BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1423_g2_i1 len=384 path=[362:0-383]

Length=384
                                                                      Score     E

gb|AAU95241.1|  osmotin-like protein                                    112   1e-27   Solanum tuberosum [potatoes]
ref|NP_001234161.1|  PR-5x precursor                                    112   1e-27   
sp|P50701.1|OS13_SOLCO  RecName: Full=Osmotin-like protein OSML13...    112   2e-27   Solanum commersonii
ref|XP_006358887.1|  PREDICTED: osmotin-like protein OSML13-like        112   2e-27   
emb|CAA50059.1|  pathogenesis-related protein PR P23                    112   2e-27   Solanum lycopersicum
ref|XP_004245629.1|  PREDICTED: osmotin-like protein TPM-1              112   2e-27   
sp|Q01591.1|TPM1_SOLLC  RecName: Full=Osmotin-like protein TPM-1;...    111   3e-27   Solanum lycopersicum
gb|AAK55411.1|AF376058_1  osmotin                                       111   4e-27   Petunia x hybrida [garden petunia]
gb|AGH14263.1|  osmotin-like protein                                    111   5e-27   
gb|AAN40693.1|  osmotin-like protein precursor                          109   7e-27   Solanum aethiopicum [gilo]
sp|P50702.1|OS81_SOLCO  RecName: Full=Osmotin-like protein OSML81...    110   8e-27   Solanum commersonii
emb|CAA51430.1|  osmotin-like protein                                   110   8e-27   Solanum commersonii
gb|AAU93855.1|  osmotin-like protein A81                                110   8e-27   Solanum phureja [chaucha]
ref|XP_006358888.1|  PREDICTED: osmotin-like protein OSML81-like        110   8e-27   
gb|AAL87641.1|AF450277_1  osmotin-like protein                          109   8e-27   Solanum nigrum
pdb|2I0W|A  Chain A, Crystal Structure Analysis Of Np24-I, A Thau...    109   9e-27   
ref|XP_004245630.1|  PREDICTED: protein NP24                            110   1e-26   
gb|AAA34175.1|  NP24 protein precursor                                  109   1e-26   Solanum lycopersicum
gb|AAG16625.1|  cryoprotective osmotin-like protein                     109   2e-26   Solanum dulcamara [climbing nightshade]
ref|XP_006358885.1|  PREDICTED: osmotin-like protein OSML13-like        109   2e-26   
emb|CAA43854.1|  osmotin                                                108   3e-26   Nicotiana tabacum [American tobacco]
gb|AAU93853.1|  osmotin-like protein A13                                108   3e-26   Solanum phureja [chaucha]
pdb|1PCV|A  Chain A, Crystal Structure Of Osmotin, A Plant Antifu...    107   4e-26   
ref|XP_009782398.1|  PREDICTED: osmotin                                 108   4e-26   
emb|CAA64620.1|  PR protein                                             108   4e-26   Nicotiana tabacum [American tobacco]
gb|AAB23375.1|  osmotin                                                 108   4e-26   Nicotiana tabacum [American tobacco]
ref|XP_009610144.1|  PREDICTED: osmotin                                 108   5e-26   
sp|P14170.2|OSMO_TOBAC  RecName: Full=Osmotin; Flags: Precursor         108   5e-26   Nicotiana tabacum [American tobacco]
gb|ACB30367.1|  PR5-like protein                                        108   6e-26   Capsicum annuum
ref|XP_006358890.1|  PREDICTED: osmotin-like protein OSML81-like        107   8e-26   
gb|AAP86781.1|  osmotin-like protein                                    107   1e-25   Capsicum annuum
gb|AAU95242.1|  osmotin-like protein                                    107   1e-25   Solanum tuberosum [potatoes]
ref|XP_006358891.1|  PREDICTED: osmotin-like protein OSML15-like        107   1e-25   
gb|AAS48588.1|  putative osmotin-like protein precursor                 107   1e-25   Brassica juncea [brown mustard]
gb|AAK97184.1|  thaumatin-like protein                                  107   1e-25   Capsicum annuum
ref|NP_001234351.1|  PR5-like protein precursor                         107   2e-25   
gb|AAL87640.1|AF450276_1  osmotin-like protein precursor                107   2e-25   Solanum nigrum
gb|AEH41422.1|  pathogenesis-related protein 5                          106   2e-25   
gb|AAL79832.2|  osmotin-like protein                                    107   2e-25   Solanum nigrum
ref|XP_006358892.1|  PREDICTED: osmotin-like protein OSML15-like        105   5e-25   
gb|AAU95240.1|  osmotin-like protein                                    105   5e-25   Solanum tuberosum [potatoes]
gb|AAA34089.1|  osmotin                                                 105   6e-25   Nicotiana tabacum [American tobacco]
ref|XP_009589206.1|  PREDICTED: osmotin-like protein                    105   6e-25   
ref|XP_009782395.1|  PREDICTED: osmotin-like protein                    105   7e-25   
ref|XP_009589205.1|  PREDICTED: osmotin-like protein                    105   8e-25   
dbj|BAD15089.1|  pathogenesis-related protein                           105   8e-25   Nicotiana tabacum [American tobacco]
emb|CAH69228.1|  putative osmotin-like protein                          105   8e-25   Nicotiana glauca [glaucous tobacco]
ref|XP_009782397.1|  PREDICTED: osmotin-like protein                    105   8e-25   
pdb|1AUN|A  Chain A, Pathogenesis-Related Protein 5d From Nicotia...    104   1e-24   
ref|XP_004245628.2|  PREDICTED: osmotin-like protein OSML15             104   2e-24   
ref|XP_010325678.1|  PREDICTED: osmotin-like protein OSML13             103   3e-24   
prf||1808326A  osmotin-like protein                                     103   3e-24
gb|AFV46355.1|  pathogenesis-related protein 5                          102   6e-24   
gb|EYU38380.1|  hypothetical protein MIMGU_mgv1a013157mg                102   6e-24   
gb|KCW77574.1|  hypothetical protein EUGRSUZ_D01888                     100   4e-23   
gb|AFV46356.1|  pathogenesis-related protein 5                        99.8    8e-23   
gb|AEH41423.1|  pathogeneis-related protein 5                         99.0    1e-22   
gb|AFV46361.1|  pathogenesis-related protein 5                        98.2    3e-22   
gb|AFV46358.1|  pathogenesis-related protein 5                        97.8    4e-22   
ref|XP_011072290.1|  PREDICTED: thaumatin-like protein                96.3    1e-21   
ref|XP_010314485.1|  PREDICTED: pathogenesis-related protein R ma...  95.9    2e-21   
ref|XP_006364119.1|  PREDICTED: pathogenesis-related protein R ma...  94.7    6e-21   
sp|E3SU11.1|ALL13_OLEEU  RecName: Full=Thaumatin-like protein; Al...  94.4    8e-21   
gb|AFV46360.1|  pathogenesis-related protein 5                        94.0    9e-21   
gb|AFV46357.1|  pathogenesis-related protein 5                        94.0    1e-20   
gb|AGC39177.1|  thaumatin-like protein                                94.4    1e-20   
gb|AGS80337.1|  thaumatin protein                                     94.0    1e-20   
gb|ACL80664.1|  pathogenesis-related protein 5                        94.0    1e-20   Zingiber zerumbet [bitter ginger]
ref|XP_009627978.1|  PREDICTED: pathogenesis-related protein R ma...  94.0    1e-20   
gb|AGC39178.1|  thaumatin-like protein                                94.0    1e-20   
ref|XP_010053305.1|  PREDICTED: protein NP24-like                     95.5    1e-20   
ref|XP_009615320.1|  PREDICTED: thaumatin-like protein                93.6    1e-20   
ref|XP_008345347.1|  PREDICTED: protein P21-like                      93.6    2e-20   
emb|CDP16242.1|  unnamed protein product                              93.2    2e-20   
ref|XP_002282917.2|  PREDICTED: protein P21                           93.6    2e-20   Vitis vinifera
gb|ADD51187.1|  thaumatin-like protein                                93.2    2e-20   Vitis cinerea var. helleri x Vitis riparia
gb|AFV46362.1|  pathogenesis-related protein 5                        92.8    3e-20   
gb|AGC39179.1|  thaumatin-like protein                                92.8    4e-20   
gb|ACH54108.1|  osmotin isoform precursor                             91.7    4e-20   Piper colubrinum
ref|XP_009781670.1|  PREDICTED: pathogenesis-related protein R mi...  92.4    4e-20   
gb|AAD55090.1|  thaumatin                                             92.4    4e-20   Vitis riparia [frost grape]
emb|CAN71616.1|  hypothetical protein VITISV_023861                   92.4    5e-20   Vitis vinifera
gb|ABE01396.1|  Thaumatin-like protein                                91.7    7e-20   Camellia sinensis [black tea]
ref|XP_009345452.1|  PREDICTED: protein P21-like                      91.7    7e-20   
ref|XP_010540702.1|  PREDICTED: osmotin-like protein OSM34            91.7    9e-20   
gb|ABX71220.1|  osmotin                                               91.3    1e-19   Piper colubrinum
gb|AAM21199.1|AF364864_1  pathogenesis-related protein 5-1            90.9    1e-19   Helianthus annuus
gb|AGC39176.1|  thaumatin-like protein                                90.9    1e-19   
ref|XP_004298782.1|  PREDICTED: osmotin-like protein OSM34-like       91.3    1e-19   
emb|CAB86199.1|  pathogenesis-related protein (PR-5 protein)          90.9    2e-19   Solanum lycopersicum
ref|XP_010530407.1|  PREDICTED: osmotin-like protein OSM34            90.1    2e-19   
ref|XP_007040160.1|  Osmotin 34                                       90.5    2e-19   
ref|XP_004143988.1|  PREDICTED: thaumatin-like protein-like           90.5    2e-19   
ref|XP_003525412.1|  PREDICTED: protein P21-like                      90.5    2e-19   
gb|AGC39182.1|  thaumatin-like protein                                90.5    2e-19   
ref|XP_008437225.1|  PREDICTED: protein P21-like                      90.5    2e-19   
ref|XP_009772655.1|  PREDICTED: thaumatin-like protein                89.7    3e-19   
gb|ADP69173.1|  pathogenesis related protein-5                        90.1    3e-19   
gb|AFV46359.1|  pathogenesis-related protein 5                        89.7    4e-19   
ref|XP_002509749.1|  Osmotin precursor, putative                      89.7    4e-19   Ricinus communis
ref|XP_004245632.1|  PREDICTED: thaumatin-like protein                89.7    4e-19   
ref|XP_009345456.1|  PREDICTED: thaumatin-like protein                89.7    4e-19   
gb|AAU95246.1|  putative thaumatin-like protein                       90.1    4e-19   Solanum tuberosum [potatoes]
gb|AAK59276.1|AF378572_1  thaumatin-like protein                      89.4    4e-19   Sambucus nigra
gb|AAK59278.1|AF378574_1  thaumatin-like protein                      89.7    4e-19   Sambucus nigra
ref|XP_002283042.1|  PREDICTED: protein P21                           89.7    4e-19   Vitis vinifera
ref|XP_007210589.1|  hypothetical protein PRUPE_ppa016268mg           89.4    4e-19   
ref|XP_010661214.1|  PREDICTED: protein P21                           89.4    5e-19   
sp|G5DC91.2|TLP1_MANZA  RecName: Full=Thaumatin-like protein 1; A...  89.0    5e-19   
gb|AEP84104.1|  acidic thaumatin-like protein                         89.0    5e-19   
ref|XP_004143926.1|  PREDICTED: thaumatin-like protein-like           89.4    5e-19   
ref|XP_008437224.1|  PREDICTED: protein P21-like                      89.4    5e-19   
pdb|4L5H|A  Chain A, Structure Of Haze Forming Proteins In White ...  89.0    5e-19   
ref|XP_002283030.1|  PREDICTED: protein P21                           89.0    6e-19   Vitis vinifera
gb|AAB61590.1|  VVTL1                                                 89.0    7e-19   Vitis vinifera
gb|AAF82264.1|  thaumatin-like protein                                89.0    7e-19   Vitis vinifera
ref|XP_007210079.1|  hypothetical protein PRUPE_ppa019608mg           86.7    8e-19   
emb|CAC22329.1|  osmotin-like protein                                 86.7    9e-19   Fagus sylvatica
gb|AGC39180.1|  thaumatin-like protein                                88.6    9e-19   
sp|P07052.1|PRR2_TOBAC  RecName: Full=Pathogenesis-related protei...  88.6    1e-18   Nicotiana tabacum [American tobacco]
ref|XP_007040162.1|  Osmotin 34                                       88.6    1e-18   
ref|XP_002509748.1|  Osmotin precursor, putative                      88.6    1e-18   Ricinus communis
gb|KCW77573.1|  hypothetical protein EUGRSUZ_D01887                   88.6    1e-18   
ref|XP_008238906.1|  PREDICTED: protein P21-like                      88.2    1e-18   
gb|AAN40692.1|  thaumatin-like protein                                87.4    1e-18   Solanum aethiopicum [gilo]
emb|CAN65933.1|  hypothetical protein VITISV_023047                   88.2    1e-18   Vitis vinifera
gb|AAV34889.2|  osmotin-like                                          87.8    1e-18   Theobroma cacao [chocolate]
ref|XP_004298786.1|  PREDICTED: thaumatin-like protein-like           88.2    1e-18   
ref|XP_010676512.1|  PREDICTED: protein P21-like                      88.2    1e-18   
emb|CAB36911.1|  osmotin-like protein                                 85.9    2e-18   Quercus suber [cork oak]
ref|XP_010906440.1|  PREDICTED: thaumatin-like protein                87.4    2e-18   
ref|XP_011018223.1|  PREDICTED: protein P21-like                      88.2    2e-18   
gb|KHN23669.1|  Protein P21                                           85.1    2e-18   
sp|P25096.1|P21_SOYBN  RecName: Full=Protein P21                      87.4    2e-18   Glycine max [soybeans]
gb|KGN50135.1|  hypothetical protein Csa_5G155460                     87.8    2e-18   
gb|AAQ10092.1|  thaumatin-like protein                                87.8    2e-18   Vitis vinifera
gb|KCW61089.1|  hypothetical protein EUGRSUZ_H03863                   87.4    2e-18   
gb|AGC39181.1|  thaumatin-like protein                                87.4    2e-18   
ref|XP_008238908.1|  PREDICTED: protein P21-like                      87.4    3e-18   
emb|CAN76134.1|  hypothetical protein VITISV_001194                   87.4    3e-18   Vitis vinifera
ref|XP_002276431.1|  PREDICTED: protein P21                           87.4    3e-18   Vitis vinifera
ref|XP_010024640.1|  PREDICTED: thaumatin-like protein                87.4    3e-18   
ref|XP_010024638.1|  PREDICTED: thaumatin-like protein                87.4    3e-18   
ref|XP_007209565.1|  hypothetical protein PRUPE_ppa011053mg           87.4    3e-18   
ref|NP_001268131.1|  thaumatin-like protein precursor                 87.4    3e-18   
dbj|BAO09560.1|  osmotin                                              87.0    3e-18   
gb|AAG34078.1|AF294846_1  PR5-like protein                            86.3    3e-18   Capsicum annuum
ref|XP_009397351.1|  PREDICTED: protein P21-like                      87.0    4e-18   
gb|KEH27441.1|  pathogenesis-related thaumatin family protein         87.0    4e-18   
ref|XP_010275299.1|  PREDICTED: protein P21-like                      87.4    4e-18   
gb|KDO63525.1|  hypothetical protein CISIN_1g043196mg                 87.0    4e-18   
ref|XP_004503751.1|  PREDICTED: protein P21-like isoform X1           86.7    4e-18   
ref|XP_010520774.1|  PREDICTED: osmotin-like protein OSM34            87.0    4e-18   
gb|KCW77577.1|  hypothetical protein EUGRSUZ_D01892                   86.7    4e-18   
ref|XP_002283064.1|  PREDICTED: protein P21-like                      86.7    4e-18   Vitis vinifera
ref|XP_010053313.1|  PREDICTED: thaumatin-like protein                86.7    5e-18   
ref|XP_009804118.1|  PREDICTED: thaumatin-like protein                86.7    5e-18   
gb|EYU38379.1|  hypothetical protein MIMGU_mgv1a013131mg              86.7    5e-18   
gb|AIR93920.1|  thaumatin                                             86.7    5e-18   
ref|XP_003525411.1|  PREDICTED: PR-5 protein                          86.3    6e-18   
gb|AAK59275.1|AF378571_1  thaumatin-like protein                      86.7    6e-18   Sambucus nigra
dbj|BAF95882.1|  putative thaumatin-like protein                      86.3    6e-18   Vitis hybrid cultivar
gb|KDP46638.1|  hypothetical protein JCGZ_04572                       86.3    6e-18   
ref|NP_001268061.1|  VVTL1 precursor                                  86.3    7e-18   
emb|CAN74833.1|  hypothetical protein VITISV_004208                   86.3    7e-18   Vitis vinifera
ref|NP_001235877.1|  PR-5b protein precursor                          86.3    7e-18   
ref|XP_008238907.1|  PREDICTED: protein P21-like                      86.3    7e-18   
ref|XP_004304709.1|  PREDICTED: thaumatin-like protein-like           86.3    8e-18   
gb|KCW77579.1|  hypothetical protein EUGRSUZ_D01894                   86.3    8e-18   
emb|CAB85636.1|  putative thaumatin-like protein                      85.5    9e-18   Vitis vinifera
ref|XP_010676518.1|  PREDICTED: protein P21-like                      85.9    9e-18   
ref|XP_010676513.1|  PREDICTED: protein P21-like                      86.3    9e-18   
ref|XP_009406738.1|  PREDICTED: protein P21-like                      85.9    1e-17   
ref|XP_007040164.1|  Osmotin 34                                       85.9    1e-17   
sp|P81370.2|TLP_ACTDE  RecName: Full=Thaumatin-like protein; AltN...  85.9    1e-17   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003611130.1|  Pathogenesis-related thaumatin-like protein      87.8    1e-17   
gb|KCW77588.1|  hypothetical protein EUGRSUZ_D01904                   85.9    1e-17   
ref|XP_010906392.1|  PREDICTED: thaumatin-like protein                84.7    1e-17   
gb|ADO32898.1|  thaumatin-like protein                                85.5    1e-17   
pdb|4JRU|A  Chain A, Structure Of Haze Forming Proteins In White ...  85.1    1e-17   
ref|XP_002869791.1|  hypothetical protein ARALYDRAFT_914296           85.5    1e-17   
emb|CAA09228.1|  thaumatin-like protein PR-5b                         85.5    1e-17   Cicer arietinum [garbanzo]
pdb|4BCT|A  Chain A, Crystal Structure Of Kiwi-fruit Allergen Act...  85.1    2e-17   
gb|KDP25478.1|  hypothetical protein JCGZ_20634                       85.1    2e-17   
gb|AEB77709.1|  thaumatin-like protein                                85.1    2e-17   
emb|CDP16244.1|  unnamed protein product                              88.2    2e-17   
gb|ABD64681.1|  thaumatin-like protein                                85.1    2e-17   Vitis vinifera
ref|XP_007099628.1|  Pathogenesis-related thaumatin-like protein,...  85.1    2e-17   
ref|XP_002299547.2|  P21 family protein                               85.1    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_007158474.1|  hypothetical protein PHAVU_002G155500g           85.1    2e-17   
ref|XP_004298781.1|  PREDICTED: thaumatin-like protein-like           84.7    2e-17   
ref|XP_007040165.1|  Osmotin 34                                       85.1    2e-17   
ref|XP_006368746.1|  P21 family protein                               84.7    2e-17   
ref|XP_011029220.1|  PREDICTED: thaumatin-like protein                84.7    2e-17   
ref|XP_006453440.1|  hypothetical protein CICLE_v10010751mg           84.7    2e-17   
ref|XP_010055609.1|  PREDICTED: protein P21-like                      84.7    2e-17   
ref|XP_004511592.1|  PREDICTED: thaumatin-like protein-like           86.7    3e-17   
ref|XP_008369460.1|  PREDICTED: protein P21                           84.7    3e-17   
emb|CDP09786.1|  unnamed protein product                              84.7    3e-17   
pdb|4L2J|A  Chain A, Crystal Structure Of Osmotin, An Antifungal ...  84.3    3e-17   
ref|XP_009406737.1|  PREDICTED: protein P21-like                      84.7    3e-17   
gb|AHA83528.1|  osmotin-like protein                                  84.7    3e-17   
gb|AFK40174.1|  unknown                                               84.7    3e-17   
emb|CDP09784.1|  unnamed protein product                              84.3    3e-17   
ref|XP_006396874.1|  hypothetical protein EUTSA_v10028948mg           84.3    3e-17   
ref|XP_006440574.1|  hypothetical protein CICLE_v10022104mg           84.3    3e-17   
ref|XP_006477593.1|  PREDICTED: uncharacterized protein LOC102624118  87.0    3e-17   
ref|XP_006477434.1|  PREDICTED: osmotin                               84.3    3e-17   
gb|ABK96488.1|  unknown                                               82.4    3e-17   Populus trichocarpa x Populus deltoides
ref|XP_006440577.1|  hypothetical protein CICLE_v10023839mg           84.3    4e-17   
gb|AFK29763.1|  thaumatin-like protein                                84.3    4e-17   
ref|XP_010055611.1|  PREDICTED: protein P21-like                      84.3    4e-17   
gb|KCW77586.1|  hypothetical protein EUGRSUZ_D01900                   84.3    4e-17   
emb|CAC22342.1|  osmotin-like protein                                 82.0    5e-17   Quercus robur [English oak]
ref|XP_010906165.1|  PREDICTED: thaumatin-like protein                84.3    5e-17   
gb|ABB86297.1|  thaumatin-like protein isoform 1                      84.0    5e-17   Ficus pumila var. awkeotsang [jelly fig]
gb|ABQ42566.1|  thaumatin-like protein                                83.6    5e-17   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002509750.1|  Osmotin precursor, putative                      84.0    5e-17   Ricinus communis
ref|XP_010529553.1|  PREDICTED: pathogenesis-related protein R ma...  84.0    6e-17   
ref|XP_009419440.1|  PREDICTED: protein P21-like                      84.0    6e-17   
gb|AAQ22606.1|  At4g11650                                             84.0    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409806.1|  PREDICTED: protein P21-like                      83.6    6e-17   
ref|XP_011029221.1|  PREDICTED: osmotin-like protein OSM34            84.0    6e-17   
ref|XP_011029305.1|  PREDICTED: osmotin-like protein OSM34            83.6    7e-17   
emb|CAE54084.1|  taumatin                                             82.0    8e-17   Fagus sylvatica
ref|XP_009782417.1|  PREDICTED: protein P21-like                      83.2    8e-17   
ref|XP_010042867.1|  PREDICTED: thaumatin-like protein                83.2    8e-17   
ref|XP_007158473.1|  hypothetical protein PHAVU_002G155400g           83.2    8e-17   
gb|AAM61750.1|  osmotin precursor                                     83.6    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010255471.1|  PREDICTED: protein P21                           83.2    8e-17   
emb|CAA71883.1|  osmotin-like protein                                 83.2    8e-17   Vitis vinifera
ref|XP_011016810.1|  PREDICTED: osmotin-like protein OSM34            83.6    8e-17   
gb|AAQ74156.1|  osmotin-like protein I                                83.2    9e-17   Gossypium hirsutum [American cotton]
gb|ACZ67185.1|  pathogenesis-related thaumatin                        83.2    9e-17   Populus deltoides
emb|CAC22330.1|  osmotin-like protein                                 81.3    9e-17   Fagus sylvatica
gb|AAQ14497.1|AF304007_1  osmotin-like protein                        83.2    1e-16   Gossypium hirsutum [American cotton]
ref|XP_010053306.1|  PREDICTED: thaumatin-like protein                85.1    1e-16   
gb|AAQ13823.1|AF192271_1  osmotin-like pathogenesis-related protein   83.2    1e-16   Gossypium hirsutum [American cotton]
ref|XP_002299521.2|  hypothetical protein POPTR_0001s09570g           83.2    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002276390.1|  PREDICTED: protein P21-like                      82.8    1e-16   Vitis vinifera
gb|AAQ74155.1|  osmotin-like protein II                               82.8    1e-16   Gossypium hirsutum [American cotton]
gb|AAF13707.1|AF199508_1  osmotin-like protein                        82.8    1e-16   Fragaria x ananassa
ref|XP_010273138.1|  PREDICTED: protein P21-like                      82.8    1e-16   
ref|XP_010054781.1|  PREDICTED: thaumatin-like protein                82.8    1e-16   
ref|XP_009609047.1|  PREDICTED: protein P21-like                      82.8    1e-16   
gb|KFK28873.1|  hypothetical protein AALP_AA7G059400                  82.8    1e-16   
gb|KDO38996.1|  hypothetical protein CISIN_1g027281mg                 82.4    1e-16   
ref|XP_006477433.1|  PREDICTED: thaumatin-like protein-like           82.4    1e-16   
gb|AAQ64678.1|  osmotin-like pathognesis-related protein 5            82.4    2e-16   Gossypium hirsutum [American cotton]
gb|KDP25477.1|  hypothetical protein JCGZ_20633                       82.4    2e-16   
gb|ACV83333.1|  pathogenesis-related protein 5                        82.4    2e-16   Panax ginseng [Chinese ginseng]
gb|AAO13658.1|  osmotin-like protein linusitin                        82.4    2e-16   Linum usitatissimum
ref|XP_002282988.1|  PREDICTED: protein P21                           82.0    2e-16   Vitis vinifera
ref|XP_010434611.1|  PREDICTED: osmotin-like protein OSM34            82.4    2e-16   
ref|XP_006440575.1|  hypothetical protein CICLE_v10022100mg           82.0    2e-16   
gb|KDP25476.1|  hypothetical protein JCGZ_20632                       82.0    2e-16   
ref|XP_006288543.1|  hypothetical protein CARUB_v10001823mg           82.0    2e-16   
ref|NP_192902.1|  osmotin-like protein OSM34                          82.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422118.1|  PREDICTED: osmotin-like protein OSM34            82.0    3e-16   
ref|XP_010054783.1|  PREDICTED: thaumatin-like protein                82.4    3e-16   
ref|XP_002874708.1|  ATOSM34                                          81.6    3e-16   
pdb|1Z3Q|A  Chain A, Resolution Of The Structure Of The Allergeni...  81.3    3e-16   
ref|XP_006396871.1|  hypothetical protein EUTSA_v10028920mg           81.6    4e-16   
gb|ACU19846.1|  unknown                                               81.3    4e-16   Glycine max [soybeans]
ref|NP_001236405.1|  osmotin-like protein, acidic precursor           81.3    4e-16   
ref|XP_009136680.1|  PREDICTED: thaumatin-like protein 1              81.3    4e-16   
gb|KHN35005.1|  Osmotin-like protein OSM34                            81.3    4e-16   
ref|XP_006396873.1|  hypothetical protein EUTSA_v10029289mg           80.5    4e-16   
dbj|BAF98916.1|  thaumatin like protein                               81.3    4e-16   Nepenthes alata
emb|CDY53136.1|  BnaC01g41460D                                        81.3    4e-16   
ref|XP_010455575.1|  PREDICTED: osmotin-like protein OSM34            81.3    5e-16   
gb|KHN25720.1|  Osmotin-like protein OSM34                            80.5    5e-16   
dbj|BAF98917.1|  thaumatin like protein                               81.3    5e-16   Nepenthes alata
ref|XP_010417229.1|  PREDICTED: pathogenesis-related protein R ma...  81.3    5e-16   
ref|XP_006364120.1|  PREDICTED: thaumatin-like protein-like           80.9    5e-16   
ref|XP_002874707.1|  ATOSM34                                          80.9    6e-16   
ref|XP_009128666.1|  PREDICTED: osmotin-like protein OSM34            81.3    6e-16   
ref|XP_010455576.1|  PREDICTED: osmotin-like protein OSM34            80.9    6e-16   
gb|AGX15390.1|  osmotin like-protein 1                                80.9    6e-16   
ref|XP_010053314.1|  PREDICTED: thaumatin-like protein                82.8    6e-16   
ref|XP_008238818.1|  PREDICTED: protein P21                           80.9    7e-16   
emb|CAA61411.1|  osmotin                                              80.5    9e-16   
dbj|BAF98918.1|  thaumatin like protein                               80.1    1e-15   
gb|EMT15457.1|  hypothetical protein F775_29722                       80.1    1e-15   
gb|AAT07462.1|  thaumatin-like protein                                77.8    1e-15   
ref|XP_004982238.1|  PREDICTED: zeamatin-like                         80.1    1e-15   
gb|EYU29729.1|  hypothetical protein MIMGU_mgv1a017668mg              79.3    1e-15   
gb|AAK59277.1|AF378573_1  thaumatin-like protein                      79.7    1e-15   
gb|AAP14946.1|  osmotin 81                                            79.0    2e-15   
gb|KEH21027.1|  pathogenesis-related thaumatin family protein         79.7    2e-15   
gb|AAG34079.1|AF294847_1  PR5-like protein                            79.0    2e-15   
gb|ACU31848.1|  thaumatin-like protein                                79.3    2e-15   
gb|AAK55326.1|AF355458_1  thaumatin-like protein TLP8                 79.3    2e-15   
gb|ABB86298.1|  thaumatin-like protein isoform 2                      79.3    2e-15   
gb|KFK31917.1|  hypothetical protein AALP_AA6G175700                  79.3    2e-15   
gb|ACU31845.1|  thaumatin-like protein                                79.3    2e-15   
emb|CBI34739.3|  unnamed protein product                              77.0    2e-15   
gb|AAU95243.1|  osmotin-like protein                                  79.0    3e-15   
gb|KCW72117.1|  hypothetical protein EUGRSUZ_E00557                   78.6    3e-15   
ref|XP_011081000.1|  PREDICTED: protein P21-like                      79.0    3e-15   
ref|XP_011072271.1|  PREDICTED: protein P21-like                      78.6    3e-15   
gb|ACU31847.1|  thaumatin-like protein                                78.6    3e-15   
prf||1906370A  protein P21                                            78.6    3e-15
emb|CDY41250.1|  BnaA01g12890D                                        78.6    4e-15   
ref|XP_010314488.1|  PREDICTED: thaumatin-like protein                78.6    4e-15   
ref|XP_006368018.1|  PREDICTED: osmotin-like protein OSML13-like      78.6    4e-15   
gb|ABC73397.1|  thaumatin-like protein                                78.6    4e-15   
ref|XP_008437223.1|  PREDICTED: protein P21-like                      78.6    4e-15   
ref|XP_004298780.1|  PREDICTED: thaumatin-like protein-like           78.6    4e-15   
gb|ACU31846.1|  thaumatin-like protein                                78.6    5e-15   
ref|XP_007160027.1|  hypothetical protein PHAVU_002G286500g           78.2    5e-15   
ref|XP_006294935.1|  hypothetical protein CARUB_v10023990mg           78.2    5e-15   
ref|XP_006364121.1|  PREDICTED: thaumatin-like protein-like isofo...  78.6    5e-15   
gb|EPS62955.1|  hypothetical protein M569_11833                       78.2    5e-15   
ref|XP_007160028.1|  hypothetical protein PHAVU_002G286600g           78.2    5e-15   
dbj|BAJ93054.1|  predicted protein                                    78.2    6e-15   
ref|XP_006853304.1|  hypothetical protein AMTR_s00032p00039030        78.2    6e-15   
ref|XP_010314486.1|  PREDICTED: thaumatin-like protein                77.8    7e-15   
gb|ABC55724.1|  osmotin-like protein                                  77.8    8e-15   
ref|XP_006650379.1|  PREDICTED: zeamatin-like                         77.8    8e-15   
ref|XP_010906112.1|  PREDICTED: thaumatin-like protein 1              77.4    1e-14   
ref|XP_003559612.2|  PREDICTED: alpha-amylase/trypsin inhibitor-like  77.4    1e-14   
gb|ABW76500.1|  pathogenesis-related thaumatin-like protein           76.6    1e-14   
ref|XP_010429452.1|  PREDICTED: protein P21-like                      77.0    1e-14   
ref|XP_002466712.1|  hypothetical protein SORBIDRAFT_01g012710        77.0    2e-14   
ref|XP_007210996.1|  hypothetical protein PRUPE_ppa021092mg           77.0    2e-14   
dbj|BAJ96714.1|  predicted protein                                    77.0    2e-14   
gb|ACU31849.1|  thaumatin-like protein                                76.6    2e-14   
gb|ABW76502.1|  pathogenesis-related thaumatin-like protein           75.9    2e-14   
ref|XP_009626639.1|  PREDICTED: thaumatin-like protein                76.3    2e-14   
gb|ACU31843.1|  thaumatin-like protein                                76.3    3e-14   
gb|EYU38378.1|  hypothetical protein MIMGU_mgv1a023080mg              74.3    3e-14   
tpg|DAA50586.1|  TPA: putative thaumatin domain family protein        76.3    3e-14   
ref|XP_003561528.1|  PREDICTED: alpha-amylase/trypsin inhibitor-like  76.3    3e-14   
ref|XP_011072299.1|  PREDICTED: thaumatin-like protein                75.9    3e-14   
gb|AAB53367.1|  pathogenesis-related thaumatin-like protein           75.5    4e-14   
gb|AAS07338.1|  putative antifungal zeamatin-like protein             75.9    4e-14   
ref|XP_002282993.1|  PREDICTED: protein P21                           75.5    4e-14   
ref|NP_001050833.1|  Os03g0663500                                     75.5    5e-14   
ref|XP_006358920.1|  PREDICTED: LOW QUALITY PROTEIN: protein P21-...  75.5    5e-14   
gb|EMT01972.1|  hypothetical protein F775_27927                       73.9    2e-13   
gb|EMS66835.1|  hypothetical protein TRIUR3_05094                     72.4    2e-13   
ref|XP_008455730.1|  PREDICTED: protein P21-like                      73.9    2e-13   
emb|CDP16245.1|  unnamed protein product                              73.6    3e-13   
emb|CAN68052.1|  hypothetical protein VITISV_010558                   73.2    3e-13   
gb|EMT04601.1|  hypothetical protein F775_15619                       72.4    3e-13   
ref|XP_010906123.1|  PREDICTED: thaumatin-like protein 1              73.2    3e-13   
dbj|BAH01716.1|  PR-5 protein                                         71.6    3e-13   
gb|AAB53368.1|  pathogenesis-related thaumatin-like protein           73.2    3e-13   
ref|NP_001147526.1|  protein P21 precursor                            73.2    3e-13   
ref|XP_002874705.1|  hypothetical protein ARALYDRAFT_911511           72.4    4e-13   
ref|NP_001050827.1|  Os03g0661600                                     72.8    4e-13   
sp|P02884.1|THM2_THADA  RecName: Full=Thaumatin-2; AltName: Full=...  72.8    4e-13   
dbj|BAF44567.1|  preprothaumatin I                                    72.8    5e-13   
gb|ABC39609.1|  osmotin                                               72.4    5e-13   
gb|ABC39615.1|  osmotin                                               72.4    5e-13   
ref|XP_006651660.1|  PREDICTED: protein P21-like                      72.0    5e-13   
gb|AAA72675.1|  thaumatin                                             72.4    5e-13   
emb|CDP09785.1|  unnamed protein product                              72.4    5e-13   
gb|ABC39616.1|  osmotin                                               72.0    6e-13   
pdb|1RQW|A  Chain A, Thaumatin Structure At 1.05 A Resolution         72.4    6e-13   
ref|XP_004958120.1|  PREDICTED: zeamatin-like                         72.4    6e-13   
pdb|3AOK|A  Chain A, Crystal Structure Of Sweet-Tasting Protein T...  72.0    6e-13   
sp|P02883.1|THM1_THADA  RecName: Full=Thaumatin-1; AltName: Full=...  72.0    6e-13   
ref|XP_007210072.1|  hypothetical protein PRUPE_ppa019495mg           72.4    6e-13   
pdb|1THV|A  Chain A, The Structures Of Three Crystal Forms Of The...  72.0    6e-13   
gb|ABW76499.1|  pathogenesis-related thaumatin-like protein           72.0    6e-13   
pdb|2BLR|A  Chain A, Thaumatin Before A High Dose X-Ray "burn"        72.0    6e-13   
dbj|BAK00815.1|  predicted protein                                    75.1    6e-13   
gb|ABW76501.1|  pathogenesis-related thaumatin-like protein           72.0    7e-13   
gb|ABW76503.1|  pathogenesis-related thaumatin-like protein           72.0    7e-13   
emb|CDM81285.1|  unnamed protein product                              75.1    7e-13   
ref|NP_001105356.1|  zeamatin precursor                               72.0    7e-13   
gb|ACJ62972.1|  zeamatin-like protein                                 72.0    7e-13   
gb|ABA33960.1|  zeamatin-like protein                                 72.0    7e-13   
gb|ACJ63017.1|  zeamatin-like protein                                 72.0    7e-13   
gb|ABA33957.1|  zeamatin-like protein                                 72.0    7e-13   
gb|EMT14789.1|  Zeamatin                                              74.7    8e-13   
gb|ACJ63015.1|  zeamatin-like protein                                 72.0    8e-13   
gb|ACG37805.1|  protein P21                                           72.0    8e-13   
gb|ACJ63016.1|  zeamatin-like protein                                 72.0    8e-13   
gb|ACJ62949.1|  zeamatin-like protein                                 72.0    8e-13   
gb|ABM91758.1|  acidic thaumatin-like protein 8 precursor             72.0    8e-13   
gb|ABA33969.1|  zeamatin-like protein                                 72.0    8e-13   
gb|EMS67566.1|  Zeamatin                                              74.3    1e-12   
gb|ABA33972.1|  zeamatin-like protein                                 71.6    1e-12   
ref|XP_002467352.1|  hypothetical protein SORBIDRAFT_01g026270        72.4    1e-12   
pdb|1DU5|A  Chain A, The Crystal Structure Of Zeamatin                71.2    1e-12   
sp|P13867.1|IAAT_MAIZE  RecName: Full=Alpha-amylase/trypsin inhib...  71.2    1e-12   
gb|KCW77585.1|  hypothetical protein EUGRSUZ_D01899                   71.2    1e-12   
gb|EMS66834.1|  hypothetical protein TRIUR3_05091                     72.0    1e-12   
ref|XP_006364122.1|  PREDICTED: thaumatin-like protein-like isofo...  70.9    2e-12   
pdb|2D8P|A  Chain A, Structure Of Hyper-Vil-Thaumatin                 70.9    2e-12   
pdb|2D8O|A  Chain A, Structure Of Vil-Thaumatin                       70.5    2e-12   
gb|ABM91761.1|  acidic thaumatin-like protein 11 precursor            70.9    2e-12   
ref|XP_010529556.1|  PREDICTED: thaumatin-like protein 1              70.5    2e-12   
tpg|DAA46712.1|  TPA: putative thaumatin domain family protein        72.4    3e-12   
gb|ABM91759.1|  acidic thaumatin-like protein 9 precursor             70.5    3e-12   
gb|ACJ62952.1|  zeamatin-like protein                                 70.5    3e-12   
ref|XP_008793571.1|  PREDICTED: thaumatin-like protein 1              70.5    3e-12   
gb|ABM91757.1|  acidic thaumatin-like protein 7 precursor             70.5    3e-12   
gb|ABM91756.1|  acidic thaumatin-like protein 6 precursor             70.5    3e-12   
gb|ABM91749.1|  acidic thaumatin-like protein 2 precursor             70.5    3e-12   
gb|ABM91763.1|  acidic thaumatin-like protein 13 precursor            70.5    3e-12   
gb|ABM91751.1|  acidic thaumatin-like protein 4 precursor             70.5    3e-12   
gb|ABC39612.1|  osmotin                                               70.1    3e-12   
gb|ABM91747.1|  acidic thaumatin-like protein precursor               70.5    3e-12   
gb|ACJ62936.1|  zeamatin-like protein                                 70.1    4e-12   
ref|XP_004983393.1|  PREDICTED: thaumatin-like protein 1a-like        71.2    4e-12   
gb|ACJ62944.1|  zeamatin-like protein                                 70.1    4e-12   
gb|ABM91752.1|  acidic thaumatin-like protein 5 precursor             70.1    4e-12   
gb|AFK46418.1|  unknown                                               70.1    4e-12   
ref|XP_006853305.1|  hypothetical protein AMTR_s00032p00040640        69.7    4e-12   
gb|ACJ63019.1|  zeamatin-like protein                                 70.1    4e-12   
ref|XP_007210624.1|  hypothetical protein PRUPE_ppa019480mg           69.3    4e-12   
ref|XP_002463077.1|  hypothetical protein SORBIDRAFT_02g037350        70.1    4e-12   
ref|XP_004144327.1|  PREDICTED: thaumatin-like protein-like           70.1    4e-12   
gb|ABM91755.1|  acidic thaumatin-like protein 3 precursor             69.7    4e-12   
ref|XP_010910080.1|  PREDICTED: protein P21-like                      69.7    5e-12   
gb|ABM91760.1|  acidic thaumatin-like protein 10 precursor            69.7    5e-12   
gb|EMT10173.1|  hypothetical protein F775_27239                       69.3    5e-12   
gb|ABM91750.1|  acidic thaumatin-like protein 3 precursor             69.7    6e-12   
ref|XP_006657281.1|  PREDICTED: thaumatin-like protein-like           68.6    7e-12   
ref|XP_006853303.1|  hypothetical protein AMTR_s00032p00038020        69.3    7e-12   
gb|AIU34432.1|  thaumatin-like protein 4                              68.9    8e-12   
ref|XP_006662179.1|  PREDICTED: thaumatin-like protein 1-like         68.9    8e-12   
ref|XP_003578322.1|  PREDICTED: protein P21-like                      68.9    9e-12   
ref|XP_009389442.1|  PREDICTED: pathogenesis-related protein 5-like   68.9    1e-11   
gb|KCW77578.1|  hypothetical protein EUGRSUZ_D01893                   68.6    1e-11   
ref|XP_009415311.1|  PREDICTED: pathogenesis-related protein 5-like   68.9    1e-11   
ref|XP_010906157.1|  PREDICTED: protein P21-like                      68.6    2e-11   
gb|EEE50571.1|  hypothetical protein OsJ_30720                        68.6    2e-11   
ref|XP_010237188.1|  PREDICTED: alpha-amylase/trypsin inhibitor-like  67.8    2e-11   
gb|AAO48959.1|  osmotin-like protein                                  67.4    2e-11   
gb|AAK63884.1|AC074105_13  Putative thaumatin-like protein            68.6    3e-11   
gb|EMS49765.1|  hypothetical protein TRIUR3_32265                     66.6    3e-11   
gb|EAY77701.1|  hypothetical protein OsI_32742                        68.6    4e-11   
gb|EEE66264.1|  hypothetical protein OsJ_22450                        67.4    4e-11   
gb|EEC81223.1|  hypothetical protein OsI_24266                        67.0    4e-11   
ref|NP_001058421.1|  Os06g0691200                                     67.4    4e-11   
ref|NP_001147654.1|  LOC100281263 precursor                           67.0    5e-11   
gb|EMS63873.1|  hypothetical protein TRIUR3_03511                     65.5    5e-11   
gb|ADM77948.1|  thaumatin-like protein                                66.6    5e-11   
gb|ADM77951.1|  thaumatin-like protein                                66.6    5e-11   
gb|ADM77976.1|  thaumatin-like protein                                66.6    5e-11   
gb|ADM77965.1|  thaumatin-like protein                                66.6    5e-11   
ref|XP_002468235.1|  hypothetical protein SORBIDRAFT_01g042220        67.0    6e-11   
ref|XP_006664769.1|  PREDICTED: pathogenesis-related protein-like     66.2    6e-11   
dbj|BAK00264.1|  predicted protein                                    67.0    6e-11   
dbj|BAD99299.1|  thaumatin-like protein                               66.6    7e-11   
ref|XP_006440578.1|  hypothetical protein CICLE_v10024049mg           66.2    7e-11   
ref|XP_004970321.1|  PREDICTED: pathogenesis-related protein-like     66.2    7e-11   
ref|NP_001169696.1|  putative thaumatin domain family protein pre...  66.2    1e-10   
ref|XP_010683999.1|  PREDICTED: thaumatin-like protein 1b             66.2    1e-10   
ref|XP_006649687.1|  PREDICTED: pathogenesis-related protein 5-like   66.2    1e-10   
ref|XP_003575667.1|  PREDICTED: protein P21-like                      65.9    1e-10   
gb|KCW72120.1|  hypothetical protein EUGRSUZ_E00561                   65.5    1e-10   
gb|EAY89154.1|  hypothetical protein OsI_10647                        66.2    1e-10   
ref|NP_001049473.1|  Os03g0233200                                     65.9    1e-10   
dbj|BAK05334.1|  predicted protein                                    65.5    1e-10   
ref|XP_002437495.1|  hypothetical protein SORBIDRAFT_10g028130        65.9    1e-10   
gb|KDO39166.1|  hypothetical protein CISIN_1g041058mg                 65.5    1e-10   
ref|XP_004966180.1|  PREDICTED: thaumatin-like protein-like           65.9    2e-10   
ref|XP_010936134.1|  PREDICTED: pathogenesis-related protein 5        65.9    2e-10   
gb|AAP14936.1|  osmotin 81                                            65.1    2e-10   
gb|AAB71680.1|  Barperm1                                              65.5    2e-10   
gb|ABK25464.1|  unknown                                               65.5    2e-10   
dbj|BAC15614.1|  thaumatin-like protein                               65.5    2e-10   
gb|ADM77973.1|  thaumatin-like protein                                65.1    2e-10   
gb|ADM77961.1|  thaumatin-like protein                                65.1    2e-10   
gb|ADM77950.1|  thaumatin-like protein                                65.1    2e-10   
gb|ADM77944.1|  thaumatin-like protein                                65.1    2e-10   
dbj|BAK03806.1|  predicted protein                                    65.5    2e-10   
ref|NP_001143894.1|  uncharacterized protein LOC100276695             63.5    2e-10   
dbj|BAC15615.1|  thaumatin-like protein                               65.1    2e-10   
gb|AAK55325.1|AF355457_1  thaumatin-like protein TLP7                 65.1    2e-10   
dbj|BAK08069.1|  predicted protein                                    65.5    2e-10   
ref|XP_008793569.1|  PREDICTED: thaumatin-like protein 1              65.1    2e-10   
dbj|BAC15616.1|  thaumatin-like protein                               64.7    3e-10   
gb|AAM15877.1|AF442967_1  thaumatin-like protein                      64.7    3e-10   
gb|EMT26984.1|  hypothetical protein F775_32839                       64.3    3e-10   
ref|XP_010230207.1|  PREDICTED: pathogenesis-related protein 5-like   65.1    4e-10   
ref|XP_004985133.1|  PREDICTED: pathogenesis-related protein 5-like   65.1    4e-10   
ref|NP_001067336.1|  Os12g0630200                                     64.3    4e-10   
gb|EAZ04105.1|  hypothetical protein OsI_26249                        64.3    4e-10   
gb|AAV65287.1|  thaumatin-like protein                                64.3    4e-10   
gb|AAB02259.1|  permatin precursor                                    64.3    4e-10   
dbj|BAJ86891.1|  predicted protein                                    64.3    4e-10   
gb|AAW21725.1|  thaumatin-like protein TLP5                           64.3    4e-10   
tpg|DAA57162.1|  TPA: putative thaumatin domain family protein        63.9    4e-10   
gb|KDP36626.1|  hypothetical protein JCGZ_08442                       64.3    5e-10   
gb|ADM77971.1|  thaumatin-like protein                                63.9    5e-10   
ref|XP_006664227.1|  PREDICTED: thaumatin-like protein-like           63.9    5e-10   
gb|EMS63872.1|  hypothetical protein TRIUR3_03510                     64.7    5e-10   
gb|ABF50105.1|  osmotin-like protein                                  60.8    6e-10   
gb|AAK55324.1|AF355456_1  thaumatin-like protein TLP6                 63.5    7e-10   
ref|XP_010911267.1|  PREDICTED: protein P21-like                      63.5    7e-10   
gb|EEE53654.1|  hypothetical protein OsJ_36960                        63.5    8e-10   
ref|XP_002325077.2|  hypothetical protein POPTR_0018s10490g           63.2    8e-10   
ref|XP_002438563.1|  hypothetical protein SORBIDRAFT_10g022000        64.7    9e-10   



>gb|AAU95241.1| osmotin-like protein [Solanum tuberosum]
Length=226

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+FSRFFK RCP+AYSYPQDDPTSLF CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTNFSRFFKQRCPNAYSYPQDDPTSLFTCPSGSTNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>ref|NP_001234161.1| PR-5x precursor [Solanum lycopersicum]
 gb|AAM23272.1| PR-5x [Solanum lycopersicum]
Length=226

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FSRFFK RCP+AYSYPQDDPTSLF CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTKFSRFFKQRCPNAYSYPQDDPTSLFTCPSGSTNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>sp|P50701.1|OS13_SOLCO RecName: Full=Osmotin-like protein OSML13; AltName: Full=PA13; 
Flags: Precursor [Solanum commersonii]
 emb|CAA47601.1| osmotin-like protein [Solanum commersonii]
 emb|CAA51432.1| osmotin-like protein [Solanum commersonii]
Length=246

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>ref|XP_006358887.1| PREDICTED: osmotin-like protein OSML13-like [Solanum tuberosum]
 gb|AAU95237.1| osmotin-like protein [Solanum phureja]
Length=246

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>emb|CAA50059.1| pathogenesis-related protein PR P23 [Solanum lycopersicum]
Length=233

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  152  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  211

Query  204  CP*NV  190
            CP  V
Sbjct  212  CPNGV  216



>ref|XP_004245629.1| PREDICTED: osmotin-like protein TPM-1 [Solanum lycopersicum]
Length=246

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>sp|Q01591.1|TPM1_SOLLC RecName: Full=Osmotin-like protein TPM-1; AltName: Full=PR P23; 
Flags: Precursor, partial [Solanum lycopersicum]
 emb|CAA47047.1| tpm 1 [Solanum lycopersicum]
Length=238

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  157  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  216

Query  204  CP*NV  190
            CP  V
Sbjct  217  CPNGV  221



>gb|AAK55411.1|AF376058_1 osmotin [Petunia x hybrida]
Length=246

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD S+FFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTDLSKFFKKRCPDAYSYPQDDPTSTFTCPSGSTNYKVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>gb|AGH14263.1| osmotin-like protein [Solanum nigrum]
Length=247

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SRFFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>gb|AAN40693.1| osmotin-like protein precursor [Solanum aethiopicum]
Length=184

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  102  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  161

Query  204  CP*NV  190
            CP  V
Sbjct  162  CPKGV  166



>sp|P50702.1|OS81_SOLCO RecName: Full=Osmotin-like protein OSML81; AltName: Full=PA81; 
Flags: Precursor [Solanum commersonii]
 emb|CAA51431.1| osmotin-like protein [Solanum commersonii]
Length=247

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>emb|CAA51430.1| osmotin-like protein [Solanum commersonii]
Length=247

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>gb|AAU93855.1| osmotin-like protein A81 [Solanum phureja]
Length=247

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYKVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>ref|XP_006358888.1| PREDICTED: osmotin-like protein OSML81-like [Solanum tuberosum]
 gb|AAU95236.1| osmotin-like protein [Solanum phureja]
Length=247

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYKVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>gb|AAL87641.1|AF450277_1 osmotin-like protein [Solanum nigrum]
Length=207

 Score =   109 bits (273),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  144  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVF  203

Query  204  CP  199
            CP
Sbjct  204  CP  205



>pdb|2I0W|A Chain A, Crystal Structure Analysis Of Np24-I, A Thaumatin-Like 
Protein
Length=207

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  144  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVF  203

Query  204  CP  199
            CP
Sbjct  204  CP  205



>ref|XP_004245630.1| PREDICTED: protein NP24 [Solanum lycopersicum]
 sp|P12670.2|NP24_SOLLC RecName: Full=Protein NP24; AltName: Full=Pathogenesis-related 
protein PR P23; AltName: Full=Salt-induced protein; Flags: 
Precursor [Solanum lycopersicum]
 gb|AAC64171.1| pathogenesis-related protein osmotin precursor [Solanum lycopersicum]
Length=247

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>gb|AAA34175.1| NP24 protein precursor, partial [Solanum lycopersicum]
 prf||1601515A salt induced protein
Length=239

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  157  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVF  216

Query  204  CP*NV  190
            CP  V
Sbjct  217  CPNGV  221



>gb|AAG16625.1| cryoprotective osmotin-like protein [Solanum dulcamara]
Length=248

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPC PTD SRFFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCNPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  225

Query  204  CP*NV  190
            CP  V
Sbjct  226  CPNGV  230



>ref|XP_006358885.1| PREDICTED: osmotin-like protein OSML13-like [Solanum tuberosum]
Length=230

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD+SRFFK RCPDAYSYPQDDPTS F CP+ ST++ V F
Sbjct  169  NNPCTTFGGQQYCCTQGPCGPTDWSRFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVF  228

Query  204  CP  199
            CP
Sbjct  229  CP  230



>emb|CAA43854.1| osmotin [Nicotiana tabacum]
Length=245

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FS+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  164  NNPCTTFGGQQYCCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYRVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|AAU93853.1| osmotin-like protein A13 [Solanum phureja]
Length=246

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQY CT GPCGPTD SRFFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYRCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>pdb|1PCV|A Chain A, Crystal Structure Of Osmotin, A Plant Antifungal Protein
 pdb|1PCV|B Chain B, Crystal Structure Of Osmotin, A Plant Antifungal Protein
Length=205

 Score =   107 bits (268),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FS+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  144  NNPCTTFGGQQYCCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYRVIF  203

Query  204  CP  199
            CP
Sbjct  204  CP  205



>ref|XP_009782398.1| PREDICTED: osmotin [Nicotiana sylvestris]
 emb|CAA46623.1| osmotin [Nicotiana tabacum]
Length=250

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FS+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  169  NNPCTTFGGQQYCCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYRVIF  228

Query  204  CP  199
            CP
Sbjct  229  CP  230



>emb|CAA64620.1| PR protein [Nicotiana tabacum]
Length=246

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FS+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYKVIF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>gb|AAB23375.1| osmotin, partial [Nicotiana tabacum]
Length=244

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FS+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  163  NNPCTTFGGQQYCCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYRVIF  222

Query  204  CP  199
            CP
Sbjct  223  CP  224



>ref|XP_009610144.1| PREDICTED: osmotin [Nicotiana tomentosiformis]
Length=250

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FS+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  169  NNPCTTFGGQQYCCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYKVIF  228

Query  204  CP  199
            CP
Sbjct  229  CP  230



>sp|P14170.2|OSMO_TOBAC RecName: Full=Osmotin; Flags: Precursor [Nicotiana tabacum]
 emb|CAA46622.1| osmotin [Nicotiana tabacum]
 gb|AAB22459.2| osmotin [Nicotiana tabacum]
Length=246

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FS+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYRVIF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>gb|ACB30367.1| PR5-like protein [Capsicum annuum]
Length=251

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCP+AYSYPQDDPTS F CP GST++ V F
Sbjct  169  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPNAYSYPQDDPTSTFTCPGGSTNYRVVF  228

Query  204  CP*NV  190
            CP  V
Sbjct  229  CPNGV  233



>ref|XP_006358890.1| PREDICTED: osmotin-like protein OSML81-like [Solanum tuberosum]
 gb|AAU95235.1| osmotin-like protein [Solanum phureja]
Length=247

 Score =   107 bits (268),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT FS FFK RCPDAYSYPQDDPTS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTFFSNFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>gb|AAP86781.1| osmotin-like protein [Capsicum annuum]
Length=250

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>gb|AAU95242.1| osmotin-like protein [Solanum tuberosum]
Length=250

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>ref|XP_006358891.1| PREDICTED: osmotin-like protein OSML15-like [Solanum tuberosum]
 sp|P50703.1|OS35_SOLCO RecName: Full=Osmotin-like protein OSML15; AltName: Full=PA15; 
Flags: Precursor [Solanum commersonii]
 emb|CAA47669.1| osmotin-like protein [Solanum commersonii]
 gb|AAU93854.1| osmotin-like protein A35 [Solanum phureja]
 gb|AAU95239.1| osmotin-like protein [Solanum phureja]
Length=250

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>gb|AAS48588.1| putative osmotin-like protein precursor [Brassica juncea]
Length=228

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP+ ST++ V F
Sbjct  146  NNPCTTFGGQQYCCTQGPCGPTELSKFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVF  205

Query  204  CP*NV  190
            CP  V
Sbjct  206  CPNGV  210



>gb|AAK97184.1| thaumatin-like protein [Capsicum annuum]
 emb|CAC34055.2| osmotin-like protein [Capsicum annuum]
Length=246

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDD TS F CP+GST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>ref|NP_001234351.1| PR5-like protein precursor [Solanum lycopersicum]
 gb|AAP43673.1| PR5-like protein [Solanum lycopersicum]
 gb|ACZ71038.1| PR5-like protein [Solanum lycopersicum]
Length=250

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>gb|AAL87640.1|AF450276_1 osmotin-like protein precursor [Solanum nigrum]
Length=247

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP+ ST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSKFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>gb|AEH41422.1| pathogenesis-related protein 5 [Curcuma amada]
Length=227

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT FG QQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDD TS F CP G T+++VTF
Sbjct  167  NNPCTVFGTQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDQTSTFTCPGG-TNYSVTF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>gb|AAL79832.2| osmotin-like protein [Solanum nigrum]
 gb|ABB36660.1| osmotin-like protein [Solanum nigrum]
Length=247

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ S+FFK RCPDAYSYPQDDPTS F CP+ ST++ V F
Sbjct  165  NNPCTTFGGQQYCCTQGPCGPTELSKFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVF  224

Query  204  CP*NV  190
            CP  V
Sbjct  225  CPNGV  229



>ref|XP_006358892.1| PREDICTED: osmotin-like protein OSML15-like [Solanum tuberosum]
 gb|AAU95238.1| osmotin-like protein [Solanum phureja]
Length=250

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCC +GPCGPTD SRFFK RCPDAYSYPQDDPTS F C + +TD+ + F
Sbjct  166  NNPCTTFGGQQYCCNHGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKIMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>gb|AAU95240.1| osmotin-like protein [Solanum tuberosum]
Length=226

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQ+CCT GPCGPTD+SRFFK RCPDAYSYPQDD TS F CP+ ST++ V F
Sbjct  165  NNPCTTFGGQQHCCTQGPCGPTDWSRFFKQRCPDAYSYPQDDATSTFTCPSDSTNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>gb|AAA34089.1| osmotin [Nicotiana tabacum]
Length=243

 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT  PCGPT FS+FFK RCPDAYSYPQDDPTS F CP GST++ V F
Sbjct  162  NNPCTTFGGQQYCCTQRPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYRVIF  221

Query  204  CP  199
            CP
Sbjct  222  CP  223



>ref|XP_009589206.1| PREDICTED: osmotin-like protein [Nicotiana tomentosiformis]
Length=255

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SR+FK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  170  NNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMF  229

Query  204  CP  199
            CP
Sbjct  230  CP  231



>ref|XP_009782395.1| PREDICTED: osmotin-like protein [Nicotiana sylvestris]
 dbj|BAA11180.1| neutral PR-5 [Nicotiana sylvestris]
Length=251

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SR+FK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>ref|XP_009589205.1| PREDICTED: osmotin-like protein [Nicotiana tomentosiformis]
 sp|P25871.1|OLPA_TOBAC RecName: Full=Osmotin-like protein; AltName: Full=Pathogenesis-related 
protein PR-5d; Flags: Precursor [Nicotiana tabacum]
 gb|AAA34087.1| osmotin-like protein [Nicotiana tabacum]
Length=251

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SR+FK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>dbj|BAD15089.1| pathogenesis-related protein [Nicotiana tabacum]
Length=244

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SR+FK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  159  NNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMF  218

Query  204  CP  199
            CP
Sbjct  219  CP  220



>emb|CAH69228.1| putative osmotin-like protein [Nicotiana glauca]
Length=251

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SR+FK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>ref|XP_009782397.1| PREDICTED: osmotin-like protein [Nicotiana sylvestris]
 dbj|BAD15090.1| pathogenesis-related protein [Nicotiana tabacum]
Length=251

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SR+FK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>pdb|1AUN|A Chain A, Pathogenesis-Related Protein 5d From Nicotiana Tabacum
Length=208

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SR+FK RCPDAYSYPQDDPTS F C + +TD+ V F
Sbjct  145  NNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMF  204

Query  204  CP  199
            CP
Sbjct  205  CP  206



>ref|XP_004245628.2| PREDICTED: osmotin-like protein OSML15 [Solanum lycopersicum]
Length=250

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCC +GPCGPT+ SRFFK RCPDAYSYPQDDPTS F C + +TD+ + F
Sbjct  166  NNPCTTFGGQQYCCNHGPCGPTELSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKIMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>ref|XP_010325678.1| PREDICTED: osmotin-like protein OSML13 [Solanum lycopersicum]
Length=233

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPC PT++S+FFK RCPDAYSYPQDD TS F CP+ ST++ V F
Sbjct  172  NNPCTTFGGQQYCCTQGPCSPTEWSKFFKQRCPDAYSYPQDDATSTFACPSDSTNYKVVF  231

Query  204  CP  199
            CP
Sbjct  232  CP  233



>prf||1808326A osmotin-like protein
Length=251

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCTTFGGQQYCCT GPCGPT+ SR+FK RCP+AYSYPQDDPTS F C + +TD+ V F
Sbjct  166  NNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPNAYSYPQDDPTSTFTCTSWTTDYKVMF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>gb|AFV46355.1| pathogenesis-related protein 5, partial [Curcuma amada]
Length=225

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT FG QQYCCTNGPCGPTD SRFFKTRCPDAYSYPQDD TS F CP G T+++VTF
Sbjct  162  NNPCTVFGTQQYCCTNGPCGPTDLSRFFKTRCPDAYSYPQDDATSTFTCPGG-TNYSVTF  220

Query  204  CP  199
             P
Sbjct  221  LP  222



>gb|EYU38380.1| hypothetical protein MIMGU_mgv1a013157mg [Erythranthe guttata]
Length=229

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT FGG QYCCTNGP  CGPT FSRFFK RCPDAYSYPQDDPTSLF CPAG T++ V
Sbjct  167  NNPCTVFGGNQYCCTNGPGTCGPTPFSRFFKERCPDAYSYPQDDPTSLFTCPAG-TNYRV  225

Query  210  TFCP  199
             FCP
Sbjct  226  VFCP  229



>gb|KCW77574.1| hypothetical protein EUGRSUZ_D01888 [Eucalyptus grandis]
Length=241

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCCT G CGPT+FS+FFK +CPDAYSYPQDDPTS F CP+GSTD+TV F
Sbjct  163  NNPCTVFKTDEYCCTKGKCGPTNFSKFFKNKCPDAYSYPQDDPTSTFTCPSGSTDYTVVF  222

Query  204  CP  199
            CP
Sbjct  223  CP  224



>gb|AFV46356.1| pathogenesis-related protein 5, partial [Zingiber officinale]
Length=224

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N+PCT FG Q+YCC NGPCGPTDFSRFFKTRCPDAYSYPQDD TS F CP G T+++VTF
Sbjct  163  NDPCTVFGTQEYCCNNGPCGPTDFSRFFKTRCPDAYSYPQDDQTSTFTCPGG-TNYSVTF  221

Query  204  CP  199
             P
Sbjct  222  MP  223



>gb|AEH41423.1| pathogeneis-related protein 5 [Zingiber officinale]
Length=223

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT FG  Q CCTNGPCGPTDFSRFFKTRCPDAYSYPQDD TS F CP G T+++VTF
Sbjct  163  NNPCTVFGTPQCCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDQTSTFTCPGG-TNYSVTF  221

Query  204  CP  199
            CP
Sbjct  222  CP  223



>gb|AFV46361.1| pathogenesis-related protein 5, partial [Alpinia luteocarpa]
Length=223

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT FG QQYCCTNGPCGPTD+SRFFKT+CPDAYSYP DD TS F CP G T ++VTF
Sbjct  162  NNPCTVFGTQQYCCTNGPCGPTDYSRFFKTQCPDAYSYPLDDATSTFTCPGG-THYSVTF  220

Query  204  CP  199
             P
Sbjct  221  MP  222



>gb|AFV46358.1| pathogenesis-related protein 5, partial [Curcuma longa]
Length=228

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT FG Q+YCCTNGPCGPT+ S FFKTRCPDAYSYPQDD TS F CP G T+++VTF
Sbjct  167  NNPCTVFGTQRYCCTNGPCGPTELSEFFKTRCPDAYSYPQDDETSTFTCPGG-TNYSVTF  225

Query  204  CP  199
             P
Sbjct  226  LP  227



>ref|XP_011072290.1| PREDICTED: thaumatin-like protein [Sesamum indicum]
Length=226

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT FG  +YCCT+GP  CGPT++SRFFK RCPDAYSYPQDDPTSLF CPAG T++ V
Sbjct  164  NNPCTVFGTNEYCCTDGPGSCGPTNYSRFFKERCPDAYSYPQDDPTSLFTCPAG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>ref|XP_010314485.1| PREDICTED: pathogenesis-related protein R major form [Solanum 
lycopersicum]
Length=227

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   ++CCTNGP  CGPTDFSRFFK RCPDAYSYPQDDPTSLF CPAG T++ V
Sbjct  165  NNPCTVFKTNEFCCTNGPGSCGPTDFSRFFKQRCPDAYSYPQDDPTSLFTCPAG-TNYKV  223

Query  210  TFCP  199
             FCP
Sbjct  224  VFCP  227



>ref|XP_006364119.1| PREDICTED: pathogenesis-related protein R major form-like [Solanum 
tuberosum]
 gb|AAU95244.1| putative thaumatin-like protein [Solanum tuberosum]
Length=227

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   ++CCTNGP  CGPTD SRFFK RCPDAYSYPQDDPTSLF CPAG T++ V
Sbjct  165  NNPCTVFKTNEFCCTNGPGSCGPTDLSRFFKQRCPDAYSYPQDDPTSLFTCPAG-TNYKV  223

Query  210  TFCP  199
             FCP
Sbjct  224  VFCP  227



>sp|E3SU11.1|ALL13_OLEEU RecName: Full=Thaumatin-like protein; AltName: Allergen=Ole e 
13; Flags: Precursor [Olea europaea]
 gb|ACZ57583.1| allergenic thaumatin [Olea europaea]
Length=226

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNGP  CGPT  SRFFK RCPDAYSYPQDDPTSLF CPAG T++ V
Sbjct  164  NNPCTVFNTNEYCCTNGPGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>gb|AFV46360.1| pathogenesis-related protein 5, partial [Elettaria cardamomum]
Length=229

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT FG  QYCCTNG CG TD+SRFFKT+CPDAYSYPQDD TS F CP G T+++VTF
Sbjct  167  NNPCTVFGTSQYCCTNGRCGSTDYSRFFKTQCPDAYSYPQDDQTSTFTCPGG-TNYSVTF  225

Query  204  CP  199
             P
Sbjct  226  WP  227



>gb|AFV46357.1| pathogenesis-related protein 5, partial [Zingiber zerumbet]
Length=217

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 3/62 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTS--LFNCPAGSTDFTV  211
            N+PCT FG QQYCC NGPCGPTDFSRFFK RCPDAYSYPQDD TS  +F CP G T+++V
Sbjct  157  NDPCTVFGTQQYCCNNGPCGPTDFSRFFKARCPDAYSYPQDDRTSTVVFTCPGG-TNYSV  215

Query  210  TF  205
            TF
Sbjct  216  TF  217



>gb|AGC39177.1| thaumatin-like protein [Actinidia chinensis]
Length=244

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            +NPCT F  Q+YCCT GPCGPT++SRFFK RC DAYSYPQDDPTS F CP GS ++ VTF
Sbjct  167  HNPCTVFKTQEYCCTQGPCGPTNYSRFFKERCRDAYSYPQDDPTSTFTCPGGS-NYRVTF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>gb|AGS80337.1| thaumatin protein [Actinidia eriantha]
Length=225

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTD+SRFFKTRCPDAYSYP+DD TSLF CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGNCGPTDYSRFFKTRCPDAYSYPKDDKTSLFTCPGG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|ACL80664.1| pathogenesis-related protein 5 [Zingiber zerumbet]
Length=227

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTS--LFNCPAGSTDFTV  211
            N+PCT FG +QYCC NGPC PTDFSRFFK RCPDAYSYPQDD TS  +F CP G T+++V
Sbjct  165  NDPCTVFGTEQYCCNNGPCDPTDFSRFFKARCPDAYSYPQDDRTSTVVFTCPGG-TNYSV  223

Query  210  TFCP  199
            TFCP
Sbjct  224  TFCP  227



>ref|XP_009627978.1| PREDICTED: pathogenesis-related protein R major form [Nicotiana 
tomentosiformis]
 sp|P13046.1|PRR1_TOBAC RecName: Full=Pathogenesis-related protein R major form; AltName: 
Full=Thaumatin-like protein E22; Flags: Precursor [Nicotiana 
tabacum]
 emb|CAA33293.1| thaumatin-like protein [Nicotiana tabacum]
 emb|CAA31235.1| unnamed protein product [Nicotiana tabacum]
 gb|AAW66482.1| thaumatin-like protein [Nicotiana tabacum]
Length=226

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT     +YCCTNGP  CGPTD SRFFK RCPDAYSYPQDDPTSLF CP+G T++ V
Sbjct  164  NNPCTVIKTNEYCCTNGPGSCGPTDLSRFFKERCPDAYSYPQDDPTSLFTCPSG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>gb|AGC39178.1| thaumatin-like protein [Actinidia deliciosa]
Length=243

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPC  F  QQYCCT GPCGPTD+SRFFK RC DAYSYPQDDPTS F CP G T++ V F
Sbjct  166  NNPCQVFKTQQYCCTQGPCGPTDYSRFFKDRCYDAYSYPQDDPTSTFTCPGG-TNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>ref|XP_010053305.1| PREDICTED: protein NP24-like [Eucalyptus grandis]
Length=425

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCCT G CGPT+FS+FFK +CPDAYSYPQDDPTS F CP+GSTD+TV F
Sbjct  163  NNPCTVFKTDEYCCTKGKCGPTNFSKFFKNKCPDAYSYPQDDPTSTFTCPSGSTDYTVVF  222


 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT +S+FFKT+CPDAYSYPQDDPTS F CP+G T++ V
Sbjct  363  NNPCTVFKTNEYCCTNGQGSCGPTTYSQFFKTKCPDAYSYPQDDPTSTFTCPSG-TNYKV  421

Query  210  TFCP  199
            TFCP
Sbjct  422  TFCP  425



>ref|XP_009615320.1| PREDICTED: thaumatin-like protein [Nicotiana tomentosiformis]
Length=224

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNGP  CGPTD SRFFK RC DAYSYPQDDPTSLF CP+G T++ V
Sbjct  162  NNPCTVFNTNEYCCTNGPESCGPTDLSRFFKERCSDAYSYPQDDPTSLFTCPSG-TNYRV  220

Query  210  TFCP  199
             FCP
Sbjct  221  VFCP  224



>ref|XP_008345347.1| PREDICTED: protein P21-like [Malus domestica]
Length=225

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTDFS+FFK+RCPDAYSYP+DDPTSLF CP G  ++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGNCGPTDFSKFFKSRCPDAYSYPKDDPTSLFTCPGGX-NYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>emb|CDP16242.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   ++CCTNGP  C PTDFSRFFK+RCPDAYSYPQDDPTSLF CP+G T++ V
Sbjct  162  NNPCTVFKTNEFCCTNGPGSCRPTDFSRFFKSRCPDAYSYPQDDPTSLFTCPSG-TNYRV  220

Query  210  TFCP  199
             FCP
Sbjct  221  VFCP  224



>ref|XP_002282917.2| PREDICTED: protein P21 [Vitis vinifera]
Length=262

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC N  CGPTD+SRFFKTRCPDAYSYPQDDPTS F CP G T++ V F
Sbjct  183  NNPCTVFKTPQYCCNNIKCGPTDYSRFFKTRCPDAYSYPQDDPTSTFTCPGG-TNYRVVF  241

Query  204  CP  199
            CP
Sbjct  242  CP  243



>gb|ADD51187.1| thaumatin-like protein [Vitis cinerea var. helleri x Vitis riparia]
Length=239

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC N  CGPTD+SRFFKTRCPDAYSYPQDDPTS F CP G T++ V F
Sbjct  160  NNPCTVFKTPQYCCNNIKCGPTDYSRFFKTRCPDAYSYPQDDPTSTFTCPGG-TNYRVVF  218

Query  204  CP  199
            CP
Sbjct  219  CP  220



>gb|AFV46362.1| pathogenesis-related protein 5, partial [Hedychium coronarium]
Length=221

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSL--FNCPAGSTDFTV  211
            NNPCT FG  QYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDD  S+  F CP G T+++V
Sbjct  157  NNPCTVFGTPQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDRNSMVVFTCPGG-TNYSV  215

Query  210  TFCP  199
            T  P
Sbjct  216  TSWP  219



>gb|AGC39179.1| thaumatin-like protein [Actinidia deliciosa]
Length=243

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F  Q+YCCT GPCGPT +SRFFK RC DAYSYPQDDPTS F CP G T++ V F
Sbjct  166  NNPCTVFKTQEYCCTQGPCGPTGYSRFFKDRCYDAYSYPQDDPTSTFTCPGG-TNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>gb|ACH54108.1| osmotin isoform precursor [Piper colubrinum]
Length=180

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTD+SRFFKTRCPDAYSYP+DDPTS F CP G T++ V F
Sbjct  120  NNPCTVFKTDQYCCNSGSCSPTDYSRFFKTRCPDAYSYPKDDPTSTFTCPGG-TNYRVVF  178

Query  204  CP  199
            CP
Sbjct  179  CP  180



>ref|XP_009781670.1| PREDICTED: pathogenesis-related protein R minor form [Nicotiana 
sylvestris]
Length=226

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT     ++CCTNGP  CGPTD SRFFK RCPDAYSYPQDDPTSLF CP+G T++ V
Sbjct  164  NNPCTVIKTNEFCCTNGPGSCGPTDLSRFFKARCPDAYSYPQDDPTSLFTCPSG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>gb|AAD55090.1| thaumatin [Vitis riparia]
Length=247

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC N  CGPTD+SRFFKTRCPDAYSYPQDDPTS F CP G+ ++ V F
Sbjct  168  NNPCTVFKTPQYCCNNIKCGPTDYSRFFKTRCPDAYSYPQDDPTSTFTCPGGA-NYRVVF  226

Query  204  CP  199
            CP
Sbjct  227  CP  228



>emb|CAN71616.1| hypothetical protein VITISV_023861 [Vitis vinifera]
Length=247

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC N  CGPTD+SRFFKTRCPDAYSYPQDDPTS F CP G+ ++ V F
Sbjct  168  NNPCTVFKTPQYCCNNIKCGPTDYSRFFKTRCPDAYSYPQDDPTSTFTCPGGA-NYRVVF  226

Query  204  CP  199
            CP
Sbjct  227  CP  228



>gb|ABE01396.1| Thaumatin-like protein [Camellia sinensis]
 gb|AGY30681.1| thaumatin-like protein [Camellia sinensis]
Length=226

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   QYCCT+GP  CGPT  S+FFK RCPDAYSYPQDDPTSLF CPAG T++ +
Sbjct  164  NNPCTVYKTNQYCCTDGPGTCGPTPLSKFFKDRCPDAYSYPQDDPTSLFTCPAG-TNYAI  222

Query  210  TFCP  199
            TFCP
Sbjct  223  TFCP  226



>ref|XP_009345452.1| PREDICTED: protein P21-like [Pyrus x bretschneideri]
Length=225

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPTDFSRFFK+RCPDAYSYP+DDPTS F CP G T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGNCGPTDFSRFFKSRCPDAYSYPKDDPTSTFTCPTG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_010540702.1| PREDICTED: osmotin-like protein OSM34 [Tarenaya hassleriana]
Length=245

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNGP  C PT +S+FFK RCPDAYSYPQDD TS F CP GST++ V
Sbjct  170  NNPCTVFKTNEYCCTNGPGSCAPTTYSKFFKDRCPDAYSYPQDDATSTFTCPGGSTNYRV  229

Query  210  TFCP  199
             FCP
Sbjct  230  VFCP  233



>gb|ABX71220.1| osmotin [Piper colubrinum]
Length=230

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTD+SRFFKTRCPDAYSYP+DDPTS F CP G T++ V F
Sbjct  170  NNPCTVFKTDQYCCNSGSCSPTDYSRFFKTRCPDAYSYPKDDPTSTFTCPGG-TNYRVVF  228

Query  204  CP  199
            CP
Sbjct  229  CP  230



>gb|AAM21199.1|AF364864_1 pathogenesis-related protein 5-1 [Helianthus annuus]
Length=222

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT +   QYCC +G CGPTD SRFFKTRCPDAYSYP+DDPTS F CP G T++ V F
Sbjct  162  NNPCTVYKTDQYCCNSGNCGPTDLSRFFKTRCPDAYSYPKDDPTSTFTCPGG-TNYDVIF  220

Query  204  CP  199
            CP
Sbjct  221  CP  222



>gb|AGC39176.1| thaumatin-like protein [Actinidia chinensis]
Length=225

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTD+SRFFKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGNCGPTDYSRFFKTRCPDAYSYPKDDQTSTFTCPGG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_004298782.1| PREDICTED: osmotin-like protein OSM34-like [Fragaria vesca subsp. 
vesca]
Length=248

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT+FS+FFKTRCPDAYSYPQDDPTS F CP G T++ V
Sbjct  168  NNPCTVFKTNEYCCTNGQGSCGPTNFSKFFKTRCPDAYSYPQDDPTSTFTCPGG-TNYRV  226

Query  210  TFCP  199
             FCP
Sbjct  227  VFCP  230



>emb|CAB86199.1| pathogenesis-related protein (PR-5 protein) [Solanum lycopersicum]
Length=249

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PCTT   QQYCC +GPCGPT+ SRFFK RCPDAYSYPQDDPTS F C + +TD+ + F
Sbjct  166  NKPCTT-SRQQYCCNHGPCGPTELSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKIMF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>ref|XP_010530407.1| PREDICTED: osmotin-like protein OSM34, partial [Tarenaya hassleriana]
Length=189

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FSRFFK RC DAYSYPQDDPTS F CP G+T++ V
Sbjct  126  NNPCTVFRTNEYCCTNGQGSCGPTTFSRFFKDRCRDAYSYPQDDPTSTFTCPGGTTNYRV  185

Query  210  TFCP  199
             FCP
Sbjct  186  VFCP  189



>ref|XP_007040160.1| Osmotin 34 [Theobroma cacao]
 gb|EOY24661.1| Osmotin 34 [Theobroma cacao]
Length=225

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT+FS FFK RCPDAYSYP+DD TS F CPAG TD+ V F
Sbjct  165  NNPCTVFKTDQYCCNSGSCGPTNFSSFFKERCPDAYSYPKDDETSTFTCPAG-TDYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_004143988.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004159977.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
Length=225

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCT--NGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT FGG QYCCT  N  CGPTD+SRFFK RCPDAYSYP+DD TS F CP G T++ V
Sbjct  163  NNPCTVFGGDQYCCTDPNSSCGPTDYSRFFKDRCPDAYSYPKDDATSTFTCPGG-TNYRV  221

Query  210  TFCP  199
             FCP
Sbjct  222  VFCP  225



>ref|XP_003525412.1| PREDICTED: protein P21-like [Glycine max]
Length=224

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTD+SRFFK RCPDAYSYP+DDPTS F C  G TD+ V F
Sbjct  164  NNPCTVFKTDQYCCNSGSCGPTDYSRFFKQRCPDAYSYPKDDPTSTFTCNGG-TDYRVVF  222

Query  204  CP  199
            CP
Sbjct  223  CP  224



>gb|AGC39182.1| thaumatin-like protein [Actinidia eriantha]
Length=228

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+GP  CGPT +S+FFK RCPDAYSYPQDDPTSLF CP G T++ V
Sbjct  166  NNPCTVFKTNEYCCTDGPGSCGPTTYSKFFKDRCPDAYSYPQDDPTSLFTCPGG-TNYKV  224

Query  210  TFCP  199
             FCP
Sbjct  225  VFCP  228



>ref|XP_008437225.1| PREDICTED: protein P21-like [Cucumis melo]
Length=225

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCT--NGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT FGG QYCCT  N  CGPTD+SRFFK RCPDAYSYP+DD TS F CP G T++ V
Sbjct  163  NNPCTVFGGDQYCCTDPNSSCGPTDYSRFFKDRCPDAYSYPKDDETSTFTCPGG-TNYRV  221

Query  210  TFCP  199
             FCP
Sbjct  222  VFCP  225



>ref|XP_009772655.1| PREDICTED: thaumatin-like protein [Nicotiana sylvestris]
Length=220

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT+FSRFFK RCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  160  NNPCTVFKTDQYCCNSGNCGPTNFSRFFKQRCPDAYSYPKDDQTSTFTCPAG-TNYKVVF  218

Query  204  CP  199
            CP
Sbjct  219  CP  220



>gb|ADP69173.1| pathogenesis related protein-5 [Populus tomentosa]
Length=225

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTDFSRFFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGTCGPTDFSRFFKQRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|AFV46359.1| pathogenesis-related protein 5, partial [Curcuma aromatica]
Length=218

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N+PCT F  QQYCC NGPCGPTDFSRFFKTRCPDAY YPQD  T+ F CP  ST ++VTF
Sbjct  155  NDPCTVFWTQQYCCNNGPCGPTDFSRFFKTRCPDAYRYPQDYQTNTFTCPGRST-YSVTF  213

Query  204  CP  199
             P
Sbjct  214  LP  215



>ref|XP_002509749.1| Osmotin precursor, putative [Ricinus communis]
 gb|EEF51136.1| Osmotin precursor, putative [Ricinus communis]
Length=225

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FS+FFK RCPDAYSYPQDDPTS F CP G T++ V
Sbjct  163  NNPCTVFKTNEYCCTNGQGSCGPTTFSKFFKNRCPDAYSYPQDDPTSTFTCPGG-TNYRV  221

Query  210  TFCP  199
            TFCP
Sbjct  222  TFCP  225



>ref|XP_004245632.1| PREDICTED: thaumatin-like protein [Solanum lycopersicum]
Length=220

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT FSRFFK RCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  160  NNPCTVFKTDQYCCNSGNCGPTKFSRFFKERCPDAYSYPKDDQTSTFTCPAG-TNYRVVF  218

Query  204  CP  199
            CP
Sbjct  219  CP  220



>ref|XP_009345456.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=225

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTDFS+FFK+RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGNCGPTDFSKFFKSRCPDAYSYPKDDQTSTFTCPGG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|AAU95246.1| putative thaumatin-like protein [Solanum tuberosum]
Length=246

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F  +++CCTNGP  CGPTD+S+FFK RCPDAYSYP DDPTS+F C AG T++ V
Sbjct  161  NNPCTVFKMKEFCCTNGPGSCGPTDYSKFFKQRCPDAYSYPLDDPTSMFTCHAG-TNYKV  219

Query  210  TFCP*N  193
             FCP N
Sbjct  220  VFCPGN  225



>gb|AAK59276.1|AF378572_1 thaumatin-like protein [Sambucus nigra]
Length=200

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+GP  C PTDFSRFFKTRCP +YSYPQDDPTSLF CP+G T++ V
Sbjct  138  NNPCTVFPRNEYCCTDGPGSCQPTDFSRFFKTRCPTSYSYPQDDPTSLFTCPSG-TNYRV  196

Query  210  TFCP  199
             FCP
Sbjct  197  VFCP  200



>gb|AAK59278.1|AF378574_1 thaumatin-like protein [Sambucus nigra]
Length=224

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+GP  C PTDFSRFFKTRCP +YSYPQDDPTSLF CP+G T++ V
Sbjct  162  NNPCTVFPRNEYCCTDGPGSCQPTDFSRFFKTRCPTSYSYPQDDPTSLFTCPSG-TNYRV  220

Query  210  TFCP  199
             FCP
Sbjct  221  VFCP  224



>ref|XP_002283042.1| PREDICTED: protein P21 [Vitis vinifera]
 emb|CAN80707.1| hypothetical protein VITISV_034657 [Vitis vinifera]
Length=225

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTD+SR+FKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGSCGPTDYSRYFKTRCPDAYSYPKDDQTSTFTCPGG-TNYDVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_007210589.1| hypothetical protein PRUPE_ppa016268mg [Prunus persica]
 gb|EMJ11788.1| hypothetical protein PRUPE_ppa016268mg [Prunus persica]
Length=226

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTDFSRFFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  166  NNPCTVFKTDQYCCNSGSCGPTDFSRFFKDRCPDAYSYPKDDQTSTFTCPTG-TNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>ref|XP_010661214.1| PREDICTED: protein P21 [Vitis vinifera]
 emb|CAN82850.1| hypothetical protein VITISV_030860 [Vitis vinifera]
Length=225

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPTD+SR+FKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTNEYCCNSGSCGPTDYSRYFKTRCPDAYSYPKDDQTSTFTCPGG-TNYEVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>sp|G5DC91.2|TLP1_MANZA RecName: Full=Thaumatin-like protein 1; AltName: Full=Acidic 
thaumatin-like protein; AltName: Full=Beta-1,3-glucanase; AltName: 
Full=Thaumatin-like protein 1b [Manilkara zapota]
Length=207

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   +YCCTNG   CGPT  S+FFK RCPDAYSYPQDDPTSLF CPAG T++ V
Sbjct  141  NNPCTVYKTNEYCCTNGQGTCGPTALSKFFKDRCPDAYSYPQDDPTSLFTCPAG-TNYKV  199

Query  210  TFCP  199
             FCP
Sbjct  200  VFCP  203



>gb|AEP84104.1| acidic thaumatin-like protein, partial [Manilkara zapota]
Length=200

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   +YCCTNG   CGPT  S+FFK RCPDAYSYPQDDPTSLF CPAG T++ V
Sbjct  134  NNPCTVYKTNEYCCTNGQGTCGPTALSKFFKDRCPDAYSYPQDDPTSLFTCPAG-TNYKV  192

Query  210  TFCP  199
             FCP
Sbjct  193  VFCP  196



>ref|XP_004143926.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004159963.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN50134.1| Thaumatin-like protein [Cucumis sativus]
Length=223

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCT--NGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT FGG +YCCT  N  CGPTD+SRFFK RCPDAYSYP+DD TS F CP G T++ V
Sbjct  161  NNPCTVFGGDRYCCTAPNSSCGPTDYSRFFKNRCPDAYSYPKDDATSTFTCPGG-TNYRV  219

Query  210  TFCP  199
             FCP
Sbjct  220  VFCP  223



>ref|XP_008437224.1| PREDICTED: protein P21-like [Cucumis melo]
Length=227

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCT--NGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT FGG +YCCT  N  CGPTD+SRFFK RCPDAYSYP+DD TS F CP G T++ V
Sbjct  165  NNPCTVFGGDRYCCTAPNSSCGPTDYSRFFKDRCPDAYSYPKDDATSTFTCPGG-TNYRV  223

Query  210  TFCP  199
             FCP
Sbjct  224  VFCP  227



>pdb|4L5H|A Chain A, Structure Of Haze Forming Proteins In White Wines: Vitis 
Vinifera Thaumatin-like Proteins
 pdb|4L5H|B Chain B, Structure Of Haze Forming Proteins In White Wines: Vitis 
Vinifera Thaumatin-like Proteins
 pdb|4MBT|A Chain A, Structure Of Haze Forming Proteins In White Wines: Vitis 
Vinifera Thaumatin-like Proteins
 pdb|4MBT|B Chain B, Structure Of Haze Forming Proteins In White Wines: Vitis 
Vinifera Thaumatin-like Proteins
Length=198

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+GP  CGPT +S+FFK RCPDAYSYPQDD TSLF CP+G T++ V
Sbjct  136  NNPCTVFKTNEYCCTDGPGSCGPTTYSKFFKDRCPDAYSYPQDDKTSLFTCPSG-TNYKV  194

Query  210  TFCP  199
            TFCP
Sbjct  195  TFCP  198



>ref|XP_002283030.1| PREDICTED: protein P21 [Vitis vinifera]
 emb|CAN60240.1| hypothetical protein VITISV_027469 [Vitis vinifera]
Length=225

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPTD+SR+FKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTNEYCCNSGSCGPTDYSRYFKTRCPDAYSYPKDDQTSTFTCPGG-TNYDVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|AAB61590.1| VVTL1 [Vitis vinifera]
Length=222

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+GP  CGPT +S+FFK RCPDAYSYPQDD TSLF CP+G T++ V
Sbjct  160  NNPCTVFKTNEYCCTDGPGSCGPTTYSKFFKDRCPDAYSYPQDDKTSLFTCPSG-TNYKV  218

Query  210  TFCP  199
            TFCP
Sbjct  219  TFCP  222



>gb|AAF82264.1| thaumatin-like protein [Vitis vinifera]
Length=226

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F    YCCTNGP  CGPT +S+FFK RCPDAYSYPQDD TSLF CP+G  ++ V
Sbjct  164  NNPCTVFKTNNYCCTNGPGSCGPTTYSKFFKDRCPDAYSYPQDDKTSLFTCPSG-VNYKV  222

Query  210  TFCP  199
            TFCP
Sbjct  223  TFCP  226



>ref|XP_007210079.1| hypothetical protein PRUPE_ppa019608mg, partial [Prunus persica]
 gb|EMJ11278.1| hypothetical protein PRUPE_ppa019608mg, partial [Prunus persica]
Length=128

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTN-GPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVT  208
            NNPCT F   QYCC N G CGPTDFSRFFK RCPDAYSYP+DD TS F CP G T++ V 
Sbjct  61   NNPCTVFKTDQYCCNNSGSCGPTDFSRFFKVRCPDAYSYPEDDQTSTFTCPTG-TNYRVV  119

Query  207  FCP  199
            FCP
Sbjct  120  FCP  122



>emb|CAC22329.1| osmotin-like protein [Fagus sylvatica]
Length=125

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FS+FFK RCPDAYSYPQDDPTS F CP G T++ V
Sbjct  63   NNPCTVFKTNEYCCTNGQGSCGPTRFSKFFKQRCPDAYSYPQDDPTSTFTCPGG-TNYRV  121

Query  210  TFCP  199
             FCP
Sbjct  122  VFCP  125



>gb|AGC39180.1| thaumatin-like protein [Actinidia deliciosa]
Length=228

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+G   CGPT FS+FFK RCPDAYSYPQDDPTSLF CP G T++ V
Sbjct  166  NNPCTVFKTNEYCCTDGQGTCGPTTFSKFFKDRCPDAYSYPQDDPTSLFTCPGG-TNYKV  224

Query  210  TFCP  199
             FCP
Sbjct  225  VFCP  228



>sp|P07052.1|PRR2_TOBAC RecName: Full=Pathogenesis-related protein R minor form; Short=PR-R; 
AltName: Full=PROB12; AltName: Full=Thaumatin-like protein 
E2; Flags: Precursor [Nicotiana tabacum]
 emb|CAA33292.1| thaumatin-like protein [Nicotiana tabacum]
 emb|CAA27548.1| unnamed protein product [Nicotiana tabacum]
 prf||1206322A protein,TMV induced
Length=226

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT     ++CCTNGP  CGPTD SRFFK RCPDAYSYPQDDP SLF CP G T++ V
Sbjct  164  NNPCTVIKTNEFCCTNGPGSCGPTDLSRFFKARCPDAYSYPQDDPPSLFTCPPG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>ref|XP_007040162.1| Osmotin 34 [Theobroma cacao]
 gb|EOY24663.1| Osmotin 34 [Theobroma cacao]
Length=224

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTDFSRFFKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  164  NNPCTVFRTDQYCCNSGNCRPTDFSRFFKTRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  222

Query  204  CP  199
            CP
Sbjct  223  CP  224



>ref|XP_002509748.1| Osmotin precursor, putative [Ricinus communis]
 gb|EEF51135.1| Osmotin precursor, putative [Ricinus communis]
Length=225

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FS+FFK RCPDAYSYPQDDP+S F CP+G T++ V
Sbjct  163  NNPCTVFKTNEYCCTNGQGSCGPTTFSKFFKDRCPDAYSYPQDDPSSTFTCPSG-TNYRV  221

Query  210  TFCP  199
            TFCP
Sbjct  222  TFCP  225



>gb|KCW77573.1| hypothetical protein EUGRSUZ_D01887 [Eucalyptus grandis]
Length=227

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT +S+FFKT+CPDAYSYPQDDPTS F CP+G T++ V
Sbjct  165  NNPCTVFKTNEYCCTNGQGSCGPTTYSQFFKTKCPDAYSYPQDDPTSTFTCPSG-TNYKV  223

Query  210  TFCP  199
            TFCP
Sbjct  224  TFCP  227



>ref|XP_008238906.1| PREDICTED: protein P21-like [Prunus mume]
Length=226

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTDFS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  166  NNPCTVFKTDQYCCNSGSCGPTDFSKFFKDRCPDAYSYPKDDQTSTFTCPTG-TNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>gb|AAN40692.1| thaumatin-like protein [Solanum aethiopicum]
Length=186

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCP  235
            NNPCT FGGQQYCCT GPC PTD SRFFK RCPDAYSYP+DD TS F CP
Sbjct  137  NNPCTRFGGQQYCCTQGPCDPTDLSRFFKQRCPDAYSYPKDDATSTFTCP  186



>emb|CAN65933.1| hypothetical protein VITISV_023047 [Vitis vinifera]
Length=225

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C  TD+SRFFKTRCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCSATDYSRFFKTRCPDAYSYPKDDQTSTFTCPAG-TNYEVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|AAV34889.2| osmotin-like [Theobroma cacao]
Length=204

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTDFSRFFKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  144  NNPCTVFRTDQYCCNSGNCRPTDFSRFFKTRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  202

Query  204  CP  199
            CP
Sbjct  203  CP  204



>ref|XP_004298786.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=226

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTS--LFNCPAGSTDFTV  211
            NNPCT F   +YCC +GPCGPTD+SRFFK+RCPDAYSYP+DD TS  +F+CP G T++ V
Sbjct  164  NNPCTVFRTNEYCCNSGPCGPTDYSRFFKSRCPDAYSYPKDDQTSTVVFSCPGG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>ref|XP_010676512.1| PREDICTED: protein P21-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010676517.1| PREDICTED: protein P21-like [Beta vulgaris subsp. vulgaris]
Length=228

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F    YCC +G CGPTD+S +FK+RCPDAYSYPQDD TS F CP G T++ VTF
Sbjct  168  NNPCTVFRTNMYCCNSGSCGPTDYSMYFKSRCPDAYSYPQDDATSTFTCPTG-TNYMVTF  226

Query  204  CP  199
            CP
Sbjct  227  CP  228



>emb|CAB36911.1| osmotin-like protein [Quercus suber]
Length=126

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT++S+FFK RCP+AYSYP+DDPTS F C AG T++ V F
Sbjct  66   NNPCTVFKNDQYCCNSGKCGPTNYSKFFKDRCPNAYSYPKDDPTSTFTCNAG-TNYKVVF  124

Query  204  CP  199
            CP
Sbjct  125  CP  126



>ref|XP_010906440.1| PREDICTED: thaumatin-like protein [Elaeis guineensis]
Length=184

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPT++SRFFK RCPDAYSYP+DD TS F CP G T++ VTF
Sbjct  124  NNPCTVFKTNEYCCNSGSCGPTNYSRFFKERCPDAYSYPKDDQTSTFTCPGG-TNYKVTF  182

Query  204  CP  199
            CP
Sbjct  183  CP  184



>ref|XP_011018223.1| PREDICTED: protein P21-like [Populus euphratica]
Length=263

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QY C +G CGPTD+SRFFK RCPDAYSYP+DD TS F CP G TD+ V F
Sbjct  203  NNPCTVFKTDQYGCNSGSCGPTDYSRFFKQRCPDAYSYPKDDQTSTFTCPGG-TDYRVVF  261

Query  204  CP  199
            CP
Sbjct  262  CP  263



>gb|KHN23669.1| Protein P21 [Glycine soja]
Length=95

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTD+SRFFK RCPDAYSYP+DDPTS F C  G T++ V F
Sbjct  35   NNPCTVFKTDQYCCNSGSCVPTDYSRFFKQRCPDAYSYPKDDPTSTFTCKGG-TNYRVVF  93

Query  204  CP  199
            CP
Sbjct  94   CP  95



>sp|P25096.1|P21_SOYBN RecName: Full=Protein P21 [Glycine max]
Length=202

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTD+SRFFK RCPDAYSYP+DDP S F C  G TD+ V F
Sbjct  142  NNPCTVFKTDQYCCNSGSCGPTDYSRFFKQRCPDAYSYPKDDPPSTFTCNGG-TDYRVVF  200

Query  204  CP  199
            CP
Sbjct  201  CP  202



>gb|KGN50135.1| hypothetical protein Csa_5G155460 [Cucumis sativus]
Length=225

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCT--NGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT FGG QYCCT  N  CGPTD+SRFFK RCPDAYSYP+DD TS F  P G T++ V
Sbjct  163  NNPCTVFGGDQYCCTDPNSSCGPTDYSRFFKDRCPDAYSYPKDDATSTFTSPGG-TNYRV  221

Query  210  TFCP  199
             FCP
Sbjct  222  VFCP  225



>gb|AAQ10092.1| thaumatin-like protein [Vitis vinifera]
Length=225

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C  TD+SRFFKTRCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCNATDYSRFFKTRCPDAYSYPKDDQTSTFTCPAG-TNYEVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|KCW61089.1| hypothetical protein EUGRSUZ_H03863 [Eucalyptus grandis]
Length=212

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  152  NNPCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  210

Query  204  CP  199
            CP
Sbjct  211  CP  212



>gb|AGC39181.1| thaumatin-like protein [Actinidia chinensis]
Length=228

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+GP  C PT +S+FFK RCPDAYSYPQDDPTSLF CP G T++ V
Sbjct  166  NNPCTVFKTNEYCCTDGPGSCEPTTYSKFFKDRCPDAYSYPQDDPTSLFTCPGG-TNYRV  224

Query  210  TFCP  199
             FCP
Sbjct  225  VFCP  228



>ref|XP_008238908.1| PREDICTED: protein P21-like [Prunus mume]
Length=225

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C PTDFSRFFK+RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCQPTDFSRFFKSRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>emb|CAN76134.1| hypothetical protein VITISV_001194 [Vitis vinifera]
Length=225

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F    YCC +G CGPTD+SR+FKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDXYCCNSGSCGPTDYSRYFKTRCPDAYSYPKDDXTSTFTCPGG-TNYDVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_002276431.1| PREDICTED: protein P21 [Vitis vinifera]
Length=237

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C  TDFSRFFKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCNATDFSRFFKTRCPDAYSYPKDDQTSTFTCPGG-TNYEVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_010024640.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW61091.1| hypothetical protein EUGRSUZ_H03865 [Eucalyptus grandis]
Length=225

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_010024638.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 ref|XP_010041217.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW44533.1| hypothetical protein EUGRSUZ_L01962 [Eucalyptus grandis]
 gb|KCW61090.1| hypothetical protein EUGRSUZ_H03864 [Eucalyptus grandis]
Length=225

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F CP+G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPSG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_007209565.1| hypothetical protein PRUPE_ppa011053mg [Prunus persica]
 gb|EMJ10764.1| hypothetical protein PRUPE_ppa011053mg [Prunus persica]
Length=225

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPTD SRFFK RCP AYSYP+DDPTS F CP G T++ V F
Sbjct  165  NNPCTVFRTDKYCCNSGSCGPTDLSRFFKDRCPSAYSYPKDDPTSTFTCPGG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|NP_001268131.1| thaumatin-like protein precursor [Vitis vinifera]
 gb|ABD64682.1| thaumatin-like protein [Vitis vinifera]
Length=225

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C  TD+SRFFKTRCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCDATDYSRFFKTRCPDAYSYPKDDQTSTFTCPAG-TNYEVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>dbj|BAO09560.1| osmotin, partial [Morus alba]
Length=231

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = -1

Query  381  NPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVT  208
            NPCT F   +YCCTNG   CGPT FSRFFK RCPDAYSYPQDDPTS F CP G T++ V 
Sbjct  154  NPCTVFKTNEYCCTNGYGSCGPTTFSRFFKQRCPDAYSYPQDDPTSTFTCPGG-TNYRVV  212

Query  207  FCP  199
            FCP
Sbjct  213  FCP  215



>gb|AAG34078.1|AF294846_1 PR5-like protein, partial [Capsicum annuum]
Length=180

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDP  256
            NNPCTTFGGQQYCCT GPCGPTD SRFFK RCPDAYSYPQDDP
Sbjct  138  NNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDP  180



>ref|XP_009397351.1| PREDICTED: protein P21-like [Musa acuminata subsp. malaccensis]
Length=223

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F  ++YCC +G CGPT++S FFK  CPDAYSYPQD PTSLF CP G T++ V F
Sbjct  161  NNPCTVFKTEEYCCNSGSCGPTNYSMFFKNLCPDAYSYPQDGPTSLFTCPGG-TNYRVVF  219

Query  204  CP  199
            CP
Sbjct  220  CP  221



>gb|KEH27441.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=241

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FSRFFK RC D+YSYPQDDPTS F CPAGS ++ V
Sbjct  163  NNPCTVFKTNEYCCTNGQGSCGPTKFSRFFKDRCHDSYSYPQDDPTSTFTCPAGS-NYKV  221

Query  210  TFCP  199
             FCP
Sbjct  222  VFCP  225



>ref|XP_010275299.1| PREDICTED: protein P21-like [Nelumbo nucifera]
Length=301

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT +   +YCC +G CGPT  SRFFK RCPDAYSYP+DDPTS F CP G T++ V F
Sbjct  219  NNPCTVYKTDEYCCNSGSCGPTPLSRFFKERCPDAYSYPKDDPTSTFTCPGG-TNYRVIF  277

Query  204  CP  199
            CP
Sbjct  278  CP  279



>gb|KDO63525.1| hypothetical protein CISIN_1g043196mg, partial [Citrus sinensis]
Length=227

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPT+FSRFFK RCPD YSYP+DD TS+F CP+G TD+ V F
Sbjct  160  NGPCHVFKTDKYCCNSGNCGPTNFSRFFKERCPDVYSYPKDDATSVFTCPSG-TDYKVVF  218

Query  204  CP  199
            CP
Sbjct  219  CP  220



>ref|XP_004503751.1| PREDICTED: protein P21-like isoform X1 [Cicer arietinum]
 ref|XP_004503752.1| PREDICTED: protein P21-like isoform X2 [Cicer arietinum]
Length=223

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPTD+SR+FKTRCPDAYSYP+DD TS F C  G T++ V F
Sbjct  163  NNPCTVFKTDEYCCNSGSCGPTDYSRYFKTRCPDAYSYPKDDQTSTFTCQGG-TNYRVVF  221

Query  204  CP  199
            CP
Sbjct  222  CP  223



>ref|XP_010520774.1| PREDICTED: osmotin-like protein OSM34 [Tarenaya hassleriana]
Length=243

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCT--NGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT   G CGPT +SRFFK RC D+YSYPQDDP+S F CP+GST++ V
Sbjct  163  NNPCTVFKTNEYCCTAGQGSCGPTPYSRFFKDRCRDSYSYPQDDPSSTFTCPSGSTNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>gb|KCW77577.1| hypothetical protein EUGRSUZ_D01892 [Eucalyptus grandis]
Length=225

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_002283064.1| PREDICTED: protein P21-like [Vitis vinifera]
Length=225

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F    YCC +G CGPTD+SR+FKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDPYCCNSGSCGPTDYSRYFKTRCPDAYSYPKDDQTSTFTCPGG-TNYDVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_010053313.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW77584.1| hypothetical protein EUGRSUZ_D01898 [Eucalyptus grandis]
Length=225

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFRTNQYCCYSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_009804118.1| PREDICTED: thaumatin-like protein [Nicotiana sylvestris]
Length=224

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            N+PCT F   +YCCTNGP  CGPTDFS+FFK RCPDAYSYP D+PTSL  CP+ +T++ V
Sbjct  162  NDPCTVFNTNEYCCTNGPGSCGPTDFSKFFKERCPDAYSYPLDEPTSLSTCPS-ATNYRV  220

Query  210  TFCP  199
             FCP
Sbjct  221  VFCP  224



>gb|EYU38379.1| hypothetical protein MIMGU_mgv1a013131mg [Erythranthe guttata]
Length=230

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT +SRFFK RCPDAYSYPQDDP+S F CP G T++ V
Sbjct  168  NNPCTVFRTNEYCCTNGQGSCGPTGYSRFFKDRCPDAYSYPQDDPSSTFTCPGG-TNYRV  226

Query  210  TFCP  199
             FCP
Sbjct  227  VFCP  230



>gb|AIR93920.1| thaumatin [Cicer arietinum]
Length=241

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   +YCCTNG   CGPT FSRFFK RC DAYSYPQDDPTS F CPAGS ++ V
Sbjct  163  NNPCTVYKTNEYCCTNGQGSCGPTYFSRFFKDRCHDAYSYPQDDPTSTFTCPAGS-NYKV  221

Query  210  TFCP  199
             FCP
Sbjct  222  VFCP  225



>ref|XP_003525411.1| PREDICTED: PR-5 protein [Glycine max]
Length=222

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTD+SRFFK RCPDAYSYP+DDPTS F C  G T++ V F
Sbjct  162  NNPCTVFKTDQYCCNSGSCVPTDYSRFFKQRCPDAYSYPKDDPTSTFTCKGG-TNYRVVF  220

Query  204  CP  199
            CP
Sbjct  221  CP  222



>gb|AAK59275.1|AF378571_1 thaumatin-like protein [Sambucus nigra]
Length=226

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   +YCCTNG   CGPT+FSRFFK RC DAYSYPQDDPTS F CP G T++ V
Sbjct  164  NNPCTVYRTNEYCCTNGQGTCGPTNFSRFFKERCRDAYSYPQDDPTSTFTCPGG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>dbj|BAF95882.1| putative thaumatin-like protein [Vitis hybrid cultivar]
Length=222

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+GP  CGPT +S+FFK RCPDAYSYPQDD TSLF C +G T++ V
Sbjct  160  NNPCTVFKTNEYCCTDGPGSCGPTTYSKFFKDRCPDAYSYPQDDKTSLFTCTSG-TNYKV  218

Query  210  TFCP  199
            TFCP
Sbjct  219  TFCP  222



>gb|KDP46638.1| hypothetical protein JCGZ_04572 [Jatropha curcas]
Length=227

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTD+SRFFK RC DAYSYP+DD TS F CP G T++ V F
Sbjct  167  NNPCTVFKTDQYCCNSGNCGPTDYSRFFKDRCRDAYSYPKDDQTSTFTCPGG-TNYKVVF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>ref|NP_001268061.1| VVTL1 precursor [Vitis vinifera]
 emb|CAB85637.1| putative thaumatin-like protein [Vitis vinifera]
Length=222

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+GP  CGPT +S+FFK RCPDAYSYPQDD TSLF C +G T++ V
Sbjct  160  NNPCTVFKTNEYCCTDGPGSCGPTTYSKFFKDRCPDAYSYPQDDKTSLFTCTSG-TNYKV  218

Query  210  TFCP  199
            TFCP
Sbjct  219  TFCP  222



>emb|CAN74833.1| hypothetical protein VITISV_004208 [Vitis vinifera]
Length=224

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F    YCC +G CGPTD+SR+FKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  164  NNPCTVFKTDPYCCNSGSCGPTDYSRYFKTRCPDAYSYPKDDQTSTFTCPGG-TNYDVIF  222

Query  204  CP  199
            CP
Sbjct  223  CP  224



>ref|NP_001235877.1| PR-5b protein precursor [Glycine max]
 dbj|BAH01715.1| PR-5 protein [Glycine max]
Length=240

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT++SRFFK RC D+YSYPQDDPTS F CPAGS ++ V
Sbjct  161  NNPCTVFKTNEYCCTNGQGSCGPTNYSRFFKDRCHDSYSYPQDDPTSTFTCPAGS-NYKV  219

Query  210  TFCP  199
             FCP
Sbjct  220  VFCP  223



>ref|XP_008238907.1| PREDICTED: protein P21-like [Prunus mume]
Length=226

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTDFS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  166  NNPCTVFKTDQYCCNSGSCSPTDFSKFFKDRCPDAYSYPKDDQTSTFTCPTG-TNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>ref|XP_004304709.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=229

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPTD+SRFFKTRC  AYSYP+DD TS F CP G T++ V F
Sbjct  169  NNPCTVFKTDQYCCNSGNCGPTDYSRFFKTRCSGAYSYPKDDATSTFTCPGG-TNYRVVF  227

Query  204  CP  199
            CP
Sbjct  228  CP  229



>gb|KCW77579.1| hypothetical protein EUGRSUZ_D01894 [Eucalyptus grandis]
Length=243

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +  CGPT+FS+FFK RCPDA+SYP DD TS F CPAG T++ V F
Sbjct  171  NNPCTVFKTDQYCCNSASCGPTNFSKFFKDRCPDAFSYPMDDQTSTFTCPAG-TNYRVVF  229

Query  204  CP  199
            CP
Sbjct  230  CP  231



>emb|CAB85636.1| putative thaumatin-like protein [Vitis vinifera]
Length=190

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C  TD+SRFFKTRCPDAYSYP+DD TS F CP G T++ V F
Sbjct  130  NNPCTVFKTDEYCCNSGSCNATDYSRFFKTRCPDAYSYPKDDQTSTFTCPTG-TNYEVVF  188

Query  204  CP  199
            CP
Sbjct  189  CP  190



>ref|XP_010676518.1| PREDICTED: protein P21-like [Beta vulgaris subsp. vulgaris]
Length=227

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F    YCC +G CGPTD+SR+FK +CPDAYSYP+DD TS F CP G T++ VTF
Sbjct  167  NNPCTVFKTDNYCCNSGSCGPTDYSRYFKGKCPDAYSYPKDDATSTFTCPTG-TNYMVTF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>ref|XP_010676513.1| PREDICTED: protein P21-like [Beta vulgaris subsp. vulgaris]
Length=284

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F    YCC +G CGPTD+SR+FK +CPDAYSYP+DD TS F CP G T++ VTF
Sbjct  224  NNPCTVFKTDNYCCNSGNCGPTDYSRYFKGKCPDAYSYPKDDATSTFTCPTG-TNYMVTF  282

Query  204  CP  199
            CP
Sbjct  283  CP  284



>ref|XP_009406738.1| PREDICTED: protein P21-like [Musa acuminata subsp. malaccensis]
Length=221

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PT++S+FFK+ CPDAYSYP+DDPTSL  CP G T++ V F
Sbjct  161  NNPCTVFKTDQYCCNSGSCQPTEYSKFFKSNCPDAYSYPKDDPTSLVACPGG-TNYRVVF  219

Query  204  CP  199
            CP
Sbjct  220  CP  221



>ref|XP_007040164.1| Osmotin 34 [Theobroma cacao]
 gb|EOY24665.1| Osmotin 34 [Theobroma cacao]
Length=224

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F  +++CC +G CGPT+FS+FFK RCPDAYSYP+DDPTSLF CP G T++ V F
Sbjct  164  NGPCPVFKTEEHCCNSGNCGPTNFSKFFKDRCPDAYSYPKDDPTSLFTCPTG-TNYKVIF  222

Query  204  CP  199
            CP
Sbjct  223  CP  224



>sp|P81370.2|TLP_ACTDE RecName: Full=Thaumatin-like protein; AltName: Allergen=Act d 
2; Flags: Precursor [Actinidia deliciosa]
 emb|CAI38795.2| thaumatin-like protein [Actinidia deliciosa]
 gb|AGC39175.1| thaumatin-like protein [Actinidia deliciosa]
Length=225

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CG T+FS+FFK RCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGNCGLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_003611130.1| Pathogenesis-related thaumatin-like protein [Medicago truncatula]
Length=453

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FSRFFK RC D+YSYPQDDPTS F CPAGS ++ V
Sbjct  375  NNPCTVFKTNEYCCTNGQGSCGPTKFSRFFKDRCHDSYSYPQDDPTSTFTCPAGS-NYKV  433

Query  210  TFCP  199
             FCP
Sbjct  434  VFCP  437


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 12/71 (17%)
 Frame = -1

Query  384  NNPCTTFGGQQYCC-----------TNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNC  238
            NNPCTTF   +YCC            +  CGPT +S+FFK RCP AYSYP+DD TS F+C
Sbjct  165  NNPCTTFDTTEYCCNSDSARSAATNASATCGPTTYSKFFKDRCPYAYSYPKDDATSTFSC  224

Query  237  PAGSTDFTVTF  205
              G+T + V F
Sbjct  225  MGGTT-YDVVF  234



>gb|KCW77588.1| hypothetical protein EUGRSUZ_D01904 [Eucalyptus grandis]
Length=225

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_010906392.1| PREDICTED: thaumatin-like protein [Elaeis guineensis]
Length=164

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPT++S+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  104  NNPCTVFKTNEYCCNSGGCGPTNYSKFFKNRCPDAYSYPKDDQTSTFTCPGG-TNYKVIF  162

Query  204  CP  199
            CP
Sbjct  163  CP  164



>gb|ADO32898.1| thaumatin-like protein [Vincetoxicum mongolicum]
Length=225

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PT+FS FFK RCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGRCSPTNFSSFFKKRCPDAYSYPKDDQTSTFTCPAG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>pdb|4JRU|A Chain A, Structure Of Haze Forming Proteins In White Wines: Vitis 
Vinifera Thaumatin-like Proteins
Length=201

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C  TD+SRFFKTRCPDAYSYP+DD TS F C AG T++ V F
Sbjct  141  NNPCTVFKTDEYCCNSGSCSATDYSRFFKTRCPDAYSYPKDDQTSTFTCTAG-TNYEVVF  199

Query  204  CP  199
            CP
Sbjct  200  CP  201



>ref|XP_002869791.1| hypothetical protein ARALYDRAFT_914296 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46050.1| hypothetical protein ARALYDRAFT_914296 [Arabidopsis lyrata subsp. 
lyrata]
Length=231

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC     +++CC +G CGPT  SRFFK RCPDAYSYP+DDPTSLF CPAG T++ V F
Sbjct  171  NGPCPVLKTEEHCCNSGNCGPTPLSRFFKQRCPDAYSYPKDDPTSLFTCPAG-TNYNVIF  229

Query  204  CP  199
            CP
Sbjct  230  CP  231



>emb|CAA09228.1| thaumatin-like protein PR-5b [Cicer arietinum]
Length=239

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   +YCCTNG   CGPT+FS FFK RC DAYSYPQDDPTS F CPAGS ++ V
Sbjct  161  NNPCTVYKTNEYCCTNGQGSCGPTNFSTFFKDRCHDAYSYPQDDPTSTFTCPAGS-NYKV  219

Query  210  TFCP  199
             FCP
Sbjct  220  VFCP  223



>pdb|4BCT|A Chain A, Crystal Structure Of Kiwi-fruit Allergen Act D 2
Length=201

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CG T+FS+FFK RCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  141  NNPCTVFKTDQYCCNSGNCGLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAG-TNYKVVF  199

Query  204  CP  199
            CP
Sbjct  200  CP  201



>gb|KDP25478.1| hypothetical protein JCGZ_20634 [Jatropha curcas]
Length=225

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPTD+SRFFK RC DAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCGPTDYSRFFKDRCGDAYSYPKDDQTSTFTCPGG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|AEB77709.1| thaumatin-like protein [Litchi chinensis]
Length=223

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -1

Query  378  PCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTFCP  199
            PC  F   ++CC +G CGPTDFSRFFK RCPD YSYP+DD TS+F CP+G TD+ V FCP
Sbjct  165  PCWVFKTNEHCCNSGSCGPTDFSRFFKDRCPDVYSYPKDDATSVFTCPSG-TDYKVVFCP  223



>emb|CDP16244.1| unnamed protein product [Coffea canephora]
Length=644

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 3/62 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNGP  C PTDFSRFFK RCPDAYSYPQDDPTSLF CP+G T++ V
Sbjct  379  NNPCTVFHTNEYCCTNGPGSCHPTDFSRFFKDRCPDAYSYPQDDPTSLFTCPSG-TNYRV  437

Query  210  TF  205
             +
Sbjct  438  VY  439


 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGS  226
            NNPCT F   +YCCTNG   CGPTDFSRFFK+RCPDAYSYPQDD TSLFNCP+G+
Sbjct  162  NNPCTVFKTNEYCCTNGQGSCGPTDFSRFFKSRCPDAYSYPQDDRTSLFNCPSGT  216


 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP-CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVT  208
            NNPCT F   +YCCT GP CGPT FS F K RCPDAY  P+DDPTSLF CP+G T++ V 
Sbjct  583  NNPCTVFNTTEYCCTGGPSCGPTFFSTFCKGRCPDAYCDPRDDPTSLFTCPSG-TNYRVV  641

Query  207  FCP  199
            FCP
Sbjct  642  FCP  644



>gb|ABD64681.1| thaumatin-like protein [Vitis vinifera]
Length=225

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C  TD+SRFFKTRCPDAYSYP+DD TS F C AG T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCSATDYSRFFKTRCPDAYSYPKDDQTSTFTCTAG-TNYEVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma 
cacao]
 gb|EOY20403.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma 
cacao]
Length=245

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTD+S+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  185  NNPCTVFKTDQYCCNSGNCSPTDYSKFFKDRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  243

Query  204  CP  199
            CP
Sbjct  244  CP  245



>ref|XP_002299547.2| P21 family protein [Populus trichocarpa]
 gb|EEE84352.2| P21 family protein [Populus trichocarpa]
Length=245

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPC+ F   +YCCTNG   CGPT FSRFFK RCP +YSYPQDDPTS F CP G T++ V
Sbjct  166  NNPCSVFKTNEYCCTNGQGSCGPTKFSRFFKDRCPTSYSYPQDDPTSTFTCPGG-TNYRV  224

Query  210  TFCP  199
             FCP
Sbjct  225  IFCP  228



>ref|XP_007158474.1| hypothetical protein PHAVU_002G155500g [Phaseolus vulgaris]
 gb|ESW30468.1| hypothetical protein PHAVU_002G155500g [Phaseolus vulgaris]
Length=242

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   +YCCTNG   CGPT +SRFFK RC DAYSYPQDDPTS F CPAGS ++ V
Sbjct  164  NNPCTVYKTNEYCCTNGQGTCGPTTYSRFFKDRCRDAYSYPQDDPTSTFTCPAGS-NYKV  222

Query  210  TFCP  199
             FCP
Sbjct  223  LFCP  226



>ref|XP_004298781.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=226

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTS--LFNCPAGSTDFTV  211
            NN CT F   QYCC +G CGPTD+SRFFK RCPDAYSYP+DD TS  LF CP G T++ V
Sbjct  164  NNACTVFKTDQYCCNSGHCGPTDYSRFFKQRCPDAYSYPKDDETSTVLFTCPGG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>ref|XP_007040165.1| Osmotin 34 [Theobroma cacao]
 gb|EOY24666.1| Osmotin 34 [Theobroma cacao]
Length=240

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   ++CCT G   CGPTDFSRFFK+RCPD+YSYPQDDP+S F C AG  ++ V
Sbjct  163  NNPCTVFKTNEFCCTQGYGTCGPTDFSRFFKSRCPDSYSYPQDDPSSTFTC-AGGANYRV  221

Query  210  TFCP  199
             FCP
Sbjct  222  VFCP  225



>ref|XP_006368746.1| P21 family protein [Populus trichocarpa]
 gb|ERP65315.1| P21 family protein [Populus trichocarpa]
Length=225

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPT FS++FK RCPDAYSYP+DDPTSLF CP G T++ V F
Sbjct  165  NGPCPVFKTDEYCCNSGTCGPTTFSKYFKERCPDAYSYPKDDPTSLFTCPTG-TNYKVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_011029220.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=225

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPT FS++FK RCPDAYSYP+DDPTSLF CP G T++ V F
Sbjct  165  NGPCPVFKTDEYCCNSGSCGPTPFSKYFKERCPDAYSYPKDDPTSLFTCPTG-TNYKVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_006453440.1| hypothetical protein CICLE_v10010751mg [Citrus clementina]
 ref|XP_006474140.1| PREDICTED: thaumatin-like protein-like [Citrus sinensis]
 gb|ESR66680.1| hypothetical protein CICLE_v10010751mg [Citrus clementina]
 gb|KDO62433.1| hypothetical protein CISIN_1g027329mg [Citrus sinensis]
Length=225

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PT+FS+FFK RCP+AYSYP+DD TS F CP G T++ VTF
Sbjct  165  NNPCTVFKTDQYCCNSGKCVPTNFSKFFKQRCPNAYSYPKDDQTSTFTCPGG-TNYKVTF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_010055609.1| PREDICTED: protein P21-like [Eucalyptus grandis]
Length=226

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPTD+SR+FK RCPDAYSYP+DD TS+F CP G T++ V F
Sbjct  166  NGPCPIFKTDEYCCNSGSCGPTDYSRYFKDRCPDAYSYPKDDATSVFTCPGG-TNYKVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>ref|XP_004511592.1| PREDICTED: thaumatin-like protein-like [Cicer arietinum]
Length=444

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   +YCCTNG   CGPT FSRFFK RC DAYSYPQDDPTS F CPAGS ++ V
Sbjct  366  NNPCTVYKTNEYCCTNGQGSCGPTYFSRFFKDRCHDAYSYPQDDPTSTFTCPAGS-NYKV  424

Query  210  TFCP  199
             FCP
Sbjct  425  VFCP  428


 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            +NPCT F   +YCCT+G   C PT +S+FFK RCP  YSYP+DD TS F C  G T++ +
Sbjct  165  HNPCTKFNTTEYCCTSGSATCSPTTYSKFFKDRCPYTYSYPKDDATSTFTC-MGGTNYDI  223

Query  210  TF  205
             F
Sbjct  224  VF  225



>ref|XP_008369460.1| PREDICTED: protein P21 [Malus domestica]
Length=225

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTDFSRFFK  CPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGTCDPTDFSRFFKNLCPDAYSYPKDDATSTFTCPTG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>emb|CDP09786.1| unnamed protein product [Coffea canephora]
Length=225

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C  TD+SRFFKTRCPDAYSYP+DD TS F C  G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGSCSATDYSRFFKTRCPDAYSYPKDDQTSTFTCRGG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>pdb|4L2J|A Chain A, Crystal Structure Of Osmotin, An Antifungal Laticifer 
Protein
Length=206

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPT +SRFFK RC DAYSYP+DDPTS F CP+G T++ V F
Sbjct  144  NNPCTVFKTDKYCCNSGSCGPTTYSRFFKERCWDAYSYPKDDPTSTFTCPSG-TNYRVIF  202

Query  204  CP  199
            CP
Sbjct  203  CP  204



>ref|XP_009406737.1| PREDICTED: protein P21-like [Musa acuminata subsp. malaccensis]
Length=226

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PTD+SRFFK  CPDAYSYP+DD TS F CP G T++ V F
Sbjct  166  NNPCTVFKTDQYCCNSGSCSPTDYSRFFKRNCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  224

Query  204  CP  199
            CP
Sbjct  225  CP  226



>gb|AHA83528.1| osmotin-like protein [Hevea brasiliensis]
Length=246

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT G   CGPT+FS+FFK+RC DAYSYPQDDP+S F CP G T++ V
Sbjct  167  NNPCTVFKTNKYCCTEGYGSCGPTEFSKFFKSRCSDAYSYPQDDPSSTFTCPGG-TNYRV  225

Query  210  TFCP  199
             FCP
Sbjct  226  VFCP  229



>gb|AFK40174.1| unknown [Lotus japonicus]
Length=243

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   ++CCTNG   CGPT+FSRFFK RC D+YSYPQDDPTS F CPAGS ++ V
Sbjct  163  NNPCTVYKTNEFCCTNGQGTCGPTNFSRFFKDRCHDSYSYPQDDPTSTFTCPAGS-NYKV  221

Query  210  TFCP  199
             FCP
Sbjct  222  VFCP  225



>emb|CDP09784.1| unnamed protein product [Coffea canephora]
Length=225

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C  TD+S+FFK RCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGSCSATDYSKFFKDRCPDAYSYPKDDQTSTFTCPAG-TNYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_006396874.1| hypothetical protein EUTSA_v10028948mg [Eutrema salsugineum]
 dbj|BAJ34101.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38327.1| hypothetical protein EUTSA_v10028948mg [Eutrema salsugineum]
Length=222

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   QYCCTNG   CG T+FSRFFK RCPDAYSYPQDDP+S F C   +T++ V
Sbjct  160  NNPCTVFKTNQYCCTNGQGSCGATEFSRFFKQRCPDAYSYPQDDPSSTFTCT--NTNYRV  217

Query  210  TFCP  199
             FCP
Sbjct  218  VFCP  221



>ref|XP_006440574.1| hypothetical protein CICLE_v10022104mg [Citrus clementina]
 gb|ESR53814.1| hypothetical protein CICLE_v10022104mg [Citrus clementina]
 gb|KDO38995.1| hypothetical protein CISIN_1g027335mg [Citrus sinensis]
Length=225

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F  +++CC +G CGPT FSRFFK RCPDAYSYP+DD TS+F CP G T++ V F
Sbjct  165  NGPCPVFKTEEHCCNSGKCGPTKFSRFFKERCPDAYSYPKDDATSVFTCPGG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_006477593.1| PREDICTED: uncharacterized protein LOC102624118 [Citrus sinensis]
Length=489

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPT+FSRFFK RCPD YSYP+DD TS+F CP+G TD+ V F
Sbjct  160  NGPCHVFKTDKYCCNSGNCGPTNFSRFFKERCPDVYSYPKDDATSVFTCPSG-TDYKVVF  218

Query  204  CP  199
            CP
Sbjct  219  CP  220


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCT--NGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   Q+CC      CG T +S+ FK  CP+ Y+YP DDP S   CP G T + V
Sbjct  427  NNPCTLFKNDQFCCNVDRRSCGATAYSKIFKNLCPNVYTYPMDDPASTLACPTG-TGYKV  485

Query  210  TFCP  199
             FCP
Sbjct  486  VFCP  489



>ref|XP_006477434.1| PREDICTED: osmotin [Citrus sinensis]
Length=225

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F  +++CC +G CGPT FSRFFK RCPDAYSYP+DD TS+F CP G T++ V F
Sbjct  165  NGPCPVFKTEEHCCNSGKCGPTKFSRFFKERCPDAYSYPKDDATSVFTCPGG-TNYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|ABK96488.1| unknown [Populus trichocarpa x Populus deltoides]
Length=117

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FSRFFK RCP +YSYPQDDP+S F CP G T++ V
Sbjct  38   NNPCTVFKTNEYCCTNGQGSCGPTYFSRFFKDRCPTSYSYPQDDPSSTFTCPGG-TNYRV  96

Query  210  TFCP  199
             FCP
Sbjct  97   IFCP  100



>ref|XP_006440577.1| hypothetical protein CICLE_v10023839mg, partial [Citrus clementina]
 gb|ESR53817.1| hypothetical protein CICLE_v10023839mg, partial [Citrus clementina]
Length=227

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPTD S+FFK RCPD YSYP+DDPTS F CP+G T++ V F
Sbjct  160  NGPCPVFKTNEYCCNSGNCGPTDLSKFFKDRCPDVYSYPKDDPTSTFTCPSG-TNYEVVF  218

Query  204  CP  199
            CP
Sbjct  219  CP  220



>gb|AFK29763.1| thaumatin-like protein [Musa acuminata]
Length=243

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCCT+G CGPT +S+FFK+ CPDAYSYP+DD TS F CP G+ D+ V F
Sbjct  154  NNPCTVFKTDEYCCTSGSCGPTTYSKFFKSNCPDAYSYPKDDATSTFTCP-GNGDYKVIF  212

Query  204  CP  199
            CP
Sbjct  213  CP  214



>ref|XP_010055611.1| PREDICTED: protein P21-like [Eucalyptus grandis]
 gb|KCW72119.1| hypothetical protein EUGRSUZ_E00560 [Eucalyptus grandis]
Length=235

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F  +++CC +G CGPTD+SR+FK RCPDAYSYP+DD TS+F CP G T++ V F
Sbjct  175  NGPCPIFKTEEHCCNSGSCGPTDYSRYFKDRCPDAYSYPKDDATSVFTCPGG-TNYKVVF  233

Query  204  CP  199
            CP
Sbjct  234  CP  235



>gb|KCW77586.1| hypothetical protein EUGRSUZ_D01900 [Eucalyptus grandis]
Length=231

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F C AG TD+ V F
Sbjct  165  NGPCAVFRTDEYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDLTSTFTCRAG-TDYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>emb|CAC22342.1| osmotin-like protein [Quercus robur]
Length=124

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPT++S+FFK RCPDAYSYP+DD TS F C  G T++ V F
Sbjct  64   NNPCTVFKTDEYCCNSGSCGPTNYSKFFKDRCPDAYSYPKDDQTSTFTCKGG-TNYRVVF  122

Query  204  CP  199
            CP
Sbjct  123  CP  124



>ref|XP_010906165.1| PREDICTED: thaumatin-like protein [Elaeis guineensis]
Length=255

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G CGPT +SRFFK RCPDAYSYP DD  S F CP G T++ VTF
Sbjct  195  NNPCTVFKTNEYCCNSGSCGPTFYSRFFKDRCPDAYSYPMDDQNSTFTCPGG-TNYKVTF  253

Query  204  CP  199
            CP
Sbjct  254  CP  255



>gb|ABB86297.1| thaumatin-like protein isoform 1 [Ficus pumila var. awkeotsang]
Length=244

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = -1

Query  381  NPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVT  208
            NPCT F   ++CCTNG   CGPT+FS+FFK RC DAYSYPQDDPTS F CPAG+ ++ V 
Sbjct  166  NPCTVFKTNEFCCTNGQGSCGPTNFSKFFKDRCRDAYSYPQDDPTSTFTCPAGA-NYKVV  224

Query  207  FCP  199
            FCP
Sbjct  225  FCP  227



>gb|ABQ42566.1| thaumatin-like protein [Actinidia deliciosa]
Length=201

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   Q+CC +G CG T+FS+FFK RCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  141  NNPCTVFKTDQFCCNSGNCGLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAG-TNYKVVF  199

Query  204  CP  199
            CP
Sbjct  200  CP  201



>ref|XP_002509750.1| Osmotin precursor, putative [Ricinus communis]
 gb|EEF51137.1| Osmotin precursor, putative [Ricinus communis]
Length=225

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F  +++CC +G C PT FSR+FK RCPDAYSYP+DDPTSLF CP G T++ V F
Sbjct  165  NGPCPVFKTEEHCCNSGNCSPTTFSRYFKERCPDAYSYPKDDPTSLFTCPTG-TNYKVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_010529553.1| PREDICTED: pathogenesis-related protein R major form-like [Tarenaya 
hassleriana]
Length=232

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC     +++CC +G C PTD SRFFK RCPDAYSYP+DDPTSLF CP G T++ V F
Sbjct  172  NGPCPVLKTEEHCCNSGNCQPTDLSRFFKQRCPDAYSYPKDDPTSLFTCPTG-TNYKVIF  230

Query  204  CP  199
            CP
Sbjct  231  CP  232



>ref|XP_009419440.1| PREDICTED: protein P21-like [Musa acuminata subsp. malaccensis]
Length=241

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCCT+G CGPT++S FFK+ CPDAYSYP+DD TS F CP G+ D+ V F
Sbjct  161  NNPCTVFKTDEYCCTSGSCGPTNYSNFFKSNCPDAYSYPKDDATSTFTCP-GNGDYKVIF  219

Query  204  CP  199
            CP
Sbjct  220  CP  221



>gb|AAQ22606.1| At4g11650 [Arabidopsis thaliana]
 dbj|BAF00218.1| osmotin precursor like protein [Arabidopsis thaliana]
Length=244

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   QYCCTNG   C  T++SRFFK RCPDAYSYPQDDPTS+F C   +T++ V
Sbjct  162  NNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSIFTCT--NTNYRV  219

Query  210  TFCP  199
             FCP
Sbjct  220  VFCP  223



>ref|XP_009409806.1| PREDICTED: protein P21-like [Musa acuminata subsp. malaccensis]
Length=221

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCCT+G CGPT++S FFK  CPDAYSYP+DD TS F CP G T++ V F
Sbjct  161  NNPCTVFKTDEYCCTSGSCGPTNYSMFFKNNCPDAYSYPKDDATSTFTCPGG-TNYRVVF  219

Query  204  CP  199
            CP
Sbjct  220  CP  221



>ref|XP_011029221.1| PREDICTED: osmotin-like protein OSM34 [Populus euphratica]
Length=246

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPC+ F   +YCCTNG   CGPT FSRFFK RCP +YSYPQDDP+S F CP G T++ V
Sbjct  167  NNPCSVFKTNEYCCTNGQGSCGPTHFSRFFKDRCPTSYSYPQDDPSSTFTCPGG-TNYRV  225

Query  210  TFCP  199
             FCP
Sbjct  226  IFCP  229



>ref|XP_011029305.1| PREDICTED: osmotin-like protein OSM34 [Populus euphratica]
Length=246

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FSRFFK RCP +YSYPQDDP+S F CP G T++ V
Sbjct  167  NNPCTVFKTNEYCCTNGQGSCGPTYFSRFFKDRCPTSYSYPQDDPSSTFTCPGG-TNYRV  225

Query  210  TFCP  199
             FCP
Sbjct  226  VFCP  229



>emb|CAE54084.1| taumatin [Fagus sylvatica]
Length=156

 Score = 82.0 bits (201),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G C PT++SRFFK RCPDAYSYP+DDPTS F C  G T++ V F
Sbjct  86   NNPCTVFKTDQYCCNSGSCRPTNYSRFFKVRCPDAYSYPKDDPTSTFTC-NGGTNYKVVF  144

Query  204  C  202
            C
Sbjct  145  C  145



>ref|XP_009782417.1| PREDICTED: protein P21-like [Nicotiana sylvestris]
Length=230

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F    YCC  G CGPT+FS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  170  NNPCTIFKTDNYCCNYGNCGPTEFSKFFKDRCPDAYSYPKDDQTSTFACPTG-TNYRVVF  228

Query  204  CP  199
            CP
Sbjct  229  CP  230



>ref|XP_010042867.1| PREDICTED: thaumatin-like protein, partial [Eucalyptus grandis]
Length=227

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F C AG TD+ V F
Sbjct  165  NGPCAVFRTDEYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDLTSTFTCRAG-TDYRVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_007158473.1| hypothetical protein PHAVU_002G155400g [Phaseolus vulgaris]
 gb|ESW30467.1| hypothetical protein PHAVU_002G155400g [Phaseolus vulgaris]
Length=225

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT+G   CGPTD+S+FFK RCPDAYSYP DD TS F C  GS D+ V
Sbjct  163  NNPCTVFNTTEYCCTSGASGCGPTDYSKFFKERCPDAYSYPMDDATSTFTCMGGS-DYRV  221

Query  210  TFCP  199
             FCP
Sbjct  222  VFCP  225



>gb|AAM61750.1| osmotin precursor [Arabidopsis thaliana]
Length=244

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   QYCCTNG   C  TD+SRFFK RCPDAYSYPQDDPTS F C   +T++ V
Sbjct  162  NNPCTVFQTNQYCCTNGQGSCSDTDYSRFFKQRCPDAYSYPQDDPTSTFTCT--NTNYRV  219

Query  210  TFCP  199
             FCP
Sbjct  220  VFCP  223



>ref|XP_010255471.1| PREDICTED: protein P21 [Nelumbo nucifera]
Length=227

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT +   QYCC +G CGPT  S+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  167  NNPCTVYKTDQYCCNSGSCGPTPLSQFFKQRCPDAYSYPKDDATSTFTCPGG-TNYRVVF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>emb|CAA71883.1| osmotin-like protein [Vitis vinifera]
Length=225

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   +YCC +G C  T +S FFKTRCPDAYSYP+DD TS F CPAG T++ V F
Sbjct  165  NNPCTVFKTDEYCCNSGSCNATTYSEFFKTRCPDAYSYPKDDQTSTFTCPAG-TNYEVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_011016810.1| PREDICTED: osmotin-like protein OSM34, partial [Populus euphratica]
Length=243

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FSRFFK RCP +YSYPQDDP+S F CP G T++ V
Sbjct  164  NNPCTVFKTNEYCCTNGQGSCGPTYFSRFFKDRCPTSYSYPQDDPSSTFTCPGG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>gb|AAQ74156.1| osmotin-like protein I [Gossypium hirsutum]
Length=242

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT G   CGPT +SRFFK RC D+YSYPQDDP+S F CPAGS ++ V
Sbjct  164  NNPCTVFKTNEYCCTQGYGTCGPTRYSRFFKDRCRDSYSYPQDDPSSTFTCPAGS-NYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>gb|ACZ67185.1| pathogenesis-related thaumatin, partial [Populus deltoides]
Length=241

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FSRFFK RCP +YSYPQDDP+S F CP G T++ V
Sbjct  167  NNPCTVFKTNEYCCTNGQGSCGPTYFSRFFKDRCPTSYSYPQDDPSSTFTCPGG-TNYRV  225

Query  210  TFCP  199
             FCP
Sbjct  226  IFCP  229



>emb|CAC22330.1| osmotin-like protein [Fagus sylvatica]
Length=125

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT +   +YCCT+GP  CGPT +S+FFK RCPDAYSYPQDD TS F CP G T++ V
Sbjct  63   NNPCTVYKTNEYCCTDGPGSCGPTTYSKFFKDRCPDAYSYPQDDKTSTFPCPTG-TNYRV  121

Query  210  TFCP  199
             FCP
Sbjct  122  VFCP  125



>gb|AAQ14497.1|AF304007_1 osmotin-like protein [Gossypium hirsutum]
Length=242

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT G   CGPT FSRFFK RC D+YSYPQDDP+S F CPAGS ++ V
Sbjct  164  NNPCTVFKTNEYCCTQGYGTCGPTYFSRFFKDRCHDSYSYPQDDPSSTFTCPAGS-NYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>ref|XP_010053306.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
Length=433

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +  CGPT+FS+FFK RCPDA+SYP DD TS F CPAG T++ V F
Sbjct  171  NNPCTVFKTDQYCCNSASCGPTNFSKFFKDRCPDAFSYPMDDQTSTFTCPAG-TNYRVVF  229

Query  204  CP  199
            CP
Sbjct  230  CP  231


 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 4/63 (6%)
 Frame = -1

Query  381  NPCTTFGGQQYCCTNGP--CGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVT  208
            +PCT F   +YCC N    CG T +S+FFK RCPDA+SYP+DDP + F CP G T++TVT
Sbjct  373  DPCTVFRTTKYCCNNASESCGSTAYSQFFKDRCPDAFSYPRDDPAT-FTCPGG-TNYTVT  430

Query  207  FCP  199
            FCP
Sbjct  431  FCP  433



>gb|AAQ13823.1|AF192271_1 osmotin-like pathogenesis-related protein [Gossypium hirsutum]
Length=238

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT G   CGPT +SRFFK RC D+YSYPQDDP+S F CPAGS ++ V
Sbjct  160  NNPCTVFKTNEYCCTQGYGTCGPTRYSRFFKDRCRDSYSYPQDDPSSTFTCPAGS-NYRV  218

Query  210  TFCP  199
             FCP
Sbjct  219  VFCP  222



>ref|XP_002299521.2| hypothetical protein POPTR_0001s09570g [Populus trichocarpa]
 gb|EEE84326.2| hypothetical protein POPTR_0001s09570g [Populus trichocarpa]
Length=246

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCTNG   CGPT FSRFFK RCP +YSYPQDDP+S F CP G T++ V
Sbjct  167  NNPCTVFKTNEYCCTNGQGSCGPTYFSRFFKDRCPTSYSYPQDDPSSTFTCPGG-TNYRV  225

Query  210  TFCP  199
             FCP
Sbjct  226  IFCP  229



>ref|XP_002276390.1| PREDICTED: protein P21-like [Vitis vinifera]
Length=227

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT +S FFK RCP+AYSYP+DD TSLF C  GS ++ V F
Sbjct  167  NNPCTVFKNSQYCCDSGSCGPTTYSEFFKDRCPNAYSYPEDDSTSLFTCSTGS-NYRVVF  225

Query  204  CP  199
            CP
Sbjct  226  CP  227



>gb|AAQ74155.1| osmotin-like protein II [Gossypium hirsutum]
Length=234

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT G   CGPT FSRFFK RC D+YSYPQDDP+S F CPAGS ++ V
Sbjct  156  NNPCTVFKTNEYCCTQGYGTCGPTYFSRFFKDRCHDSYSYPQDDPSSTFTCPAGS-NYRV  214

Query  210  TFCP  199
             FCP
Sbjct  215  VFCP  218



>gb|AAF13707.1|AF199508_1 osmotin-like protein [Fragaria x ananassa]
Length=226

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTS--LFNCPAGSTDFTV  211
            NN CT     QYCC +G CGPTD+SRFFK+RCPDAYSYP+DD TS  LF CP G T++ V
Sbjct  164  NNACTVSKTDQYCCNSGHCGPTDYSRFFKSRCPDAYSYPKDDATSTVLFTCPGG-TNYRV  222

Query  210  TFCP  199
             FCP
Sbjct  223  VFCP  226



>ref|XP_010273138.1| PREDICTED: protein P21-like [Nelumbo nucifera]
Length=224

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT +   QYCC +G CGPT  SRFFK RCP +YSYP+DDPTS F CP G T++ V F
Sbjct  164  NNPCTVYKTDQYCCNSGNCGPTPLSRFFKDRCPTSYSYPKDDPTSTFTCPGG-TNYRVVF  222

Query  204  CP  199
            CP
Sbjct  223  CP  224



>ref|XP_010054781.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
Length=251

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F   QYCC +G CGPT+FS+FFK RCPDAYSYP+DD TS F CP G T++ V F
Sbjct  165  NNPCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGG-TNYRVVF  223



>ref|XP_009609047.1| PREDICTED: protein P21-like [Nicotiana tomentosiformis]
Length=232

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            NNPCT F    YCC +G CGPT+FS++FK +CPDAYSYP+DD TS F CP G T++ V F
Sbjct  172  NNPCTVFKTDNYCCNSGNCGPTEFSKYFKDKCPDAYSYPKDDQTSTFTCPTG-TNYRVVF  230

Query  204  CP  199
            CP
Sbjct  231  CP  232



>gb|KFK28873.1| hypothetical protein AALP_AA7G059400 [Arabis alpina]
Length=231

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC     +++CC +G CGPT  S FFK RCPDAYSYP+DDPTSLF CPAG T++ V F
Sbjct  171  NGPCPVLKTEEHCCNSGNCGPTPLSMFFKQRCPDAYSYPKDDPTSLFTCPAG-TNYNVIF  229

Query  204  CP  199
            CP
Sbjct  230  CP  231



>gb|KDO38996.1| hypothetical protein CISIN_1g027281mg [Citrus sinensis]
Length=225

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPT FS+FFK RCPD YSYP+DD TS F CP+G TD+ V F
Sbjct  165  NGPCPVFKTDEYCCNSGNCGPTGFSKFFKDRCPDVYSYPKDDATSTFTCPSG-TDYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>ref|XP_006477433.1| PREDICTED: thaumatin-like protein-like [Citrus sinensis]
Length=225

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC  F   +YCC +G CGPT FS+FFK RCPD YSYP+DD TS F CP+G TD+ V F
Sbjct  165  NGPCPVFKTDEYCCNSGNCGPTGFSKFFKDRCPDVYSYPKDDATSTFTCPSG-TDYKVVF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



>gb|AAQ64678.1| osmotin-like pathognesis-related protein 5 [Gossypium hirsutum]
Length=208

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNG--PCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTV  211
            NNPCT F   +YCCT G   CGPT FSRFFK RC D+YSYPQDDP+S F CPAGS ++ V
Sbjct  130  NNPCTVFKTNEYCCTQGYGTCGPTYFSRFFKDRCHDSYSYPQDDPSSTFTCPAGS-NYRV  188

Query  210  TFCP  199
             FCP
Sbjct  189  VFCP  192



>gb|KDP25477.1| hypothetical protein JCGZ_20633 [Jatropha curcas]
Length=225

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  384  NNPCTTFGGQQYCCTNGPCGPTDFSRFFKTRCPDAYSYPQDDPTSLFNCPAGSTDFTVTF  205
            N PC     ++ CC +G CGPTD S++FK RCPDAYSYP+DDPTSLF CP G T++ V F
Sbjct  165  NGPCPQLKTEEQCCNSGNCGPTDLSKYFKERCPDAYSYPKDDPTSLFTCPTG-TNYKVIF  223

Query  204  CP  199
            CP
Sbjct  224  CP  225



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520268298656