: transmembrane protein 205 isoform X5 [Chinchilla lanigera]
Length=189

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 3/124 (2%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
            AG    +A+L+ L+ A+GM +WVTF+S ++L + LPR  F + QS+++P+YF     S+G
Sbjct  7    AGGLVKVAHLLVLSGAWGMQMWVTFVSGFLLFRNLPRHTFGLVQSRLFPLYFHI---SVG  63

Query  639  TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             AF+    + +Q   +     +      L  SL++  +N  +LEPR T  M     +EKE
Sbjct  64   CAFVNLCTAASQRAWVQFTFWEASQCCLLFLSLVLAAINARWLEPRTTAAMRALQSVEKE  123

Query  459  EGRG  448
             G G
Sbjct  124  RGLG  127



>ref|XP_007460759.1| PREDICTED: transmembrane protein 205 [Lipotes vexillifer]
Length=189

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q  R      +      LL SL++  +N  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHARAQLTFWEASQLCLLLLSLMLATINARWLEPRTTAAMWALQTMEKERGLG  127



>ref|XP_003123224.2| PREDICTED: transmembrane protein 205 isoform 3 [Sus scrofa]
Length=199

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM VWVTF+S ++L + LPR  F + QSK++P YF     S+G+AF+  
Sbjct  23   VVHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGSAFINL  79

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      LL SL +  +N  +LEPR T  M+    +EKE G G
Sbjct  80   CVLASQHAWAQLTFWEASQLCLLLVSLTLATINARWLEPRTTATMWALQTMEKERGLG  137



>ref|XP_003981931.2| PREDICTED: transmembrane protein 205 isoform X1 [Felis catus]
Length=196

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+
Sbjct  13   NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  69

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G AF+   +   Q         +    F L  SL +  +N  +LEPR T  M+    +EK
Sbjct  70   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTINARWLEPRTTAAMWALHAVEK  129

Query  462  EEGRG  448
            E G G
Sbjct  130  ERGLG  134



>ref|XP_006928487.1| PREDICTED: transmembrane protein 205 isoform X2 [Felis catus]
Length=199

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+
Sbjct  16   NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  72

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G AF+   +   Q         +    F L  SL +  +N  +LEPR T  M+    +EK
Sbjct  73   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTINARWLEPRTTAAMWALHAVEK  132

Query  462  EEGRG  448
            E G G
Sbjct  133  ERGLG  137



>ref|XP_008385637.1| PREDICTED: uncharacterized protein LOC103448159 [Malus domestica]
Length=117

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 9/120 (8%)
 Frame = -3

Query  510  EPRATKVMFERMKIEKEEGRGKGSTTETEHGDGVTKDRsaagavvdgstgavvdggtaat  331
            EPR+TKVMFERMKIEKEEGRG+    E  H D     R +  A          +G  + T
Sbjct  5    EPRSTKVMFERMKIEKEEGRGR----ERVHVDA----RISREAGQQQQQQTTTEGEPSIT  56

Query  330  aaTEIAEKKQRERAEKSEMMRLSRK-LKKLNSYSSFLNVVTLMCLTLYLAHLAQRLHVAC  154
               ++  ++Q+      E +   R+ LKKLN+ SSFLN+ +LM L+ +L +LAQ L  +C
Sbjct  57   TPPQVXRREQQVVEPDIERLNEMREXLKKLNTCSSFLNIASLMALSWHLVYLAQHLPSSC  116



>ref|XP_006928488.1| PREDICTED: transmembrane protein 205 isoform X3 [Felis catus]
 ref|XP_006928489.1| PREDICTED: transmembrane protein 205 isoform X4 [Felis catus]
Length=189

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+
Sbjct  6    NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  62

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G AF+   +   Q         +    F L  SL +  +N  +LEPR T  M+    +EK
Sbjct  63   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTINARWLEPRTTAAMWALHAVEK  122

Query  462  EEGRG  448
            E G G
Sbjct  123  ERGLG  127



>ref|XP_007079370.1| PREDICTED: transmembrane protein 205 isoform X2 [Panthera tigris 
altaica]
Length=196

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+
Sbjct  13   NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  69

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G AF+   +   Q         +    F L  SL +  VN  +LEPR T  M+    +EK
Sbjct  70   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTVNARWLEPRTTAAMWALHAVEK  129

Query  462  EEGRG  448
            E G G
Sbjct  130  ERGLG  134



>ref|XP_003797991.1| PREDICTED: transmembrane protein 205 [Otolemur garnettii]
Length=189

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHT---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      L  SL++  +N  +LEP  T  M+    +EKE G G
Sbjct  70   CILASQYAWAQLTFWEASQLCLLFLSLMLATINARWLEPHTTAAMWALQTVEKERGLG  127



>ref|XP_007079369.1| PREDICTED: transmembrane protein 205 isoform X1 [Panthera tigris 
altaica]
Length=199

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+
Sbjct  16   NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  72

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G AF+   +   Q         +    F L  SL +  VN  +LEPR T  M+    +EK
Sbjct  73   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTVNARWLEPRTTAAMWALHAVEK  132

Query  462  EEGRG  448
            E G G
Sbjct  133  ERGLG  137



>ref|XP_002761800.1| PREDICTED: transmembrane protein 205 [Callithrix jacchus]
 ref|XP_008985546.1| PREDICTED: transmembrane protein 205 [Callithrix jacchus]
 ref|XP_008985547.1| PREDICTED: transmembrane protein 205 [Callithrix jacchus]
 ref|XP_008985548.1| PREDICTED: transmembrane protein 205 [Callithrix jacchus]
Length=189

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +    + L  SL++  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILALQHTWAQLTFWEASQLYLLFLSLMLATVNARWLEPRTTAAMWALQMVEKERGLG  127



>ref|XP_003123222.1| PREDICTED: transmembrane protein 205 isoform 1 [Sus scrofa]
 ref|XP_003123223.1| PREDICTED: transmembrane protein 205 isoform 2 [Sus scrofa]
Length=189

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM VWVTF+S ++L + LPR  F + QSK++P YF     S+G+AF+  
Sbjct  13   VVHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGSAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      LL SL +  +N  +LEPR T  M+    +EKE G G
Sbjct  70   CVLASQHAWAQLTFWEASQLCLLLVSLTLATINARWLEPRTTATMWALQTMEKERGLG  127



>ref|XP_007079371.1| PREDICTED: transmembrane protein 205 isoform X3 [Panthera tigris 
altaica]
 ref|XP_007079372.1| PREDICTED: transmembrane protein 205 isoform X4 [Panthera tigris 
altaica]
Length=189

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            + G    M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+
Sbjct  6    NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  62

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
            G AF+   +   Q         +    F L  SL +  VN  +LEPR T  M+    +EK
Sbjct  63   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTVNARWLEPRTTAAMWALHAVEK  122

Query  462  EEGRG  448
            E G G
Sbjct  123  ERGLG  127



>ref|XP_007488571.1| PREDICTED: transmembrane protein 205 isoform X1 [Monodelphis 
domestica]
 ref|XP_007488572.1| PREDICTED: transmembrane protein 205 isoform X2 [Monodelphis 
domestica]
Length=194

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 2/124 (2%)
 Frame = -3

Query  783  LAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQ  604
            L+ A+GM VWVTFIS +VL + LPR  F + QSK++P YF  ++ +  T  LG  L  + 
Sbjct  20   LSAAWGMQVWVTFISGFVLFRRLPRHTFGLVQSKLFPFYFH-ISLACATISLGIFLFHHP  78

Query  603  TQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKGSTTETE  424
              +L     +      L  +L +  +N  ++EPR T  M+    +EK+ G G G      
Sbjct  79   LVKLSFTLAEAGQLVLLAMNLALSALNARWIEPRTTAAMWALQAMEKDRGLG-GELPGPS  137

Query  423  HGDG  412
             G G
Sbjct  138  QGQG  141



>ref|XP_533912.2| PREDICTED: transmembrane protein 205 [Canis lupus familiaris]
Length=189

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M +L+ L+ A+GM +WVTFIS + L + LPR  F + QSK++P+YF     S+G AF+  
Sbjct  13   MVHLLVLSGAWGMQMWVTFISGFQLFRNLPRHTFGLVQSKLFPLYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      L  SL +  +N  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQHAWAQLTFWETSQLCLLFLSLTLSTINARWLEPRTTAAMWALHTVEKERGLG  127



>ref|XP_005861438.1| PREDICTED: transmembrane protein 205 [Myotis brandtii]
 gb|EPQ04691.1| Transmembrane protein 205 [Myotis brandtii]
Length=189

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 9/121 (7%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L K LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQIWVTFVSGFLLFKGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNF  69

Query  621  ILSQNQ---TQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
             +   Q   +Q    +T+Q      L  SL +  +N  +LEPR T  M+    +EK++G 
Sbjct  70   CILFPQHPWSQLTFWETSQ---LCLLFLSLTLATINARWLEPRTTAAMWALQTVEKKQGL  126

Query  450  G  448
            G
Sbjct  127  G  127



>ref|XP_007265995.1| hypothetical protein FOMMEDRAFT_19631 [Fomitiporia mediterranea 
MF3/22]
 gb|EJD04394.1| hypothetical protein FOMMEDRAFT_19631 [Fomitiporia mediterranea 
MF3/22]
Length=189

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 4/119 (3%)
 Frame = -3

Query  798  ANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHI  619
            A L+G A  FGMS+WVTF    +  +ALPRQQF   Q + +PVYFK ++ ++ +A LG  
Sbjct  21   AYLVGYAWLFGMSLWVTFFGGVIAYRALPRQQFGALQHRTFPVYFK-LSIALASALLGLW  79

Query  618  LSQNQTQRLHSKTTQHflgfnllssllmvlvn---llyLEPRATKVMFERMKIEKEEGR  451
               +   R +    +        + L +VL+       + P  +++MF+R K+EKEEG+
Sbjct  80   NWGHPAVRANPMAFRQVDVIQAYTLLAVVLLQGANHFVVGPYTSRLMFQRHKLEKEEGK  138



>ref|XP_010976605.1| PREDICTED: transmembrane protein 205 [Camelus dromedarius]
 ref|XP_010976606.1| PREDICTED: transmembrane protein 205 [Camelus dromedarius]
Length=189

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM VWVTFIS ++L + LPR  F + QSK++P YF     S+  AF+  
Sbjct  13   VVHLLVLSGAWGMQVWVTFISGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMSCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      LL SL +  +N  +LEP  T  M+   K+EKE G G
Sbjct  70   CILASQHTWAQLTFWETSQLCLLLLSLTLATINARWLEPHTTAAMWSLQKVEKERGLG  127



>ref|XP_010633032.1| PREDICTED: transmembrane protein 205 [Fukomys damarensis]
 ref|XP_010633033.1| PREDICTED: transmembrane protein 205 [Fukomys damarensis]
 ref|XP_010633034.1| PREDICTED: transmembrane protein 205 [Fukomys damarensis]
 gb|KFO28773.1| Transmembrane protein 205 [Fukomys damarensis]
Length=189

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = -3

Query  774  AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
            A+GM +WVTF S ++L + LPR  F + QSK++P YF     S+  AF+   ++ +Q   
Sbjct  22   AWGMQMWVTFASGFLLFRNLPRHTFGLVQSKLFPFYFHI---SVACAFINLCVAASQRAW  78

Query  594  LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            +H    +      LL SL++ ++N  +LEPR T  M+    +EKE G G
Sbjct  79   VHLTFWETSQCCLLLLSLVLAIINARWLEPRTTAAMWALQSVEKERGLG  127



>ref|XP_007168997.1| PREDICTED: transmembrane protein 205 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007168998.1| PREDICTED: transmembrane protein 205 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007168999.1| PREDICTED: transmembrane protein 205 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=189

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q       + +      LL SL++  +N  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQRAGAQLTSWEASQLCLLLLSLMLATINARWLEPRTTATMWALQTMEKERGLG  127



>ref|XP_006161572.1| PREDICTED: transmembrane protein 205 isoform X1 [Tupaia chinensis]
 ref|XP_006161573.1| PREDICTED: transmembrane protein 205 isoform X2 [Tupaia chinensis]
 ref|XP_006161574.1| PREDICTED: transmembrane protein 205 isoform X3 [Tupaia chinensis]
Length=189

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ LA A+GM +WVTF S ++L +ALPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLAGAWGMQMWVTFASGFLLFRALPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   +   +     +      LL SL +  VN  +LEPR T  M+    +EKE G G
Sbjct  70   CILAPRHVWVQPTFWEASQLCLLLLSLTLATVNARWLEPRTTAAMWALQAMEKERGLG  127



>ref|XP_006905911.1| PREDICTED: transmembrane protein 205 [Pteropus alecto]
 gb|ELK17820.1| Transmembrane protein 205 [Pteropus alecto]
Length=189

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTFIS ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFISGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNF  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q   +     +      LL SL +  +N  +LEPR T  M+    +EK  G G
Sbjct  70   CILVPQHAWVQLTFWEASQLCLLLLSLTLATINARWLEPRTTAAMWALQTVEKNRGLG  127



>ref|XP_006184934.1| PREDICTED: transmembrane protein 205 [Camelus ferus]
 ref|XP_010965169.1| PREDICTED: transmembrane protein 205 [Camelus bactrianus]
 ref|XP_010965170.1| PREDICTED: transmembrane protein 205 [Camelus bactrianus]
Length=189

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM VWVTF+S ++L + LPR  F + QSK++P YF     S+  AF+  
Sbjct  13   VVHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMSCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      LL SL +  +N  +LEP  T  M+   K+EKE G G
Sbjct  70   CILASQHTWAQLTFWETSQLCLLLLSLTLATINARWLEPHTTAAMWSLQKVEKERGLG  127



>gb|EQB78321.1| transmembrane protein 205 [Camelus ferus]
Length=211

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM VWVTF+S ++L + LPR  F + QSK++P YF     S+  AF+  
Sbjct  35   VVHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMSCAFVNL  91

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      LL SL +  +N  +LEP  T  M+   K+EKE G G
Sbjct  92   CILASQHTWAQLTFWETSQLCLLLLSLTLATINARWLEPHTTAAMWSLQKVEKERGLG  149



>ref|XP_006206363.1| PREDICTED: transmembrane protein 205 [Vicugna pacos]
Length=189

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM VWVTF+S ++L + LPR  F + QSK++P YF     S+  AF+  
Sbjct  13   VVHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMSCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      LL SL +  +N  +LEP  T  M+   K+EKE G G
Sbjct  70   CILASQHTWAQLTFWETSQLCLLLLSLTLATINARWLEPHTTAAMWSLQKVEKERGLG  127



>ref|XP_006104631.1| PREDICTED: transmembrane protein 205 [Myotis lucifugus]
Length=189

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 9/121 (7%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQIWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNF  69

Query  621  ILSQNQ---TQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
             +   Q   +Q    +T+Q      L  SL +  +N  +LEPR T  M+    +EK++G 
Sbjct  70   CILFPQHPWSQLTFWETSQ---LCLLFLSLTLATINARWLEPRTTAAMWALQTVEKKQGL  126

Query  450  G  448
            G
Sbjct  127  G  127



>ref|XP_006063973.1| PREDICTED: transmembrane protein 205 isoform X1 [Bubalus bubalis]
 ref|XP_006063974.1| PREDICTED: transmembrane protein 205 isoform X2 [Bubalus bubalis]
 ref|XP_006063975.1| PREDICTED: transmembrane protein 205 isoform X3 [Bubalus bubalis]
 ref|XP_010826625.1| PREDICTED: transmembrane protein 205 [Bison bison bison]
 ref|XP_010826626.1| PREDICTED: transmembrane protein 205 [Bison bison bison]
 ref|XP_010826627.1| PREDICTED: transmembrane protein 205 [Bison bison bison]
Length=189

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTFIS +VL + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    F LL SL +  VN  +LE R T  M+    +EKE G G
Sbjct  70   CILASQCSWAQLTFWEASQLFLLLLSLTLATVNARWLESRTTAAMWALQTVEKERGLG  127



>ref|XP_007106730.1| PREDICTED: transmembrane protein 205 isoform X1 [Physeter catodon]
 ref|XP_007106731.1| PREDICTED: transmembrane protein 205 isoform X2 [Physeter catodon]
Length=189

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 3/119 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
             +  +Q         +      LL SL++  +N  +LEPR T  M+    +EKE G G+
Sbjct  70   CILASQHAGAQLTFWEASQLCLLLLSLMLATINARWLEPRTTAAMWALQTMEKERGLGR  128



>ref|NP_001032688.1| transmembrane protein 205 [Bos taurus]
 ref|XP_005208797.1| PREDICTED: transmembrane protein 205 isoform X1 [Bos taurus]
 ref|XP_005208798.1| PREDICTED: transmembrane protein 205 isoform X1 [Bos taurus]
 ref|XP_005208799.1| PREDICTED: transmembrane protein 205 isoform X1 [Bos taurus]
 sp|Q32L10.1|TM205_BOVIN RecName: Full=Transmembrane protein 205 [Bos taurus]
 gb|AAI09821.1| Transmembrane protein 205 [Bos taurus]
 tpg|DAA27928.1| TPA: transmembrane protein 205 [Bos taurus]
Length=189

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTFIS +VL + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    F LL SL +  +N  +LE R T  M+    +EKE G G
Sbjct  70   CILASQCSWAQLTFWEASQLFLLLLSLTLATINARWLESRTTAAMWALQTVEKERGLG  127



>ref|XP_005890840.1| PREDICTED: transmembrane protein 205 [Bos mutus]
 gb|ELR59984.1| Transmembrane protein 205 [Bos mutus]
Length=189

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = -3

Query  795  NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
            +L+ L+ A+GM +WVTFIS +VL + LPR  F + QSK++P YF     S+G AF+   +
Sbjct  15   HLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNLCI  71

Query  615  SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
              +Q         +    F LL SL +  VN  +LE R T  M+    +EKE G G
Sbjct  72   LASQCSWAQLTFWEASQLFLLLLSLTLATVNARWLESRTTAAMWALQTVEKERGLG  127



>ref|XP_007307589.1| hypothetical protein STEHIDRAFT_101745 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM83489.1| hypothetical protein STEHIDRAFT_101745 [Stereum hirsutum FP-91666 
SS1]
Length=202

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 61/114 (54%), Gaps = 7/114 (6%)
 Frame = -3

Query  780  AVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK----AMAYSIGTAFLGHILS  613
            A  FGMS+WVTF    +  +ALPRQ F   Q K +P+YF     A  + +GT  + H + 
Sbjct  29   AFIFGMSIWVTFFGGVIAYRALPRQMFGTLQHKTFPIYFNISIAAATFLLGTWTVSHSVL  88

Query  612  QNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
             N T+   +   Q    + L + +L    N   + P  +++MF+R K+EKEEG+
Sbjct  89   DNLTKPYFADVAQ---AYTLATVILFQGTNTGVVGPMTSRLMFKRHKLEKEEGK  139



>ref|XP_008706293.1| PREDICTED: transmembrane protein 205 [Ursus maritimus]
Length=189

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 59/118 (50%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M  L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVYLLVLSGAWGMQMWVTFVSGFLLFRNLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +      L     +   +  +LEPR T  M    ++EKE G G
Sbjct  70   CILAPQHAWAQLTFWEASQVCGLRLHCPLETRSCCWLEPRTTAAMRALHRVEKERGLG  127



>ref|XP_004277434.1| PREDICTED: transmembrane protein 205 [Orcinus orca]
 ref|XP_004316048.1| PREDICTED: transmembrane protein 205 [Tursiops truncatus]
Length=189

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +      LL SL++  +N  +LEPR T  M+    +EKE G G
Sbjct  70   CILASQRAGAQLTFWEASQLCLLLLSLMLATINARWLEPRTTAAMWALQTMEKERGLG  127



>ref|XP_006982404.1| PREDICTED: transmembrane protein 205 isoform X1 [Peromyscus maniculatus 
bairdii]
 ref|XP_006982405.1| PREDICTED: transmembrane protein 205 isoform X2 [Peromyscus maniculatus 
bairdii]
Length=189

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
             G    + +L+ L+ A+GM +WVTF S ++L ++LPR  F + QSK++PVYF     S+G
Sbjct  7    PGSLIKVVHLLVLSGAWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPVYFHI---SLG  63

Query  639  TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             A +   +   Q   +H    +      LL SL +  +N  +LE R T  M+    +EK+
Sbjct  64   CALINLCILAPQRAWIHLSLWEASQLALLLLSLTLATINARWLEARTTAAMWALQTVEKD  123

Query  459  EGRG  448
             G G
Sbjct  124  RGLG  127



>ref|XP_001490060.1| PREDICTED: transmembrane protein 205 isoform X1 [Equus caballus]
 ref|XP_005611984.1| PREDICTED: transmembrane protein 205 isoform X2 [Equus caballus]
 ref|XP_005611985.1| PREDICTED: transmembrane protein 205 isoform X3 [Equus caballus]
 ref|XP_005611986.1| PREDICTED: transmembrane protein 205 isoform X4 [Equus caballus]
Length=189

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            S+G    + +L+ L+ A+GM +WVTF S +VL +ALPR  F + QSK++P YF     S+
Sbjct  6    SSGSLTQVVHLLVLSGAWGMQMWVTFASGFVLFRALPRHTFGLVQSKLFPFYFHI---SM  62

Query  642  GTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
              AF+   +   Q         +    F  L SL +  +N  +LEPR T  M+    +EK
Sbjct  63   ACAFVSFCILAPQRAWAQLTFWEASQLFLTLLSLTLATINARWLEPRTTAAMWALQTVEK  122

Query  462  EEGRG  448
            E G G
Sbjct  123  ERGLG  127



>ref|XP_008051446.1| PREDICTED: transmembrane protein 205 [Tarsius syrichta]
 ref|XP_008051447.1| PREDICTED: transmembrane protein 205 [Tarsius syrichta]
Length=189

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 3/116 (3%)
 Frame = -3

Query  795  NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
            +L+ L+ A+GM +WVTF+S ++L + LPR  F +AQSK++P YF     S+G AF+   +
Sbjct  15   HLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFHI---SMGCAFINLCI  71

Query  615  SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
               Q         +      L  SL +  +N  +L PR T  M+    +EKE G G
Sbjct  72   LAPQHAWARLTFWEASQLCLLFLSLTLATLNARWLGPRTTATMWALQTVEKERGLG  127



>ref|XP_004632884.1| PREDICTED: transmembrane protein 205 [Octodon degus]
Length=189

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 60/109 (55%), Gaps = 3/109 (3%)
 Frame = -3

Query  774  AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
            A+GM +WVTF S ++L + LPR  F + QSK++P YF     S+G AF+    + +Q   
Sbjct  22   AWGMQMWVTFASGFLLFRNLPRHTFGLVQSKLFPFYFHI---SMGCAFINLCTAASQRAW  78

Query  594  LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            +     +      LL SL++  VN  +LEPR T  M+    +EKE G G
Sbjct  79   VQFTFWEASQCCLLLLSLVLAAVNARWLEPRTTAAMWALQSVEKEHGLG  127



>ref|XP_002921398.1| PREDICTED: transmembrane protein 205-like isoform 1 [Ailuropoda 
melanoleuca]
 ref|XP_002921399.1| PREDICTED: transmembrane protein 205-like isoform 2 [Ailuropoda 
melanoleuca]
 gb|EFB12965.1| hypothetical protein PANDA_010291 [Ailuropoda melanoleuca]
Length=189

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            M  L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   MVYLLVLSGAWGMQMWVTFVSGFLLFRNLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +      LL + ++  +N  +LEPR T  M    ++EKE G G
Sbjct  70   CILAPQHAWAQLTFWEASQLCLLLLNFVLSAINARWLEPRTTAAMRALHRVEKERGLG  127



>ref|XP_004716881.1| PREDICTED: transmembrane protein 205 [Echinops telfairi]
Length=191

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 64/122 (52%), Gaps = 6/122 (5%)
 Frame = -3

Query  804  GMANLIGLAV---AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTA  634
            G+A ++ L V   A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G A
Sbjct  9    GLAKVVHLLVLSGAWGMQIWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCA  65

Query  633  FLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
             +   +  +Q         +      LL  L +  +N  +LEPR T  M+    +EK+ G
Sbjct  66   LVNLCILASQCAWTQLTFWEASQLGLLLLCLTLAAINGRWLEPRTTATMWALQTVEKKRG  125

Query  453  RG  448
             G
Sbjct  126  LG  127



>ref|NP_001100274.1| transmembrane protein 205 [Rattus norvegicus]
 ref|XP_006242683.1| PREDICTED: transmembrane protein 205 isoform X1 [Rattus norvegicus]
 ref|XP_006242684.1| PREDICTED: transmembrane protein 205 isoform X1 [Rattus norvegicus]
 ref|XP_006242685.1| PREDICTED: transmembrane protein 205 isoform X1 [Rattus norvegicus]
 ref|XP_006242686.1| PREDICTED: transmembrane protein 205 isoform X1 [Rattus norvegicus]
 ref|XP_006242687.1| PREDICTED: transmembrane protein 205 isoform X1 [Rattus norvegicus]
 ref|XP_008764150.1| PREDICTED: transmembrane protein 205 isoform X1 [Rattus norvegicus]
 ref|XP_008764151.1| PREDICTED: transmembrane protein 205 isoform X1 [Rattus norvegicus]
 gb|EDL78257.1| RGD1563250 (predicted), isoform CRA_a [Rattus norvegicus]
 gb|EDL78258.1| RGD1563250 (predicted), isoform CRA_a [Rattus norvegicus]
 gb|EDL78260.1| RGD1563250 (predicted), isoform CRA_a [Rattus norvegicus]
Length=189

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
             G    + +L+ L+  +GM +WVTF S ++L ++LPR  F + QSK++PVYF     S+G
Sbjct  7    PGSLIKVIHLLVLSGVWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPVYFHV---SLG  63

Query  639  TAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKE  460
             AF+   +   Q   ++    +      LL SL +  +N  +LE R T  M+    IEKE
Sbjct  64   CAFINLCILAPQRAWINLTLWEISQLTLLLLSLTLATINARWLEARTTATMWALQSIEKE  123

Query  459  EGRG  448
             G G
Sbjct  124  RGLG  127



>gb|EDL25229.1| cDNA sequence BC010787, isoform CRA_c [Mus musculus]
Length=104

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = -3

Query  816  GRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGT  637
            G    + +L+ L+ A+GM VWVTFIS ++L ++LPR  F + QSK++PVYF     S+G 
Sbjct  8    GSLIKVIHLLVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHV---SLGC  64

Query  636  AFLGHILSQNQTQRLH  589
            AF+   +   Q   +H
Sbjct  65   AFINLCILAPQRAWIH  80



>ref|XP_004378381.1| PREDICTED: transmembrane protein 205 [Trichechus manatus latirostris]
Length=189

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 61/118 (52%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P+YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPLYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +       L  L +  +N   L PR T  M+    +EKE G G
Sbjct  70   WILATQHTWAQLTFWEASQLCLRLLCLTLAAINARLLGPRTTAAMWALQTLEKERGLG  127



>ref|XP_008831793.1| PREDICTED: transmembrane protein 205 [Nannospalax galili]
 ref|XP_008831794.1| PREDICTED: transmembrane protein 205 [Nannospalax galili]
 ref|XP_008831795.1| PREDICTED: transmembrane protein 205 [Nannospalax galili]
 ref|XP_008831796.1| PREDICTED: transmembrane protein 205 [Nannospalax galili]
Length=189

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF S ++L ++LPR  F + QSK++PVYF     S+G AF   
Sbjct  13   VVHLMVLSGAWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPVYFHV---SLGCAFTNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q   +H    +      LL SL +  +N  +LE R T  M+     EKE G G
Sbjct  70   CILAPQRAWIHLTFWEASQLALLLLSLTLATINARWLEARTTAAMWALQAAEKERGLG  127



>ref|XP_004008585.1| PREDICTED: transmembrane protein 205 isoform 1 [Ovis aries]
 ref|XP_004008586.1| PREDICTED: transmembrane protein 205 isoform 2 [Ovis aries]
Length=189

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTFIS +VL + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    F LL SL +  VN  +LE R +  M+    +EKE G G
Sbjct  70   CILASQCTWAQLTFWEASQLFLLLLSLTLATVNARWLESRTSAAMWALQTVEKERGLG  127



>ref|XP_005682437.1| PREDICTED: transmembrane protein 205 isoform X1 [Capra hircus]
 ref|XP_005682438.1| PREDICTED: transmembrane protein 205 isoform X2 [Capra hircus]
 ref|XP_005682439.1| PREDICTED: transmembrane protein 205 isoform X3 [Capra hircus]
Length=189

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTFIS +VL + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    F LL SL +  VN  +LE R +  M+    +EKE G G
Sbjct  70   CILASQCAWAQLTFWEASQLFLLLLSLTLATVNARWLESRTSAAMWALQTVEKERGLG  127



>ref|XP_004616637.1| PREDICTED: transmembrane protein 205 [Sorex araneus]
Length=189

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = -3

Query  804  GMANLIGLAV---AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTA  634
            G+A ++ L V   A+GM +WVTF S ++L + LPR  F + QSK++P YF     S+  A
Sbjct  9    GLARVVHLLVLSGAWGMQMWVTFASGFILFRGLPRHTFGLVQSKLFPFYFHV---SVACA  65

Query  633  FLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
            F+   +  +Q         +    F LL SL++  VN  +LEPR +  M+   ++EKE G
Sbjct  66   FVNLCVLASQYSWARITFWESSQVFLLLLSLVLAAVNDRWLEPRTSSAMWALYRVEKERG  125

Query  453  RGK  445
             G+
Sbjct  126  LGQ  128



>ref|XP_005970320.1| PREDICTED: ras-related protein Rab-3D-like isoform X2 [Pantholops 
hodgsonii]
 ref|XP_005970321.1| PREDICTED: ras-related protein Rab-3D-like isoform X3 [Pantholops 
hodgsonii]
 ref|XP_005970322.1| PREDICTED: ras-related protein Rab-3D-like isoform X4 [Pantholops 
hodgsonii]
 ref|XP_005970323.1| PREDICTED: ras-related protein Rab-3D-like isoform X5 [Pantholops 
hodgsonii]
Length=189

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTFIS +VL + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +  +Q         +    F LL SL +  VN  +LE R +  M+    +EKE G G
Sbjct  70   CILASQCTWAQLTFWEASQLFLLLLSLTLATVNARWLESRISAAMWALQTVEKERGLG  127



>ref|XP_004689065.1| PREDICTED: transmembrane protein 205 [Condylura cristata]
Length=189

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 63/119 (53%), Gaps = 3/119 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF S ++L + LPR  F + QSK++P YF     S+  AF+  
Sbjct  13   VVHLLVLSGAWGMQIWVTFASGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMSCAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
             +  +Q         +      L  +L +  +N  +LEPR T  M+    +EKE G G+
Sbjct  70   CILASQHSWAQLTYWEASQLCLLFLNLTLATINARWLEPRTTAAMWALQMVEKERGLGQ  128



>ref|XP_007951790.1| PREDICTED: transmembrane protein 205 [Orycteropus afer afer]
Length=189

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 3/126 (2%)
 Frame = -3

Query  825  RSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYS  646
            R  G    + +L+ L+ A+GM +WVTF++ ++L + LPR  F + QSK++P YF     S
Sbjct  5    RDPGSLTKVVHLLVLSGAWGMQMWVTFVAGFLLFRGLPRHTFGLVQSKLFPFYFHI---S  61

Query  645  IGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIE  466
            +G AF+   +             +      LL  L +  +N  +LEPR T  M+    +E
Sbjct  62   MGCAFINLCILAPWHSWAQLTFWEASQLCLLLLCLTLAAINARWLEPRTTAAMWALQTLE  121

Query  465  KEEGRG  448
            KE G G
Sbjct  122  KERGLG  127



>ref|XP_001828635.2| hypothetical protein CC1G_10507 [Coprinopsis cinerea okayama7#130]
 gb|EAU93139.2| hypothetical protein CC1G_10507 [Coprinopsis cinerea okayama7#130]
Length=190

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = -3

Query  837  HNILRSAGRAFGMANLIGLAVA-----FGMSVWVTFISSYVLAKALPRQQFAVAQSKIYP  673
            HN L +      + NL GL +A     FGMSVWVTF    +  + LPRQQF   Q K +P
Sbjct  3    HNELLTLSSLKELVNLNGLYLAGFGWLFGMSVWVTFFGGVIAFRTLPRQQFGALQHKTFP  62

Query  672  VYFKAMAYSIGTAFLGHILSQNQT--QRLH-SKTTQHflgfnllssllmvlvnllyLEPR  502
            VYF   + ++  A L   +S++ +    LH  +       + L + +L    NL  + P 
Sbjct  63   VYFT-QSIALSAALLSIWISKHPSVLANLHQPRLADVAQAYALATVILAQGSNLFVVGPW  121

Query  501  ATKVMFERMKIEKEEG  454
             +KVMF+R K+EKEEG
Sbjct  122  TSKVMFKRHKLEKEEG  137



>ref|XP_003941832.1| PREDICTED: transmembrane protein 205 [Saimiri boliviensis boliviensis]
 ref|XP_010327827.1| PREDICTED: transmembrane protein 205 [Saimiri boliviensis boliviensis]
Length=189

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFVSGFLLFRRLPRHTFGLVQSKLFPFYFHI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +    + L  SL +  VN  +LEPR T   +    +EKE G G
Sbjct  70   CILAPQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAATWALQTVEKERGLG  127



>ref|XP_004667532.1| PREDICTED: transmembrane protein 205 [Jaculus jaculus]
Length=189

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = -3

Query  774  AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
            A+GM +WVTF S ++L ++LPR  F + QSK++P YF     S+G AF+   L     QR
Sbjct  22   AWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPFYFYI---SMGCAFIN--LCILAPQR  76

Query  594  LHSKTT--QHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
              S+ T  +      LL SL +  +N  +LEPR T  M+    +EKE G G
Sbjct  77   AWSQLTVWEASQLCLLLLSLTLATINAHWLEPRTTAAMWALQTVEKERGLG  127



>ref|XP_007058305.1| PREDICTED: transmembrane protein 205 [Chelonia mydas]
Length=228

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLG-  625
            +A L  L++A+GM +WVTFIS +VL +++ R  F + QSK++P YF A+   +  AFL  
Sbjct  13   VAQLFILSLAWGMQIWVTFISGFVLIRSVSRHTFGLVQSKLFPFYFYAL---VACAFLNL  69

Query  624  HILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATK-VMFERMKIEKEEGRG  448
             I +    + L S T +                 +   +P AT   MF    IE+E G G
Sbjct  70   SIFAYYHPRELLS-TVETLQLGIGPRRPATTQCPMPLSQPSATTAAMFRWQAIEREHGLG  128



>ref|XP_008031847.1| hypothetical protein TRAVEDRAFT_25694 [Trametes versicolor FP-101664 
SS1]
 gb|EIW64548.1| hypothetical protein TRAVEDRAFT_25694 [Trametes versicolor FP-101664 
SS1]
Length=192

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 4/117 (3%)
 Frame = -3

Query  789  IGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQ  610
            +G A  FGM++WVTF+   +  K LPRQQF   Q + +PVYF  ++ ++ +  LG     
Sbjct  24   VGYAWLFGMTLWVTFVGGVIAFKTLPRQQFGTLQHRTFPVYF-VISIALSSGLLGLWTYS  82

Query  609  NQ---TQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            +    T+ L          + L + +     N   + P  +K MF+R ++EK+EG+G
Sbjct  83   HPTVLTEYLKPTNADVAQAYALAAVVFAQASNHFVIGPLTSKTMFQRHRLEKQEGKG  139



>ref|XP_004900414.1| PREDICTED: transmembrane protein 205 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004900415.1| PREDICTED: transmembrane protein 205 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004865632.1| PREDICTED: transmembrane protein 205 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004865633.1| PREDICTED: transmembrane protein 205 isoform X2 [Heterocephalus 
glaber]
 gb|EHB12952.1| Transmembrane protein 205 [Heterocephalus glaber]
Length=189

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 59/109 (54%), Gaps = 3/109 (3%)
 Frame = -3

Query  774  AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
            A+GM +WVTF S ++L + LPR  F + QSK++P YF     S+  AF    ++ +Q   
Sbjct  22   AWGMQMWVTFASGFLLFRNLPRHTFGLVQSKLFPFYFHI---SMACAFSNLCIAVSQCAW  78

Query  594  LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            +     +      LL SL++  +N  +LEPR T  M+    +EKE G G
Sbjct  79   VQLTFWEASQCCLLLLSLVLTAINARWLEPRTTAAMWALQSVEKERGLG  127



>ref|XP_005336217.1| PREDICTED: transmembrane protein 205 isoform X1 [Ictidomys tridecemlineatus]
 ref|XP_005336218.1| PREDICTED: transmembrane protein 205 isoform X2 [Ictidomys tridecemlineatus]
 ref|XP_005336219.1| PREDICTED: transmembrane protein 205 isoform X3 [Ictidomys tridecemlineatus]
Length=189

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF S ++L + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFASGFLLFRTLPRHTFGLVQSKLFPFYFYI---SMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +       L SL +  +N  +LEP  T  M+    +EKE+G G
Sbjct  70   CILAPQRAWAQLTFWEASQLCLQLLSLTLATINAHWLEPHTTAAMWALQIVEKEQGLG  127



>dbj|BAE87170.1| unnamed protein product [Macaca fascicularis]
Length=118

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = -3

Query  816  GRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGT  637
            G    M +L+ L+ A+GM +WVTF+S ++L + LPR  F +AQSK++P YF     S+G 
Sbjct  8    GGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFH---ISMGC  64

Query  636  AFL  628
            AF+
Sbjct  65   AFI  67



>gb|KDR84846.1| hypothetical protein GALMADRAFT_233266 [Galerina marginata CBS 
339.88]
Length=189

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 66/136 (49%), Gaps = 11/136 (8%)
 Frame = -3

Query  798  ANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHI  619
            A L+G A  FGMS+W++F    +  + LPR QF   Q KI+P+YF   +  +  + LG  
Sbjct  21   AYLVGYAWLFGMSIWISFFGGVIAFQTLPRHQFGSLQHKIFPIYF-VQSIVLSASLLGTW  79

Query  618  LSQNQTQRLH---SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            + ++    +H            + L + L     N   + P  ++ MF+R K+EKEEG+ 
Sbjct  80   IFKHPDVMMHLARPNVADVAQAYALATVLFSQGFNYFVIGPMTSRTMFQRHKLEKEEGK-  138

Query  447  KGSTTETEHGDGVTKD  400
                  T +  GV+ D
Sbjct  139  ------TYNEPGVSAD  148



>ref|XP_004495913.1| PREDICTED: transmembrane protein 205-like [Cicer arietinum]
Length=208

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 7/121 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAF--L  628
            +A+L+G ++AFG ++WVTFI   ++ K LPR QF   QSK++P YF  +   I  A    
Sbjct  38   LAHLLGFSIAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCIAVAVASF  97

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G+ L   +T    S TT+ +    LLSSL   L NL    P   ++M +R K+E+E   G
Sbjct  98   GY-LHPWKT----SSTTEKYQLGFLLSSLAFNLANLFVFTPMTIELMKQRHKVERENSIG  152

Query  447  K  445
            +
Sbjct  153  E  153



>ref|XP_003413409.1| PREDICTED: transmembrane protein 205 [Loxodonta africana]
 ref|XP_010591634.1| PREDICTED: transmembrane protein 205 [Loxodonta africana]
Length=189

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S ++L + LPR  F + QSK++P YF     ++G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---TMGCAFINL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +      LL  L +  +N  +L PR T  M+    +EK++G G
Sbjct  70   YIMATQHAWGQLTFWEASQLCLLLLCLTLAAINARWLGPRTTAAMWALHTLEKDQGLG  127



>ref|XP_006898852.1| PREDICTED: transmembrane protein 205 [Elephantulus edwardii]
Length=189

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 65/116 (56%), Gaps = 5/116 (4%)
 Frame = -3

Query  792  LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILS  613
            L+ L+ A+GM +W+TF+S ++L  ALPR  F + QSK++P YF          F G ++S
Sbjct  16   LLVLSGAWGMQMWITFVSGFLLFPALPRHTFGLVQSKLFPFYFHICMVCAFVNF-GILVS  74

Query  612  Q-NQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            Q    Q    +T+Q      LL  LL+ ++N  +LEPR T  M+    +EK+ G G
Sbjct  75   QLTWAQLTFWETSQF---CLLLLCLLLAVINARWLEPRTTAAMWAMQALEKDRGLG  127



>ref|XP_004442704.1| PREDICTED: transmembrane protein 205 [Ceratotherium simum simum]
Length=189

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF S +VL + +PR  F + QSK++P YF     S+  AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFASGFVLFRGVPRHTFGLVQSKLFPFYFHI---SMACAFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +   Q         +      LL SL +  +N  +LEPR T  M+    +EKE G G
Sbjct  70   CILAPQRAWAQLTFWEASQLCLLLLSLTLATINARWLEPRTTAAMWALQTVEKERGLG  127



>gb|AFK35536.1| unknown [Medicago truncatula]
Length=235

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 11/123 (9%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L+G ++AFG ++WVTFI   ++ K LPR QF   QSK++P YF  +   I       
Sbjct  38   LAHLLGFSIAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCIA------  91

Query  621  ILSQNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
             +++     LH    S T+Q +    L+S+L   L NL    P   ++M +R K+E+E  
Sbjct  92   -VTEASFGYLHPWKTSSTSQRYQLGFLISALAFNLTNLFVFTPMTIEMMKQRHKVERENS  150

Query  453  RGK  445
             G+
Sbjct  151  IGE  153



>ref|XP_007638645.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein Rab-3D isoform 
X1 [Cricetulus griseus]
Length=393

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG  640
             G    + +L+ L+ A+GM +WVTF S +VL ++LPR  F + QSK++PVYF     S+G
Sbjct  74   PGSFIKVVHLLVLSGAWGMQMWVTFASGFVLFRSLPRHTFGLVQSKLFPVYFHV---SLG  130

Query  639  TAFLGHILSQNQTQRLH  589
             A +   +   Q   +H
Sbjct  131  CALINLCILAPQRAWIH  147



>ref|XP_003591427.1| Transmembrane protein [Medicago truncatula]
 gb|AES61678.1| late embryogenesis abundant protein (LEA) family protein [Medicago 
truncatula]
Length=208

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 7/120 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIG--TAFL  628
            +A+L+G ++AFG ++WVTFI   ++ K LPR QF   QSK++P YF  +   I    A  
Sbjct  38   LAHLLGFSIAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCIAVTVASF  97

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          S T+Q +    L+S+L   L NL    P   ++M +R K+E+E   G
Sbjct  98   GYLHPWKT-----SSTSQRYQLGFLISALAFNLTNLFVFTPMTIEMMKQRHKVERENSIG  152



>gb|EAW84194.1| MBC3205, isoform CRA_b, partial [Homo sapiens]
Length=113

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = -3

Query  816  GRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGT  637
            G    M +L+ L+ A+GM +WVTF+S ++L ++LPR  F + QSK++P YF     S+G 
Sbjct  8    GGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFH---ISMGC  64

Query  636  AFL  628
            AF+
Sbjct  65   AFI  67



>ref|XP_010038276.1| PREDICTED: transmembrane protein 205-like [Eucalyptus grandis]
 gb|KCW50101.1| hypothetical protein EUGRSUZ_K03534 [Eucalyptus grandis]
Length=213

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 64/120 (53%), Gaps = 7/120 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            + +L+G A A+G + WVTFI   ++ K LPR QF   QSK++P YF   A+  +I  A  
Sbjct  43   LGHLLGFATAWGAAPWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFTMVAVCCAISVASF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          S TT+ +    LLS+    L NL    P   ++M +R K+EKEE  G
Sbjct  103  GYLHPWKS-----SSTTEKYQLGFLLSAFAFNLTNLFVFSPMTIEMMKQRHKVEKEENIG  157



>ref|XP_003461291.1| PREDICTED: transmembrane protein 205 [Cavia porcellus]
Length=189

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 60/109 (55%), Gaps = 3/109 (3%)
 Frame = -3

Query  774  AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
            A+GM +WVTF S ++L + LPR  F   QSK++P+YF     S+  AF+    + +Q   
Sbjct  22   AWGMQMWVTFASGFLLFRNLPRHTFGQVQSKLFPLYFHI---SVACAFVNLCTAASQRAW  78

Query  594  LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            +     +      LL SL++  +N  +LEPR T  M+   ++E++ G G
Sbjct  79   VQFTFWEASQCCLLLLSLVLAAINARWLEPRTTATMWALQRVERDHGLG  127



>ref|XP_004595566.1| PREDICTED: transmembrane protein 205 [Ochotona princeps]
Length=189

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 59/116 (51%), Gaps = 3/116 (3%)
 Frame = -3

Query  795  NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
            +L+ L+ A+GM VWVTF S ++L +ALPR  F   QSK++P YF     S+G AF    +
Sbjct  15   HLLALSGAWGMQVWVTFASGFLLFRALPRHTFGQVQSKLFPYYFYI---SVGCAFFNLCV  71

Query  615  SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
                         +      LL SL +   N L+LEPR T  M     +EKE G G
Sbjct  72   VAPLRAWEQLTFWETSKLCLLLLSLFLAATNALWLEPRTTAAMRVMHAVEKERGLG  127



>ref|XP_007359865.1| hypothetical protein DICSQDRAFT_46861 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF66433.1| hypothetical protein DICSQDRAFT_46861 [Dichomitus squalens LYAD-421 
SS1]
Length=192

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 62/117 (53%), Gaps = 6/117 (5%)
 Frame = -3

Query  789  IGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK-AMAYSIGTAFL---GH  622
            IG A  FGM++WVTFI   +  K LPRQQF   Q + +P+YF  ++A S G   L    H
Sbjct  24   IGYASLFGMTLWVTFIGGVIAFKVLPRQQFGNLQHRTFPIYFSISIALSSGLLALWTWSH  83

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
             L    T  L          + L S LL  +VN   + P  +K MF+R ++EKEEG+
Sbjct  84   PLV--LTHYLQPAVADVSQAYTLASVLLSQVVNYFVIGPLTSKTMFQRHRLEKEEGK  138



>ref|XP_005970319.1| PREDICTED: ras-related protein Rab-3D-like isoform X1 [Pantholops 
hodgsonii]
Length=320

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTFIS +VL + LPR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFVNL  69

Query  621  ILSQNQT  601
             +  +Q 
Sbjct  70   CILASQC  76



>ref|XP_010827125.1| PREDICTED: transmembrane protein 205-like [Bison bison bison]
Length=109

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 3/58 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFL  628
            + +L+ L+ A+GM +WVTFIS +VL + LPR  F + QSK++P YF     S+G AF+
Sbjct  13   VVHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFH---ISMGCAFV  67



>ref|XP_003760487.1| PREDICTED: transmembrane protein 205 [Sarcophilus harrisii]
Length=193

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 63/124 (51%), Gaps = 4/124 (3%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAV---AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMA  652
            S G   G+A ++ + V   A+GM VWVTFIS +VL + LPR  F + QSK++P YF    
Sbjct  3    SEGEPGGLAKVVQVLVLSGAWGMQVWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHVSL  62

Query  651  YSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMK  472
                 + LG  L  +   +L     +      L  SL +  +N  +LEP+ T  M+    
Sbjct  63   VCAAIS-LGIFLFHHPLVKLSFTLAEAGQLGLLALSLSLSGLNARWLEPKTTAAMWALQA  121

Query  471  IEKE  460
            +EKE
Sbjct  122  MEKE  125



>gb|EMP37259.1| hypothetical protein UY3_05573 [Chelonia mydas]
Length=215

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLG  625
            +A L  L++A+GM +WVTFIS +VL +++ R  F + QSK++P YF A+   +  AFL 
Sbjct  11   VAQLFILSLAWGMQIWVTFISGFVLIRSVSRHTFGLVQSKLFPFYFYAL---VACAFLN  66



>ref|XP_006023565.1| PREDICTED: transmembrane protein 205-like [Alligator sinensis]
Length=142

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -3

Query  819  AGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAM  655
             G   G+A+L  LA A+GM VWVTFIS +VLA+ + R  F   QSK++P YF  +
Sbjct  7    GGSLVGVAHLFVLATAWGMQVWVTFISGFVLARGVGRHVFGQVQSKLFPWYFHTL  61



>ref|XP_006262415.1| PREDICTED: transmembrane protein 205 [Alligator mississippiensis]
Length=187

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  804  GMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYF  664
            G+A+L  LA A+GM VWVTFIS +VLA+ + R  F   QSK++P YF
Sbjct  12   GVAHLFVLATAWGMQVWVTFISGFVLARGVGRHVFGQVQSKLFPWYF  58



>ref|XP_007842458.1| hypothetical protein Moror_273 [Moniliophthora roreri MCA 2997]
 gb|ESK98226.1| hypothetical protein Moror_273 [Moniliophthora roreri MCA 2997]
Length=189

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (51%), Gaps = 6/130 (5%)
 Frame = -3

Query  825  RSAGRAFGMANL--IGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMA  652
            +S   AF +  L  IG    FG S+WVTF    +  +ALPRQQF   Q +++P+YF   +
Sbjct  10   QSLLNAFSLNGLYMIGYGWIFGTSLWVTFFGGVIAYRALPRQQFGALQHRVFPIYF-FQS  68

Query  651  YSIGTAFLGHILSQNQTQRLHSK---TTQHflgfnllssllmvlvnllyLEPRATKVMFE  481
              +G+  L   +S +     H +          + L S +L   +N   + P  +K MF+
Sbjct  69   ILVGSGLLVLWISSHPDVITHIQRPLVADVAQAYTLASVILAQSINYFVIGPMTSKTMFQ  128

Query  480  RMKIEKEEGR  451
            R K+EKEEG+
Sbjct  129  RHKLEKEEGK  138



>emb|CCM01621.1| predicted protein [Fibroporia radiculosa]
Length=188

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 18/124 (15%)
 Frame = -3

Query  792  LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYF-KAMAYSIGT-------  637
            LIG A   GMS+WV+F +  +  +ALPR QF   Q +I+PVYF  ++  S G        
Sbjct  23   LIGYAWLLGMSIWVSFFAGPIAFRALPRHQFGALQHRIFPVYFVMSIIMSSGLLALWTRS  82

Query  636  --AFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEK  463
              A L H+     +Q L +   Q    ++L S LL    N   + P  +K MF+R K+EK
Sbjct  83   HPAVLAHL-----SQPLVADVAQ---AYSLASVLLFQGANYFVVGPLTSKTMFQRQKLEK  134

Query  462  EEGR  451
            EEG+
Sbjct  135  EEGK  138



>ref|XP_010038275.1| PREDICTED: transmembrane protein 205-like [Eucalyptus grandis]
 gb|KCW50099.1| hypothetical protein EUGRSUZ_K03533 [Eucalyptus grandis]
Length=213

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 7/120 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+G A A+G ++WVTFI   ++ K LPR QF   QSK++P YF    +  ++  A  
Sbjct  43   LAHLLGFATAWGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFTMVGVCCAMSVASF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          S +T+ +    LLS+    L NL    P   ++M +R K+EKEE  G
Sbjct  103  GYLHPWKS-----SSSTEKYQLGFLLSAFAFNLTNLFVFTPMTIEMMKQRHKVEKEENIG  157



>ref|XP_006631556.1| PREDICTED: transmembrane protein 205-like [Lepisosteus oculatus]
Length=188

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = -3

Query  795  NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
            +L+ L+V++GM +WVTF++ +VLA  + R  F + QSK++P YF  +   +G++FL   +
Sbjct  15   HLLVLSVSWGMQIWVTFVAGFVLAAGVSRHTFGLVQSKLFPFYFYGL---LGSSFLNLAV  71

Query  615  SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
                  R    T +        S++++  +N  +  P   ++M +  ++E+E G G
Sbjct  72   YAVYHPRELLDTHEAVQMGLFFSAVVLAGLNAQWFSPAVAELMLQMQEVEREHGLG  127



>gb|EMD41633.1| hypothetical protein CERSUDRAFT_90206 [Ceriporiopsis subvermispora 
B]
Length=191

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 12/121 (10%)
 Frame = -3

Query  792  LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL-  616
            L+G +  FGM++WVTFI   +  K+LPRQQF   Q + +P+YF     SI  A  G +L 
Sbjct  23   LVGYSWLFGMTLWVTFIGGVIAFKSLPRQQFGALQHRTFPIYF-----SISIALSGGLLG  77

Query  615  ------SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
                      +  L  +       + L +  +  + N   + P  +K MF+R + EKEEG
Sbjct  78   LWAYSHPAVLSHYLEPQLADVAQAYTLATVFVSQVANQTVIGPLTSKTMFQRHRQEKEEG  137

Query  453  R  451
            +
Sbjct  138  K  138



>ref|XP_005310207.1| PREDICTED: transmembrane protein 205 [Chrysemys picta bellii]
 ref|XP_008172982.1| PREDICTED: transmembrane protein 205 [Chrysemys picta bellii]
Length=188

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 60/118 (51%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A L  L++A+GM +WVTFIS +VL +++ R  F + QSK++P YF  +   +  A L  
Sbjct  13   VAQLFILSLAWGMQMWVTFISGFVLIRSVSRHTFGLVQSKLFPFYFYTL---VACAVLNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             +      R    T +   G      LL+  VN L L P  T  MF    IE+E G G
Sbjct  70   SIFACYHPRELLTTGETLQGALYFVCLLLASVNALGLSPATTAAMFRLQAIEREHGLG  127



>ref|XP_006124822.1| PREDICTED: transmembrane protein 205 [Pelodiscus sinensis]
Length=95

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFL  628
            +A L  L++A+GM +WVTFIS +VL + + R  F + QSK++P YF  +   +  AFL
Sbjct  13   VAQLFVLSLAWGMQIWVTFISGFVLIRGVSRHTFGLVQSKLFPFYFYTL---VACAFL  67



>ref|XP_008156250.1| PREDICTED: transmembrane protein 205 [Eptesicus fuscus]
Length=189

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFL  628
            + +L+ L+ A+GM +WVTF S ++L + LPR  F + QSK++P YF     S+G AF+
Sbjct  13   VVHLLVLSGAWGMQMWVTFFSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMGCAFV  67



>ref|XP_007423085.1| PREDICTED: transmembrane protein 205 isoform X1 [Python bivittatus]
 ref|XP_007423086.1| PREDICTED: transmembrane protein 205 isoform X2 [Python bivittatus]
Length=188

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (48%), Gaps = 3/119 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +  L  L+ A+GM +WVTFI+ +VL + + R  F + Q K++P YF  +   +G  FL  
Sbjct  13   ITQLFLLSTAWGMQIWVTFIAGFVLFRTVSRHTFGLVQGKLFPFYFYTL---LGCTFLNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
             +      R    T +          L++V  N  +     TK M +  KIEKE G G+
Sbjct  70   AIFATYHPRELLNTRETVQITLFFICLILVATNASWFSQVTTKTMLKMQKIEKEHGLGE  128



>ref|XP_003577242.1| PREDICTED: transmembrane protein 205-like [Brachypodium distachyon]
Length=214

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (55%), Gaps = 11/122 (9%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L+  A A+G ++WVTF+   V+ K LPR QF   Q K++P YF  M  S+ +A    
Sbjct  44   LAHLLCFATAWGAALWVTFVGGVVMFKYLPRHQFGNLQGKMFPAYF--MLISMCSA----  97

Query  621  ILSQNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
             +S      LH    + T +H+    LL++L   L NLL   P   ++M +R K+EK+ G
Sbjct  98   -ISVAAFAYLHPWKTASTIEHYQLGFLLAALGFDLSNLLVFTPMTIEMMMKRHKLEKDLG  156

Query  453  RG  448
             G
Sbjct  157  IG  158



>ref|XP_007325253.1| hypothetical protein AGABI1DRAFT_81244 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM83479.1| hypothetical protein AGABI1DRAFT_81244 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=188

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 6/59 (10%)
 Frame = -3

Query  822  SAGRAFGMANL------IGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYF  664
            + G  F +AN+      +G A  FGMS+WVTF  + +  KALPRQ F   Q +++PVYF
Sbjct  8    TLGSIFHLANIADGLYMLGYAWLFGMSLWVTFFGAIISLKALPRQYFGTLQHRVFPVYF  66



>ref|XP_002724192.1| PREDICTED: transmembrane protein 205 [Oryctolagus cuniculus]
 ref|XP_008251516.1| PREDICTED: transmembrane protein 205 [Oryctolagus cuniculus]
 ref|XP_008251517.1| PREDICTED: transmembrane protein 205 [Oryctolagus cuniculus]
Length=189

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 3/111 (3%)
 Frame = -3

Query  780  AVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQT  601
            A A+GM +WVTF S ++L ++LPR  F   QS+++P YF     S+G A +   L   Q 
Sbjct  20   AGAWGMQMWVTFASGFLLFRSLPRHTFGQVQSRLFPYYFCT---SVGCALINLCLVAPQR  76

Query  600  QRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
                    +      LL SL +   N L+LEPR T  M     +E+E G G
Sbjct  77   AWAQLTFWETSKLCLLLLSLSLAAGNALWLEPRTTAAMRAMQAVEREHGLG  127



>ref|XP_008378789.1| PREDICTED: uncharacterized protein LOC103441857 [Malus domestica]
Length=207

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 12/106 (11%)
 Frame = -3

Query  1524  KKQEDVIVKDGHRVVVVEYEKE-HGNTKV-LISPHESSSEDVA--AEKGGENDGD-----  1372
             ++ ++VIVK+GH VVVVEY++  H NTKV +IS H    +D +  ++   EN  +     
Sbjct  56    RRDQEVIVKNGHMVVVVEYDEHGHPNTKVSIISEHHPPCKDTSLFSDNAMENIKEAASAL  115

Query  1371  ---GSYHRRTTAGELVCDAFGRCRRKIAGVFDRTKDTAPEMAEGAR  1243
                G +       EL+CD +G+C+ K+A   +  K+   E A GA+
Sbjct  116   PNFGQHGEGHNPRELMCDVYGKCKHKLASAIETKKEICRETAHGAK  161



>ref|XP_003216825.1| PREDICTED: transmembrane protein 205 [Anolis carolinensis]
Length=187

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 58/118 (49%), Gaps = 3/118 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +  L  L+ A+GM +WVTFI+ +VL + + R  F + QSK++P YF  M   +G  F+  
Sbjct  13   LLQLFVLSTAWGMQIWVTFIAGFVLFQGVSRHTFGLVQSKLFPFYFYTM---LGCTFVNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             L      R      +        + L++ L N  +     TK MF+  +IEKE G G
Sbjct  70   SLFAIYHPRELLDARETIQIVLFFACLILTLANASWFSHITTKTMFKMQEIEKEHGLG  127



>ref|XP_007145160.1| hypothetical protein PHAVU_007G215400g [Phaseolus vulgaris]
 gb|ESW17154.1| hypothetical protein PHAVU_007G215400g [Phaseolus vulgaris]
Length=208

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 7/121 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAM--AYSIGTAFL  628
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF  +    +I  A  
Sbjct  38   LAHLLSFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGACCAISVASF  97

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          S TT+ +    LLSS    L NL    P   ++M +R K+E+E   G
Sbjct  98   GYLHPWKT-----SSTTERYQLGFLLSSFAFNLTNLFVFTPMTIEMMKQRHKVERESNIG  152

Query  447  K  445
            +
Sbjct  153  E  153



>ref|XP_004300464.1| PREDICTED: transmembrane protein 205-like [Fragaria vesca subsp. 
vesca]
Length=213

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 64/121 (53%), Gaps = 7/121 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  A AFG ++WVTFI   ++ K LPR QF   QSK++P YF    +  +I  A  
Sbjct  43   LAHLLSFATAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFTMVGICCAISVASF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++   +      S     +    L+SSL   L NL    P   ++M +R KIEKE+  G
Sbjct  103  GYLHPWSS-----STVADKYQLGFLISSLAFNLTNLFVFTPMTIEMMKQRHKIEKEQNIG  157

Query  447  K  445
            +
Sbjct  158  E  158



>ref|XP_001516741.3| PREDICTED: transmembrane protein 205 [Ornithorhynchus anatinus]
Length=186

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 89/212 (42%), Gaps = 39/212 (18%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A ++ L++ +G  +WVTFIS +VL + + R  F + QSK++P YF     ++  AFL  
Sbjct  11   VAQVLILSLTWGTQIWVTFISGFVLYRGVARHTFGLVQSKLFPFYFYV---TLACAFLNL  67

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGKG  442
             +      R      +          L++  +N  +L    T+ M++   +EKE G G+ 
Sbjct  68   SIFVMYHPREQLTQGEAGQLSLFFVCLVLSALNAQWLSGSTTEAMWKMQAVEKEHGLGQE  127

Query  441  STTETEHGDGVTKDRsaagavvdgstgavvdggtaataaTEIAEKKQRERAEKSEMMRLS  262
                +  G                                  A K+ RE+  K   +R  
Sbjct  128  VGLSSNQG----------------------------------AYKQLREKDPKYRALR--  151

Query  261  RKLKKLNSYSSFLNVVTLMCLTLYLAHLAQRL  166
            +K  + +  SS  N+V L+C  + LA LA RL
Sbjct  152  QKFFRYHGLSSLCNLVCLICNGVCLACLALRL  183



>ref|XP_004084163.1| PREDICTED: transmembrane protein 205-like isoform 1 [Oryzias 
latipes]
 ref|XP_004084164.1| PREDICTED: transmembrane protein 205-like isoform 2 [Oryzias 
latipes]
Length=188

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 59/117 (50%), Gaps = 3/117 (3%)
 Frame = -3

Query  795  NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
            +L+ L+  +GM VWV+FI+ +VL   + R  F + QSK++PVYF  +   +G  F+   +
Sbjct  15   HLLVLSFTWGMQVWVSFIAGFVLVTQVTRHTFGLVQSKLFPVYFYCL---LGCNFVSLAV  71

Query  615  SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
                  R      +         SL+   +N  +  P AT+VMF+   +E+E G G 
Sbjct  72   YAVYHPRELLDWHESVQILLFFVSLITAGLNAQWFGPAATEVMFQMRAVEEEHGLGN  128



>ref|XP_001775467.1| predicted protein [Physcomitrella patens]
 gb|EDQ59664.1| predicted protein [Physcomitrella patens]
Length=214

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 60/119 (50%), Gaps = 5/119 (4%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+  A AFG +VW +FI   ++ K LPR QF   Q+K++P YFK +           
Sbjct  44   LVHLLSFATAFGTAVWASFIGGIIMFKNLPRHQFGNLQAKMFPAYFKLLTVCCSLC----  99

Query  621  ILSQNQTQRLHSKT-TQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            + +   T    S T  +      L  SL  V+ NLL  +P   K+M +R KIEK+ G G
Sbjct  100  VSAMATTHPWLSATRRERLQIVALGVSLFTVVFNLLVFQPLTVKIMKQRHKIEKDSGIG  158



>ref|NP_001068440.1| Os11g0673100 [Oryza sativa Japonica Group]
 gb|ABA95272.1| seed maturation protein PM27, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28803.1| Os11g0673100 [Oryza sativa Japonica Group]
 gb|EAY81824.1| hypothetical protein OsI_36996 [Oryza sativa Indica Group]
 dbj|BAG90937.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97623.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65486.1| hypothetical protein OsJ_20902 [Oryza sativa Japonica Group]
Length=211

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 11/123 (9%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+++  A A+G ++WVTFI   V+ K LPR QF   Q K++P YF  M  S+ +A    
Sbjct  41   LAHVLCFATAWGAALWVTFIGGIVMFKYLPRHQFGSLQGKMFPAYF--MLISVCSA----  94

Query  621  ILSQNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
             +S      LH    + T + +    L+S+L   L NLL   P  T++M  R KIEK+ G
Sbjct  95   -ISVAAFAYLHPWKTASTIERYQLGFLISALGFDLSNLLVFTPMTTEMMMRRHKIEKDLG  153

Query  453  RGK  445
             G 
Sbjct  154  IGS  156



>ref|XP_005802843.1| PREDICTED: transmembrane protein 205-like [Xiphophorus maculatus]
Length=188

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 3/122 (2%)
 Frame = -3

Query  810  AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAF  631
            A  + +L+ LA  +GM VWV+FI  + L K + R  F + QSK++PVYF  +   +G+ F
Sbjct  10   AIKVLHLLLLAFTWGMQVWVSFIGGFALVKQVSRHTFGLVQSKLFPVYFYCL---LGSNF  66

Query  630  LGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
                +      R      +         +L+   +N  +  P AT+VMF+   +E+E G 
Sbjct  67   TSLAVYAVYHPRELLDWHEGVQMLMFFVALITAGLNAQWFGPAATEVMFQMRAVEEEHGL  126

Query  450  GK  445
            G 
Sbjct  127  GN  128



>ref|NP_001235713.1| uncharacterized protein LOC100305973 [Glycine max]
 gb|ACU13921.1| unknown [Glycine max]
 gb|KHN30649.1| Transmembrane protein 205 [Glycine soja]
Length=208

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 7/121 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF    +  ++  A  
Sbjct  38   LAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCCAVSVASF  97

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          S TT+ +    LLSS    L NL    P   ++M +R K+E+E   G
Sbjct  98   GYLHPWKT-----SSTTERYQLGFLLSSFAFNLTNLFVFTPMTIEMMKQRHKVERENNIG  152

Query  447  K  445
            +
Sbjct  153  E  153



>ref|XP_003275696.2| PREDICTED: LOW QUALITY PROTEIN: transmembrane protein 205 [Nomascus 
leucogenys]
Length=213

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK  661
            M +L+ L+ A+GM +WVTF S ++L + LPR  F + QS+++P YF+
Sbjct  13   MVHLLVLSGAWGMQMWVTFFSRFLLFRGLPRPTFXLLQSRLFPFYFR  59



>ref|XP_006663101.1| PREDICTED: transmembrane protein 205-like [Oryza brachyantha]
Length=207

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 68/130 (52%), Gaps = 11/130 (8%)
 Frame = -3

Query  825  RSAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYS  646
            RS   A  +A+++  A A+G S+WVTFI   V+ K LPR QF   Q K++P YF  M  S
Sbjct  29   RSGAAAARLAHVLCFATAWGASLWVTFIGGIVMFKHLPRHQFGSLQGKMFPAYF--MLIS  86

Query  645  IGTAFLGHILSQNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFER  478
            + +A     +S      LH    + T + +    L+S+L   L NLL   P   ++M  R
Sbjct  87   VCSA-----ISVAAFAYLHPWKTASTIERYQLGFLISALGFDLSNLLVFTPMTIEMMMRR  141

Query  477  MKIEKEEGRG  448
             KIEK+ G G
Sbjct  142  HKIEKDLGIG  151



>ref|XP_007526029.1| PREDICTED: transmembrane protein 205 [Erinaceus europaeus]
Length=187

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 3/110 (3%)
 Frame = -3

Query  774  AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
            A+GM VW+TF S ++L + LPR  F + QSK++P YF     S+  A +   +  +Q + 
Sbjct  20   AWGMQVWMTFASGFLLFRNLPRHTFGLVQSKLFPFYFHT---SLACALINLFIWLSQKKW  76

Query  594  LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
                         L +S ++  +N  +L PR T  M+     EKE G G+
Sbjct  77   AQFTWWDVGQLLLLAASTVLAALNARWLGPRTTAAMWALQAAEKERGLGR  126



>ref|XP_008235189.1| PREDICTED: transmembrane protein 205 [Prunus mume]
Length=213

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 65/121 (54%), Gaps = 7/121 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF    +  ++  A  
Sbjct  43   LAHLLTFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGICCAVSVASF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++   N      S   + +    LLSSL   L NL    P   ++M +R K+E+E+  G
Sbjct  103  GYLHPWNS-----SSVAEKYQLGFLLSSLAFNLTNLFVFTPMTVEMMKQRHKVEREQNIG  157

Query  447  K  445
            +
Sbjct  158  E  158



>ref|XP_008510119.1| PREDICTED: transmembrane protein 205, partial [Equus przewalskii]
Length=106

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = -3

Query  822  SAGRAFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSI  643
            S+G    + +L+ L+ A+GM +WVTF S +VL +ALP   F + QSK++P YF     S+
Sbjct  6    SSGSLTQVVHLLVLSGAWGMQMWVTFASGFVLFRALPLHTFGLVQSKLFPFYFH---ISM  62

Query  642  GTAFL  628
              AF+
Sbjct  63   ACAFV  67



>ref|XP_007200488.1| hypothetical protein PRUPE_ppa011378mg [Prunus persica]
 gb|EMJ01687.1| hypothetical protein PRUPE_ppa011378mg [Prunus persica]
Length=213

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 65/121 (54%), Gaps = 7/121 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF    +  ++  A  
Sbjct  43   LAHLLTFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGICCAVSVASF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++   N      S   + +    LLSSL   L NL    P   ++M +R K+E+E+  G
Sbjct  103  GYLHPWNS-----SSVAEKYQLGFLLSSLAFNLTNLFVFTPMTVEMMKQRHKVEREQNIG  157

Query  447  K  445
            +
Sbjct  158  E  158



>ref|XP_004458246.1| PREDICTED: transmembrane protein 205 isoform 1 [Dasypus novemcinctus]
 ref|XP_004458247.1| PREDICTED: transmembrane protein 205 isoform 2 [Dasypus novemcinctus]
Length=189

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 3/116 (3%)
 Frame = -3

Query  795  NLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHIL  616
            +L+ LA A+GM +WVTF S ++L ++LPR  F + QSK++P YF     S+   F+   +
Sbjct  15   HLLVLAGAWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPSYFHI---SVACPFINLCI  71

Query  615  SQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
               Q         +      LL SL +   N  +L PR T  M     +EKE G G
Sbjct  72   LAPQHAWAQLTFWEAGQLGLLLLSLALAATNARWLGPRTTAAMQALQILEKERGLG  127



>gb|ETE69392.1| Transmembrane protein [Ophiophagus hannah]
Length=188

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 3/119 (3%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +  L  L+ A+GM +WVTFI+ +VL + + R  F + Q K++P YF  +   +G  FL  
Sbjct  13   ITQLFLLSTAWGMQIWVTFIAGFVLFRTVSRHTFGLVQGKLFPFYFYTL---LGCTFLNL  69

Query  621  ILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRGK  445
             +      R    T +          L++V  N  +     TK M +  +IEKE G G+
Sbjct  70   AIFAAYHPRELLSTRETVQITLFFICLILVATNASWFSQVTTKTMLKMQEIEKEHGLGQ  128



>gb|KDP28239.1| hypothetical protein JCGZ_14010 [Jatropha curcas]
Length=209

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 11/122 (9%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF  +     T     
Sbjct  39   LAHLLSFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFWLVGVCCAT-----  93

Query  621  ILSQNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
              S      LH    + T + +    LLSSL   L NL    P   ++M +R K+E+EE 
Sbjct  94   --SVGSFGYLHPWKSASTAEKYQLGFLLSSLAFNLANLFVFTPMTIEMMRQRHKVEREEN  151

Query  453  RG  448
             G
Sbjct  152  IG  153



>ref|XP_002275502.1| PREDICTED: transmembrane protein 205 [Vitis vinifera]
 emb|CAN73725.1| hypothetical protein VITISV_016653 [Vitis vinifera]
 emb|CBI36931.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 66/124 (53%), Gaps = 7/124 (6%)
 Frame = -3

Query  810  AFGMANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGT  637
            A  +A+L+  A A+G ++WVTFI   ++ K LPR  F   QSK++P YF    +  ++ T
Sbjct  40   ALKLAHLLCFATAWGAALWVTFIGGIIMFKNLPRHTFGNLQSKMFPAYFSMVGVCCAVST  99

Query  636  AFLGHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEE  457
            A  G++          S T + +    LLS+    L NLL   P   ++M +R K+E+E+
Sbjct  100  ASFGYLHPWKS-----SSTAEKYQLGFLLSAFAFNLTNLLVFTPMTIEMMKQRHKVEREQ  154

Query  456  GRGK  445
              G+
Sbjct  155  NIGE  158



>gb|EPS99083.1| hypothetical protein FOMPIDRAFT_1037137 [Fomitopsis pinicola 
FP-58527 SS1]
Length=188

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 60/118 (51%), Gaps = 6/118 (5%)
 Frame = -3

Query  792  LIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYF-KAMAYSIGTAFLGHIL  616
            L+G A   GMS+WVTF +  +  + LPR QF   Q +++P+YF +++  S G   L   L
Sbjct  23   LVGYAWLLGMSIWVTFFAGPIAYRTLPRHQFGALQHRVFPIYFVQSIIASAG--LLALWL  80

Query  615  SQNQ---TQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
            S +    T             + L S LL    N L + P  +K MFER ++EK EG+
Sbjct  81   SAHPAVTTYVFQPAVADVAQAYTLASVLLTQTSNHLVIGPLTSKAMFERHRLEKAEGK  138



>ref|XP_009541459.1| hypothetical protein HETIRDRAFT_469713 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87573.1| hypothetical protein HETIRDRAFT_469713 [Heterobasidion irregulare 
TC 32-1]
Length=189

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 54/149 (36%), Gaps = 62/149 (42%)
 Frame = -3

Query  798  ANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--------------  661
            A  +G +  FGMS+WVTF    +  KALPR QF   Q + +PVYF               
Sbjct  21   AYYMGYSFLFGMSLWVTFFGGIIAFKALPRHQFGALQHRTFPVYFNTTITISAGLLAAWT  80

Query  660  ------------------AMAYSIGTAFLGHILSQNQTQRLHSKTTQHflgfnllssllm  535
                              A AYS+ T  L        TQ L+S                 
Sbjct  81   YSHPAILDNVKRPYLADVAQAYSLATVLL--------TQALNSFVI--------------  118

Query  534  vlvnllyLEPRATKVMFERMKIEKEEGRG  448
                     P  +K MF R K+EK+EG+ 
Sbjct  119  --------GPLTSKTMFARHKLEKDEGKA  139



>ref|XP_010095303.1| hypothetical protein L484_001912 [Morus notabilis]
 gb|EXB59332.1| hypothetical protein L484_001912 [Morus notabilis]
Length=213

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  + A+G ++WVTFI   +L K LPR QF   QSK++P YF    +  +I  A  
Sbjct  43   LAHLLSFSTAWGAALWVTFIGGIILFKNLPRHQFGNLQSKMFPAYFSMVGVCCAISVASF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          S T + +    LLS+    L NL    P   ++M +R K+E+E+  G
Sbjct  103  GYLHPWKS-----SDTAEKYQLGFLLSAFAFNLANLFVFTPMTIEMMKQRHKVEREQNIG  157



>ref|XP_008572016.1| PREDICTED: transmembrane protein 205 isoform X1 [Galeopterus 
variegatus]
Length=210

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = -3

Query  774  AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
            A+GM +WVTF+S ++L + L R  F   QSK++P+YF     S+  +F+   +   Q   
Sbjct  43   AWGMQMWVTFVSGFLLFRHLSRHTFGQVQSKLFPLYFHI---SMACSFINLCILVPQHTW  99

Query  594  LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
                         LL SL +  +N  +LEPR T  M+    +EKE G G
Sbjct  100  AQLTFWDGSQLCLLLLSLTLATINARWLEPRTTAAMWAMQTVEKERGLG  148



>ref|XP_007051074.1| Late embryogenesis abundant protein (LEA) family protein [Theobroma 
cacao]
 gb|EOX95231.1| Late embryogenesis abundant protein (LEA) family protein [Theobroma 
cacao]
Length=213

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  A A+G ++WVTFI   ++ K LPR QF   QSK++P YF    +  +I  A  
Sbjct  43   LAHLLSFATAWGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCCAIAVAAF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          + T + +    L+S     L NLL   P   ++M +R K+EKE+  G
Sbjct  103  GYLHPWKS-----ATTAEKYQLGFLVSGFAFNLSNLLVFTPMTIEMMKQRHKVEKEQNIG  157



>ref|XP_006765857.1| PREDICTED: transmembrane protein 205 [Myotis davidii]
Length=189

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 9/121 (7%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            + +L+ L+ A+GM +WVTF+S        PR  F + QSK++P YF     S+G AF+  
Sbjct  13   VVHLLVLSGAWGMQIWVTFVSGRDPRSGRPRHTFGLVQSKLFPFYFHI---SMGCAFVNF  69

Query  621  ILSQNQ---TQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
             +   Q   +Q    +T+Q      L  SL +  +N  +LEPR T  M+    +EK++G 
Sbjct  70   CILFPQHPWSQLTFWETSQ---LCLLFLSLTLATINARWLEPRTTAAMWALQTVEKKQGL  126

Query  450  G  448
            G
Sbjct  127  G  127



>ref|XP_008386731.1| PREDICTED: transmembrane protein 205 [Malus domestica]
Length=213

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 11/123 (9%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGH  622
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF  +   +       
Sbjct  43   LAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFTMVGICLA------  96

Query  621  ILSQNQTQRLH----SKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEG  454
             +S      LH    S  T  +    LLSS    L NL    P   ++M +R K+E+E+ 
Sbjct  97   -VSAGSFGYLHPWSSSSVTDKYQLGFLLSSFAFNLTNLFVFTPMTXEMMKQRHKVEREQN  155

Query  453  RGK  445
             G+
Sbjct  156  IGE  158



>gb|AFK37222.1| unknown [Lotus japonicus]
Length=208

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYF  664
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF
Sbjct  38   LAHLLSFSTAFGSALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYF  83



>ref|XP_002302753.1| hypothetical protein POPTR_0002s19890g [Populus trichocarpa]
 ref|XP_011042228.1| PREDICTED: transmembrane protein 205 [Populus euphratica]
 gb|ABK94325.1| unknown [Populus trichocarpa]
 gb|EEE82026.1| hypothetical protein POPTR_0002s19890g [Populus trichocarpa]
Length=209

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF    +  +I  A  
Sbjct  39   LAHLLCFSTAFGSALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFLLVGVCCAISVAAF  98

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          + T + +    LLSS    L NL    P   ++M +R K+E+EE  G
Sbjct  99   GYLHPWKS-----ASTAEKYQLGFLLSSFAFNLTNLFVFTPMTIEMMKQRHKVEREENIG  153



>gb|AFK41050.1| unknown [Lotus japonicus]
Length=220

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYF  664
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF
Sbjct  38   LAHLLSFSTAFGSALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYF  83



>ref|XP_004229403.1| PREDICTED: transmembrane protein 205 [Solanum lycopersicum]
Length=213

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK----AMAYSIGT  637
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF       A S+G+
Sbjct  43   LAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCCAVSVGS  101



>ref|XP_006444466.1| hypothetical protein CICLE_v10022218mg [Citrus clementina]
 ref|XP_006492313.1| PREDICTED: transmembrane protein 205-like [Citrus sinensis]
 gb|ESR57706.1| hypothetical protein CICLE_v10022218mg [Citrus clementina]
 gb|KDO87038.1| hypothetical protein CISIN_1g028150mg [Citrus sinensis]
Length=213

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 7/120 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  + A+G ++WVTFI   ++ K LPR QF   QSK++P YF    +  SI  A  
Sbjct  43   LAHLLCFSTAWGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSLVGVCCSIAVASF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
             ++          S T + +    LLS+    L NL    P   ++M +R K+E+EE  G
Sbjct  103  AYLHPWKS-----SSTAEKYQLGFLLSAFAFNLTNLFVFTPMTIEMMKQRHKVEREENIG  157



>gb|KHF99197.1| Transmembrane protein [Gossypium arboreum]
Length=213

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 64/120 (53%), Gaps = 7/120 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  A A+G ++WVTFI   ++ K LPR QF   QSK++P YF    +  ++  A  
Sbjct  43   LAHLLCFATAWGTALWVTFIGGILMFKYLPRHQFGNLQSKMFPAYFSMVGVCCAVSAAAF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++          + TT+ +    L+S+    L+NL    P   ++M  R K+E+EE  G
Sbjct  103  GYMHPWKS-----ATTTEKYQLGFLVSAFAFNLINLFVFTPMTIEMMKHRHKVEREENIG  157



>ref|XP_010259357.1| PREDICTED: transmembrane protein 205 [Nelumbo nucifera]
Length=213

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 64/121 (53%), Gaps = 7/121 (6%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK--AMAYSIGTAFL  628
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF    +  +I  A  
Sbjct  43   LAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSLVGVCCAISVASF  102

Query  627  GHILSQNQTQRLHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
            G++       R  S   + +    L+SS    + NL    P   ++M +R K+E+EE  G
Sbjct  103  GYL----HPWR-SSSPAERYQFGFLISSFAFNIANLFVFTPMTIEMMKQRHKVEREENIG  157

Query  447  K  445
            +
Sbjct  158  E  158



>ref|XP_008501066.1| PREDICTED: transmembrane protein 205 [Calypte anna]
Length=187

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 37/59 (63%), Gaps = 3/59 (5%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLG  625
            + +L+ L+ ++GM +WVTF++ +V+   LPR  F + Q K++P YF  ++     AFL 
Sbjct  13   LLHLLFLSTSWGMQIWVTFVAGFVMGTHLPRHTFGLIQRKLFPYYFHILS---ACAFLN  68



>ref|XP_007378569.1| hypothetical protein PUNSTDRAFT_117368 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN13652.1| hypothetical protein PUNSTDRAFT_117368 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=191

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 4/109 (4%)
 Frame = -3

Query  768  GMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQRLH  589
            GMS+WVTF   ++  KALPR QF   Q + +PVYF +++ ++ T  L    + +     +
Sbjct  31   GMSLWVTFFGGFIALKALPRHQFGALQHRTFPVYF-SVSIALSTILLLMWTTTHPDVLSY  89

Query  588  SKTTQHf---lgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGR  451
                 H      + L   L+   +N L + P  ++ MF+R K+EK+EG+
Sbjct  90   IAKPTHVDVAQAYALAFVLVNQTINQLVVGPLTSRTMFQRHKLEKDEGK  138



>ref|XP_009339789.1| PREDICTED: transmembrane protein 205 [Pyrus x bretschneideri]
Length=213

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYF  664
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF
Sbjct  43   LAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYF  88



>ref|XP_008572017.1| PREDICTED: transmembrane protein 205 isoform X2 [Galeopterus 
variegatus]
Length=189

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = -3

Query  774  AFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFKAMAYSIGTAFLGHILSQNQTQR  595
            A+GM +WVTF+S ++L + L R  F   QSK++P+YF     S+  +F+   +   Q   
Sbjct  22   AWGMQMWVTFVSGFLLFRHLSRHTFGQVQSKLFPLYFHI---SMACSFINLCILVPQHTW  78

Query  594  LHSKTTQHflgfnllssllmvlvnllyLEPRATKVMFERMKIEKEEGRG  448
                         LL SL +  +N  +LEPR T  M+    +EKE G G
Sbjct  79   AQLTFWDGSQLCLLLLSLTLATINARWLEPRTTAAMWAMQTVEKERGLG  127



>ref|XP_009788476.1| PREDICTED: transmembrane protein 205 [Nicotiana sylvestris]
Length=213

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK----AMAYSIGT  637
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF       A S+G+
Sbjct  43   LAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCCAVSVGS  101



>ref|XP_009594998.1| PREDICTED: transmembrane protein 205 [Nicotiana tomentosiformis]
Length=213

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYFK----AMAYSIGT  637
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF       A S+G+
Sbjct  43   LAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCCAVSVGS  101



>ref|XP_002515303.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47287.1| conserved hypothetical protein [Ricinus communis]
Length=209

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  801  MANLIGLAVAFGMSVWVTFISSYVLAKALPRQQFAVAQSKIYPVYF  664
            +A+L+  + AFG ++WVTFI   ++ K LPR QF   QSK++P YF
Sbjct  39   LAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYF  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4673223584680