BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1423_g1_i1 len=533 path=[723:0-532]

Length=533
                                                                      Score     E

gb|AAK97184.1|  thaumatin-like protein                                  275   5e-90   Capsicum annuum
emb|CAA50059.1|  pathogenesis-related protein PR P23                    274   9e-90   Solanum lycopersicum
gb|AAK55411.1|AF376058_1  osmotin                                       274   9e-90   Petunia x hybrida [garden petunia]
ref|XP_004245629.1|  PREDICTED: osmotin-like protein TPM-1              274   1e-89   
sp|Q01591.1|TPM1_SOLLC  RecName: Full=Osmotin-like protein TPM-1;...    273   2e-89   Solanum lycopersicum
gb|AAL79832.2|  osmotin-like protein                                    273   2e-89   Solanum nigrum
gb|AAP14934.1|  osmotin 81                                              271   2e-89   Solanum tuberosum [potatoes]
gb|AAL87640.1|AF450276_1  osmotin-like protein precursor                273   3e-89   Solanum nigrum
gb|AAU93853.1|  osmotin-like protein A13                                272   5e-89   Solanum phureja [chaucha]
gb|AAP14937.1|  osmotin 81                                              270   6e-89   Solanum tuberosum [potatoes]
ref|XP_006358887.1|  PREDICTED: osmotin-like protein OSML13-like        272   7e-89   
sp|P50701.1|OS13_SOLCO  RecName: Full=Osmotin-like protein OSML13...    272   8e-89   Solanum commersonii
gb|AAP14948.1|  osmotin 81                                              270   9e-89   Solanum tuberosum [potatoes]
gb|AAP14941.1|  osmotin 81                                              269   9e-89   Solanum tuberosum [potatoes]
gb|AGH14263.1|  osmotin-like protein                                    271   1e-88   
gb|AAP14935.1|  osmotin 81                                              269   1e-88   Solanum tuberosum [potatoes]
sp|P50702.1|OS81_SOLCO  RecName: Full=Osmotin-like protein OSML81...    271   2e-88   Solanum commersonii
ref|XP_006358888.1|  PREDICTED: osmotin-like protein OSML81-like        271   2e-88   
gb|AAP14936.1|  osmotin 81                                              269   2e-88   Solanum tuberosum [potatoes]
gb|ACB30367.1|  PR5-like protein                                        270   4e-88   Capsicum annuum
gb|AAP14946.1|  osmotin 81                                              268   4e-88   Solanum tuberosum [potatoes]
ref|XP_004245630.1|  PREDICTED: protein NP24                            269   1e-87   
gb|AAA34175.1|  NP24 protein precursor                                  268   1e-87   Solanum lycopersicum
ref|XP_006358885.1|  PREDICTED: osmotin-like protein OSML13-like        268   2e-87   
emb|CAA51430.1|  osmotin-like protein                                   268   2e-87   Solanum commersonii
ref|NP_001234161.1|  PR-5x precursor                                    268   2e-87   
ref|XP_006368018.1|  PREDICTED: osmotin-like protein OSML13-like        267   3e-87   
gb|AAU95241.1|  osmotin-like protein                                    267   3e-87   Solanum tuberosum [potatoes]
gb|AAG16625.1|  cryoprotective osmotin-like protein                     268   5e-87   Solanum dulcamara [climbing nightshade]
gb|AAP14944.1|  osmotin 81                                              265   6e-87   Solanum tuberosum [potatoes]
gb|AAP14933.1|  osmotin 81                                              264   9e-87   Solanum tuberosum [potatoes]
gb|AAU93855.1|  osmotin-like protein A81                                266   1e-86   Solanum phureja [chaucha]
ref|XP_009610144.1|  PREDICTED: osmotin                                 266   1e-86   
emb|CAA64620.1|  PR protein                                             266   2e-86   Nicotiana tabacum [American tobacco]
gb|AAU95243.1|  osmotin-like protein                                    265   2e-86   Solanum tuberosum [potatoes]
ref|XP_009782398.1|  PREDICTED: osmotin                                 266   3e-86   
gb|AAP14942.1|  osmotin 81                                              263   3e-86   Solanum tuberosum [potatoes]
gb|AAB23375.1|  osmotin                                                 265   3e-86   Nicotiana tabacum [American tobacco]
sp|P14170.2|OSMO_TOBAC  RecName: Full=Osmotin; Flags: Precursor         265   3e-86   Nicotiana tabacum [American tobacco]
gb|AAU95240.1|  osmotin-like protein                                    264   4e-86   Solanum tuberosum [potatoes]
gb|AAP14947.1|  osmotin 81                                              262   7e-86   Solanum tuberosum [potatoes]
gb|AAL87641.1|AF450277_1  osmotin-like protein                          263   8e-86   Solanum nigrum
pdb|2I0W|A  Chain A, Crystal Structure Analysis Of Np24-I, A Thau...    262   2e-85   
gb|AAP14943.1|  osmotin 81                                              260   3e-85   Solanum tuberosum [potatoes]
ref|XP_006358890.1|  PREDICTED: osmotin-like protein OSML81-like        262   5e-85   
gb|AAP14938.1|  osmotin 81                                              258   3e-84   Solanum tuberosum [potatoes]
gb|AAP14932.1|  osmotin 81                                              257   4e-84   Solanum tuberosum [potatoes]
gb|AAP14945.1|  osmotin 81                                              257   6e-84   Solanum tuberosum [potatoes]
pdb|1PCV|A  Chain A, Crystal Structure Of Osmotin, A Plant Antifu...    258   6e-84   
gb|AAP14939.1|  osmotin 81                                              255   3e-83   Solanum tuberosum [potatoes]
ref|XP_009589206.1|  PREDICTED: osmotin-like protein                    256   2e-82   
prf||1808326A  osmotin-like protein                                     256   2e-82
ref|XP_009589205.1|  PREDICTED: osmotin-like protein                    256   3e-82   
ref|XP_009782395.1|  PREDICTED: osmotin-like protein                    255   3e-82   
gb|AAP14940.1|  osmotin 81                                              253   3e-82   Solanum tuberosum [potatoes]
ref|XP_006358892.1|  PREDICTED: osmotin-like protein OSML15-like        255   3e-82   
gb|AAS48588.1|  putative osmotin-like protein precursor                 254   3e-82   Brassica juncea [brown mustard]
dbj|BAD15089.1|  pathogenesis-related protein                           255   3e-82   Nicotiana tabacum [American tobacco]
ref|XP_009782397.1|  PREDICTED: osmotin-like protein                    255   4e-82   
emb|CAH69228.1|  putative osmotin-like protein                          254   8e-82   Nicotiana glauca [glaucous tobacco]
pdb|1AUN|A  Chain A, Pathogenesis-Related Protein 5d From Nicotia...    252   1e-81   
ref|XP_004245628.2|  PREDICTED: osmotin-like protein OSML15             253   2e-81   
gb|KCW77574.1|  hypothetical protein EUGRSUZ_D01888                     253   2e-81   
gb|AHA83528.1|  osmotin-like protein                                    252   6e-81   
emb|CAB86199.1|  pathogenesis-related protein (PR-5 protein)            251   9e-81   Solanum lycopersicum
ref|NP_001234351.1|  PR5-like protein precursor                         251   1e-80   
gb|AAQ95740.1|  osmotin-like protein                                    248   2e-80   Solanum tuberosum [potatoes]
gb|AAP86781.1|  osmotin-like protein                                    250   3e-80   Capsicum annuum
ref|XP_006358891.1|  PREDICTED: osmotin-like protein OSML15-like        250   4e-80   
gb|AAG34079.1|AF294847_1  PR5-like protein                              247   4e-80   Capsicum annuum
gb|AAU95242.1|  osmotin-like protein                                    249   1e-79   Solanum tuberosum [potatoes]
gb|AAN40692.1|  thaumatin-like protein                                  246   1e-79   Solanum aethiopicum [gilo]
emb|CAA43854.1|  osmotin                                                248   2e-79   Nicotiana tabacum [American tobacco]
gb|AAA34089.1|  osmotin                                                 246   7e-79   Nicotiana tabacum [American tobacco]
ref|XP_010053305.1|  PREDICTED: protein NP24-like                       251   1e-78   
gb|AGC39177.1|  thaumatin-like protein                                  246   2e-78   
ref|XP_002299521.2|  hypothetical protein POPTR_0001s09570g             245   2e-78   Populus trichocarpa [western balsam poplar]
gb|ACZ67185.1|  pathogenesis-related thaumatin                          245   3e-78   Populus deltoides
emb|CAN71616.1|  hypothetical protein VITISV_023861                     245   3e-78   Vitis vinifera
gb|ADD51187.1|  thaumatin-like protein                                  244   4e-78   Vitis cinerea var. helleri x Vitis riparia
ref|XP_002282917.2|  PREDICTED: protein P21                             245   5e-78   Vitis vinifera
ref|XP_011016810.1|  PREDICTED: osmotin-like protein OSM34              243   1e-77   
gb|AAG34078.1|AF294846_1  PR5-like protein                              241   1e-77   Capsicum annuum
gb|AAO48958.1|  osmotin-like protein                                    239   4e-77   Solanum tuberosum [potatoes]
gb|AAD55090.1|  thaumatin                                               242   4e-77   Vitis riparia [frost grape]
gb|AAO48965.1|  osmotin-like protein                                    238   6e-77   Solanum tuberosum [potatoes]
emb|CDP09786.1|  unnamed protein product                                241   8e-77   
ref|XP_011029305.1|  PREDICTED: osmotin-like protein OSM34              240   2e-76   
gb|AAO48966.1|  osmotin-like protein                                    238   2e-76   Solanum tuberosum [potatoes]
gb|AAO48967.1|  osmotin-like protein                                    238   2e-76   Solanum tuberosum [potatoes]
ref|XP_002299547.2|  P21 family protein                                 240   2e-76   Populus trichocarpa [western balsam poplar]
gb|AAO48959.1|  osmotin-like protein                                    238   2e-76   Solanum tuberosum [potatoes]
gb|AAQ74156.1|  osmotin-like protein I                                  239   7e-76   Gossypium hirsutum [American cotton]
gb|AAQ13823.1|AF192271_1  osmotin-like pathogenesis-related protein     238   1e-75   Gossypium hirsutum [American cotton]
ref|XP_002874708.1|  ATOSM34                                            238   1e-75   
ref|XP_011029221.1|  PREDICTED: osmotin-like protein OSM34              238   2e-75   
gb|AAQ22606.1|  At4g11650                                               238   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192902.1|  osmotin-like protein OSM34                            238   2e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CAA61411.1|  osmotin                                                238   2e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61750.1|  osmotin precursor                                       237   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010255471.1|  PREDICTED: protein P21                             236   6e-75   
gb|AAO13658.1|  osmotin-like protein linusitin                          236   1e-74   Linum usitatissimum
ref|XP_010273138.1|  PREDICTED: protein P21-like                        234   2e-74   
ref|XP_004298782.1|  PREDICTED: osmotin-like protein OSM34-like         235   2e-74   
gb|AAQ14497.1|AF304007_1  osmotin-like protein                          235   2e-74   Gossypium hirsutum [American cotton]
gb|KFK31917.1|  hypothetical protein AALP_AA6G175700                    234   4e-74   
gb|AAQ74155.1|  osmotin-like protein II                                 234   5e-74   Gossypium hirsutum [American cotton]
gb|ABB86297.1|  thaumatin-like protein isoform 1                        234   5e-74   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_007040165.1|  Osmotin 34                                         233   1e-73   
ref|XP_010434611.1|  PREDICTED: osmotin-like protein OSM34              233   1e-73   
ref|XP_010422118.1|  PREDICTED: osmotin-like protein OSM34              233   1e-73   
ref|XP_010024640.1|  PREDICTED: thaumatin-like protein                  232   1e-73   
ref|XP_006288543.1|  hypothetical protein CARUB_v10001823mg             232   3e-73   
gb|ADO32898.1|  thaumatin-like protein                                  231   4e-73   
ref|XP_006396871.1|  hypothetical protein EUTSA_v10028920mg             232   4e-73   
gb|ABX71220.1|  osmotin                                                 231   5e-73   Piper colubrinum
gb|KCW77588.1|  hypothetical protein EUGRSUZ_D01904                     231   6e-73   
gb|AAO48964.1|  osmotin-like protein                                    228   7e-73   Solanum tuberosum [potatoes]
dbj|BAO09560.1|  osmotin                                                230   2e-72   
ref|XP_002874707.1|  ATOSM34                                            229   2e-72   
ref|XP_010455575.1|  PREDICTED: osmotin-like protein OSM34              229   3e-72   
gb|KDP46638.1|  hypothetical protein JCGZ_04572                         228   5e-72   
ref|XP_010024638.1|  PREDICTED: thaumatin-like protein                  228   5e-72   
gb|AIR93920.1|  thaumatin                                               229   6e-72   
ref|XP_009128666.1|  PREDICTED: osmotin-like protein OSM34              229   6e-72   
emb|CDP09784.1|  unnamed protein product                                228   7e-72   
gb|AAO48955.1|  osmotin-like protein                                    225   8e-72   Solanum tuberosum [potatoes]
ref|XP_010054783.1|  PREDICTED: thaumatin-like protein                  231   9e-72   
gb|KCW77577.1|  hypothetical protein EUGRSUZ_D01892                     228   1e-71   
pdb|4L2J|A  Chain A, Crystal Structure Of Osmotin, An Antifungal ...    226   1e-71   
ref|XP_009772655.1|  PREDICTED: thaumatin-like protein                  227   1e-71   
ref|XP_010054781.1|  PREDICTED: thaumatin-like protein                  228   2e-71   
emb|CAA09228.1|  thaumatin-like protein PR-5b                           227   2e-71   Cicer arietinum [garbanzo]
ref|XP_004245632.1|  PREDICTED: thaumatin-like protein                  226   2e-71   
ref|XP_008238908.1|  PREDICTED: protein P21-like                        226   3e-71   
gb|AGC39178.1|  thaumatin-like protein                                  227   3e-71   
gb|ABW76501.1|  pathogenesis-related thaumatin-like protein             224   4e-71   Coffea arabica [arabica coffee]
ref|XP_010520774.1|  PREDICTED: osmotin-like protein OSM34              226   4e-71   
gb|ABW76503.1|  pathogenesis-related thaumatin-like protein             224   5e-71   Coffea arabica [arabica coffee]
ref|XP_009609047.1|  PREDICTED: protein P21-like                        226   6e-71   
gb|AAO48960.1|  osmotin-like protein                                    223   8e-71   Solanum tuberosum [potatoes]
ref|XP_002509749.1|  Osmotin precursor, putative                        225   9e-71   Ricinus communis
ref|XP_010275299.1|  PREDICTED: protein P21-like                        227   1e-70   
gb|AGC39179.1|  thaumatin-like protein                                  225   2e-70   
gb|ABW76499.1|  pathogenesis-related thaumatin-like protein             223   2e-70   Coffea arabica [arabica coffee]
gb|KEH27441.1|  pathogenesis-related thaumatin family protein           224   2e-70   
gb|AAO48956.1|  osmotin-like protein                                    222   3e-70   Solanum tuberosum [potatoes]
ref|XP_010455576.1|  PREDICTED: osmotin-like protein OSM34              224   3e-70   
ref|XP_009345452.1|  PREDICTED: protein P21-like                        223   5e-70   
ref|XP_007210996.1|  hypothetical protein PRUPE_ppa021092mg             223   6e-70   
gb|ABW76500.1|  pathogenesis-related thaumatin-like protein             221   8e-70   Coffea arabica [arabica coffee]
gb|ABW76502.1|  pathogenesis-related thaumatin-like protein             221   1e-69   Coffea arabica [arabica coffee]
gb|AAO48962.1|  osmotin-like protein                                    220   1e-69   Solanum tuberosum [potatoes]
ref|XP_009406737.1|  PREDICTED: protein P21-like                        222   1e-69   
ref|XP_007158474.1|  hypothetical protein PHAVU_002G155500g             223   1e-69   
ref|XP_008345347.1|  PREDICTED: protein P21-like                        222   2e-69   
gb|AAO48957.1|  osmotin-like protein                                    219   2e-69   Solanum tuberosum [potatoes]
emb|CAA71883.1|  osmotin-like protein                                   222   2e-69   Vitis vinifera
ref|XP_011018223.1|  PREDICTED: protein P21-like                        223   2e-69   
ref|NP_001235877.1|  PR-5b protein precursor                            222   3e-69   
gb|AFK40174.1|  unknown                                                 222   3e-69   
ref|XP_008369460.1|  PREDICTED: protein P21                             221   4e-69   
ref|XP_010540702.1|  PREDICTED: osmotin-like protein OSM34              221   5e-69   
ref|XP_004511592.1|  PREDICTED: thaumatin-like protein-like             227   7e-69   
ref|XP_007208801.1|  hypothetical protein PRUPE_ppa024543mg             220   7e-69   
ref|XP_007040160.1|  Osmotin 34                                         220   7e-69   
ref|XP_009782417.1|  PREDICTED: protein P21-like                        220   9e-69   
ref|XP_003525412.1|  PREDICTED: protein P21-like                        220   9e-69   
gb|ACZ67186.1|  pathogenesis-related thaumatin                          217   1e-68   Populus balsamifera [balsam poplar]
gb|AAK59275.1|AF378571_1  thaumatin-like protein                        219   2e-68   Sambucus nigra
ref|XP_004143926.1|  PREDICTED: thaumatin-like protein-like             219   3e-68   
ref|XP_003611130.1|  Pathogenesis-related thaumatin-like protein        226   3e-68   
ref|XP_007160028.1|  hypothetical protein PHAVU_002G286600g             219   3e-68   
ref|XP_010053313.1|  PREDICTED: thaumatin-like protein                  219   3e-68   
ref|XP_002283030.1|  PREDICTED: protein P21                             219   3e-68   Vitis vinifera
ref|XP_010661214.1|  PREDICTED: protein P21                             218   5e-68   
ref|XP_007209565.1|  hypothetical protein PRUPE_ppa011053mg             218   7e-68   
pdb|1Z3Q|A  Chain A, Resolution Of The Structure Of The Allergeni...    217   8e-68   
gb|KDP25478.1|  hypothetical protein JCGZ_20634                         218   8e-68   
gb|AAM21199.1|AF364864_1  pathogenesis-related protein 5-1              217   9e-68   Helianthus annuus
gb|ABD65913.1|  osmotin                                                 214   1e-67   Nicotiana tabacum [American tobacco]
gb|ABC39612.1|  osmotin                                                 216   1e-67   Rosa roxburghii [chestnut rose]
ref|XP_008238907.1|  PREDICTED: protein P21-like                        217   1e-67   
gb|ACJ63016.1|  zeamatin-like protein                                   217   1e-67   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABC39609.1|  osmotin                                                 215   2e-67   Rosa roxburghii [chestnut rose]
gb|ACJ62936.1|  zeamatin-like protein                                   217   2e-67   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAK59277.1|AF378573_1  thaumatin-like protein                        217   2e-67   Sambucus nigra
ref|XP_004304709.1|  PREDICTED: thaumatin-like protein-like             216   2e-67   
ref|XP_008238906.1|  PREDICTED: protein P21-like                        216   3e-67   
sp|P81370.2|TLP_ACTDE  RecName: Full=Thaumatin-like protein; AltN...    216   3e-67   Actinidia deliciosa [Chinese gooseberry]
gb|AAB82777.1|  ripening-associated protein                             215   3e-67   Musa acuminata [banana]
gb|ADP69173.1|  pathogenesis related protein-5                          216   3e-67   
ref|XP_008437224.1|  PREDICTED: protein P21-like                        216   3e-67   
gb|AGC39176.1|  thaumatin-like protein                                  216   4e-67   
gb|ACJ62952.1|  zeamatin-like protein                                   216   4e-67   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62944.1|  zeamatin-like protein                                   216   5e-67   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ63015.1|  zeamatin-like protein                                   216   5e-67   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003525411.1|  PREDICTED: PR-5 protein                            215   6e-67   
gb|ABA33969.1|  zeamatin-like protein                                   216   6e-67   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABC39615.1|  osmotin                                                 214   6e-67   Rosa roxburghii [chestnut rose]
gb|AAQ10092.1|  thaumatin-like protein                                  215   6e-67   Vitis vinifera
gb|AGS80337.1|  thaumatin protein                                       215   7e-67   
gb|ACZ67184.1|  pathogenesis-related thaumatin                          213   8e-67   Populus nigra [black poplar]
ref|XP_006453440.1|  hypothetical protein CICLE_v10010751mg             215   1e-66   
ref|XP_011018224.1|  PREDICTED: thaumatin-like protein                  213   1e-66   
emb|CAN68052.1|  hypothetical protein VITISV_010558                     214   1e-66   Vitis vinifera
ref|XP_007040164.1|  Osmotin 34                                         214   1e-66   
ref|XP_002282988.1|  PREDICTED: protein P21                             214   2e-66   Vitis vinifera
gb|ABC39616.1|  osmotin                                                 212   2e-66   Rosa roxburghii [chestnut rose]
prf||1906370A  protein P21                                              213   2e-66
gb|ABB86298.1|  thaumatin-like protein isoform 2                        214   2e-66   Ficus pumila var. awkeotsang [jelly fig]
emb|CAN65933.1|  hypothetical protein VITISV_023047                     214   3e-66   Vitis vinifera
ref|XP_007210589.1|  hypothetical protein PRUPE_ppa016268mg             214   3e-66   
sp|P25096.1|P21_SOYBN  RecName: Full=Protein P21                        213   3e-66   Glycine max [soybeans]
gb|ACV83333.1|  pathogenesis-related protein 5                          214   3e-66   Panax ginseng [Chinese ginseng]
gb|ABA33972.1|  zeamatin-like protein                                   214   3e-66   Zea diploperennis [chapule]
gb|ABQ42566.1|  thaumatin-like protein                                  213   3e-66   Actinidia deliciosa [Chinese gooseberry]
gb|ABD64681.1|  thaumatin-like protein                                  213   4e-66   Vitis vinifera
ref|XP_006477434.1|  PREDICTED: osmotin                                 213   4e-66   
gb|ABA33960.1|  zeamatin-like protein                                   213   4e-66   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105356.1|  zeamatin precursor                                 213   4e-66   Zea mays [maize]
ref|XP_010042867.1|  PREDICTED: thaumatin-like protein                  213   4e-66   
gb|ACJ62967.1|  zeamatin-like protein                                   214   5e-66   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62989.1|  zeamatin-like protein                                   214   5e-66   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ63017.1|  zeamatin-like protein                                   213   5e-66   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62976.1|  zeamatin-like protein                                   213   6e-66   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62977.1|  zeamatin-like protein                                   213   8e-66   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008437223.1|  PREDICTED: protein P21-like                        212   9e-66   
gb|ACJ63019.1|  zeamatin-like protein                                   213   9e-66   Zea mays subsp. parviglumis [Balsas teosinte]
pdb|4BCT|A  Chain A, Crystal Structure Of Kiwi-fruit Allergen Act...    211   9e-66   
gb|KCW77586.1|  hypothetical protein EUGRSUZ_D01900                     213   1e-65   
gb|KGN50135.1|  hypothetical protein Csa_5G155460                       212   1e-65   
ref|XP_008437225.1|  PREDICTED: protein P21-like                        212   1e-65   
gb|ACJ62949.1|  zeamatin-like protein                                   212   1e-65   Zea mays subsp. parviglumis [Balsas teosinte]
dbj|BAF95882.1|  putative thaumatin-like protein                        212   1e-65   Vitis hybrid cultivar
gb|ABA33957.1|  zeamatin-like protein                                   212   1e-65   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004143988.1|  PREDICTED: thaumatin-like protein-like             212   1e-65   
gb|ACJ62972.1|  zeamatin-like protein                                   212   1e-65   Zea mays subsp. parviglumis [Balsas teosinte]
gb|KCW77573.1|  hypothetical protein EUGRSUZ_D01887                     212   1e-65   
ref|XP_004298786.1|  PREDICTED: thaumatin-like protein-like             211   2e-65   
pdb|1DU5|A  Chain A, The Crystal Structure Of Zeamatin                  211   2e-65   
ref|XP_004298781.1|  PREDICTED: thaumatin-like protein-like             211   3e-65   
ref|XP_006396874.1|  hypothetical protein EUTSA_v10028948mg             211   3e-65   
ref|XP_002276431.1|  PREDICTED: protein P21                             211   4e-65   Vitis vinifera
gb|AAQ64678.1|  osmotin-like pathognesis-related protein 5              210   5e-65   Gossypium hirsutum [American cotton]
ref|XP_006440574.1|  hypothetical protein CICLE_v10022104mg             211   5e-65   
ref|XP_007040162.1|  Osmotin 34                                         211   5e-65   
ref|XP_002283042.1|  PREDICTED: protein P21                             210   5e-65   Vitis vinifera
gb|AAB61590.1|  VVTL1                                                   210   5e-65   Vitis vinifera
ref|XP_002463077.1|  hypothetical protein SORBIDRAFT_02g037350          211   6e-65   Sorghum bicolor [broomcorn]
ref|XP_010055611.1|  PREDICTED: protein P21-like                        211   7e-65   
ref|XP_009409806.1|  PREDICTED: protein P21-like                        210   8e-65   
gb|ACG37805.1|  protein P21                                             210   1e-64   Zea mays [maize]
emb|CAN76134.1|  hypothetical protein VITISV_001194                     209   1e-64   Vitis vinifera
ref|XP_002283064.1|  PREDICTED: protein P21-like                        209   1e-64   Vitis vinifera
gb|AAF13707.1|AF199508_1  osmotin-like protein                          209   1e-64   Fragaria x ananassa
gb|AAU95246.1|  putative thaumatin-like protein                         210   2e-64   Solanum tuberosum [potatoes]
ref|XP_002509748.1|  Osmotin precursor, putative                        209   2e-64   Ricinus communis
ref|XP_004503751.1|  PREDICTED: protein P21-like isoform X1             209   2e-64   
gb|AAF82264.1|  thaumatin-like protein                                  209   2e-64   Vitis vinifera
ref|NP_001268131.1|  thaumatin-like protein precursor                   209   2e-64   
ref|XP_011072290.1|  PREDICTED: thaumatin-like protein                  209   2e-64   
ref|XP_009406738.1|  PREDICTED: protein P21-like                        208   3e-64   
ref|NP_001268061.1|  VVTL1 precursor                                    208   3e-64   
ref|XP_009626639.1|  PREDICTED: thaumatin-like protein                  208   3e-64   
ref|XP_009615320.1|  PREDICTED: thaumatin-like protein                  208   5e-64   
gb|AAO48961.1|  osmotin-like protein                                    204   1e-63   Solanum tuberosum [potatoes]
pdb|4JRU|A  Chain A, Structure Of Haze Forming Proteins In White ...    206   1e-63   
gb|AEB77709.1|  thaumatin-like protein                                  207   1e-63   
ref|XP_010053314.1|  PREDICTED: thaumatin-like protein                  213   2e-63   
ref|XP_010325678.1|  PREDICTED: osmotin-like protein OSML13             206   2e-63   
ref|XP_009782394.1|  PREDICTED: osmotin-like protein OSML81             207   3e-63   
ref|XP_011029220.1|  PREDICTED: thaumatin-like protein                  206   3e-63   
ref|XP_004958120.1|  PREDICTED: zeamatin-like                           206   4e-63   
sp|E3SU11.1|ALL13_OLEEU  RecName: Full=Thaumatin-like protein; Al...    205   5e-63   
ref|XP_009345456.1|  PREDICTED: thaumatin-like protein                  205   6e-63   
ref|XP_009419440.1|  PREDICTED: protein P21-like                        206   7e-63   
ref|XP_006368746.1|  P21 family protein                                 205   7e-63   
ref|XP_006364119.1|  PREDICTED: pathogenesis-related protein R ma...    205   9e-63   
sp|P13867.1|IAAT_MAIZE  RecName: Full=Alpha-amylase/trypsin inhib...    204   9e-63   
gb|EYU38380.1|  hypothetical protein MIMGU_mgv1a013157mg                205   1e-62   
ref|XP_010314485.1|  PREDICTED: pathogenesis-related protein R ma...    204   1e-62   
gb|AGC39181.1|  thaumatin-like protein                                  204   1e-62   
gb|AAO48968.1|  osmotin-like protein                                    201   2e-62   
ref|XP_010530407.1|  PREDICTED: osmotin-like protein OSM34              202   2e-62   
gb|AGC39182.1|  thaumatin-like protein                                  203   3e-62   
ref|XP_006440575.1|  hypothetical protein CICLE_v10022100mg             203   4e-62   
ref|XP_009627978.1|  PREDICTED: pathogenesis-related protein R ma...    203   4e-62   
gb|KDO38996.1|  hypothetical protein CISIN_1g027281mg                   203   4e-62   
gb|ABC55724.1|  osmotin-like protein                                    203   4e-62   
ref|XP_006477433.1|  PREDICTED: thaumatin-like protein-like             203   5e-62   
ref|XP_004298780.1|  PREDICTED: thaumatin-like protein-like             203   5e-62   
emb|CBI34740.3|  unnamed protein product                                204   6e-62   
ref|XP_009781670.1|  PREDICTED: pathogenesis-related protein R mi...    202   7e-62   
pdb|4L5H|A  Chain A, Structure Of Haze Forming Proteins In White ...    201   7e-62   
gb|ABR17922.1|  unknown                                                 203   7e-62   
sp|P07052.1|PRR2_TOBAC  RecName: Full=Pathogenesis-related protei...    202   8e-62   
gb|AAK59278.1|AF378574_1  thaumatin-like protein                        202   1e-61   
ref|XP_010055609.1|  PREDICTED: protein P21-like                        202   1e-61   
ref|XP_007160027.1|  hypothetical protein PHAVU_002G286500g             202   1e-61   
ref|XP_002509750.1|  Osmotin precursor, putative                        202   1e-61   
ref|XP_011072299.1|  PREDICTED: thaumatin-like protein                  201   2e-61   
gb|AGC39180.1|  thaumatin-like protein                                  201   3e-61   
gb|ABE01396.1|  Thaumatin-like protein                                  201   4e-61   
gb|KEH21027.1|  pathogenesis-related thaumatin family protein           201   7e-61   
dbj|BAF98917.1|  thaumatin like protein                                 200   7e-61   
dbj|BAF98918.1|  thaumatin like protein                                 200   8e-61   
dbj|BAF98916.1|  thaumatin like protein                                 200   8e-61   
sp|G5DC91.2|TLP1_MANZA  RecName: Full=Thaumatin-like protein 1; A...    199   1e-60   
ref|XP_007099628.1|  Pathogenesis-related thaumatin-like protein,...    199   2e-60   
gb|ABC73397.1|  thaumatin-like protein                                  199   2e-60   
ref|XP_007210055.1|  hypothetical protein PRUPE_ppa018275mg             197   3e-60   
ref|XP_008780841.1|  PREDICTED: thaumatin-like protein                  196   5e-60   
ref|XP_009397351.1|  PREDICTED: protein P21-like                        197   1e-59   
gb|EYU38383.1|  hypothetical protein MIMGU_mgv1a013324mg                197   1e-59   
gb|KDO63525.1|  hypothetical protein CISIN_1g043196mg                   196   2e-59   
gb|ACU31845.1|  thaumatin-like protein                                  196   2e-59   
gb|ACU31846.1|  thaumatin-like protein                                  196   2e-59   
ref|XP_010314488.1|  PREDICTED: thaumatin-like protein                  196   2e-59   
ref|XP_004144327.1|  PREDICTED: thaumatin-like protein-like             197   2e-59   
gb|AEH41422.1|  pathogenesis-related protein 5                          196   2e-59   
gb|AFV46358.1|  pathogenesis-related protein 5                          196   3e-59   
gb|EYU38379.1|  hypothetical protein MIMGU_mgv1a013131mg                196   3e-59   
gb|AFV46355.1|  pathogenesis-related protein 5                          196   3e-59   
ref|NP_001147526.1|  protein P21 precursor                              196   4e-59   
ref|XP_006440577.1|  hypothetical protein CICLE_v10023839mg             195   4e-59   
gb|AAT07456.1|  thaumatin-like protein                                  193   5e-59   
tpg|DAA50586.1|  TPA: putative thaumatin domain family protein          195   5e-59   
gb|ACU31843.1|  thaumatin-like protein                                  195   6e-59   
ref|XP_003559612.2|  PREDICTED: alpha-amylase/trypsin inhibitor-like    195   6e-59   
ref|XP_011081000.1|  PREDICTED: protein P21-like                        194   8e-59   
gb|ACU31848.1|  thaumatin-like protein                                  194   1e-58   
gb|KHN35005.1|  Osmotin-like protein OSM34                              194   2e-58   
emb|CDP16242.1|  unnamed protein product                                194   2e-58   
gb|ACU19846.1|  unknown                                                 194   2e-58   
ref|XP_006364122.1|  PREDICTED: thaumatin-like protein-like isofo...    193   2e-58   
emb|CDP09785.1|  unnamed protein product                                193   2e-58   
gb|AAS07338.1|  putative antifungal zeamatin-like protein               193   3e-58   
ref|NP_001050833.1|  Os03g0663500                                       193   3e-58   
ref|XP_011072271.1|  PREDICTED: protein P21-like                        193   3e-58   
ref|XP_004982238.1|  PREDICTED: zeamatin-like                           193   3e-58   
gb|ACN30261.1|  osmotin                                                 189   5e-58   
gb|AAN40693.1|  osmotin-like protein precursor                          191   5e-58   
gb|ACZ98825.1|  osmotin-like protein                                    191   7e-58   
ref|XP_006364121.1|  PREDICTED: thaumatin-like protein-like isofo...    193   8e-58   
dbj|BAC15615.1|  thaumatin-like protein                                 192   8e-58   
gb|KDP25477.1|  hypothetical protein JCGZ_20633                         192   8e-58   
gb|ACU31849.1|  thaumatin-like protein                                  192   1e-57   
ref|XP_006650379.1|  PREDICTED: zeamatin-like                           192   1e-57   
ref|XP_002869791.1|  hypothetical protein ARALYDRAFT_914296             192   1e-57   
ref|XP_003578322.1|  PREDICTED: protein P21-like                        191   2e-57   
ref|XP_008455730.1|  PREDICTED: protein P21-like                        192   3e-57   
gb|AFU82551.1|  pathogenesis-related protein                            189   3e-57   
ref|XP_009136680.1|  PREDICTED: thaumatin-like protein 1                190   4e-57   
gb|AEP84104.1|  acidic thaumatin-like protein                           189   5e-57   
ref|XP_009804118.1|  PREDICTED: thaumatin-like protein                  190   6e-57   
ref|XP_006477593.1|  PREDICTED: uncharacterized protein LOC102624118    197   8e-57   
ref|NP_001236405.1|  osmotin-like protein, acidic precursor             189   9e-57   
dbj|BAC15614.1|  thaumatin-like protein                                 189   2e-56   
gb|ADR80225.1|  thaumatin-like protein                                  188   3e-56   
ref|XP_003561528.1|  PREDICTED: alpha-amylase/trypsin inhibitor-like    188   3e-56   
gb|AFK29763.1|  thaumatin-like protein                                  188   4e-56   
gb|AFK46418.1|  unknown                                                 188   4e-56   
emb|CBI34736.3|  unnamed protein product                                186   5e-56   
gb|AAV34889.2|  osmotin-like                                            186   6e-56   
ref|NP_001050827.1|  Os03g0661600                                       187   7e-56   
ref|XP_010676513.1|  PREDICTED: protein P21-like                        189   7e-56   
ref|XP_010676518.1|  PREDICTED: protein P21-like                        187   7e-56   
ref|XP_002282993.1|  PREDICTED: protein P21                             187   8e-56   
gb|KDP25476.1|  hypothetical protein JCGZ_20632                         187   9e-56   
gb|AAK59276.1|AF378572_1  thaumatin-like protein                        186   1e-55   
gb|ABM91760.1|  acidic thaumatin-like protein 10 precursor              187   1e-55   
gb|ABR17314.1|  unknown                                                 187   1e-55   
ref|XP_006294935.1|  hypothetical protein CARUB_v10023990mg             186   1e-55   
gb|AIU34432.1|  thaumatin-like protein 4                                186   2e-55   
gb|ABM91752.1|  acidic thaumatin-like protein 5 precursor               186   4e-55   
emb|CDY53136.1|  BnaC01g41460D                                          185   4e-55   
ref|XP_006364118.1|  PREDICTED: thaumatin-like protein-like             185   6e-55   
emb|CDY41250.1|  BnaA01g12890D                                          185   6e-55   
ref|XP_002466712.1|  hypothetical protein SORBIDRAFT_01g012710          184   1e-54   
gb|ADB97926.1|  thaumatin-like protein L2                               184   1e-54   
ref|XP_002874705.1|  hypothetical protein ARALYDRAFT_911511             182   1e-54   
ref|XP_008788870.1|  PREDICTED: protein P21-like                        184   2e-54   
ref|XP_010906165.1|  PREDICTED: thaumatin-like protein                  184   2e-54   
dbj|BAK05334.1|  predicted protein                                      183   2e-54   
emb|CDP16244.1|  unnamed protein product                                193   2e-54   
ref|XP_004968009.1|  PREDICTED: G-type lectin S-receptor-like ser...    193   3e-54   
ref|XP_006358920.1|  PREDICTED: LOW QUALITY PROTEIN: protein P21-...    183   3e-54   
gb|EMT15457.1|  hypothetical protein F775_29722                         183   3e-54   
ref|XP_010417229.1|  PREDICTED: pathogenesis-related protein R ma...    183   3e-54   
ref|XP_010676512.1|  PREDICTED: protein P21-like                        182   5e-54   
gb|ADB97927.1|  thaumatin-like protein L3                               182   5e-54   
gb|ABM91755.1|  acidic thaumatin-like protein 3 precursor               182   6e-54   
gb|ABM91761.1|  acidic thaumatin-like protein 11 precursor              182   6e-54   
ref|XP_006853304.1|  hypothetical protein AMTR_s00032p00039030          182   6e-54   
gb|ABM91758.1|  acidic thaumatin-like protein 8 precursor               182   6e-54   
gb|ABM91756.1|  acidic thaumatin-like protein 6 precursor               182   7e-54   
gb|ABM91750.1|  acidic thaumatin-like protein 3 precursor               182   7e-54   
gb|AAQ84890.1|  PR-5 thaumatin-like protein                             182   7e-54   
gb|ABM91751.1|  acidic thaumatin-like protein 4 precursor               182   8e-54   
ref|XP_010314486.1|  PREDICTED: thaumatin-like protein                  182   8e-54   
gb|AAV74248.1|  thaumatin-like protein                                  182   8e-54   
ref|XP_006364120.1|  PREDICTED: thaumatin-like protein-like             182   9e-54   
gb|ABM91747.1|  acidic thaumatin-like protein precursor                 182   1e-53   
ref|XP_007210072.1|  hypothetical protein PRUPE_ppa019495mg             182   1e-53   
gb|ABM91749.1|  acidic thaumatin-like protein 2 precursor               182   1e-53   
emb|CAB85636.1|  putative thaumatin-like protein                        180   1e-53   
gb|ADM77948.1|  thaumatin-like protein                                  181   2e-53   
gb|ADM77951.1|  thaumatin-like protein                                  181   2e-53   
ref|XP_007158473.1|  hypothetical protein PHAVU_002G155400g             181   2e-53   
gb|ADM77973.1|  thaumatin-like protein                                  181   2e-53   
gb|ADM77961.1|  thaumatin-like protein                                  181   2e-53   
gb|ABM91759.1|  acidic thaumatin-like protein 9 precursor               181   2e-53   
gb|ACU31847.1|  thaumatin-like protein                                  181   2e-53   
gb|ABK25464.1|  unknown                                                 181   3e-53   
ref|XP_010429452.1|  PREDICTED: protein P21-like                        181   3e-53   
gb|ADB97930.1|  thaumatin-like protein L6                               181   3e-53   
gb|KCW77579.1|  hypothetical protein EUGRSUZ_D01894                     181   3e-53   
gb|ADM77971.1|  thaumatin-like protein                                  180   3e-53   
gb|AGX15390.1|  osmotin like-protein 1                                  180   4e-53   
gb|ADM77965.1|  thaumatin-like protein                                  180   4e-53   
gb|ADM77976.1|  thaumatin-like protein                                  180   4e-53   
gb|ADM77944.1|  thaumatin-like protein                                  180   4e-53   
gb|ADM77950.1|  thaumatin-like protein                                  180   4e-53   
gb|AAQ84889.1|  PR-5 thaumatin-like protein                             180   5e-53   
gb|KCW61089.1|  hypothetical protein EUGRSUZ_H03863                     179   7e-53   
gb|AFV46360.1|  pathogenesis-related protein 5                          179   9e-53   
emb|CDP16245.1|  unnamed protein product                                179   1e-52   
gb|AAV65287.1|  thaumatin-like protein                                  179   1e-52   
ref|XP_002457489.1|  hypothetical protein SORBIDRAFT_03g008160          188   1e-52   
gb|ABM91763.1|  acidic thaumatin-like protein 13 precursor              179   2e-52   
gb|AAO48963.1|  osmotin-like protein                                    174   4e-52   
ref|XP_010529553.1|  PREDICTED: pathogenesis-related protein R ma...    177   4e-52   
ref|XP_008793571.1|  PREDICTED: thaumatin-like protein 1                177   4e-52   
gb|AAB53368.1|  pathogenesis-related thaumatin-like protein             177   5e-52   
gb|KCW77585.1|  hypothetical protein EUGRSUZ_D01899                     176   8e-52   
ref|XP_002276390.1|  PREDICTED: protein P21-like                        176   9e-52   
dbj|BAC15616.1|  thaumatin-like protein                                 176   1e-51   
gb|KCW77578.1|  hypothetical protein EUGRSUZ_D01893                     176   1e-51   
sp|P02884.1|THM2_THADA  RecName: Full=Thaumatin-2; AltName: Full=...    176   2e-51   
gb|ABR17554.1|  unknown                                                 176   2e-51   
gb|ABR18306.1|  unknown                                                 175   4e-51   
ref|XP_010053306.1|  PREDICTED: thaumatin-like protein                  180   5e-51   
gb|EPS62955.1|  hypothetical protein M569_11833                         174   6e-51   
gb|AFV46361.1|  pathogenesis-related protein 5                          174   7e-51   
ref|XP_010906157.1|  PREDICTED: protein P21-like                        174   8e-51   
ref|XP_003575667.1|  PREDICTED: protein P21-like                        174   1e-50   
gb|ABK26607.1|  unknown                                                 174   1e-50   
ref|XP_010906134.1|  PREDICTED: pathogenesis-related protein R mi...    173   1e-50   
gb|ABQ14359.1|  thaumatin-like protein                                  173   2e-50   
gb|EMT01972.1|  hypothetical protein F775_27927                         173   2e-50   
ref|XP_010906440.1|  PREDICTED: thaumatin-like protein                  171   3e-50   
pdb|3AOK|A  Chain A, Crystal Structure Of Sweet-Tasting Protein T...    172   3e-50   
ref|XP_010906112.1|  PREDICTED: thaumatin-like protein 1                173   3e-50   
gb|AEH41423.1|  pathogeneis-related protein 5                           172   6e-50   
gb|AFW65499.1|  putative D-mannose binding lectin receptor-like p...    171   9e-50   
gb|ADB97928.1|  thaumatin-like protein L4                               171   9e-50   
gb|KEH21028.1|  pathogenesis-related thaumatin family protein           169   1e-49   
dbj|BAD90813.1|  thaumatin-like protein                                 172   1e-49   
dbj|BAD90815.1|  thaumatin-like protein                                 171   1e-49   
gb|AHH02776.1|  thaumatin-like protein                                  171   2e-49   
emb|CAA10492.1|  Thaumatin-like protein                                 171   2e-49   
gb|AAR21072.1|  PR5 allergen Jun r 3.2 precursor                        170   2e-49   
ref|XP_006477435.1|  PREDICTED: thaumatin-like protein-like             170   3e-49   
sp|P81295.1|PRR3_JUNAS  RecName: Full=Pathogenesis-related protei...    170   3e-49   
dbj|BAF44567.1|  preprothaumatin I                                      170   4e-49   
gb|KDO63526.1|  hypothetical protein CISIN_1g023881mg                   171   4e-49   
gb|AAR21071.1|  PR5 allergen Jun r 3.1 precursor                        169   6e-49   
ref|XP_006643673.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   6e-49   
gb|EEE53749.1|  hypothetical protein OsJ_00116                          178   6e-49   
gb|EYU29729.1|  hypothetical protein MIMGU_mgv1a017668mg                168   7e-49   
gb|KCW72117.1|  hypothetical protein EUGRSUZ_E00557                     168   7e-49   
dbj|BAF79625.1|  osmotin-like protein PR-5                              164   7e-49   
ref|XP_010676519.1|  PREDICTED: alpha-amylase/trypsin inhibitor-like    168   8e-49   
pdb|1RQW|A  Chain A, Thaumatin Structure At 1.05 A Resolution           168   8e-49   
ref|NP_001172138.1|  Os01g0113650                                       177   9e-49   
gb|ADM76215.1|  thaumatin-like protein                                  168   1e-48   
gb|EMT13028.1|  Zeamatin                                                177   1e-48   
gb|AAR21073.1|  PR5 allergen Cup s 3.1 precursor                        168   1e-48   
gb|EMT14788.1|  Protein P21                                             177   2e-48   
emb|CAN74833.1|  hypothetical protein VITISV_004208                     168   2e-48   
gb|KFK28873.1|  hypothetical protein AALP_AA7G059400                    168   2e-48   
gb|ADM76217.1|  thaumatin-like protein                                  167   2e-48   
gb|ADM76211.1|  thaumatin-like protein                                  167   3e-48   
gb|ACF81601.1|  unknown                                                 171   3e-48   
gb|ADM76219.1|  thaumatin-like protein                                  167   3e-48   
gb|ADM76237.1|  thaumatin-like protein                                  167   3e-48   
gb|ADB97929.1|  thaumatin-like protein L5                               167   3e-48   
gb|AAR21074.1|  PR5 allergen Cup s 3.2 precursor                        167   3e-48   
gb|ADM76213.1|  thaumatin-like protein                                  166   3e-48   
gb|ADM76242.1|  thaumatin-like protein                                  166   3e-48   
gb|ADM76229.1|  thaumatin-like protein                                  166   3e-48   
gb|ADM76205.1|  thaumatin-like protein                                  166   3e-48   
gb|ADM76212.1|  thaumatin-like protein                                  166   4e-48   
gb|ADM76218.1|  thaumatin-like protein                                  166   4e-48   
gb|ADM76230.1|  thaumatin-like protein                                  166   4e-48   
pdb|2BLR|A  Chain A, Thaumatin Before A High Dose X-Ray "burn"          166   5e-48   
sp|P02883.1|THM1_THADA  RecName: Full=Thaumatin-1; AltName: Full=...    166   5e-48   
pdb|1THV|A  Chain A, The Structures Of Three Crystal Forms Of The...    166   6e-48   
gb|AAA72675.1|  thaumatin                                               166   6e-48   



>gb|AAK97184.1| thaumatin-like protein [Capsicum annuum]
 emb|CAC34055.2| osmotin-like protein [Capsicum annuum]
Length=246

 Score =   275 bits (703),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTW I AP GT MARIWGRTNC FD 
Sbjct  17   TYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIQCTANINGECPGSLRVPGGCNNPCTT  170



>emb|CAA50059.1| pathogenesis-related protein PR P23 [Solanum lycopersicum]
Length=233

 Score =   274 bits (700),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAATFEVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC FD 
Sbjct  4    TYTYAATFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDG  63

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  64   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  123

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  124  SGGKCHAIHCTANINGECPGSLRVPGGCNNPCTT  157



>gb|AAK55411.1|AF376058_1 osmotin [Petunia x hybrida]
Length=246

 Score =   274 bits (701),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YA + EVRNNCPYTVWAASTP+GGGRRLDRGQTW I APAGTKMARIWGRT C F++
Sbjct  17   TCTYAISIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPAGTKMARIWGRTKCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDF+DISLVDGFNIPM FAPTK 
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFWDISLVDGFNIPMTFAPTKP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC  + CTANING+CP AL+VPGGCNNPCTT
Sbjct  137  SAGKCHPIHCTANINGECPGALRVPGGCNNPCTT  170



>ref|XP_004245629.1| PREDICTED: osmotin-like protein TPM-1 [Solanum lycopersicum]
Length=246

 Score =   274 bits (701),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAATFEVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC FD 
Sbjct  17   TYTYAATFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPGSLRVPGGCNNPCTT  170



>sp|Q01591.1|TPM1_SOLLC RecName: Full=Osmotin-like protein TPM-1; AltName: Full=PR P23; 
Flags: Precursor, partial [Solanum lycopersicum]
 emb|CAA47047.1| tpm 1 [Solanum lycopersicum]
Length=238

 Score =   273 bits (699),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAATFEVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC FD 
Sbjct  9    TYTYAATFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDG  68

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
             GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  69   DGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  128

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  129  SGGKCHAIHCTANINGECPGSLRVPGGCNNPCTT  162



>gb|AAL79832.2| osmotin-like protein [Solanum nigrum]
 gb|ABB36660.1| osmotin-like protein [Solanum nigrum]
Length=247

 Score =   273 bits (699),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YA +FEVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GT MARIWGRTNC FD 
Sbjct  17   TYTYATSFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTSMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC ++ CTANING+CPAAL+VPGGCNNPCTT
Sbjct  137  SGGKCHSIQCTANINGECPAALRVPGGCNNPCTT  170



>gb|AAP14934.1| osmotin 81 [Solanum tuberosum]
Length=179

 Score =   271 bits (692),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  1    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  120

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  154



>gb|AAL87640.1|AF450276_1 osmotin-like protein precursor [Solanum nigrum]
Length=247

 Score =   273 bits (699),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YA +FEVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GT MARIWGRTNC FD 
Sbjct  17   TYTYATSFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTSMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC ++ CTANING+CPAAL+VPGGCNNPCTT
Sbjct  137  SGGKCHSIQCTANINGECPAALRVPGGCNNPCTT  170



>gb|AAU93853.1| osmotin-like protein A13 [Solanum phureja]
Length=246

 Score =   272 bits (696),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC FD 
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPGSLRVPGGCNNPCTT  170



>gb|AAP14937.1| osmotin 81 [Solanum tuberosum]
Length=179

 Score =   270 bits (690),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  1    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  120

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  154



>ref|XP_006358887.1| PREDICTED: osmotin-like protein OSML13-like [Solanum tuberosum]
 gb|AAU95237.1| osmotin-like protein [Solanum phureja]
Length=246

 Score =   272 bits (696),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC FD 
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPGSLRVPGGCNNPCTT  170



>sp|P50701.1|OS13_SOLCO RecName: Full=Osmotin-like protein OSML13; AltName: Full=PA13; 
Flags: Precursor [Solanum commersonii]
 emb|CAA47601.1| osmotin-like protein [Solanum commersonii]
 emb|CAA51432.1| osmotin-like protein [Solanum commersonii]
Length=246

 Score =   272 bits (695),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC FD 
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPGSLRVPGGCNNPCTT  170



>gb|AAP14948.1| osmotin 81 [Solanum tuberosum]
Length=180

 Score =   270 bits (689),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  1    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  120

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  154



>gb|AAP14941.1| osmotin 81 [Solanum tuberosum]
Length=178

 Score =   269 bits (688),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  1    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  120

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  154



>gb|AGH14263.1| osmotin-like protein [Solanum nigrum]
Length=247

 Score =   271 bits (694),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GT MARIWGRTNC FD 
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTSMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC ++ CTANING+CPAAL+VPGGCNNPCTT
Sbjct  137  SGGKCHSIQCTANINGECPAALRVPGGCNNPCTT  170



>gb|AAP14935.1| osmotin 81 [Solanum tuberosum]
Length=180

 Score =   269 bits (687),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  1    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  120

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             A KC A+ CTANING+CP ALKVPGGCNNPCT
Sbjct  121  SAGKCHAIHCTANINGECPRALKVPGGCNNPCT  153



>sp|P50702.1|OS81_SOLCO RecName: Full=Osmotin-like protein OSML81; AltName: Full=PA81; 
Flags: Precursor [Solanum commersonii]
 emb|CAA51431.1| osmotin-like protein [Solanum commersonii]
Length=247

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  137  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  170



>ref|XP_006358888.1| PREDICTED: osmotin-like protein OSML81-like [Solanum tuberosum]
 gb|AAU95236.1| osmotin-like protein [Solanum phureja]
Length=247

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  137  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  170



>gb|AAP14936.1| osmotin 81 [Solanum tuberosum]
Length=198

 Score =   269 bits (688),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  456  SYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSG  277
            +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F+++G
Sbjct  2    TYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNAAG  61

Query  276  RGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGA  97
            RGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK  A
Sbjct  62   RGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSA  121

Query  96   NKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  122  GKCHAIHCTANINGECPRALKVPGGCNNPCTT  153



>gb|ACB30367.1| PR5-like protein [Capsicum annuum]
Length=251

 Score =   270 bits (691),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL+RGQTW I AP GTKMARIWGRT C F++
Sbjct  21   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNA  80

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  81   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  140

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  141  SGGKCHAIHCTANINGECPRALKVPGGCNNPCTT  174



>gb|AAP14946.1| osmotin 81 [Solanum tuberosum]
Length=188

 Score =   268 bits (685),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  1    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIP+ FAPTK 
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPIAFAPTKP  120

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  154



>ref|XP_004245630.1| PREDICTED: protein NP24 [Solanum lycopersicum]
 sp|P12670.2|NP24_SOLLC RecName: Full=Protein NP24; AltName: Full=Pathogenesis-related 
protein PR P23; AltName: Full=Salt-induced protein; Flags: 
Precursor [Solanum lycopersicum]
 gb|AAC64171.1| pathogenesis-related protein osmotin precursor [Solanum lycopersicum]
Length=247

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL+RGQTW I AP GTKMARIWGRT C F++
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  77   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPRALKVPGGCNNPCTT  170



>gb|AAA34175.1| NP24 protein precursor, partial [Solanum lycopersicum]
 prf||1601515A salt induced protein
Length=239

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL+RGQTW I AP GTKMARIWGRT C F++
Sbjct  9    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNA  68

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  69   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  128

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  129  SGGKCHAIHCTANINGECPRALKVPGGCNNPCTT  162



>ref|XP_006358885.1| PREDICTED: osmotin-like protein OSML13-like [Solanum tuberosum]
Length=230

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YA +FEVRNNCPYTVWAASTP+GGG+RLD+GQTW I AP GTKMARIWGRTNC FD 
Sbjct  21   TYTYATSFEVRNNCPYTVWAASTPIGGGQRLDQGQTWVINAPGGTKMARIWGRTNCNFDG  80

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSC+TGDCGGVLQCTGWGKPPNTLAEYALNQF NLDF+DISLVDGFNIPM FAPT  
Sbjct  81   AGRGSCETGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNP  140

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC ++ CTANING+CP  LKVPGGCNNPCTT
Sbjct  141  SGGKCHSIQCTANINGECPGELKVPGGCNNPCTT  174



>emb|CAA51430.1| osmotin-like protein [Solanum commersonii]
Length=247

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVL CTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  77   AGRGSCQTGDCGGVLLCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  137  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  170



>ref|NP_001234161.1| PR-5x precursor [Solanum lycopersicum]
 gb|AAM23272.1| PR-5x [Solanum lycopersicum]
Length=226

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC F+ 
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFNG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVL CTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLHCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP+ L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPSPLRVPGGCNNPCTT  170



>ref|XP_006368018.1| PREDICTED: osmotin-like protein OSML13-like [Solanum tuberosum]
Length=220

 Score =   267 bits (682),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  519  SNMEYlrtlpilllllsLFTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITA  340
            +NM+YL     +  LLS  T +Y+ +FEV+NNCPYT+WAASTP+GGGRRL++GQTW I A
Sbjct  3    TNMDYLIRSSSVFFLLSFVTYTYSTSFEVQNNCPYTIWAASTPIGGGRRLNKGQTWVINA  62

Query  339  PAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFF  160
            P GTKMARIWGRTNC FD SGRGSCQTGDCGGVLQCTGWGK PNTLAEYALNQF NLDF+
Sbjct  63   PRGTKMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKSPNTLAEYALNQFSNLDFW  122

Query  159  DISLVDGFNIPMRFAPTKAGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            DISL++GFNIPM FAPT     KC AV CTANING+CP  LKVPGGCNNPCT
Sbjct  123  DISLIEGFNIPMTFAPTNPSGGKCHAVQCTANINGECPGQLKVPGGCNNPCT  174



>gb|AAU95241.1| osmotin-like protein [Solanum tuberosum]
Length=226

 Score =   267 bits (682),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVW ASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC F+ 
Sbjct  17   TYTYAATIEVRNNCPYTVWVASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFNG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP  L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPGPLRVPGGCNNPCTT  170



>gb|AAG16625.1| cryoprotective osmotin-like protein [Solanum dulcamara]
Length=248

 Score =   268 bits (684),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRT C F+ 
Sbjct  18   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTGCNFNG  77

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  78   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  137

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  138  SGGKCHAIHCTANINGECPGSLRVPGGCNNPCTT  171



>gb|AAP14944.1| osmotin 81 [Solanum tuberosum]
Length=180

 Score =   265 bits (677),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F+++GRG
Sbjct  1    AATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNAAGRG  60

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK  A K
Sbjct  61   SCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSAGK  120

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  CHAIHCTANINGECPRALKVPGGCNNPCTT  150



>gb|AAP14933.1| osmotin 81 [Solanum tuberosum]
Length=173

 Score =   264 bits (675),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            AT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F+++GRGS
Sbjct  2    ATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNAAGRGS  61

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK  A KC
Sbjct  62   CQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSAGKC  121

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  122  HAIHCTANINGECPRALKVPGGCNNPCTT  150



>gb|AAU93855.1| osmotin-like protein A81 [Solanum phureja]
Length=247

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAAS P+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  17   TYTYAATIEVRNNCPYTVWAASXPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDC GVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  77   AGRGSCQTGDCRGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  137  SAGKCHAIHCTANINGECPRALKVPGGCNNPCTT  170



>ref|XP_009610144.1| PREDICTED: osmotin [Nicotiana tomentosiformis]
Length=250

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC F++
Sbjct  21   TCTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFNA  80

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF  LDF+DISLVDGFNIPM FAPT  
Sbjct  81   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLVDGFNIPMTFAPTNP  140

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP  L+VPGGCNNPCTT
Sbjct  141  SGGKCHAIHCTANINGECPRELRVPGGCNNPCTT  174



>emb|CAA64620.1| PR protein [Nicotiana tabacum]
Length=246

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC F++
Sbjct  17   TCTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF  LDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP  L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPRELRVPGGCNNPCTT  170



>gb|AAU95243.1| osmotin-like protein [Solanum tuberosum]
Length=220

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  519  SNMEYlrtlpilllllsLFTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITA  340
            +NM+YL     +  LLS  T +Y+ +FEVRNNCPYT+WAASTP+GGGRRLD GQTW I A
Sbjct  3    TNMDYLIRSSSVFFLLSFVTYTYSTSFEVRNNCPYTIWAASTPIGGGRRLDSGQTWVIDA  62

Query  339  PAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFF  160
            P GTKMARIWGRTNC FD +GRGSCQTGDCGGVLQCTGWGK PNTLAEYALNQF NLDF+
Sbjct  63   PRGTKMARIWGRTNCNFDGAGRGSCQTGDCGGVLQCTGWGKSPNTLAEYALNQFSNLDFW  122

Query  159  DISLVDGFNIPMRFAPTKAGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            DISL++GFNIPM FAPT     KC AV CTANING+CP  LKV GGCNNPCT
Sbjct  123  DISLIEGFNIPMTFAPTNPSGGKCHAVQCTANINGECPNQLKVSGGCNNPCT  174



>ref|XP_009782398.1| PREDICTED: osmotin [Nicotiana sylvestris]
 emb|CAA46623.1| osmotin [Nicotiana tabacum]
Length=250

 Score =   266 bits (679),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMAR+WGRTNC F++
Sbjct  21   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARVWGRTNCNFNA  80

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF  LDF+DISLVDGFNIPM FAPT  
Sbjct  81   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLVDGFNIPMTFAPTNP  140

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP  L+VPGGCNNPCTT
Sbjct  141  SGGKCHAIHCTANINGECPRELRVPGGCNNPCTT  174



>gb|AAP14942.1| osmotin 81 [Solanum tuberosum]
Length=175

 Score =   263 bits (671),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            AT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F+++GRGS
Sbjct  2    ATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNAAGRGS  61

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK  A KC
Sbjct  62   CQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSAGKC  121

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  122  HAIHCTANINGECPRALKVPGGCNNPCTT  150



>gb|AAB23375.1| osmotin, partial [Nicotiana tabacum]
Length=244

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMAR+WGRTNC F++
Sbjct  15   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARVWGRTNCNFNA  74

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF  LDF+DISLVDGFNIPM FAPT  
Sbjct  75   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLVDGFNIPMTFAPTNP  134

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP  L+VPGGCNNPCTT
Sbjct  135  SGGKCHAIHCTANINGECPRELRVPGGCNNPCTT  168



>sp|P14170.2|OSMO_TOBAC RecName: Full=Osmotin; Flags: Precursor [Nicotiana tabacum]
 emb|CAA46622.1| osmotin [Nicotiana tabacum]
 gb|AAB22459.2| osmotin [Nicotiana tabacum]
Length=246

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMAR+WGRTNC F++
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARVWGRTNCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF  LDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP  L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANINGECPRELRVPGGCNNPCTT  170



>gb|AAU95240.1| osmotin-like protein [Solanum tuberosum]
Length=226

 Score =   264 bits (675),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YA +FEVRNNCPYTVWAASTP+GGGRRLD+GQTW I  P GTKMARIWGRTNC FD 
Sbjct  17   TYTYATSFEVRNNCPYTVWAASTPIGGGRRLDQGQTWVIDTPRGTKMARIWGRTNCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQF NLDF+DISLVD FNIPM F PT  
Sbjct  77   AGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDEFNIPMTFTPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC ++ CTANING+CP  LKVPGGCNNPCTT
Sbjct  137  SGGKCHSIQCTANINGECPGQLKVPGGCNNPCTT  170



>gb|AAP14947.1| osmotin 81 [Solanum tuberosum]
Length=180

 Score =   262 bits (670),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F+++GRG
Sbjct  1    AATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNAAGRG  60

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT     K
Sbjct  61   SCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNPSGGK  120

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  CHAIHCTANINGECPRALKVPGGCNNPCTT  150



>gb|AAL87641.1|AF450277_1 osmotin-like protein [Solanum nigrum]
Length=207

 Score =   263 bits (672),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            AT EVRNNCPYTVWAASTP+GGGRRL+RGQTW I AP GTKMARIWGRT C F+++GRGS
Sbjct  1    ATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGS  60

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVL+CTGWGKPPNTLAEYAL+QFGNLDF+DISLVDGFNIPM FAPTK    KC
Sbjct  61   CQTGDCGGVLRCTGWGKPPNTLAEYALDQFGNLDFWDISLVDGFNIPMTFAPTKPSGGKC  120

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  HAIHCTANINGECPRALKVPGGCNNPCTT  149



>pdb|2I0W|A Chain A, Crystal Structure Analysis Of Np24-I, A Thaumatin-Like 
Protein
Length=207

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            AT EVRNNCPYTVWAASTP+GGGRRL+RGQTW I AP GTKMARIWGRT C F+++GRG+
Sbjct  1    ATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGT  60

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK    KC
Sbjct  61   CQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKC  120

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  HAIHCTANINGECPRALKVPGGCNNPCTT  149



>gb|AAP14943.1| osmotin 81 [Solanum tuberosum]
Length=175

 Score =   260 bits (665),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            AT EVRNNCPYTVWAASTP+GGGRRL+RGQTW I AP GTKMARIWGRT C F+++GRGS
Sbjct  2    ATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGS  61

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT     KC
Sbjct  62   CQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNPSGGKC  121

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A+ CTANING+CP +LKVPGGCNNPCTT
Sbjct  122  HAIHCTANINGECPGSLKVPGGCNNPCTT  150



>ref|XP_006358890.1| PREDICTED: osmotin-like protein OSML81-like [Solanum tuberosum]
 gb|AAU95235.1| osmotin-like protein [Solanum phureja]
Length=247

 Score =   262 bits (670),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YA T EVRNNCPY VWAASTP+GGGRRLDRGQTW I AP GT MARIWGRT C FD 
Sbjct  17   TFTYAVTIEVRNNCPYIVWAASTPIGGGRRLDRGQTWVIDAPRGTTMARIWGRTGCNFDG  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSC TGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGSCMTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANING+CP  LKVPGGCNNPCTT
Sbjct  137  SGGKCHAIQCTANINGECPGQLKVPGGCNNPCTT  170



>gb|AAP14938.1| osmotin 81 [Solanum tuberosum]
Length=179

 Score =   258 bits (659),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMARIWGRTNC FD 
Sbjct  1    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDG  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPN-TLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +GRGSCQTGDCGGVLQCTGWGK    TLAEYAL+QF NLDF+DISLVDGFNIPM FAPT 
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGKATKPTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTN  120

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
                KC A+ CTANING+CP +L+VPGGCNNPCTT
Sbjct  121  PSGGKCHAIHCTANINGECPGSLRVPGGCNNPCTT  155



>gb|AAP14932.1| osmotin 81 [Solanum tuberosum]
Length=169

 Score =   257 bits (657),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            AT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F+ +GRGS
Sbjct  2    ATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNGAGRGS  61

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT     KC
Sbjct  62   CQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNPSGGKC  121

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A+ CTANING+CP  LKVPGGCNNPCTT
Sbjct  122  HAIHCTANINGECPGPLKVPGGCNNPCTT  150



>gb|AAP14945.1| osmotin 81 [Solanum tuberosum]
Length=177

 Score =   257 bits (657),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F+++GRG
Sbjct  1    AATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNAAGRG  60

Query  270  -SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN  94
             SCQTGDCGGVLQCTGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPT     
Sbjct  61   GSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNPSGG  120

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            KC A+ CTANING+CP ALKVPGGCNNPCTT
Sbjct  121  KCHAIHCTANINGECPRALKVPGGCNNPCTT  151



>pdb|1PCV|A Chain A, Crystal Structure Of Osmotin, A Plant Antifungal Protein
 pdb|1PCV|B Chain B, Crystal Structure Of Osmotin, A Plant Antifungal Protein
Length=205

 Score =   258 bits (659),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            AT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMAR+WGRTNC F+++GRG+
Sbjct  1    ATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARVWGRTNCNFNAAGRGT  60

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF  LDF+DISLVDGFNIPM FAPT     KC
Sbjct  61   CQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLVDGFNIPMTFAPTNPSGGKC  120

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A+ CTANING+CP  L+VPGGCNNPCTT
Sbjct  121  HAIHCTANINGECPRELRVPGGCNNPCTT  149



>gb|AAP14939.1| osmotin 81 [Solanum tuberosum]
Length=179

 Score =   255 bits (652),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTV AASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  1    TYTYAATIEVRNNCPYTVGAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFA-PTK  106
            +GRGSCQTGDCGGVLQCTGWGK PNTLAEYAL+QF NLDF+DISLVDGFNIPM FA PTK
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGKHPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPPTK  120

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
                KC A+ CTANING+CP +LKVPGGCNNPCTT
Sbjct  121  PSGGKCHAIHCTANINGECPRSLKVPGGCNNPCTT  155



>ref|XP_009589206.1| PREDICTED: osmotin-like protein [Nicotiana tomentosiformis]
Length=255

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  21   TYTYASGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFD  80

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK
Sbjct  81   GAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTK  140

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  KC  + CTANING+CP +L+VPGGCNNPCTT
Sbjct  141  PGPGKCHGIQCTANINGECPGSLRVPGGCNNPCTT  175



>prf||1808326A osmotin-like protein
Length=251

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  17   TYTYASGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK
Sbjct  77   GAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTK  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  KC  + CTANING+CP +L+VPGGCNNPCTT
Sbjct  137  PGPGKCHGIQCTANINGECPGSLRVPGGCNNPCTT  171



>ref|XP_009589205.1| PREDICTED: osmotin-like protein [Nicotiana tomentosiformis]
 sp|P25871.1|OLPA_TOBAC RecName: Full=Osmotin-like protein; AltName: Full=Pathogenesis-related 
protein PR-5d; Flags: Precursor [Nicotiana tabacum]
 gb|AAA34087.1| osmotin-like protein [Nicotiana tabacum]
Length=251

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  17   TYTYASGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK
Sbjct  77   GAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTK  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  KC  + CTANING+CP +L+VPGGCNNPCTT
Sbjct  137  PGPGKCHGIQCTANINGECPGSLRVPGGCNNPCTT  171



>ref|XP_009782395.1| PREDICTED: osmotin-like protein [Nicotiana sylvestris]
 dbj|BAA11180.1| neutral PR-5 [Nicotiana sylvestris]
Length=251

 Score =   255 bits (652),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            +  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG
Sbjct  22   SGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK G  K
Sbjct  82   WCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGK  141

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + CTANING+CP AL+VPGGCNNPCTT
Sbjct  142  CHGIQCTANINGECPGALRVPGGCNNPCTT  171



>gb|AAP14940.1| osmotin 81 [Solanum tuberosum]
Length=178

 Score =   253 bits (646),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRL++GQTW I AP GTKMARIWGRT C F++
Sbjct  1    TYTYAATIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNA  60

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQCTGWG  P T AEYAL+QF NLDF+DISLVDGFNIPM FAPTK 
Sbjct  61   AGRGSCQTGDCGGVLQCTGWGN-PQTPAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKP  119

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPC  7
             A KC A+ CTANING+CP ALKVPGGCNNPC
Sbjct  120  SAGKCHAIHCTANINGECPRALKVPGGCNNPC  151



>ref|XP_006358892.1| PREDICTED: osmotin-like protein OSML15-like [Solanum tuberosum]
 gb|AAU95238.1| osmotin-like protein [Solanum phureja]
Length=250

 Score =   255 bits (652),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+ PVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  17   TYTYASGVFEVHNNCPYTVWAAAVPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL C GWGKPPNTLAEYALNQFGNLDF+DIS++DGFNIPM F PTK
Sbjct  77   GAGRGGCQTGDCGGVLDCKGWGKPPNTLAEYALNQFGNLDFWDISVIDGFNIPMSFGPTK  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  KC  + CTANING+CP +L+VPGGCNNPCTT
Sbjct  137  PGPGKCHGIQCTANINGECPGSLRVPGGCNNPCTT  171



>gb|AAS48588.1| putative osmotin-like protein precursor [Brassica juncea]
Length=228

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -3

Query  423  CPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCGG  244
            CPYTVWAASTP+GGGRRLDRGQTW I AP GT MARIWGRTNC FD +GRGSCQTGDCGG
Sbjct  11   CPYTVWAASTPIGGGRRLDRGQTWVINAPRGTSMARIWGRTNCNFDGAGRGSCQTGDCGG  70

Query  243  VLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTAN  64
            VLQCTGWGKPPNTLAEYALNQF NLDF+DISLVDGFNIPM FAPT     KC ++ CTAN
Sbjct  71   VLQCTGWGKPPNTLAEYALNQFSNLDFWDISLVDGFNIPMTFAPTNPSGGKCHSIQCTAN  130

Query  63   INGQCPAALKVPGGCNNPCTT  1
            ING+CPAAL+VPGGCNNPCTT
Sbjct  131  INGECPAALRVPGGCNNPCTT  151



>dbj|BAD15089.1| pathogenesis-related protein [Nicotiana tabacum]
Length=244

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  10   TYTYASGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFD  69

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK
Sbjct  70   GAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTK  129

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  KC  + CTANING+CP +L+VPGGCNNPCTT
Sbjct  130  PGPGKCHGIQCTANINGECPGSLRVPGGCNNPCTT  164



>ref|XP_009782397.1| PREDICTED: osmotin-like protein [Nicotiana sylvestris]
 dbj|BAD15090.1| pathogenesis-related protein [Nicotiana tabacum]
Length=251

 Score =   255 bits (651),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+TPVGGG+RL+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  17   TYTYASGVFEVHNNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK
Sbjct  77   GAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTK  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  KC  + CTANING+CP AL+VPGGCNNPCTT
Sbjct  137  PGPGKCHGIQCTANINGECPGALRVPGGCNNPCTT  171



>emb|CAH69228.1| putative osmotin-like protein [Nicotiana glauca]
Length=251

 Score =   254 bits (649),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            +  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG
Sbjct  22   SGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK G  K
Sbjct  82   WCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGK  141

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + CTANING+CP +L+VPGGCNNPCTT
Sbjct  142  CHGIQCTANINGECPGSLRVPGGCNNPCTT  171



>pdb|1AUN|A Chain A, Pathogenesis-Related Protein 5d From Nicotiana Tabacum
Length=208

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            +  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG
Sbjct  1    SGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRG  60

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK G  K
Sbjct  61   WCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGK  120

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + CTANING+CP +L+VPGGCNNPCTT
Sbjct  121  CHGIQCTANINGECPGSLRVPGGCNNPCTT  150



>ref|XP_004245628.2| PREDICTED: osmotin-like protein OSML15 [Solanum lycopersicum]
Length=250

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            +  FEV NNCPYTVWAA+ PVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG
Sbjct  22   SGVFEVHNNCPYTVWAAAVPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGGVL C GWGKPPNTLAEYALNQFGNLDF+DIS++DGFNIPM F PTK G  K
Sbjct  82   WCQTGDCGGVLDCKGWGKPPNTLAEYALNQFGNLDFWDISVIDGFNIPMSFGPTKPGPGK  141

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + CTANING+CP +L+VPGGCNNPCTT
Sbjct  142  CHPIQCTANINGECPGSLRVPGGCNNPCTT  171



>gb|KCW77574.1| hypothetical protein EUGRSUZ_D01888 [Eucalyptus grandis]
Length=241

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F  S++ TF VRNNCPYTVWAA++P GGGRRLDRGQTW +  PAGT MARIWGRTNC FD
Sbjct  14   FAPSHSTTFTVRNNCPYTVWAAASP-GGGRRLDRGQTWTLNVPAGTSMARIWGRTNCNFD  72

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG CQTGDCG VLQCTGWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F+PT+
Sbjct  73   ASGRGHCQTGDCGNVLQCTGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFSPTR  132

Query  105  AGAN-KCRAVSCTANINGQCPAALKVPGGCNNPCT  4
              +  KCR + CT+++NGQCP  LK PGGCNNPCT
Sbjct  133  PSSKAKCRQIKCTSDVNGQCPNQLKAPGGCNNPCT  167



>gb|AHA83528.1| osmotin-like protein [Hevea brasiliensis]
Length=246

 Score =   252 bits (643),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTSS  ATF +RNNCPYTVWAA++P GGGRRLD+GQTW +  PAGT MARIWGRTNC FD
Sbjct  19   FTSSDGATFTIRNNCPYTVWAAASP-GGGRRLDQGQTWELNVPAGTSMARIWGRTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SG+G CQTGDCGG+L C GWG PPNTLAEYALNQ+GNLDF+DISLVDGFNIP+ F+PT 
Sbjct  78   GSGKGHCQTGDCGGILACQGWGVPPNTLAEYALNQYGNLDFYDISLVDGFNIPIEFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               +KCR + CTA+INGQCP  LK PGGCNNPCT 
Sbjct  138  GAKDKCRPLFCTADINGQCPKELKAPGGCNNPCTV  172



>emb|CAB86199.1| pathogenesis-related protein (PR-5 protein) [Solanum lycopersicum]
Length=249

 Score =   251 bits (642),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            +  FEV NNCPYTVWAA+ PVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG
Sbjct  22   SGVFEVHNNCPYTVWAAAVPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGGVL C GWGKPPNTLAEYALNQFGNLDF+DIS++DGFNIPM F PTK G  K
Sbjct  82   WCQTGDCGGVLDCKGWGKPPNTLAEYALNQFGNLDFWDISVIDGFNIPMSFGPTKPGPGK  141

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + CTANING+CP +L+VPGGCN PCTT
Sbjct  142  CHPIQCTANINGECPGSLRVPGGCNKPCTT  171



>ref|NP_001234351.1| PR5-like protein precursor [Solanum lycopersicum]
 gb|AAP43673.1| PR5-like protein [Solanum lycopersicum]
 gb|ACZ71038.1| PR5-like protein [Solanum lycopersicum]
Length=250

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  17   TYTYASGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT 
Sbjct  77   GAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTN  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  KC  + C ANING+CP +L+VPGGCNNPCTT
Sbjct  137  PGPGKCHPIQCVANINGECPGSLRVPGGCNNPCTT  171



>gb|AAQ95740.1| osmotin-like protein [Solanum tuberosum]
Length=177

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            +  FEV NNCPYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG
Sbjct  6    SGVFEVHNNCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRG  65

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  K
Sbjct  66   GCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGK  125

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + C ANING+CP +L+VPGGCNNPCTT
Sbjct  126  CHPIQCVANINGECPDSLRVPGGCNNPCTT  155



>gb|AAP86781.1| osmotin-like protein [Capsicum annuum]
Length=250

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+TPVGGG+ L+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  17   TYTYASGVFEVHNNCPYTVWAAATPVGGGKLLERGQSWWFWAPPGTKMARIWGRTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK
Sbjct  77   GAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTK  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  KC  + C ANING+CP +L+VPGGCNNPCTT
Sbjct  137  PGPGKCHPIQCVANINGECPGSLRVPGGCNNPCTT  171



>ref|XP_006358891.1| PREDICTED: osmotin-like protein OSML15-like [Solanum tuberosum]
 sp|P50703.1|OS35_SOLCO RecName: Full=Osmotin-like protein OSML15; AltName: Full=PA15; 
Flags: Precursor [Solanum commersonii]
 emb|CAA47669.1| osmotin-like protein [Solanum commersonii]
 gb|AAU93854.1| osmotin-like protein A35 [Solanum phureja]
 gb|AAU95239.1| osmotin-like protein [Solanum phureja]
Length=250

 Score =   250 bits (638),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            +  FEV NNCPYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG
Sbjct  22   SGVFEVHNNCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  K
Sbjct  82   WCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGK  141

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + C ANING+CP +L+VPGGCNNPCTT
Sbjct  142  CHPIQCVANINGECPGSLRVPGGCNNPCTT  171



>gb|AAG34079.1|AF294847_1 PR5-like protein [Capsicum annuum]
Length=180

 Score =   247 bits (631),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAASTP+GGGRRL+RGQTW I AP GTKMARIWGRT C F+++GRGSCQTGDC
Sbjct  1    NNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGSCQTGDC  60

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            GGVLQ TGWGKPPNTLAEYAL+QF NLDF+DISLVDGFNIPM FAPTK    KC A+ CT
Sbjct  61   GGVLQWTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCT  120

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            ANING+CP ALKVPGGCN+PCTT
Sbjct  121  ANINGECPRALKVPGGCNDPCTT  143



>gb|AAU95242.1| osmotin-like protein [Solanum tuberosum]
Length=250

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            +  FEV NNCPYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG
Sbjct  22   SGVFEVHNNCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             C+TGDCGGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  K
Sbjct  82   WCETGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGK  141

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + C ANING+CP +L+VPGGCNNPCTT
Sbjct  142  CHPIQCVANINGECPGSLRVPGGCNNPCTT  171



>gb|AAN40692.1| thaumatin-like protein [Solanum aethiopicum]
Length=186

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -3

Query  426  NCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCG  247
            NCPYTVWAASTP+GGG+RLD+GQ+W I AP GT MARIWGRTNC FD +GRGSCQTGDCG
Sbjct  1    NCPYTVWAASTPIGGGQRLDQGQSWIIDAPRGTSMARIWGRTNCNFDGAGRGSCQTGDCG  60

Query  246  GVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTA  67
            GVLQCTGWGKPPNTLAEYALNQF NLDF+DISLVDGFNIPM FAPT     KC ++ CTA
Sbjct  61   GVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKCHSIQCTA  120

Query  66   NINGQCPAALKVPGGCNNPCT  4
            NING+CPA L+VPGGCNNPCT
Sbjct  121  NINGECPAELRVPGGCNNPCT  141



>emb|CAA43854.1| osmotin [Nicotiana tabacum]
Length=245

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GT MAR+WGRTNC F++
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTNMARVWGRTNCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF  LDF+DISLVDGFNIPM FAPT  
Sbjct  77   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLVDGFNIPMTFAPTNP  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTANI  +    L+VPGGCNNPCTT
Sbjct  137  SGGKCHAIHCTANIR-RMSRELRVPGGCNNPCTT  169



>gb|AAA34089.1| osmotin [Nicotiana tabacum]
Length=243

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T +YAAT EVRNNCPYTVWAASTP+GGGRRLDRGQTW I AP GTKMAR+WGRTNC F++
Sbjct  17   TYTYAATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARVWGRTNCNFNA  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF  LDF+DISL+DGFNIP+ F PT  
Sbjct  77   AGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLLDGFNIPITF-PTNP  135

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               KC A+ CTA ING+CPA L+VPGGCNNPCTT
Sbjct  136  SGGKCHAL-CTA-INGECPAELRVPGGCNNPCTT  167



>ref|XP_010053305.1| PREDICTED: protein NP24-like [Eucalyptus grandis]
Length=425

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F  S++ TF VRNNCPYTVWAA++P GGGRRLDRGQTW +  PAGT MARIWGRTNC FD
Sbjct  14   FAPSHSTTFTVRNNCPYTVWAAASP-GGGRRLDRGQTWTLNVPAGTSMARIWGRTNCNFD  72

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG CQTGDCG VLQCTGWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F+PT+
Sbjct  73   ASGRGHCQTGDCGNVLQCTGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFSPTR  132

Query  105  AGAN-KCRAVSCTANINGQCPAALKVPGGCNNPCT  4
              +  KCR + CT+++NGQCP  LK PGGCNNPCT
Sbjct  133  PSSKAKCRQIKCTSDVNGQCPNQLKAPGGCNNPCT  167


 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 119/154 (77%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            +T  ++ATF++ N C YTVWAA++P GGGRRLD  QTW +T   GT MARIWGRTNC FD
Sbjct  218  YTVVFSATFDIVNQCTYTVWAAASP-GGGRRLDPSQTWSLTVAPGTTMARIWGRTNCNFD  276

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++G+G C++GDC  +L C GWG PPNTLAE+ALNQ  N+DF DISLVDGFNIPM F+PT 
Sbjct  277  ANGQGQCESGDCNRLLDCQGWGSPPNTLAEFALNQPNNVDFLDISLVDGFNIPMDFSPTT  336

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
                 CR + C A+INGQCPA LK PGGCNNPCT
Sbjct  337  GA---CRGIRCAADINGQCPAELKAPGGCNNPCT  367



>gb|AGC39177.1| thaumatin-like protein [Actinidia chinensis]
Length=244

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F+S++AATFE+RNNCPYTVWAA++P GGGRRL+  Q W +   AGTKMARIWGRT C FD
Sbjct  19   FSSAHAATFEIRNNCPYTVWAAASP-GGGRRLNSKQQWNLNVAAGTKMARIWGRTKCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SGRG C+TGDCGGVL+C GWG PPNTLAEYALNQFGNLDFFDISLVDGFNIPM F+PT+
Sbjct  78   GSGRGHCETGDCGGVLECKGWGVPPNTLAEYALNQFGNLDFFDISLVDGFNIPMDFSPTR  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            + + KCR +SCTANI GQCP  LK  GGC+NPCT 
Sbjct  138  SPSGKCRPISCTANIIGQCPNPLKTAGGCHNPCTV  172



>ref|XP_002299521.2| hypothetical protein POPTR_0001s09570g [Populus trichocarpa]
 gb|EEE84326.2| hypothetical protein POPTR_0001s09570g [Populus trichocarpa]
Length=246

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 130/151 (86%), Gaps = 2/151 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATFE+RNNCPYTVWAA++P GGGRRLDRGQTW +  PAGT MARIWGRTNC FD SGRG
Sbjct  23   AATFEIRNNCPYTVWAAASP-GGGRRLDRGQTWYLNVPAGTSMARIWGRTNCNFDGSGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN-  94
             CQTGDC G L+C GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F+PT +G + 
Sbjct  82   RCQTGDCTGGLECKGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFSPTSSGGSG  141

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            KC+A+ CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  142  KCQALLCTADINGQCPNELRAPGGCNNPCTV  172



>gb|ACZ67185.1| pathogenesis-related thaumatin, partial [Populus deltoides]
Length=241

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 130/151 (86%), Gaps = 2/151 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATFE+RNNCPYTVWAA++P GGGRRLDRGQTW +  PAGT MARIWGRTNC FD SGRG
Sbjct  23   AATFEIRNNCPYTVWAAASP-GGGRRLDRGQTWYLNVPAGTSMARIWGRTNCNFDGSGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN-  94
             CQTGDC G L+C GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F+PT +G + 
Sbjct  82   RCQTGDCTGGLECKGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFSPTSSGGSG  141

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            KC+A+ CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  142  KCQALLCTADINGQCPNELRAPGGCNNPCTV  172



>emb|CAN71616.1| hypothetical protein VITISV_023861 [Vitis vinifera]
Length=247

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 128/154 (83%), Gaps = 4/154 (3%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            +S +AATF++ N C YTVWAA++P GGGRRLDRGQ+W +  PAGTKMARIWGRTNC FD+
Sbjct  24   SSIHAATFQITNQCSYTVWAAASP-GGGRRLDRGQSWTLNVPAGTKMARIWGRTNCHFDA  82

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SGRG C TGDCGGVL C GWG PPNTLAEYALNQFGN DFFDISLVDGFNIPM F+PT  
Sbjct  83   SGRGRCDTGDCGGVLNCQGWGSPPNTLAEYALNQFGNKDFFDISLVDGFNIPMDFSPTSG  142

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G   CR + CTANINGQCP ALK PGGCNNPCT 
Sbjct  143  G---CRGIKCTANINGQCPQALKAPGGCNNPCTV  173



>gb|ADD51187.1| thaumatin-like protein [Vitis cinerea var. helleri x Vitis riparia]
Length=239

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 128/155 (83%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +S +AATF++ N C YTVWAA++P GGGRRLDRGQ+W +  PAGTKMARIWGRTNC FD
Sbjct  15   ISSIHAATFQITNQCSYTVWAAASP-GGGRRLDRGQSWTLNVPAGTKMARIWGRTNCHFD  73

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG C TGDCGGVL C GWG PPNTLAEYALNQFGN DFFDISLVDGFNIPM F+PT 
Sbjct  74   ASGRGRCDTGDCGGVLNCQGWGSPPNTLAEYALNQFGNKDFFDISLVDGFNIPMDFSPTS  133

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   CR + CTANINGQCP ALK PGGCNNPCT 
Sbjct  134  GG---CRGIKCTANINGQCPQALKAPGGCNNPCTV  165



>ref|XP_002282917.2| PREDICTED: protein P21 [Vitis vinifera]
Length=262

 Score =   245 bits (625),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 128/155 (83%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +S +AATF++ N C YTVWAA++P GGGRRLDRGQ+W +  PAGTKMARIWGRTNC FD
Sbjct  38   ISSIHAATFQITNQCSYTVWAAASP-GGGRRLDRGQSWTLNVPAGTKMARIWGRTNCHFD  96

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG C TGDCGGVL C GWG PPNTLAEYALNQFGN DFFDISLVDGFNIPM F+PT 
Sbjct  97   ASGRGRCDTGDCGGVLNCQGWGSPPNTLAEYALNQFGNKDFFDISLVDGFNIPMDFSPTS  156

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   CR + CTANINGQCP ALK PGGCNNPCT 
Sbjct  157  RG---CRGIKCTANINGQCPQALKAPGGCNNPCTV  188



>ref|XP_011016810.1| PREDICTED: osmotin-like protein OSM34, partial [Populus euphratica]
Length=243

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 129/151 (85%), Gaps = 2/151 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATFE+RNNCPYTVWAA++P GGGRRLDRGQTW +  PAGT MARIWGRTNC FD SGRG
Sbjct  20   AATFEIRNNCPYTVWAAASP-GGGRRLDRGQTWYLNVPAGTSMARIWGRTNCNFDGSGRG  78

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN-  94
             CQTGDC G L C GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F+PT +G + 
Sbjct  79   RCQTGDCTGGLVCKGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFSPTSSGGSG  138

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            KC+A+ CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  139  KCQALLCTADINGQCPNELRAPGGCNNPCTV  169



>gb|AAG34078.1|AF294846_1 PR5-like protein, partial [Capsicum annuum]
Length=180

 Score =   241 bits (614),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA+TPVGGG+RL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDC
Sbjct  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC  60

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            GGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PTK G  KC  + C 
Sbjct  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV  120

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            ANING+CP +L+VPGGCNNPCTT
Sbjct  121  ANINGECPGSLRVPGGCNNPCTT  143



>gb|AAO48958.1| osmotin-like protein [Solanum tuberosum]
Length=154

 Score =   239 bits (609),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  NCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCG  247
            NCPYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCG
Sbjct  1    NCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGGCQTGDCG  60

Query  246  GVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTA  67
            GVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C A
Sbjct  61   GVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVA  120

Query  66   NINGQCPAALKVPGGCNNPCTT  1
            NING+CP +L+VPGGCNNPCTT
Sbjct  121  NINGECPXSLRVPGGCNNPCTT  142



>gb|AAD55090.1| thaumatin [Vitis riparia]
Length=247

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 127/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            +S +AATF++ N C YTVWAA++P GGGRRLDRGQ+W +  PAGTKMARIWGRTNC FD+
Sbjct  24   SSIHAATFQITNQCSYTVWAAASP-GGGRRLDRGQSWTLNVPAGTKMARIWGRTNCHFDA  82

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SGRG C TGDCGGVL C GWG PPNTLAEYALNQFGN DFFDISLVDGFNIPM F+PT  
Sbjct  83   SGRGRCDTGDCGGVLNCQGWGSPPNTLAEYALNQFGNKDFFDISLVDGFNIPMDFSPTSG  142

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G   CR + CTANINGQCP ALK  GGCNNPCT 
Sbjct  143  G---CRGIKCTANINGQCPQALKASGGCNNPCTV  173



>gb|AAO48965.1| osmotin-like protein [Solanum tuberosum]
Length=158

 Score =   238 bits (608),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  NCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCG  247
            NCPYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCG
Sbjct  1    NCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGGCQTGDCG  60

Query  246  GVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTA  67
            GVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C A
Sbjct  61   GVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVA  120

Query  66   NINGQCPAALKVPGGCNNPCTT  1
            NING+CP +L+VPGGCNNPCTT
Sbjct  121  NINGECPXSLRVPGGCNNPCTT  142



>emb|CDP09786.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   241 bits (614),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = -3

Query  459  SSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSS  280
            S++AATF++RNNCPYTVWAA+ P GGGRRLDRGQTW I   AGT  ARIW RTNC FD +
Sbjct  21   SAHAATFDIRNNCPYTVWAAAKP-GGGRRLDRGQTWTINVAAGTAGARIWARTNCNFDGN  79

Query  279  GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAG  100
            GRGSCQTGDCGGVLQCT +G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT  G
Sbjct  80   GRGSCQTGDCGGVLQCTAYGRPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTSNG  139

Query  99   ANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
                R + CTA+INGQCP+ LK PGGCNNPCT
Sbjct  140  CT--RGIRCTADINGQCPSVLKAPGGCNNPCT  169



>ref|XP_011029305.1| PREDICTED: osmotin-like protein OSM34 [Populus euphratica]
Length=246

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = -3

Query  459  SSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSS  280
            S+ AATFE+RN+CPYTVWAA++P GGGRRL+RGQTW +  PAGT MARIWGRTNC FD  
Sbjct  20   STNAATFEIRNSCPYTVWAAASP-GGGRRLERGQTWNLNVPAGTSMARIWGRTNCNFDGG  78

Query  279  GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAG  100
            G+G CQTGDC G L+C GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F+PT +G
Sbjct  79   GQGRCQTGDCTGGLECKGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFSPTSSG  138

Query  99   AN-KCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             + KC+A+ CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  139  GSGKCQALLCTADINGQCPNELRAPGGCNNPCTV  172



>gb|AAO48966.1| osmotin-like protein [Solanum tuberosum]
Length=167

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  NCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCG  247
            NCPYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCG
Sbjct  1    NCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGGCQTGDCG  60

Query  246  GVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTA  67
            GVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C A
Sbjct  61   GVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVA  120

Query  66   NINGQCPAALKVPGGCNNPCTT  1
            NING+CP +L+VPGGCNNPCTT
Sbjct  121  NINGECPDSLRVPGGCNNPCTT  142



>gb|AAO48967.1| osmotin-like protein [Solanum tuberosum]
Length=166

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  NCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCG  247
            NCPYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCG
Sbjct  1    NCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCG  60

Query  246  GVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTA  67
            GVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C A
Sbjct  61   GVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVA  120

Query  66   NINGQCPAALKVPGGCNNPCTT  1
            NING+CP +L+VPGGCNNPCTT
Sbjct  121  NINGECPGSLRVPGGCNNPCTT  142



>ref|XP_002299547.2| P21 family protein [Populus trichocarpa]
 gb|EEE84352.2| P21 family protein [Populus trichocarpa]
Length=245

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S+ AATFE+RN+CPYTVWAA++P GGGRRL+RGQTW +  PAGT MARIWGRTNC FD
Sbjct  19   FISTNAATFEIRNSCPYTVWAAASP-GGGRRLERGQTWNLNVPAGTSMARIWGRTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
              G+G CQTGDC G L+C GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIP+ F+PT 
Sbjct  78   GGGKGRCQTGDCTGGLECKGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPIEFSPT-  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            +G  KC+A+ CTA+INGQCP  L+ PGGCNNPC+ 
Sbjct  137  SGGGKCQALLCTADINGQCPNELRAPGGCNNPCSV  171



>gb|AAO48959.1| osmotin-like protein [Solanum tuberosum]
Length=171

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  426  NCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCG  247
            NCPYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCG
Sbjct  1    NCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCG  60

Query  246  GVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTA  67
            GVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C A
Sbjct  61   GVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVA  120

Query  66   NINGQCPAALKVPGGCNNPCTT  1
            NING+CP +L+VPGGCNNPCTT
Sbjct  121  NINGECPGSLRVPGGCNNPCTT  142



>gb|AAQ74156.1| osmotin-like protein I [Gossypium hirsutum]
Length=242

 Score =   239 bits (609),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S++AA FE+RN C YTVWAA++P GGGRRLD  Q+W I  PAGT MARIWGRTNC FD
Sbjct  19   FISAHAARFEIRNECSYTVWAAASP-GGGRRLDPRQSWTIDVPAGTAMARIWGRTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG CQTGDCGG+LQC GWG PPNTLAEYALNQFGN+DF+DISLVDGFNIPM F PT 
Sbjct  78   ASGRGHCQTGDCGGLLQCKGWGVPPNTLAEYALNQFGNMDFYDISLVDGFNIPMVFGPTN  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   C  + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  138  GG---CHNIRCTADINGQCPNELRAPGGCNNPCTV  169



>gb|AAQ13823.1|AF192271_1 osmotin-like pathogenesis-related protein [Gossypium hirsutum]
Length=238

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S++AA FE+RN C YTVWAA++P GGGRRLD  Q+W I  PAGT MARIWGRTNC FD
Sbjct  15   FISAHAARFEIRNECSYTVWAAASP-GGGRRLDPRQSWTIDVPAGTAMARIWGRTNCNFD  73

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG CQTGDCGG+LQC GWG PPNTLAEYALNQFGN+DF+DISLVDGFNIPM F PT 
Sbjct  74   ASGRGHCQTGDCGGLLQCKGWGVPPNTLAEYALNQFGNMDFYDISLVDGFNIPMVFGPTN  133

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   C  + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  134  GG---CHNIRCTADINGQCPNELRAPGGCNNPCTV  165



>ref|XP_002874708.1| ATOSM34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50967.1| ATOSM34 [Arabidopsis lyrata subsp. lyrata]
Length=244

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 127/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATFE+ N C YTVWAA++P GGGRRLD GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFEILNQCSYTVWAAASP-GGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG CQTGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            +    C  + CTA+INGQCP  LK PGGCNNPCT
Sbjct  136  S---NCHRILCTADINGQCPNVLKAPGGCNNPCT  166



>ref|XP_011029221.1| PREDICTED: osmotin-like protein OSM34 [Populus euphratica]
Length=246

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = -3

Query  459  SSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSS  280
            S+ AATFE+RN+CPYTVWAA++P GGGRRL+RGQTW +  PAGT MARIWGRTNC FD  
Sbjct  20   STNAATFEIRNSCPYTVWAAASP-GGGRRLERGQTWNLNVPAGTSMARIWGRTNCNFDGG  78

Query  279  GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAG  100
            G+G CQTGDC G L+C GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIP+ F+PT  G
Sbjct  79   GQGRCQTGDCTGGLECKGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPIEFSPTSGG  138

Query  99   AN-KCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             + KC+A+ CTA+INGQCP  L+ PGGCNNPC+ 
Sbjct  139  GSGKCQALLCTADINGQCPKELRAPGGCNNPCSV  172



>gb|AAQ22606.1| At4g11650 [Arabidopsis thaliana]
 dbj|BAF00218.1| osmotin precursor like protein [Arabidopsis thaliana]
Length=244

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 128/155 (83%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATFE+ N C YTVWAA++P GGGRRLD GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFEILNQCSYTVWAAASP-GGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG CQTGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPT-  134

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
              ++ C  + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  135  --SSNCHRILCTADINGQCPNVLRAPGGCNNPCTV  167



>ref|NP_192902.1| osmotin-like protein OSM34 [Arabidopsis thaliana]
 sp|P50700.2|OSL3_ARATH RecName: Full=Osmotin-like protein OSM34; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB39936.1| osmotin precursor [Arabidopsis thaliana]
 emb|CAB78208.1| osmotin precursor [Arabidopsis thaliana]
 gb|AEE83033.1| osmotin-like protein OSM34 [Arabidopsis thaliana]
Length=244

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATFE+ N C YTVWAA++P GGGRRLD GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFEILNQCSYTVWAAASP-GGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG CQTGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            +    C  + CTA+INGQCP  L+ PGGCNNPCT
Sbjct  136  S---NCHRILCTADINGQCPNVLRAPGGCNNPCT  166



>emb|CAA61411.1| osmotin [Arabidopsis thaliana]
Length=244

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 128/154 (83%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATFE+ N C YTVWAA++P GGGRRLD GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFEILNQCSYTVWAAASP-GGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG CQTGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPT-  134

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
              ++ C  + CTA+INGQCP  L+ PGGCNNPCT
Sbjct  135  --SSNCHRILCTADINGQCPNVLRAPGGCNNPCT  166



>gb|AAM61750.1| osmotin precursor [Arabidopsis thaliana]
Length=244

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 126/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATFE+ N C YTVWAA++P GGGRRLD GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFEILNQCSYTVWAAASP-GGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG CQTGDC G LQCTGWG PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCQTGDCSGGLQCTGWGHPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            +    C  + CTA+INGQCP  L+ PGGCNNPCT
Sbjct  136  S---NCHRILCTADINGQCPNVLRAPGGCNNPCT  166



>ref|XP_010255471.1| PREDICTED: protein P21 [Nelumbo nucifera]
Length=227

 Score =   236 bits (602),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 128/154 (83%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT + AATFE+RN CPYTVWAA++P GGG+RL++GQ+W I  PAGT MARIWGRTNC FD
Sbjct  22   FTFTQAATFEIRNQCPYTVWAAASP-GGGQRLEQGQSWTINVPAGTTMARIWGRTNCNFD  80

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++GRG CQTGDCGG+LQC G+G PPNTLAEYALNQF N+DFFDIS++DGFNIPM F+PT 
Sbjct  81   ANGRGQCQTGDCGGLLQCQGYGSPPNTLAEYALNQFNNMDFFDISVIDGFNIPMDFSPTT  140

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
                 CR + C A+I GQCPA LK PGGCNNPCT
Sbjct  141  G---NCRGIRCAADIIGQCPAELKTPGGCNNPCT  171



>gb|AAO13658.1| osmotin-like protein linusitin [Linum usitatissimum]
Length=263

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA  ++ NNCPYTVWAASTP+GGGR+LD GQTW I  PAGT MARIWGR NC FD SGRG
Sbjct  24   AAVIDIFNNCPYTVWAASTPIGGGRQLDHGQTWTIYPPAGTSMARIWGRRNCNFDGSGRG  83

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPT-KAGAN  94
             C+TGDCGGVL C GWG PPNTLAEYALNQF NLDF+DISLVDGFNIPM F PT   G+ 
Sbjct  84   WCETGDCGGVLNCQGWGVPPNTLAEYALNQFSNLDFYDISLVDGFNIPMIFTPTANVGSG  143

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             C++++CTA+IN QCP  L+ PGGCNNPCT
Sbjct  144  NCQSLTCTADINTQCPGELRAPGGCNNPCT  173



>ref|XP_010273138.1| PREDICTED: protein P21-like [Nelumbo nucifera]
Length=224

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 129/155 (83%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT ++AA FE+RN C YTVWAA++P GGGRRL+RGQ+W I  PAGTK ARIWGRTNC FD
Sbjct  19   FTFTHAAQFEIRNQCAYTVWAAASP-GGGRRLERGQSWTINVPAGTKGARIWGRTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++GRG CQTGDCGGVLQC G+G PPNTLAEYALNQ+ NLDFFDISLVDGFNIPM F+PT 
Sbjct  78   ANGRGRCQTGDCGGVLQCQGYGVPPNTLAEYALNQYNNLDFFDISLVDGFNIPMDFSPT-  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
              +  CR + C+A+I GQCPA L+ PGGCNNPCT 
Sbjct  137  --SGNCRGIKCSADIVGQCPAELRAPGGCNNPCTV  169



>ref|XP_004298782.1| PREDICTED: osmotin-like protein OSM34-like [Fragaria vesca subsp. 
vesca]
Length=248

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 125/150 (83%), Gaps = 5/150 (3%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATFE+RN CPYTVWAA++P GGGRRLDRGQ+W +   AGTKMARIWGRTNCKFD+SGRG
Sbjct  29   AATFEIRNECPYTVWAAASP-GGGRRLDRGQSWNLNVAAGTKMARIWGRTNCKFDNSGRG  87

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             C TGDC G L+C GWG PPNTLAEYALNQFGN+DF DISLVDGFNIPM F+PT  G   
Sbjct  88   RCATGDC-GALECNGWGVPPNTLAEYALNQFGNMDFIDISLVDGFNIPMDFSPTSGG---  143

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            CR + CTA+INGQCP  LKVP GCNNPCT 
Sbjct  144  CRGIRCTADINGQCPGELKVPSGCNNPCTV  173



>gb|AAQ14497.1|AF304007_1 osmotin-like protein [Gossypium hirsutum]
Length=242

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S++AA FE+RN CPYTVWAA++P GGGRRLD  Q+W I  PAGT MARIWGRTNC FD
Sbjct  19   FISAHAARFEIRNECPYTVWAAASP-GGGRRLDPRQSWTINVPAGTAMARIWGRTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++GRG CQTGDCGG+L+C GWG PPNTLAEY+LNQFGN+DF+DISL+DGFNIPM F PT 
Sbjct  78   ANGRGHCQTGDCGGLLECQGWGVPPNTLAEYSLNQFGNMDFYDISLIDGFNIPMVFGPTN  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   C  + CTA++ GQCP  L+ PGGCNNPCT 
Sbjct  138  GG---CHNIRCTADLKGQCPNELRAPGGCNNPCTV  169



>gb|KFK31917.1| hypothetical protein AALP_AA6G175700 [Arabis alpina]
Length=244

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 126/153 (82%), Gaps = 4/153 (3%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            +++ AATFE+ N C YTVWAA++P GGGRRL+ GQ+W +  PAGT MARIWGRTNC FDS
Sbjct  18   STATAATFEILNQCSYTVWAAASP-GGGRRLNSGQSWTLNVPAGTAMARIWGRTNCNFDS  76

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SGRG C+TGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT +
Sbjct  77   SGRGRCETGDCTGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSS  136

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
                C  + CTA+INGQCP  LK PGGCNNPCT
Sbjct  137  ---SCHRIICTADINGQCPNVLKAPGGCNNPCT  166



>gb|AAQ74155.1| osmotin-like protein II [Gossypium hirsutum]
Length=234

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S++AA FE+RN CPYTVWAA++P GGGRRLD  Q+W I  PAGT MARIWGRTNC FD
Sbjct  11   FISAHAARFEIRNECPYTVWAAASP-GGGRRLDPRQSWTINVPAGTAMARIWGRTNCNFD  69

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++GRG CQTGDCGG+L+C GWG PPNTLAEY+LNQFGN+DF+DISL+DGFNIPM F PT 
Sbjct  70   ANGRGHCQTGDCGGLLECQGWGVPPNTLAEYSLNQFGNMDFYDISLIDGFNIPMVFGPTN  129

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   C  + CTA++ GQCP  L+ PGGCNNPCT 
Sbjct  130  GG---CHNIRCTADLKGQCPNELRAPGGCNNPCTV  161



>gb|ABB86297.1| thaumatin-like protein isoform 1 [Ficus pumila var. awkeotsang]
Length=244

 Score =   234 bits (597),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 125/155 (81%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F+SS AA+FE+RN C Y VWAA++P GGGRRLD  Q W +  PAGT MARIWGRTNC FD
Sbjct  20   FSSSNAASFEIRNECSYPVWAAASP-GGGRRLDPTQNWILNVPAGTSMARIWGRTNCNFD  78

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGG+LQC GWG PPNTLAE+ALNQFGNLDF+DISLVDGFNIPM F PT+
Sbjct  79   GAGRGRCQTGDCGGLLQCQGWGNPPNTLAEHALNQFGNLDFYDISLVDGFNIPMSFGPTR  138

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   C+ + CTA+INGQCP  L+ PGGC NPCT 
Sbjct  139  GG---CKVIGCTADINGQCPNELRTPGGCQNPCTV  170



>ref|XP_007040165.1| Osmotin 34 [Theobroma cacao]
 gb|EOY24666.1| Osmotin 34 [Theobroma cacao]
Length=240

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S++AA FE+RN C YTVWAA++P GGGRRLD  Q+W I  PAGT MARIWGRTNC FD
Sbjct  18   FISTHAALFEIRNECSYTVWAAASP-GGGRRLDPWQSWTINVPAGTAMARIWGRTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SGRG C+TGDCGG+L+C GWG PPNTLAEYALNQFGN+DF+DISLVDGFNIPM F PT 
Sbjct  77   GSGRGQCKTGDCGGLLECRGWGAPPNTLAEYALNQFGNMDFYDISLVDGFNIPMVFGPTS  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   C  + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  137  GG---CHNIWCTADINGQCPNELRAPGGCNNPCTV  168



>ref|XP_010434611.1| PREDICTED: osmotin-like protein OSM34 [Camelina sativa]
Length=244

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATF++ N C YTVWAA++P GGGRRL+ GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFDILNQCSYTVWAAASP-GGGRRLNSGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG C+TGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCETGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            +    C  + CTA+INGQCP  L+ PGGCNNPCT
Sbjct  136  S---NCHRIVCTADINGQCPNVLRAPGGCNNPCT  166



>ref|XP_010422118.1| PREDICTED: osmotin-like protein OSM34 [Camelina sativa]
 ref|XP_010455577.1| PREDICTED: osmotin-like protein OSM34 [Camelina sativa]
Length=244

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATF++ N C YTVWAA++P GGGRRL+ GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFDILNQCSYTVWAAASP-GGGRRLNSGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG C+TGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCETGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            +    C  + CTA+INGQCP  L+ PGGCNNPCT
Sbjct  136  S---NCHRIVCTADINGQCPNVLRAPGGCNNPCT  166



>ref|XP_010024640.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW61091.1| hypothetical protein EUGRSUZ_H03865 [Eucalyptus grandis]
Length=225

 Score =   232 bits (592),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 126/155 (81%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             TS+ AATF++RNNCPYTVWAA+ P GGGRRLDRGQ+W +    GTK ARIW RTNC+FD
Sbjct  19   LTSANAATFDIRNNCPYTVWAAAVP-GGGRRLDRGQSWSLNVSPGTKQARIWARTNCQFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +G+G CQTGDCGGVL+C  +G+PPNTLAEYALNQFG  DFFDISLVDGFN+PM F+PT 
Sbjct  78   GAGKGKCQTGDCGGVLECKSFGQPPNTLAEYALNQFGGKDFFDISLVDGFNVPMDFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            +G    R + CTA+INGQCP  LK PGGCNNPCT 
Sbjct  138  SGCT--RGIKCTADINGQCPTQLKAPGGCNNPCTV  170



>ref|XP_006288543.1| hypothetical protein CARUB_v10001823mg [Capsella rubella]
 gb|EOA21441.1| hypothetical protein CARUB_v10001823mg [Capsella rubella]
Length=244

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 127/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATF++ N C YTVWAA++P GGGRRL+ GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFDILNQCSYTVWAAASP-GGGRRLNSGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG C+TGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   ASGRGRCETGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            +    C  + CTA+INGQCP  L+ PGGCNNPCT
Sbjct  136  S---NCHRIVCTADINGQCPNVLRAPGGCNNPCT  166



>gb|ADO32898.1| thaumatin-like protein [Vincetoxicum mongolicum]
Length=225

 Score =   231 bits (590),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F +SYAATF V NNC Y VWAA  PVGGGRRLDRGQ WR+  PAGTK ARIWGRTNC FD
Sbjct  18   FATSYAATFVVTNNCQYPVWAAGVPVGGGRRLDRGQVWRLEVPAGTKQARIWGRTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG C+TGDC G+LQC  +G PPNTLAE+ALNQF N DFFDISLVDGFN+PM F+PT 
Sbjct  78   ASGRGKCETGDCNGLLQCKNFGSPPNTLAEFALNQFANKDFFDISLVDGFNVPMDFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G +  R + C A IN +CP  LK PGGCNNPCT 
Sbjct  138  NGCS--RGIKCAAQINRECPNQLKAPGGCNNPCTV  170



>ref|XP_006396871.1| hypothetical protein EUTSA_v10028920mg [Eutrema salsugineum]
 gb|ESQ38324.1| hypothetical protein EUTSA_v10028920mg [Eutrema salsugineum]
Length=241

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 126/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATFE+ N C YTVWAA++P GGGRRL+ GQ+W +  PAGT MARIWGRTNC FD
Sbjct  17   ISTATAATFEILNQCGYTVWAAASP-GGGRRLNSGQSWTLNVPAGTSMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG C+TGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCETGDCTGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTT  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            +    C  + CTA+INGQCP  L+ PGGCNNPCT
Sbjct  136  S---SCHRILCTADINGQCPNVLRAPGGCNNPCT  166



>gb|ABX71220.1| osmotin [Piper colubrinum]
Length=230

 Score =   231 bits (589),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 124/154 (81%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            TS++AA F +RNNCPYTVWAA+ P GGGRRLDRG TW +  PAGT  ARIW RTNC FD 
Sbjct  25   TSAHAANFLIRNNCPYTVWAAAVP-GGGRRLDRGATWSLNVPAGTTGARIWPRTNCNFDG  83

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SGRG CQTGDCGGVLQCT +G PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+P  +
Sbjct  84   SGRGRCQTGDCGGVLQCTAYGAPPNTLAEYALNQFSNLDFFDISLVDGFNVPMDFSPVSS  143

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    RA  CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  144  GCRGPRA--CTADINGQCPNVLRAPGGCNNPCTV  175



>gb|KCW77588.1| hypothetical protein EUGRSUZ_D01904 [Eucalyptus grandis]
Length=225

 Score =   231 bits (588),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T + AATF++RNNCPYTVWAA+ P GGGRRLDRGQ+W +T   GTK ARIW RTNC+FD+
Sbjct  20   TCANAATFDIRNNCPYTVWAAAVP-GGGRRLDRGQSWSLTVSPGTKQARIWPRTNCQFDA  78

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +G+G CQTGDCGGV +CT +G+PPNTLAEYALNQFG  DFFDISLVDGFN+PM F+PT  
Sbjct  79   AGKGKCQTGDCGGVRECTSYGQPPNTLAEYALNQFGGKDFFDISLVDGFNVPMDFSPTSN  138

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCPA LK PGGCNNPCT 
Sbjct  139  GCT--RGIKCTADINGQCPAQLKAPGGCNNPCTV  170



>gb|AAO48964.1| osmotin-like protein [Solanum tuberosum]
Length=167

 Score =   228 bits (582),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  420  PYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGV  241
            PYTVWAA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCGGV
Sbjct  4    PYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGGCQTGDCGGV  63

Query  240  LQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTANI  61
            L+C GWGKPPNTLAE ALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C ANI
Sbjct  64   LECKGWGKPPNTLAEXALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANI  123

Query  60   NGQCPAALKVPGGCNNPCTT  1
             G+CP +L+VPGGCNNPCTT
Sbjct  124  XGECPDSLRVPGGCNNPCTT  143



>dbj|BAO09560.1| osmotin, partial [Morus alba]
Length=231

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 127/154 (82%), Gaps = 5/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F SS AATF +RN+C YTVWAA++P GGGRRLDRGQTW +  PAGT MARIWGRTNC FD
Sbjct  9    FFSSNAATFTIRNDCSYTVWAAASP-GGGRRLDRGQTWTLNVPAGTSMARIWGRTNCNFD  67

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++GRG CQTGDC G+LQC GWG PPNTLAEYALNQ+ NLDF+DISLVDGFNIPM F+ T 
Sbjct  68   AAGRGRCQTGDC-GLLQCQGWGTPPNTLAEYALNQYNNLDFYDISLVDGFNIPMEFSATS  126

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G   C+++ CTA+INGQCP  L+ PGGC NPCT
Sbjct  127  GG---CKSIRCTADINGQCPNELRTPGGCQNPCT  157



>ref|XP_002874707.1| ATOSM34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50966.1| ATOSM34 [Arabidopsis lyrata subsp. lyrata]
Length=223

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 124/155 (80%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATF++ N C YTVWAA++P GGGRRLD GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFDILNRCSYTVWAAASP-GGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SG G CQTGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   PSGSGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            +    C  + C A+INGQCP  LK PGGCNNPCT 
Sbjct  136  S---NCHRIVCNADINGQCPNELKAPGGCNNPCTV  167



>ref|XP_010455575.1| PREDICTED: osmotin-like protein OSM34 [Camelina sativa]
Length=223

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 127/155 (82%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATF++ N C YTVWAA++P GGGRRL+ GQ+WR+   AGTKMARIWGRTNC FD
Sbjct  17   ISTATAATFDILNRCSYTVWAAASP-GGGRRLNAGQSWRLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG C+TGDC G LQCTGWG+PPNTLAEYALNQ+ NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   SSGRGRCETGDCSGGLQCTGWGQPPNTLAEYALNQYNNLDFYDISLVDGFNIPMEFSPTS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            +    C+ + C A+INGQCP  L+ PGGCNNPCT 
Sbjct  136  S---NCKRIICNADINGQCPNELRAPGGCNNPCTV  167



>gb|KDP46638.1| hypothetical protein JCGZ_04572 [Jatropha curcas]
Length=227

 Score =   228 bits (582),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 124/155 (80%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTS +AATF + NNCPYTVWAA+ P GGGR+LD  Q+W +    GTK ARIW RT C+FD
Sbjct  21   FTSVHAATFAITNNCPYTVWAAAVP-GGGRQLDSHQSWSLNVNPGTKAARIWARTKCRFD  79

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVLQC G+G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT 
Sbjct  80   GAGRGQCQTGDCGGVLQCQGYGQPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTS  139

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G +  R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  140  GGCS--RGIRCTADINGQCPNVLRAPGGCNNPCTV  172



>ref|XP_010024638.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 ref|XP_010041217.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW44533.1| hypothetical protein EUGRSUZ_L01962 [Eucalyptus grandis]
 gb|KCW61090.1| hypothetical protein EUGRSUZ_H03864 [Eucalyptus grandis]
Length=225

 Score =   228 bits (582),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T + AATF +RNNCPYTVWAA+ P GGGRRLDRGQ+W +    GTK ARIW RTNC+FD 
Sbjct  20   TCANAATFNIRNNCPYTVWAAAVP-GGGRRLDRGQSWSLNVSPGTKQARIWARTNCQFDG  78

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +G+G CQTGDCGG+L+C  +G+PPNTLAEYALNQFG  DFFDISLVDGFN+PM F+PT  
Sbjct  79   AGKGKCQTGDCGGILECKSFGQPPNTLAEYALNQFGGKDFFDISLVDGFNVPMDFSPTSN  138

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCPA LK PGGCNNPCT 
Sbjct  139  GCT--RGIKCTADINGQCPAQLKAPGGCNNPCTV  170



>gb|AIR93920.1| thaumatin [Cicer arietinum]
Length=241

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             T S AA FE+ NNCPYTVWAA++P GGGRRLDRGQTW +   AGT MARIWGRT C FD
Sbjct  18   LTPSQAANFEIVNNCPYTVWAAASP-GGGRRLDRGQTWNLWVNAGTSMARIWGRTGCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SGRG CQTGDC G LQCTGWG PPNTLAE+ALNQ+GNLDF+DISLVDGFNIPM F P  
Sbjct  77   GSGRGRCQTGDCTGGLQCTGWGVPPNTLAEFALNQYGNLDFYDISLVDGFNIPMDFFPIN  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   C  +SCTA+INGQCP  L+  GGCNNPCT 
Sbjct  137  GG---CHKISCTADINGQCPNELRAQGGCNNPCTV  168



>ref|XP_009128666.1| PREDICTED: osmotin-like protein OSM34 [Brassica rapa]
 emb|CDY25290.1| BnaA02g21660D [Brassica napus]
Length=244

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ AATFE+ N C YTVWAA++P GGGRRL+ GQ+W +  PAGT MARIWGRTNC FD
Sbjct  17   ISTATAATFEIINQCGYTVWAAASP-GGGRRLNSGQSWTLNVPAGTSMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG C+TGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+ T 
Sbjct  76   SSGRGRCETGDCTGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSATS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
            +    C+ + CTA+INGQCP  L+ PGGCNNPCT
Sbjct  136  S---NCKRILCTADINGQCPNVLRAPGGCNNPCT  166



>emb|CDP09784.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   228 bits (581),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = -3

Query  444  TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSC  265
            TF++RNNCPYTVWAA+ P GGG+RLD GQTW +   AGT   R+WGRTNC FD SG GSC
Sbjct  26   TFDIRNNCPYTVWAAAVP-GGGQRLDNGQTWTLNVAAGTTGGRVWGRTNCNFDGSGHGSC  84

Query  264  QTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCR  85
            QTGDCGG+LQCT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F+PT  G    R
Sbjct  85   QTGDCGGLLQCTAYGAPPNTLAEFALNQFSNLDFFDISLVDGFNVPMDFSPTSNGCT--R  142

Query  84   AVSCTANINGQCPAALKVPGGCNNPCT  4
             +SCTA+INGQCP+ LK PGGCNNPCT
Sbjct  143  GISCTADINGQCPSVLKAPGGCNNPCT  169



>gb|AAO48955.1| osmotin-like protein [Solanum tuberosum]
Length=151

 Score =   225 bits (574),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  426  NCPYTVWAA-STPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NCPYTVW     P GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDC
Sbjct  1    NCPYTVWRRRQPPKGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC  60

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            GGVL+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C 
Sbjct  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCV  120

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            ANING+CP +L+VPGGCNNPCTT
Sbjct  121  ANINGECPGSLRVPGGCNNPCTT  143



>ref|XP_010054783.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
Length=326

 Score =   231 bits (589),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T + AATF++RNNCPYTVWAA+ P GGGRRLDRGQ+W +T   GTK ARIW RTNC+FD+
Sbjct  20   TCANAATFDIRNNCPYTVWAAAVP-GGGRRLDRGQSWSLTVSPGTKQARIWPRTNCQFDA  78

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +G+G CQTGDCGGV +CT +G+PPNTLAEYALNQFG  DFFDISLVDGFN+PM F+PT  
Sbjct  79   AGKGKCQTGDCGGVRECTSYGQPPNTLAEYALNQFGGKDFFDISLVDGFNVPMDFSPTSN  138

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCPA LK PGGCNNPCT 
Sbjct  139  GCT--RGIKCTADINGQCPAQLKAPGGCNNPCTV  170


 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 3/54 (6%)
 Frame = -3

Query  174  NLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTANINGQCPAALKVPGGCNN  13
            N DF DISL++GFN+PM   P       CR + C  +INGQCP  LK  GGCN+
Sbjct  249  NPDFLDISLINGFNLPMLSRPITG---SCRGIRCLDDINGQCPEELKASGGCND  299



>gb|KCW77577.1| hypothetical protein EUGRSUZ_D01892 [Eucalyptus grandis]
Length=225

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T + AATF +RNNCPYTVWAA+ P GGGRRLDRGQ+W +    GTK ARIW RTNC+FD+
Sbjct  20   TCANAATFNIRNNCPYTVWAAAVP-GGGRRLDRGQSWSLNVSPGTKQARIWPRTNCQFDA  78

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +G+G CQTGDCGGV +CT +G+PPNTLAEYALNQFG  DFFDISLVDGFN+PM F+PT  
Sbjct  79   AGKGKCQTGDCGGVRECTSFGQPPNTLAEYALNQFGGKDFFDISLVDGFNVPMDFSPTSN  138

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCPA LK PGGCNNPCT 
Sbjct  139  GCT--RGIKCTADINGQCPAQLKAPGGCNNPCTV  170



>pdb|4L2J|A Chain A, Crystal Structure Of Osmotin, An Antifungal Laticifer 
Protein
Length=206

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 120/149 (81%), Gaps = 1/149 (1%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            ATF +RNNCPYT+WAA+ P GGGRRL+ GQTW I    GT  ARIW RTNC FD +GRG 
Sbjct  2    ATFTIRNNCPYTIWAAAVP-GGGRRLNSGQTWTINVAPGTAGARIWPRTNCNFDGAGRGR  60

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDC GVL+C G+G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+P     +KC
Sbjct  61   CQTGDCNGVLECKGYGQPPNTLAEYALNQFQNLDFFDISLVDGFNVPMEFSPVSGSGDKC  120

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
            RA+ CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  121  RAIRCTADINGQCPNELRAPGGCNNPCTV  149



>ref|XP_009772655.1| PREDICTED: thaumatin-like protein [Nicotiana sylvestris]
Length=220

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT + AAT  VRNNCPYTVWAA  P GGG+RLDRGQTW I  P GTK AR+W RT C FD
Sbjct  13   FTYANAATIIVRNNCPYTVWAAGVPAGGGKRLDRGQTWTINTPPGTKQARVWARTGCNFD  72

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SG+G CQTGDC G+L+C  +G PPNTLAE+ALNQF N DFFDISLVDGFN+PM F+PT 
Sbjct  73   ASGKGKCQTGDCNGLLECKAFGAPPNTLAEFALNQFANKDFFDISLVDGFNVPMEFSPTS  132

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R ++C A+INGQCP  LK PGGCNNPCT 
Sbjct  133  NGCT--RGITCKADINGQCPKELKAPGGCNNPCTV  165



>ref|XP_010054781.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
Length=251

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T + AATF +RNNCPYTVWAA+ P GGGRRLDRGQ+W +    GTK ARIW RTNC+FD+
Sbjct  20   TCANAATFNIRNNCPYTVWAAAVP-GGGRRLDRGQSWSLNVSPGTKQARIWPRTNCQFDA  78

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +G+G CQTGDCGGV +CT +G+PPNTLAEYALNQFG  DFFDISLVDGFN+PM F+PT  
Sbjct  79   AGKGKCQTGDCGGVRECTSFGQPPNTLAEYALNQFGGKDFFDISLVDGFNVPMDFSPTSN  138

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCPA LK PGGCNNPCT 
Sbjct  139  GCT--RGIKCTADINGQCPAQLKAPGGCNNPCTV  170



>emb|CAA09228.1| thaumatin-like protein PR-5b [Cicer arietinum]
Length=239

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             T S AA FE+ NNCPYTVWAA++P GGGRRLDRGQTW +   AGT MARIWGRT C FD
Sbjct  16   LTPSQAANFEIVNNCPYTVWAAASP-GGGRRLDRGQTWNLWVNAGTSMARIWGRTGCNFD  74

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SGRG C+TGDC G LQCTGWG PPNTLAE+ALNQ+GNLDF+DISLVDGFNIPM F P  
Sbjct  75   GSGRGRCETGDCTGGLQCTGWGVPPNTLAEFALNQYGNLDFYDISLVDGFNIPMDFFPIN  134

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   C  +SCTA+INGQCP  L+  GGCNNPCT 
Sbjct  135  GG---CHKISCTADINGQCPNELRAQGGCNNPCTV  166



>ref|XP_004245632.1| PREDICTED: thaumatin-like protein [Solanum lycopersicum]
Length=220

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT + AAT  VRNNCPYTVWAA  P GGG+RLDRGQTW I AP GTK AR+WGRT C FD
Sbjct  13   FTYANAATILVRNNCPYTVWAAGVPAGGGKRLDRGQTWTINAPPGTKQARVWGRTGCNFD  72

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SG+G CQTGDC G+L C  +G PPNTLAEYALNQF N DFFDISLVDGFN+PM F+PT 
Sbjct  73   ASGKGKCQTGDCNGLLVCKSFGVPPNTLAEYALNQFANKDFFDISLVDGFNVPMEFSPTS  132

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R ++C A IN QCP  LK PGGCNNPCT 
Sbjct  133  NGCT--RGITCKAEINQQCPNELKAPGGCNNPCTV  165



>ref|XP_008238908.1| PREDICTED: protein P21-like [Prunus mume]
Length=225

 Score =   226 bits (577),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 127/155 (82%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S+ AA F++RNNCP+TVWAA+TP GGGR+L+RG++W +   AGTK ARIW RT C FD
Sbjct  19   FASTSAARFDIRNNCPFTVWAAATP-GGGRQLNRGESWGLDVAAGTKGARIWARTGCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVLQC  +G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT 
Sbjct  78   GAGRGRCQTGDCGGVLQCQAYGQPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G +  R + CTA+INGQCP+ L+ PGGCNNPCT 
Sbjct  138  NGCS--RGIKCTADINGQCPSQLRAPGGCNNPCTV  170



>gb|AGC39178.1| thaumatin-like protein [Actinidia deliciosa]
Length=243

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F+S++AA FE+RNNCPYTVWAA++P GGGRRLD  QTW +  PAGTKMARIWGRTNC FD
Sbjct  17   FSSAHAANFEIRNNCPYTVWAAASP-GGGRRLDPYQTWWLDVPAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGV-LQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPT  109
            ++G G C+TGDCG +  +  GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F PT
Sbjct  76   ANGWGRCETGDCGSIDCRSGGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFTPT  135

Query  108  KAGANKCRAVSCTANINGQCPAALKVPGGCNNPC  7
               ++KCR + C A+INGQCP  L+ P GCNNPC
Sbjct  136  YRQSDKCRNILCVADINGQCPGPLRAPHGCNNPC  169



>gb|ABW76501.1| pathogenesis-related thaumatin-like protein [Coffea arabica]
Length=177

 Score =   224 bits (571),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA+ P GGGRRLDRGQTW I   AGT  ARIW RTNC FD +GRGSCQTGDC
Sbjct  1    NNCPYTVWAAAVP-GGGRRLDRGQTWTINVAAGTAGARIWARTNCNFDGNGRGSCQTGDC  59

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            GGVLQCT +G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT  G    R + CT
Sbjct  60   GGVLQCTAYGRPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTSNGCT--RGIRCT  117

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP+ LK PGGCNNPCT 
Sbjct  118  ADINGQCPSVLKAPGGCNNPCTV  140



>ref|XP_010520774.1| PREDICTED: osmotin-like protein OSM34 [Tarenaya hassleriana]
Length=243

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 121/150 (81%), Gaps = 4/150 (3%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            A TFE+RN C YTVWAA++P GGGRRLD GQTW ++   GTKMARIWGRTNC FD+SGRG
Sbjct  23   ATTFEIRNQCGYTVWAAASP-GGGRRLDPGQTWMLSVAPGTKMARIWGRTNCNFDASGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDC G LQCTGWG+PPNTLAEYALNQF N DF+DISLVDGFNIPM F+PT  G   
Sbjct  82   RCQTGDCTGGLQCTGWGQPPNTLAEYALNQFNNRDFYDISLVDGFNIPMDFSPTNPG---  138

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  + C A+INGQCP  L+ PGGCNNPCT 
Sbjct  139  CHRILCNADINGQCPGPLRAPGGCNNPCTV  168



>gb|ABW76503.1| pathogenesis-related thaumatin-like protein [Coffea arabica]
Length=180

 Score =   224 bits (571),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA+ P GGGRRLDRGQTW I   AGT  ARIW RTNC FD +GRGSCQTGDC
Sbjct  4    NNCPYTVWAAAVP-GGGRRLDRGQTWTINVAAGTAGARIWARTNCNFDGNGRGSCQTGDC  62

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            GGVLQCT +G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT  G    R + CT
Sbjct  63   GGVLQCTAYGRPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTSNGCT--RGIRCT  120

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP+ LK PGGCNNPCT 
Sbjct  121  ADINGQCPSVLKAPGGCNNPCTV  143



>ref|XP_009609047.1| PREDICTED: protein P21-like [Nicotiana tomentosiformis]
Length=232

 Score =   226 bits (575),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 122/157 (78%), Gaps = 4/157 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT+S AA F+VRNNCPYTVWAAS PVGGGR+LD GQTW I  PAGTK ARIW RT C FD
Sbjct  23   FTNSDAAIFDVRNNCPYTVWAASVPVGGGRQLDSGQTWTIDVPAGTKGARIWARTGCNFD  82

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SG G C+TGDC G+LQC  +G PPN+LAEYALNQF NLDFFDISLVDGFN+PM F+PT 
Sbjct  83   GSGHGKCETGDCNGLLQCHAFGVPPNSLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTS  142

Query  105  AGANKCRAVSCTANINGQCPAALKVPG--GCNNPCTT  1
             G    R + CTA+INGQCP  L+  G  GCNNPCT 
Sbjct  143  NGCT--RGIRCTADINGQCPNELRASGGHGCNNPCTV  177



>gb|AAO48960.1| osmotin-like protein [Solanum tuberosum]
Length=153

 Score =   223 bits (567),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  AASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGVLQCTG  226
            AA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCGGVL+C G
Sbjct  9    AAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGGCQTGDCGGVLECKG  68

Query  225  WGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTANINGQCP  46
            WGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C ANING+CP
Sbjct  69   WGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANINGECP  128

Query  45   AALKVPGGCNNPCTT  1
             +L+VPGGCNNPCTT
Sbjct  129  DSLRVPGGCNNPCTT  143



>ref|XP_002509749.1| Osmotin precursor, putative [Ricinus communis]
 gb|EEF51136.1| Osmotin precursor, putative [Ricinus communis]
Length=225

 Score =   225 bits (574),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 122/153 (80%), Gaps = 4/153 (3%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            TS++AATF+V N C YTVWAA++P GGGRRLDRGQTW      GTKMARIWGRTNCKFD+
Sbjct  19   TSTHAATFDVVNRCSYTVWAAASP-GGGRRLDRGQTWTFNVAQGTKMARIWGRTNCKFDA  77

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +G+G C+TGDC G L C GWG PPNTLAEYALNQF N DF DISLVDGFNIPM F+PT  
Sbjct  78   NGQGRCETGDCTGGLVCKGWGTPPNTLAEYALNQFNNRDFIDISLVDGFNIPMDFSPTTG  137

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
                CR + C A+INGQCPA LK PGGCNNPCT
Sbjct  138  A---CRGIRCAADINGQCPAQLKAPGGCNNPCT  167



>ref|XP_010275299.1| PREDICTED: protein P21-like [Nelumbo nucifera]
Length=301

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 124/155 (80%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F  + AATF V+N CPYTVWAA++P GGGRRL+ GQ+W +   AGT  ARIWGRTNC FD
Sbjct  74   FALTQAATFLVQNQCPYTVWAAASP-GGGRRLEPGQSWTLNVAAGTAGARIWGRTNCNFD  132

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SGRG CQTGDCGG+LQC G+G PPNTLAE+ALNQF NLDFFDISLVDGFNIPM F+PT 
Sbjct  133  GSGRGWCQTGDCGGLLQCQGYGSPPNTLAEFALNQFMNLDFFDISLVDGFNIPMDFSPTS  192

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G   CR + CTA+I GQCPA L+ PGGCNNPCT 
Sbjct  193  GG---CRGIKCTADIIGQCPAQLRAPGGCNNPCTV  224



>gb|AGC39179.1| thaumatin-like protein [Actinidia deliciosa]
Length=243

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F+S++AA FE+RNNCPYTVWAA++P GGGRRLD  QTW +   AGTKMARIWGRTNC FD
Sbjct  17   FSSAHAANFEIRNNCPYTVWAAASP-GGGRRLDPYQTWWLDVAAGTKMARIWGRTNCNFD  75

Query  285  SSGRGSCQTGDCGGV-LQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPT  109
            + G G C+TGDCG +  +  GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F PT
Sbjct  76   AGGWGRCETGDCGSIDCRSGGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFTPT  135

Query  108  KAGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               ++KCR + C A+INGQCP  L+ P GCNNPCT 
Sbjct  136  YRQSDKCRNILCVADINGQCPGPLRAPHGCNNPCTV  171



>gb|ABW76499.1| pathogenesis-related thaumatin-like protein [Coffea arabica]
Length=177

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA+ P GGGRRLDRGQTW I   AGT  ARIW RTNC FD +GRGSCQTGDC
Sbjct  1    NNCPYTVWAAAVP-GGGRRLDRGQTWTINVAAGTAGARIWARTNCNFDGNGRGSCQTGDC  59

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            GGVLQCT +G+PPNTLAEYALNQF +LDFFDISLVDGFN+PM F+PT  G    R + CT
Sbjct  60   GGVLQCTAYGRPPNTLAEYALNQFNSLDFFDISLVDGFNVPMDFSPTSNGCT--RGIRCT  117

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP+ LK PGGCNNPCT 
Sbjct  118  ADINGQCPSVLKAPGGCNNPCTV  140



>gb|KEH27441.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=241

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = -3

Query  456  SYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSG  277
            S AA FE+ NNCPYTVWAA++P GGGRRLDRGQTW +    GT MARIWGRT C FD SG
Sbjct  21   SQAANFEIVNNCPYTVWAAASP-GGGRRLDRGQTWNLWVNPGTAMARIWGRTGCNFDGSG  79

Query  276  RGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGA  97
            RG CQTGDC G LQCTGWG PPNTLAEYALNQFGN DF+DISLVDGFNIPM F P   G 
Sbjct  80   RGRCQTGDCTGGLQCTGWGVPPNTLAEYALNQFGNQDFYDISLVDGFNIPMDFFPLNGG-  138

Query  96   NKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
              C  +SCTA+INGQCP  L+  GGCNNPCT 
Sbjct  139  --CHKISCTADINGQCPNELRTQGGCNNPCTV  168



>gb|AAO48956.1| osmotin-like protein [Solanum tuberosum]
Length=167

 Score =   222 bits (565),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = -3

Query  420  PYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGV  241
            PY   AA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCGGV
Sbjct  6    PYA--AAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGV  63

Query  240  LQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTANI  61
            L+C GWGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C ANI
Sbjct  64   LECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANI  123

Query  60   NGQCPAALKVPGGCNNPCTT  1
            NG+CP +L+VPGGCNNPCTT
Sbjct  124  NGECPGSLRVPGGCNNPCTT  143



>ref|XP_010455576.1| PREDICTED: osmotin-like protein OSM34 [Camelina sativa]
Length=223

 Score =   224 bits (570),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 123/155 (79%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++  ATF++ N C YTVWAA++P GGGRRLD GQ+WR+   AG KMARIW RTNC FD
Sbjct  17   ISTAKTATFDILNRCSYTVWAAASP-GGGRRLDAGQSWRLDVAAGAKMARIWRRTNCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SG+G CQTGDC G LQCTGWG+PPNTLAEYALNQF NLDF+DISLVDGFNIPM F+PT 
Sbjct  76   PSGKGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPT-  134

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
              ++ C  + C A+INGQCP  L+ PGGCNNPCT 
Sbjct  135  --SSNCHRIVCNADINGQCPNELRAPGGCNNPCTV  167



>ref|XP_009345452.1| PREDICTED: protein P21-like [Pyrus x bretschneideri]
Length=225

 Score =   223 bits (569),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S+ AA F+++NNCPYTVWAA+ P GGGR+LD GQ+W I   AGT  ARIW RT C FD
Sbjct  19   FASTNAARFDIQNNCPYTVWAAAVP-GGGRQLDGGQSWAIDVSAGTTGARIWARTGCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C G+G+PPNTLAEYALNQ+ NLDFFDISLVDGFN+PM F+PT 
Sbjct  78   GAGRGQCQTGDCGGVLECQGYGQPPNTLAEYALNQYNNLDFFDISLVDGFNVPMDFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  K   + CTA+INGQCP  LK PGGCNNPCT 
Sbjct  138  GGCTK--GIRCTADINGQCPDQLKAPGGCNNPCTV  170



>ref|XP_007210996.1| hypothetical protein PRUPE_ppa021092mg [Prunus persica]
 gb|EMJ12195.1| hypothetical protein PRUPE_ppa021092mg [Prunus persica]
Length=227

 Score =   223 bits (568),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = -3

Query  456  SYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSG  277
            S+AA+F +RNNCPYTVWAA+ P GGGR+L+RGQTW +    GTKMARIW RTNC FD+SG
Sbjct  24   SHAASFNIRNNCPYTVWAAAVP-GGGRQLNRGQTWTLNVKPGTKMARIWARTNCAFDNSG  82

Query  276  RGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGA  97
            RG CQTGDCGG LQC  +G PPNTLAEYALNQFGN DFFDISLVDGFN+PM F+PT  G 
Sbjct  83   RGRCQTGDCGGFLQCQAYGSPPNTLAEYALNQFGNKDFFDISLVDGFNVPMEFSPTSNGC  142

Query  96   NKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
               R + C  +I  QCP  LK PGGC+NPCT 
Sbjct  143  T--RGIKCAQDIKTQCPNELKAPGGCHNPCTV  172



>gb|ABW76500.1| pathogenesis-related thaumatin-like protein [Coffea arabica]
Length=179

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 117/143 (82%), Gaps = 3/143 (2%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA+ P GGGRRLDRGQTW I   AGT  ARIW RTNC FD +GRGSCQTGDC
Sbjct  1    NNCPYTVWAAAVP-GGGRRLDRGQTWTINVAAGTAGARIWARTNCNFDGNGRGSCQTGDC  59

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            GGVLQCT +G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT  G    R + CT
Sbjct  60   GGVLQCTAYGRPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTSNGCT--RGIRCT  117

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP  L+ PGGCNNPCT 
Sbjct  118  ADINGQCPNQLRAPGGCNNPCTV  140



>gb|ABW76502.1| pathogenesis-related thaumatin-like protein [Coffea arabica]
Length=177

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 117/143 (82%), Gaps = 3/143 (2%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA+ P GGGRRLDRGQTW I   AGT  ARIW RTNC FD +GRGSCQTGDC
Sbjct  1    NNCPYTVWAAAVP-GGGRRLDRGQTWTINVAAGTAGARIWARTNCNFDGNGRGSCQTGDC  59

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            GGVLQCT +G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT  G    R + CT
Sbjct  60   GGVLQCTAYGRPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTSNGCT--RGIRCT  117

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP  L+ PGGCNNPCT 
Sbjct  118  ADINGQCPNQLRAPGGCNNPCTV  140



>gb|AAO48962.1| osmotin-like protein [Solanum tuberosum]
Length=154

 Score =   220 bits (560),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  AASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGVLQCTG  226
            AA+TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCGGVL+C G
Sbjct  9    AAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG  68

Query  225  WGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTANINGQCP  46
            WGKPPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C ANI G+CP
Sbjct  69   WGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANIXGECP  128

Query  45   AALKVPGGCNNPCTT  1
             +L+VPGGCNNPCTT
Sbjct  129  GSLRVPGGCNNPCTT  143



>ref|XP_009406737.1| PREDICTED: protein P21-like [Musa acuminata subsp. malaccensis]
Length=226

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 121/154 (79%), Gaps = 4/154 (3%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T S+AATFE+ N C YTVWAA+ P GGGR+L++GQ+W I   AGT   RIWGRT C FD 
Sbjct  22   TLSHAATFEIVNRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDG  80

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SGRG CQTGDCGGVL CT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F+PT  
Sbjct  81   SGRGRCQTGDCGGVLSCTAYGSPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSG  140

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G   CR + C A+INGQCP ALK PGGCNNPCT 
Sbjct  141  G---CRGIRCAADINGQCPGALKAPGGCNNPCTV  171



>ref|XP_007158474.1| hypothetical protein PHAVU_002G155500g [Phaseolus vulgaris]
 gb|ESW30468.1| hypothetical protein PHAVU_002G155500g [Phaseolus vulgaris]
Length=242

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 118/150 (79%), Gaps = 4/150 (3%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA FE+ NNCPYTVWAA++P GGGRRLDRGQTW +   AGT MARIWGRT C FD SGRG
Sbjct  24   AANFEIVNNCPYTVWAAASP-GGGRRLDRGQTWNLWVNAGTAMARIWGRTGCNFDGSGRG  82

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDC G L C GWG PPNTLAE+ALNQFGNLDF+DISLVDGFNIPM F P   G   
Sbjct  83   RCQTGDCTGGLNCQGWGVPPNTLAEFALNQFGNLDFYDISLVDGFNIPMDFYPVNGG---  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            C  +SCTA+INGQCP  L+  GGCNNPCT 
Sbjct  140  CHKISCTADINGQCPGPLRAQGGCNNPCTV  169



>ref|XP_008345347.1| PREDICTED: protein P21-like [Malus domestica]
Length=225

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S+ AA F+++NNC YTVWAA+ P GGGR+L +GQ+W +   AGTK ARIWGRT C FD
Sbjct  19   FASTNAARFDIQNNCAYTVWAAAVP-GGGRQLGKGQSWALDVSAGTKGARIWGRTGCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVLQC G+G+PPNTLAEYALNQF NLDF DISLVDGFN+PM F+PT 
Sbjct  78   GAGRGKCQTGDCGGVLQCQGYGQPPNTLAEYALNQFNNLDFIDISLVDGFNVPMEFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  138  GGCT--RRIRCTADINGQCPNQLRAPGGCNNPCTV  170



>gb|AAO48957.1| osmotin-like protein [Solanum tuberosum]
Length=159

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -3

Query  396  TPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGVLQCTGWGK  217
            TP+GGGRRL+RGQ+W   AP GTKMARIWGRTNC FD +GRG CQTGDCGGVL+C GWGK
Sbjct  12   TPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGGCQTGDCGGVLECKGWGK  71

Query  216  PPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTANINGQCPAAL  37
            PPNTLAEYALNQF NLDF+DIS++DGFNIPM F PT  G  KC  + C ANING+CP +L
Sbjct  72   PPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANINGECPDSL  131

Query  36   KVPGGCNNPCTT  1
            +VPGGCNNPCTT
Sbjct  132  RVPGGCNNPCTT  143



>emb|CAA71883.1| osmotin-like protein [Vitis vinifera]
Length=225

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 123/154 (80%), Gaps = 3/154 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTSSYAATF ++N+C YTVWAA+ P GGG +L  GQ+W +   AGT  AR+WGRTNC FD
Sbjct  19   FTSSYAATFNIQNHCSYTVWAAAVP-GGGMQLGSGQSWSLNVNAGTTGARVWGRTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SG G C+TGDCGG+LQCT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F PT 
Sbjct  78   ASGNGKCETGDCGGLLQCTAYGTPPNTLAEFALNQFSNLDFFDISLVDGFNVPMAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G    R +SCTA+I G+CPAALK  GGCNNPCT
Sbjct  138  NGCT--RGISCTADIVGECPAALKTTGGCNNPCT  169



>ref|XP_011018223.1| PREDICTED: protein P21-like [Populus euphratica]
Length=263

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 121/155 (78%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT S AATFE+RN C YTVWAA+ P GGGRRLD GQ+W ITA AGT  ARIWGRTNC FD
Sbjct  58   FTLSNAATFEIRNQCAYTVWAAAVP-GGGRRLDPGQSWTITANAGTTQARIWGRTNCNFD  116

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG C+TGDC GVLQC  +G+PPNTLAEYALNQF +LDF+DISLVD FN+PM F+P  
Sbjct  117  GAGRGKCETGDCNGVLQCQAFGQPPNTLAEYALNQFNSLDFYDISLVDRFNVPMAFSPV-  175

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
              +  CR + C  +INGQCP  LK PGGCNNPCT 
Sbjct  176  --SGNCRGIRCAGDINGQCPDVLKAPGGCNNPCTV  208



>ref|NP_001235877.1| PR-5b protein precursor [Glycine max]
 dbj|BAH01715.1| PR-5 protein [Glycine max]
Length=240

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = -3

Query  453  YAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGR  274
            +AA FE+ NNCPYTVWAA++P GGGRRLDRGQTW +    GT MARIWGRT C FD SGR
Sbjct  20   HAANFEIVNNCPYTVWAAASP-GGGRRLDRGQTWNLWVNPGTAMARIWGRTGCNFDGSGR  78

Query  273  GSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN  94
            G CQTGDC G L C GWG PPNTLAE+ALNQFGN DF+DISLVDGFNIPM F P   G  
Sbjct  79   GRCQTGDCTGGLNCQGWGVPPNTLAEFALNQFGNQDFYDISLVDGFNIPMDFYPLNGG--  136

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             C  +SC+A+INGQCP  L+ PGGCNNPCT 
Sbjct  137  -CHKISCSADINGQCPGPLRAPGGCNNPCTV  166



>gb|AFK40174.1| unknown [Lotus japonicus]
Length=243

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 120/154 (78%), Gaps = 4/154 (3%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T + AA FE+ NNCPYTVWAA++P GGGRRLDRGQTW +   AGT MARIWGRT C FD 
Sbjct  19   TLTRAANFEIVNNCPYTVWAAASP-GGGRRLDRGQTWNLGVNAGTAMARIWGRTGCNFDG  77

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG CQTGDC G L C GWG PPNTLAE+ALNQ+GN DF+DISLVDGFNIPM F P   
Sbjct  78   AGRGRCQTGDCTGGLNCQGWGVPPNTLAEFALNQYGNQDFYDISLVDGFNIPMDFFPLNG  137

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G   C  +SCTA+INGQCP  L+ PGGCNNPCT 
Sbjct  138  G---CHKISCTADINGQCPNELRAPGGCNNPCTV  168



>ref|XP_008369460.1| PREDICTED: protein P21 [Malus domestica]
Length=225

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S+ AA F+++NNC YTVWAA+ P GGGR+LD GQ+W I   AGT  ARIW RT C FD
Sbjct  19   FASTNAARFDIQNNCAYTVWAAAVP-GGGRQLDGGQSWAIDVSAGTTGARIWARTGCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C G+G+PPNTLAEYALNQ+ NLDFFDISLVDGFN+PM F+PT 
Sbjct  78   GAGRGQCQTGDCGGVLECQGYGQPPNTLAEYALNQYNNLDFFDISLVDGFNVPMDFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  K   + CTA+INGQCP  LK PGGCNNPCT 
Sbjct  138  GGCTK--GIRCTADINGQCPDQLKAPGGCNNPCTV  170



>ref|XP_010540702.1| PREDICTED: osmotin-like protein OSM34 [Tarenaya hassleriana]
Length=245

 Score =   221 bits (564),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 120/154 (78%), Gaps = 4/154 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ A TFE+RN C YTVWAA++P GGGRRLD GQ+W +     T   RIWGRT C FD
Sbjct  25   ISTASATTFEIRNQCTYTVWAAASP-GGGRRLDPGQSWTLNVDIKTSSNRIWGRTGCNFD  83

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG CQTGDCGGVLQCTGWG+PPNTLAEYALNQF NLDF+D+SLVDGFNIPM F+PT 
Sbjct  84   SSGRGRCQTGDCGGVLQCTGWGQPPNTLAEYALNQFNNLDFYDMSLVDGFNIPMDFSPTN  143

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
                 C  + C A+INGQCP  L+ PGGCNNPCT
Sbjct  144  G---NCHRILCNADINGQCPNVLRAPGGCNNPCT  174



>ref|XP_004511592.1| PREDICTED: thaumatin-like protein-like [Cicer arietinum]
Length=444

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 121/150 (81%), Gaps = 4/150 (3%)
 Frame = -3

Query  453  YAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGR  274
            ++A FE+ NNCPYTVWAA++P GGGRRLDRGQTW +   AGT MARIWGRT C FD SGR
Sbjct  225  FSANFEIVNNCPYTVWAAASP-GGGRRLDRGQTWNLWVNAGTSMARIWGRTGCNFDGSGR  283

Query  273  GSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN  94
            G CQTGDC G LQCTGWG PPNTLAE+ALNQ+GNLDF+DISLVDGFNIPM F P   G  
Sbjct  284  GRCQTGDCTGGLQCTGWGVPPNTLAEFALNQYGNLDFYDISLVDGFNIPMDFFPINGG--  341

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             C  +SCTA+INGQCP  L+  GGCNNPCT
Sbjct  342  -CHKISCTADINGQCPNELRAQGGCNNPCT  370


 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 106/146 (73%), Gaps = 4/146 (3%)
 Frame = -3

Query  441  FEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQ  262
            F + N C YT+W A+ P GGG RL+ G++W +    GT+ ARIWGRTNC FD+ G G CQ
Sbjct  28   FNITNKCNYTIWPAAVP-GGGIRLNPGESWNMNMTNGTRNARIWGRTNCTFDNFGIGKCQ  86

Query  261  TGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRA  82
            TGDC   L+CT  G PPNT+ E +LN + +LDF+DISLV+GFNIP++  P+    N C +
Sbjct  87   TGDCNNTLECTTVGTPPNTVVEISLNMYNDLDFYDISLVEGFNIPIQLTPS---INACGS  143

Query  81   VSCTANINGQCPAALKVPGGCNNPCT  4
            V+C+ANING+CP  LKV GGC+NPCT
Sbjct  144  VNCSANINGECPTQLKVIGGCHNPCT  169



>ref|XP_007208801.1| hypothetical protein PRUPE_ppa024543mg, partial [Prunus persica]
 gb|EMJ10000.1| hypothetical protein PRUPE_ppa024543mg, partial [Prunus persica]
Length=210

 Score =   220 bits (560),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S+ AA F++RNNCP+TVWAA+TP GGGR+L+RG+ W I   AGTK  RIW RT C FD
Sbjct  19   FASTNAAHFDIRNNCPFTVWAAATP-GGGRQLNRGENWGIDVAAGTKGGRIWARTGCTFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGG+LQC  +G+PPNTLAEYALNQF NLDF DISLVDGFN+PM F  T 
Sbjct  78   GAGRGRCQTGDCGGILQCQAYGQPPNTLAEYALNQFSNLDFIDISLVDGFNVPMEFGSTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            +G    R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  138  SGCT--RDIRCTADINGQCPGQLRAPGGCNNPCTV  170



>ref|XP_007040160.1| Osmotin 34 [Theobroma cacao]
 gb|EOY24661.1| Osmotin 34 [Theobroma cacao]
Length=225

 Score =   220 bits (561),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             T ++AATF +RNNCPYTVWAA+ P GGGR+LD GQ W +   +GT  ARIW RTNC+FD
Sbjct  19   ITLAHAATFNIRNNCPYTVWAAAAP-GGGRQLDHGQVWDLDVSSGTGGARIWARTNCQFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +G+G CQTGDCGG+LQC G+G PPNTLAEYALNQF  +DFFDISLVDGFN+PM F+PT 
Sbjct  78   EAGQGKCQTGDCGGLLQCQGYGLPPNTLAEYALNQFSGMDFFDISLVDGFNVPMEFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            +G    R + C++ I GQCP  L+ PGGCNNPCT 
Sbjct  138  SGCT--RGIKCSSEIVGQCPTELQAPGGCNNPCTV  170



>ref|XP_009782417.1| PREDICTED: protein P21-like [Nicotiana sylvestris]
Length=230

 Score =   220 bits (561),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT S A TF+VRNNCPYTVWAAS PVGGGR+LD GQTW I  PAGT+ ARIW RT C FD
Sbjct  23   FTHSDATTFDVRNNCPYTVWAASVPVGGGRQLDSGQTWTIDVPAGTQGARIWARTGCNFD  82

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SG G C+TGDC G+LQC  +  PPNTLAEY L QF +LDFFDISLVDGFN+PM F+PT 
Sbjct  83   GSGHGKCETGDCNGLLQCQAYVIPPNTLAEYGLKQFNDLDFFDISLVDGFNVPMDFSPTF  142

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G    R + CT +INGQCP  L+ PGG NNPCT
Sbjct  143  NGVT--RGIRCTVDINGQCPNQLRAPGGYNNPCT  174



>ref|XP_003525412.1| PREDICTED: protein P21-like [Glycine max]
Length=224

 Score =   220 bits (560),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = -3

Query  459  SSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSS  280
            S+YAA FE+ N C YTVWAAS PVGGG +L+ GQ+W +  PAGTK AR+W RT C FD S
Sbjct  19   SAYAARFEITNRCTYTVWAASVPVGGGVQLNPGQSWSVDVPAGTKGARVWARTGCNFDGS  78

Query  279  GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAG  100
            GRG CQTGDCGGVL C  +G PPNTLAEY LN F NLDFFDISLVDGFN+PM F+PT  G
Sbjct  79   GRGGCQTGDCGGVLDCKAYGAPPNTLAEYGLNGFNNLDFFDISLVDGFNVPMDFSPTSNG  138

Query  99   ANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
                R +SCTA+INGQCP+ LK  GGCNNPCT 
Sbjct  139  CT--RGISCTADINGQCPSELKTQGGCNNPCTV  169



>gb|ACZ67186.1| pathogenesis-related thaumatin, partial [Populus balsamifera]
Length=154

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATFE+RNNCPYTVWAA++P GGGRRLDRGQTW +  PAGT MARIWGRTNC FD SGRG
Sbjct  23   AATFEIRNNCPYTVWAAASP-GGGRRLDRGQTWYLNVPAGTSMARIWGRTNCNFDGSGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN-  94
             CQTGDC G L+C GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F+PT +G + 
Sbjct  82   RCQTGDCTGGLECKGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFSPTSSGGSG  141

Query  93   KCRAVSCTANING  55
            KC+A+ CTA+ING
Sbjct  142  KCQALLCTADING  154



>gb|AAK59275.1|AF378571_1 thaumatin-like protein [Sambucus nigra]
Length=226

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 121/154 (79%), Gaps = 4/154 (3%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            +S+YAA F +RNNCP+TVWAA+ P GGGR+L+RGQ W +  PAGT+ ARIW RTNC FD 
Sbjct  20   SSAYAANFNIRNNCPFTVWAAAVP-GGGRQLNRGQVWSLDVPAGTRGARIWARTNCNFDG  78

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRG CQTGDC G+L C  +G PPNTLAEYALNQF NLDFFDISLVDGFN+ M F+PT  
Sbjct  79   AGRGRCQTGDCNGLLSCQAYGAPPNTLAEYALNQFNNLDFFDISLVDGFNVAMDFSPTGG  138

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             A   R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  139  CA---RGIQCTADINGQCPNELRAPGGCNNPCTV  169



>ref|XP_004143926.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004159963.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN50134.1| Thaumatin-like protein [Cucumis sativus]
Length=223

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F  S+AATF++RNNCP+ VWAA+ P GGGRRL++   W +    GT  ARIW RTNC FD
Sbjct  15   FPHSHAATFQIRNNCPFAVWAAAVP-GGGRRLNQNDVWTLNVNPGTVAARIWARTNCNFD  73

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SGRG CQTGDCGG+LQC  +G PPNTLAEYALNQF NLDFFDISL+DGFN+PM F+PT 
Sbjct  74   GSGRGRCQTGDCGGLLQCQAYGTPPNTLAEYALNQFNNLDFFDISLIDGFNVPMEFSPTS  133

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  134  GGC--ARGIRCTADINGQCPNELRAPGGCNNPCTV  166



>ref|XP_003611130.1| Pathogenesis-related thaumatin-like protein [Medicago truncatula]
Length=453

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 119/150 (79%), Gaps = 4/150 (3%)
 Frame = -3

Query  453  YAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGR  274
            ++A FE+ NNCPYTVWAA++P GGGRRLDRGQTW +    GT MARIWGRT C FD SGR
Sbjct  234  FSANFEIVNNCPYTVWAAASP-GGGRRLDRGQTWNLWVNPGTAMARIWGRTGCNFDGSGR  292

Query  273  GSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN  94
            G CQTGDC G LQCTGWG PPNTLAEYALNQFGN DF+DISLVDGFNIPM F P   G  
Sbjct  293  GRCQTGDCTGGLQCTGWGVPPNTLAEYALNQFGNQDFYDISLVDGFNIPMDFFPLNGG--  350

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             C  +SCTA+INGQCP  L+  GGCNNPCT
Sbjct  351  -CHKISCTADINGQCPNELRTQGGCNNPCT  379


 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = -3

Query  459  SSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSS  280
            ++ A  F + N C YTVWAA+ P GGG +L+ G++W +    GT  ARIWGRTNC FD+S
Sbjct  22   AAQAGRFNITNKCNYTVWAAAFP-GGGMKLNTGESWNMNITNGTSNARIWGRTNCTFDNS  80

Query  279  GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAG  100
            G G CQTGDC G L+C   G PPNT+ E+ALN + +LDF+D+SLV GFNIP++  P+   
Sbjct  81   GLGKCQTGDCNGTLECKTIGTPPNTIMEFALNMYNDLDFYDVSLVQGFNIPIQLKPS---  137

Query  99   ANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             N C  V+CTA+ING+CP  LKVPGGCNNPCTT
Sbjct  138  LNSCGTVNCTADINGECPTPLKVPGGCNNPCTT  170



>ref|XP_007160028.1| hypothetical protein PHAVU_002G286600g [Phaseolus vulgaris]
 gb|ESW32022.1| hypothetical protein PHAVU_002G286600g [Phaseolus vulgaris]
Length=221

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTS+YAA F++ N C YTVWAA+ P GGGR L+ GQ+W +   AGTK ARIW RT C FD
Sbjct  15   FTSAYAARFDITNRCSYTVWAAAVP-GGGRMLNSGQSWALDVAAGTKEARIWARTGCNFD  73

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SGRG C+TGDCGGVL+C  +G PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT 
Sbjct  74   GSGRGGCKTGDCGGVLECNAYGTPPNTLAEYALNQFNNLDFFDISLVDGFNVPMEFSPTS  133

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G +  R ++C A+INGQCP+ LK  GGCNNPCT 
Sbjct  134  NGCS--RGITCNADINGQCPSELKTDGGCNNPCTV  166



>ref|XP_010053313.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis]
 gb|KCW77584.1| hypothetical protein EUGRSUZ_D01898 [Eucalyptus grandis]
Length=225

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 123/154 (80%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T + AATF +RNNC YTVWAA+ P GGG++LDRGQ+W +    GTK ARIW RTNC+FD+
Sbjct  20   TCANAATFNIRNNCTYTVWAAAVP-GGGQQLDRGQSWSLNVSPGTKQARIWARTNCQFDA  78

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SG+G C+TGDCGGV +CT +G+PPNTLAEYALNQFG +DFF ISLVDGFN+PM F+P   
Sbjct  79   SGKGKCKTGDCGGVRECTSYGQPPNTLAEYALNQFGGMDFFVISLVDGFNVPMDFSPNSN  138

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCPA LK PGGCNNPCT 
Sbjct  139  GCT--RGIKCTADINGQCPARLKAPGGCNNPCTV  170



>ref|XP_002283030.1| PREDICTED: protein P21 [Vitis vinifera]
 emb|CAN60240.1| hypothetical protein VITISV_027469 [Vitis vinifera]
Length=225

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTS++AA F ++N+C YTVWAA+ P GGGRRLDRGQ+W +T   GT  ARIW RT C FD
Sbjct  19   FTSAHAAIFNIQNHCSYTVWAAAVP-GGGRRLDRGQSWSLTVNPGTTGARIWARTGCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVLQCT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F PT 
Sbjct  78   GAGRGRCQTGDCGGVLQCTAYGAPPNTLAEFALNQFNNLDFFDISLVDGFNVPMAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA+I GQCP+ L+  GGCNNPCT 
Sbjct  138  NGCT--RGIRCTADIVGQCPSQLRTQGGCNNPCTV  170



>ref|XP_010661214.1| PREDICTED: protein P21 [Vitis vinifera]
 emb|CAN82850.1| hypothetical protein VITISV_030860 [Vitis vinifera]
Length=225

 Score =   218 bits (555),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTS++AA F ++N+C YTVWAA+ P GGGRRLDRGQ+W +T   GT  ARIW RT C FD
Sbjct  19   FTSAHAAIFNIQNHCSYTVWAAAVP-GGGRRLDRGQSWSLTVNPGTTGARIWARTGCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVLQCT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F PT 
Sbjct  78   GAGRGRCQTGDCGGVLQCTAYGAPPNTLAEFALNQFNNLDFFDISLVDGFNVPMAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA+I GQCP+ L+  GGCNNPCT 
Sbjct  138  NGCT--RGIRCTADIVGQCPSPLQTQGGCNNPCTV  170



>ref|XP_007209565.1| hypothetical protein PRUPE_ppa011053mg [Prunus persica]
 gb|EMJ10764.1| hypothetical protein PRUPE_ppa011053mg [Prunus persica]
Length=225

 Score =   218 bits (554),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S+ AA F++RNNCP+TVWAA+ P GGGR+L+RGQ+W +   AGT+ ARIW RT C FD
Sbjct  19   FASTNAARFDIRNNCPFTVWAAAVP-GGGRQLNRGQSWALDVRAGTQGARIWARTGCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVLQC  +G+PPNTLAEYALNQ+ NLDFFDISLVDGFN+PM F+PT 
Sbjct  78   GAGRGRCQTGDCGGVLQCQAYGQPPNTLAEYALNQYNNLDFFDISLVDGFNVPMDFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G  K   + CTA+INGQCP  L+  GGCNNPCT 
Sbjct  138  NGCTK--GIRCTADINGQCPNQLRAQGGCNNPCTV  170



>pdb|1Z3Q|A Chain A, Resolution Of The Structure Of The Allergenic And Antifungal 
Banana Fruit Thaumatin-like Protein At 1.7a
Length=200

 Score =   217 bits (552),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 117/149 (79%), Gaps = 4/149 (3%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            ATFE+ N C YTVWAA+ P GGGR+L++GQ+W I   AGT   RIWGRT C FD SGRG 
Sbjct  1    ATFEIVNRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGR  59

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVL CT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F+PT  G   C
Sbjct  60   CQTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGG---C  116

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
            R + C A+INGQCP ALK PGGCNNPCT 
Sbjct  117  RGIRCAADINGQCPGALKAPGGCNNPCTV  145



>gb|KDP25478.1| hypothetical protein JCGZ_20634 [Jatropha curcas]
Length=225

 Score =   218 bits (554),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F S++AA F + NNCPYTVWAA+ P GGGR+LD  QTW +    GT+ ARIW RTNC FD
Sbjct  19   FISAHAANFAITNNCPYTVWAAAVP-GGGRQLDSQQTWSLDVNPGTQGARIWARTNCGFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGG+L+C  +G+PPNTLAEYALNQF ++DFFDISLVDGFN+PM F+PT 
Sbjct  78   GAGRGQCQTGDCGGLLECQAYGQPPNTLAEYALNQFNDMDFFDISLVDGFNVPMDFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G +  R + C+A+INGQCP  L+ PGGCNNPCT 
Sbjct  138  GGCS--RGIRCSADINGQCPDVLRAPGGCNNPCTV  170



>gb|AAM21199.1|AF364864_1 pathogenesis-related protein 5-1 [Helianthus annuus]
Length=222

 Score =   217 bits (553),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 118/154 (77%), Gaps = 3/154 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F  + AA F +RNNCPYTVWA + P GGGR+L+ GQTW +T  AGT  ARIW RTNC FD
Sbjct  16   FHYTNAAVFTIRNNCPYTVWAGAVP-GGGRQLNSGQTWSLTVAAGTAGARIWPRTNCNFD  74

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SGRG CQTGDC G+LQC  +G PPNTLAEYALNQF NLDFFDISLVDGFN+PM F P  
Sbjct  75   GSGRGRCQTGDCNGLLQCQNYGTPPNTLAEYALNQFNNLDFFDISLVDGFNVPMVFRPNS  134

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G    R +SCTA+INGQCP  L+ PGGCNNPCT
Sbjct  135  NGCT--RGISCTADINGQCPGELRAPGGCNNPCT  166



>gb|ABD65913.1| osmotin [Nicotiana tabacum]
Length=150

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = -3

Query  462  TSSYAA-TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            T +YA+  FEV NNCPYTVWAA+TPVGGGRRL+RGQ+W   AP GTKMARIWGRTNC FD
Sbjct  17   TYTYASGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+C GWGKPP+TLAEYALNQF NLDF+DIS++DGFNIPM F PTK
Sbjct  77   GAGRGWCQTGDCGGVLECKGWGKPPHTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTK  136

Query  105  AGANKCRAVSCTAN  64
             G  KC  + CT+ 
Sbjct  137  PGPGKCHGIQCTSQ  150



>gb|ABC39612.1| osmotin [Rosa roxburghii]
Length=177

 Score =   216 bits (549),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 116/143 (81%), Gaps = 5/143 (3%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA++P GGGRRLDRGQ+W +    GT MARIWGRTNC FDSSGRG C TGDC
Sbjct  1    NNCPYTVWAAASP-GGGRRLDRGQSWTLNVAPGTAMARIWGRTNCNFDSSGRGRCATGDC  59

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            G  L+C GWG PPNTLAEYALNQFGN+DF DISLVDGFNIPM F+PT     +CR + CT
Sbjct  60   G-ALECKGWGVPPNTLAEYALNQFGNMDFIDISLVDGFNIPMDFSPTTG---RCRGIRCT  115

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP  L+VP GCNNPCT 
Sbjct  116  ADINGQCPRELRVPSGCNNPCTV  138



>ref|XP_008238907.1| PREDICTED: protein P21-like [Prunus mume]
Length=226

 Score =   217 bits (553),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 123/154 (80%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            TS+ AA F++RNNC +TVWAA++P GGGR+L+ G++W +   +GT  ARIW RT C FD 
Sbjct  21   TSTNAARFDIRNNCAFTVWAAASP-GGGRQLNSGESWPLDVSSGTTGARIWARTGCSFDG  79

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQC G+G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT  
Sbjct  80   AGRGSCQTGDCGGVLQCQGYGQPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTDN  139

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCP  LK  GGCNNPCT 
Sbjct  140  GCT--RGIQCTADINGQCPNELKAQGGCNNPCTV  171



>gb|ACJ63016.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=228

 Score =   217 bits (553),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLPDGGGSGC  140

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  141  SRGPRCAVDVNARCPAELRQDGVCNNAC  168



>gb|ABC39609.1| osmotin [Rosa roxburghii]
 gb|ABC39610.1| osmotin [Rosa roxburghii]
 gb|ABC39611.1| osmotin [Rosa roxburghii]
 gb|ABC39613.1| osmotin [Rosa roxburghii]
 gb|ABC39614.1| osmotin [Rosa roxburghii]
Length=177

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 116/143 (81%), Gaps = 5/143 (3%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA++P GGGRRLDRGQ+W +    GT MARIWGRTNC FDSSGRG C TGDC
Sbjct  1    NNCPYTVWAAASP-GGGRRLDRGQSWTLNVAPGTAMARIWGRTNCNFDSSGRGRCATGDC  59

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            G  L+C GWG PPNTLAEYALNQFGN+DF DISLVDGFNIPM F+PT     +CR + CT
Sbjct  60   G-ALECKGWGVPPNTLAEYALNQFGNMDFIDISLVDGFNIPMDFSPTTG---RCRGIRCT  115

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP  L+VP GCNNPCT 
Sbjct  116  ADINGQCPRELRVPSGCNNPCTV  138



>gb|ACJ62936.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=228

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLPDGGGSGC  140

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  141  SRGPRCAVDVNARCPAELRQDGVCNNAC  168



>gb|AAK59277.1|AF378573_1 thaumatin-like protein [Sambucus nigra]
Length=226

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F+S++AA F +RNNCP+TVWAA+ P GGGR+L+RGQ W +  PA T  ARIW RTNC FD
Sbjct  19   FSSAHAANFNIRNNCPFTVWAAAVP-GGGRQLNRGQVWSLDVPARTAGARIWARTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDC G+L C  +G PPNTLAEYALNQF NLDFFDISLVDGFN+ M F+PT 
Sbjct  78   GAGRGRCQTGDCNGLLACQAYGTPPNTLAEYALNQFNNLDFFDISLVDGFNVAMDFSPTG  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
              A   R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  138  GCA---RGIQCTADINGQCPNVLRAPGGCNNPCTV  169



>ref|XP_004304709.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=229

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATF ++NNCP+TVWA + P GGG RL  G+TW +  PAGT+ ARIW RTNC FD +GRG
Sbjct  28   AATFNIKNNCPFTVWAGAVP-GGGTRLGTGETWTLNVPAGTRGARIWPRTNCNFDGAGRG  86

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGG LQC G+G+PPNTLAEYALNQ+ NLDFFDISLVDGFN+PM F+P   G   
Sbjct  87   RCQTGDCGGHLQCQGYGQPPNTLAEYALNQYMNLDFFDISLVDGFNVPMDFSPISNGCT-  145

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             R + CTA+INGQCPA L+ PGGCNNPCT 
Sbjct  146  -RGIRCTADINGQCPAQLRAPGGCNNPCTV  174



>ref|XP_008238906.1| PREDICTED: protein P21-like [Prunus mume]
Length=226

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 123/154 (80%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            TS+ AA F+++N C +TVWAA++P GGGR+L+ G++W +   +GT  ARIW RT C FD 
Sbjct  21   TSANAAHFDIQNKCTFTVWAAASP-GGGRQLNSGESWPLDVSSGTTGARIWARTGCSFDG  79

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQC G+G+PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT  
Sbjct  80   AGRGSCQTGDCGGVLQCQGYGQPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTDN  139

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G  K   + CTA+INGQCP  LK PGGCNNPCT 
Sbjct  140  GCTK--GIQCTADINGQCPNELKAPGGCNNPCTV  171



>sp|P81370.2|TLP_ACTDE RecName: Full=Thaumatin-like protein; AltName: Allergen=Act d 
2; Flags: Precursor [Actinidia deliciosa]
 emb|CAI38795.2| thaumatin-like protein [Actinidia deliciosa]
 gb|AGC39175.1| thaumatin-like protein [Actinidia deliciosa]
Length=225

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT +  ATF + NNCP+TVWAA+ P GGG+RLDRGQ W I   AGTK AR+W RT C FD
Sbjct  19   FTCARGATFNIINNCPFTVWAAAVP-GGGKRLDRGQNWIINPGAGTKGARVWPRTGCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDC G+LQC  +G+PPNTLAEYALNQF NLDFFDISLVDGFN+ M F+PT 
Sbjct  78   GAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVDGFNVAMEFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  138  GGCT--RGIKCTADINGQCPNELRAPGGCNNPCTV  170



>gb|AAB82777.1| ripening-associated protein [Musa acuminata AAA Group]
Length=193

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 118/154 (77%), Gaps = 4/154 (3%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            T S+AATF + N C YTVWAA+ P GGGR+L++GQ+W I   AGT   RIWGRT C FD 
Sbjct  22   TLSHAATFXIVNRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDG  80

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SGRG CQTGDCGGVL CT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F+PT  
Sbjct  81   SGRGRCQTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSG  140

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G   CR + C A+INGQCP AL  PGGC NPCT 
Sbjct  141  G---CRGIRCAADINGQCPGALXAPGGCXNPCTV  171



>gb|ADP69173.1| pathogenesis related protein-5 [Populus tomentosa]
Length=225

 Score =   216 bits (550),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = -3

Query  522  ISNMEYlrtlpilllllsLFTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRIT  343
            +S   YL   P  LL   LFT S AATFE+RN C  TVWAA+ P GGG+RLD G++W IT
Sbjct  1    MSRFSYLSLFPCFLLFAHLFTFSNAATFEIRNQCTDTVWAAAVP-GGGQRLDPGRSWTIT  59

Query  342  APAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDF  163
            A AGT  ARIWGRT C FD +GRG+C+TGDC G+LQC  +GKPPNTLAEYALNQF NLDF
Sbjct  60   ANAGTTQARIWGRTKCNFDGAGRGTCETGDCNGLLQCQAYGKPPNTLAEYALNQFNNLDF  119

Query  162  FDISLVDGFNIPMRFAPTKAGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            FDISLVDGFN+PM F+P    +  CR + C A+INGQCP  L+  GGCNNPCT 
Sbjct  120  FDISLVDGFNVPMDFSPV---SGNCRGIRCAADINGQCPNQLRASGGCNNPCTV  170



>ref|XP_008437224.1| PREDICTED: protein P21-like [Cucumis melo]
Length=227

 Score =   216 bits (550),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = -3

Query  459  SSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSS  280
             ++AATF++RNNCP+ VWAA+ P GGGRRL++   W +    GT  ARIW RTNC FD S
Sbjct  21   HTHAATFQIRNNCPFAVWAAAVP-GGGRRLNQNDVWTLNVNPGTVAARIWARTNCNFDGS  79

Query  279  GRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAG  100
            GRG CQTGDCGG+LQC  +G PPNTLAEYALNQF NLDFFDIS VDGFN+PM F+PT +G
Sbjct  80   GRGRCQTGDCGGLLQCQAYGTPPNTLAEYALNQFNNLDFFDISFVDGFNVPMEFSPTSSG  139

Query  99   ANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
                R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  140  CT--RGIRCTADINGQCPNELRAPGGCNNPCTV  170



>gb|AGC39176.1| thaumatin-like protein [Actinidia chinensis]
Length=225

 Score =   216 bits (549),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT +  ATF + NNCP+TVWAA+ P GGG+RLDRGQ W I   AGTK AR+W RT C FD
Sbjct  19   FTCARGATFNIINNCPFTVWAAAVP-GGGKRLDRGQNWIINPGAGTKGARVWARTGCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDC G+LQC  +G+PPNTLAEYALNQF NLDFFDISLVDGFN+ M F+PT 
Sbjct  78   GAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVDGFNVAMEFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTANIN QCP  L+ PGGCNNPCT 
Sbjct  138  GGCT--RGIKCTANINEQCPNELRAPGGCNNPCTV  170



>gb|ACJ62952.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=228

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT C+FD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCQFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLPDGGGSGC  140

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  141  SRGPRCAVDVNARCPAELRQDGVCNNAC  168



>gb|ACJ62944.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=228

 Score =   216 bits (549),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT C+FD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCQFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLPDGGGSGC  140

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  141  SRGPRCAVDVNARCPAELRQDGVCNNAC  168



>gb|ACJ63015.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=228

 Score =   216 bits (549),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT C+FD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCQFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLPDGGGSGC  140

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  141  SRGPRCAVDVNARCPAELRQDGVCNNAC  168



>ref|XP_003525411.1| PREDICTED: PR-5 protein [Glycine max]
Length=222

 Score =   215 bits (548),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            +++YAA F++ N C Y VWAA+ P GGGRRL+ GQ+W +  PAGTK AR+W RT C FD 
Sbjct  17   SAAYAARFDITNRCSYPVWAAAVP-GGGRRLNSGQSWALDVPAGTKGARVWARTGCNFDG  75

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            SGRG CQTGDCGGVL C  +G PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT  
Sbjct  76   SGRGGCQTGDCGGVLDCKAYGTPPNTLAEYALNQFSNLDFFDISLVDGFNVPMDFSPTSN  135

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCP+ LK  GGCNNPCT 
Sbjct  136  GCT--RGIRCTADINGQCPSQLKTQGGCNNPCTV  167



>gb|ABA33969.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=228

 Score =   216 bits (549),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKF++SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFEASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLPDGGGSGC  140

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  141  SRGPRCAVDVNARCPAELRQDGVCNNAC  168



>gb|ABC39615.1| osmotin [Rosa roxburghii]
Length=177

 Score =   214 bits (544),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 116/143 (81%), Gaps = 5/143 (3%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA++P GGGRRLDRGQ+W +    GT MARIWGRT+C FDSSGRG C TGDC
Sbjct  1    NNCPYTVWAAASP-GGGRRLDRGQSWTLNVAPGTAMARIWGRTDCNFDSSGRGRCATGDC  59

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            G  L+C GWG PPNTLAEYALNQFGN+DF DISLVDGFNIPM F+PT     +CR + CT
Sbjct  60   G-ALECKGWGVPPNTLAEYALNQFGNMDFIDISLVDGFNIPMDFSPTTG---RCRGIRCT  115

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP  L+VP GCNNPCT 
Sbjct  116  ADINGQCPRELRVPSGCNNPCTV  138



>gb|AAQ10092.1| thaumatin-like protein [Vitis vinifera]
Length=225

 Score =   215 bits (548),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT SYAATF ++N+C YTVWAA+ P GGG +L  GQ+W +   AGT   R+W RTNC FD
Sbjct  19   FTPSYAATFNIQNHCSYTVWAAAVP-GGGMQLGSGQSWSLNVNAGTTGGRVWARTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SG G C+TGDCGG+LQCT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F PT 
Sbjct  78   ASGNGKCETGDCGGLLQCTAYGTPPNTLAEFALNQFSNLDFFDISLVDGFNVPMAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G    R +SCTA+I G+CPAALK  GGCNNPCT
Sbjct  138  NGCT--RGISCTADIVGECPAALKTTGGCNNPCT  169



>gb|AGS80337.1| thaumatin protein [Actinidia eriantha]
Length=225

 Score =   215 bits (548),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT ++AATF + NNCP+TVWAA+ P GGG+RLDRGQTW I   AGTK AR+W RT C FD
Sbjct  19   FTCAHAATFNIINNCPFTVWAAAVP-GGGKRLDRGQTWNIFPGAGTKGARVWARTGCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDC G+LQC  +G PPNTLAEYALNQF N+DF DISLVDGFN+P  F+PT 
Sbjct  78   GAGRGKCQTGDCNGLLQCQAYGAPPNTLAEYALNQFNNMDFIDISLVDGFNVPTEFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA IN +CP  L+ PGGCNNPCT 
Sbjct  138  GGCT--RVIKCTAKINEECPNELRAPGGCNNPCTV  170



>gb|ACZ67184.1| pathogenesis-related thaumatin, partial [Populus nigra]
Length=154

 Score =   213 bits (541),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATFE+RNNCPYTVWAA++P GGGR LDRGQTW +  PAGT MARIWGRTNC FD SG G
Sbjct  23   AATFEIRNNCPYTVWAAASP-GGGRXLDRGQTWXLNVPAGTSMARIWGRTNCNFDGSGXG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN-  94
             CQTGDC G L+C GWG PPNTLAEYALNQFGNLDF+DISLVDGFNIPM F+PT +G + 
Sbjct  82   RCQTGDCTGGLECKGWGVPPNTLAEYALNQFGNLDFYDISLVDGFNIPMEFSPTSSGGSG  141

Query  93   KCRAVSCTANING  55
            KC+A+ CTA+ING
Sbjct  142  KCQALLCTADING  154



>ref|XP_006453440.1| hypothetical protein CICLE_v10010751mg [Citrus clementina]
 ref|XP_006474140.1| PREDICTED: thaumatin-like protein-like [Citrus sinensis]
 gb|ESR66680.1| hypothetical protein CICLE_v10010751mg [Citrus clementina]
 gb|KDO62433.1| hypothetical protein CISIN_1g027329mg [Citrus sinensis]
Length=225

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             TS++ ATFE+RNNCP+TVWAA+ P GGGR+L RGQTW I    GTK ARIW RT C F+
Sbjct  19   LTSTHGATFEIRNNCPFTVWAAAVP-GGGRQLIRGQTWTINVNPGTKQARIWARTKCTFN  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            + GRG C+TGDC G+LQC  +G PPNTLAEY LNQF NLDF+DISLVDGFN+PM F+P  
Sbjct  78   AEGRGRCETGDCNGLLQCQAYGAPPNTLAEYTLNQFNNLDFYDISLVDGFNVPMDFSP--  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
                +CR + C A+I GQCP  L+ PGGCNNPCT 
Sbjct  136  LSGIRCRGIRCAADITGQCPNELRAPGGCNNPCTV  170



>ref|XP_011018224.1| PREDICTED: thaumatin-like protein, partial [Populus euphratica]
Length=159

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 123/163 (75%), Gaps = 4/163 (2%)
 Frame = -3

Query  522  ISNMEYlrtlpilllllsLFTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRIT  343
            +S   YL   P  LL    FT S AATFE+RN CPYTVWAA+ P GGGRRLDRGQ+W IT
Sbjct  1    MSRFSYLALFPCFLLFAHFFTLSNAATFEIRNQCPYTVWAAAVP-GGGRRLDRGQSWTIT  59

Query  342  APAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDF  163
            A AGT  ARIWGRT C FD +GRG+C+TGDC G+LQC  +GKPPNTLAEYALNQ+ NLDF
Sbjct  60   AKAGTTQARIWGRTKCNFDGAGRGTCETGDCNGLLQCQAFGKPPNTLAEYALNQYNNLDF  119

Query  162  FDISLVDGFNIPMRFAPTKAGANKCRAVSCTANINGQCPAALK  34
            FDISLVDGFN+PM F+P    +  CR + C A+INGQCP  L+
Sbjct  120  FDISLVDGFNVPMDFSPV---SGSCRGIRCAADINGQCPGPLR  159



>emb|CAN68052.1| hypothetical protein VITISV_010558 [Vitis vinifera]
Length=210

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTS++AA F ++N+C YTVWAA+ P GGG RLDRGQ+W +T   GT  ARIW RT C FD
Sbjct  19   FTSAHAAIFNIQNHCXYTVWAAAVP-GGGXRLDRGQSWSLTVNPGTTGARIWARTGCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL CT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F PT 
Sbjct  78   GAGRGXCQTGDCGGVLXCTAYGAPPNTLAEFALNQFNNLDFFDISLVDGFNVPMAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA+I GQCP+ L+  GGCNNPCT 
Sbjct  138  NGCT--RGIRCTADIVGQCPSQLRTQGGCNNPCTV  170



>ref|XP_007040164.1| Osmotin 34 [Theobroma cacao]
 gb|EOY24665.1| Osmotin 34 [Theobroma cacao]
Length=224

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F+ ++AATF++RNNCPYTVWAA+ P GGGR ++RG+TW+I+A  GT  ARIW RTNC+FD
Sbjct  18   FSLAHAATFDIRNNCPYTVWAAAVP-GGGRPMNRGETWQISAAPGTTQARIWARTNCQFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG CQTGDCGGVL+C G+G PPNTLAEYA+ QF N DF DIS +DGFN+PM F+   
Sbjct  77   ASGRGKCQTGDCGGVLECKGYGSPPNTLAEYAIGQFANQDFIDISNIDGFNVPMEFSSNS  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPC  7
             G    R + CTA+I GQCP  LKVPGGCN PC
Sbjct  137  PGCT--RVIKCTADIVGQCPNELKVPGGCNGPC  167



>ref|XP_002282988.1| PREDICTED: protein P21 [Vitis vinifera]
 emb|CAN66515.1| hypothetical protein VITISV_021587 [Vitis vinifera]
Length=225

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTSSYAATF ++N+C YTVWAA+ P GGG +L  GQ+W +   AGT   R+W RTNC FD
Sbjct  19   FTSSYAATFNIQNHCSYTVWAAAVP-GGGMQLGSGQSWSLNVNAGTTGGRVWARTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SG G C+TGDCGG+LQCT +G PPNTLAE+ALNQ+ NLDFFDISLVDGFN+ M F PT 
Sbjct  78   ASGNGKCETGDCGGLLQCTAYGTPPNTLAEFALNQYSNLDFFDISLVDGFNVAMAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G    R +SCTA+I G+CPAALK  GGCNNPCT
Sbjct  138  NGCT--RGISCTADIVGECPAALKTTGGCNNPCT  169



>gb|ABC39616.1| osmotin [Rosa roxburghii]
Length=177

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 115/143 (80%), Gaps = 5/143 (3%)
 Frame = -3

Query  429  NNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDC  250
            NNCPYTVWAA++P GGGRR DRGQ+W +    GT MARIWGRTNC FDSSGRG C TGDC
Sbjct  1    NNCPYTVWAAASP-GGGRRPDRGQSWTLNVAPGTAMARIWGRTNCNFDSSGRGRCATGDC  59

Query  249  GGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCT  70
            G  L+C GWG PPNTLAEYALNQFGN+DF DISLVDGFNIPM F+PT     +CR + CT
Sbjct  60   G-ALECKGWGVPPNTLAEYALNQFGNMDFIDISLVDGFNIPMDFSPTTG---RCRGIRCT  115

Query  69   ANINGQCPAALKVPGGCNNPCTT  1
            A+INGQCP  L+VP GCNNPCT 
Sbjct  116  ADINGQCPRELRVPSGCNNPCTV  138



>prf||1906370A protein P21
Length=202

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 114/149 (77%), Gaps = 2/149 (1%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            A FE+ N C YTVWAAS PVGGG +L+ GQ+W +  PAGTK AR+W RT C FD SGRG 
Sbjct  1    ARFEITNRCTYTVWAASVPVGGGVQLNPGQSWSVDVPAGTKGARVWARTGCNFDGSGRGG  60

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVL C  +G PPNTLAEY LN F NLDFFDISLVDGFN+PM F+PT  G    
Sbjct  61   CQTGDCGGVLDCKAYGAPPNTLAEYGLNGFNNLDFFDISLVDGFNVPMDFSPTSNGCT--  118

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
            R +SCTA+INGQCP+ LK  GGCNNPCT 
Sbjct  119  RGISCTADINGQCPSELKTQGGCNNPCTV  147



>gb|ABB86298.1| thaumatin-like protein isoform 2 [Ficus pumila var. awkeotsang]
Length=228

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F SS+AA F+V NNCPYTVWAASTPVGGGR+L+  +TW I  PAGT  ARIW RT C FD
Sbjct  21   FASSHAAIFDVINNCPYTVWAASTPVGGGRQLNSRETWTINVPAGTSAARIWARTGCSFD  80

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVLQCTG+G  PNTLAE+ LN F NLD+ D+S++DGFN+PM F+ T 
Sbjct  81   GAGRGRCQTGDCGGVLQCTGYGSSPNTLAEFTLNGFANLDYIDMSVIDGFNVPMEFSSTS  140

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPC  7
             G N  R + CTA+I GQCPA L+V GGCN  C
Sbjct  141  GGCN--RVIRCTADIIGQCPAELRVDGGCNGAC  171



>emb|CAN65933.1| hypothetical protein VITISV_023047 [Vitis vinifera]
Length=225

 Score =   214 bits (544),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 116/154 (75%), Gaps = 3/154 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTSSYAATF ++N C YTVWA + P GGG RL  GQ+W +   AGT   R+W RT C FD
Sbjct  19   FTSSYAATFNIQNRCSYTVWAVAIP-GGGMRLGSGQSWSLDVKAGTTGGRVWARTGCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SG G C+TGDCGG LQC  +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F PT 
Sbjct  78   ASGNGKCETGDCGGRLQCKAFGTPPNTLAEFALNQFSNLDFFDISLVDGFNVPMAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G    R +SCTANI GQCPAALK  GGCNNPCT
Sbjct  138  KGCT--RGISCTANIVGQCPAALKTAGGCNNPCT  169



>ref|XP_007210589.1| hypothetical protein PRUPE_ppa016268mg [Prunus persica]
 gb|EMJ11788.1| hypothetical protein PRUPE_ppa016268mg [Prunus persica]
Length=226

 Score =   214 bits (544),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 3/154 (2%)
 Frame = -3

Query  462  TSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDS  283
            TS+ AA F++RNNC +TVWAA++P GGGR L+ G++W +   +GT  ARIW RT C FD 
Sbjct  21   TSTNAARFDIRNNCAFTVWAAASP-GGGRPLNSGESWPLDVNSGTAGARIWARTGCSFDG  79

Query  282  SGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKA  103
            +GRGSCQTGDCGGVLQC G+G+PPNTLAEYALNQ+ NLDFFDISLVDGFN+PM F+PT  
Sbjct  80   AGRGSCQTGDCGGVLQCQGYGQPPNTLAEYALNQYNNLDFFDISLVDGFNVPMDFSPTDN  139

Query  102  GANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
            G    R + CTA+INGQCP  LK  GGCNNPCT 
Sbjct  140  GCT--RGIQCTADINGQCPNELKAQGGCNNPCTV  171



>sp|P25096.1|P21_SOYBN RecName: Full=Protein P21 [Glycine max]
Length=202

 Score =   213 bits (542),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 114/149 (77%), Gaps = 2/149 (1%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            A FE+ N C YTVWAAS PVGGG +L+ GQ+W +  PAGTK AR+W RT C FD SGRG 
Sbjct  1    ARFEITNRCTYTVWAASVPVGGGVQLNPGQSWSVDVPAGTKGARVWARTGCNFDGSGRGG  60

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDCGGVL C  +G PPNTLAEY LN F NLDFFDISLVDGFN+PM F+PT  G    
Sbjct  61   CQTGDCGGVLDCKAYGAPPNTLAEYGLNGFNNLDFFDISLVDGFNVPMDFSPTSNGCT--  118

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
            R +SCTA+INGQCP+ LK  GGCNNPCT 
Sbjct  119  RGISCTADINGQCPSELKTQGGCNNPCTV  147



>gb|ACV83333.1| pathogenesis-related protein 5 [Panax ginseng]
Length=251

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            F  ++AATF++ NNCP+TVWAA+ P GGGR+L  GQTW I  PAGT++ RIW RT+C FD
Sbjct  17   FMYTHAATFDILNNCPFTVWAAAVP-GGGRQLKHGQTWTINVPAGTQLVRIWPRTDCNFD  75

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG C TGDC G LQC G+G+PPN LAEYALNQF  LDF+DISLVDGFN+P+ F+P  
Sbjct  76   FTGRGRCATGDCNGQLQCQGFGQPPNALAEYALNQFNYLDFYDISLVDGFNVPIEFSPNS  135

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  136  GGC--ARVIRCTADINGQCPDVLRAPGGCNNPCTV  168



>gb|ABA33972.1| zeamatin-like protein [Zea diploperennis]
Length=227

 Score =   214 bits (544),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>gb|ABQ42566.1| thaumatin-like protein [Actinidia deliciosa]
Length=201

 Score =   213 bits (541),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            ATF + NNCP+TVWAA+ P GGG+RLDRGQ W I   AGTK AR+W RT C FD +GRG 
Sbjct  1    ATFNIINNCPFTVWAAAVP-GGGKRLDRGQNWIINPSAGTKGARVWPRTGCNFDGAGRGK  59

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDC G+LQC  +G+PPNTLAEYALNQF NLDFFDISLVDGFN+ M F+PT  G    
Sbjct  60   CQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVDGFNVAMEFSPTSGGCT--  117

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
            R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  118  RGIKCTADINGQCPNELRAPGGCNNPCTV  146



>gb|ABD64681.1| thaumatin-like protein [Vitis vinifera]
Length=225

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT SYAATF ++N+C YTVWAA+ P GGG +L  GQ+W +   AGT   R+W RTNC FD
Sbjct  19   FTPSYAATFIIQNHCSYTVWAAAVP-GGGMQLGSGQSWSLNVNAGTTGGRVWARTNCNFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SG G C+TGDCGG+LQCT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F PT 
Sbjct  78   ASGNGKCETGDCGGLLQCTAYGTPPNTLAEFALNQFSNLDFFDISLVDGFNVPMAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G    R  SCTA+I G+CPAALK  GGCNNPCT
Sbjct  138  NGCT--RGTSCTADIVGECPAALKTTGGCNNPCT  169



>ref|XP_006477434.1| PREDICTED: osmotin [Citrus sinensis]
Length=225

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 116/148 (78%), Gaps = 3/148 (2%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATF++RNNCPYTVWAA+ P GGGRRLDRGQ W +    GTK ARIW RTNC+FD +GRG
Sbjct  24   AATFDIRNNCPYTVWAAAVP-GGGRRLDRGQNWPLNVNPGTKAARIWARTNCQFDGAGRG  82

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGG+LQC  +G PPNTLAE+ALNQF NLDF DIS +DGFN+PM F+    G N 
Sbjct  83   RCQTGDCGGLLQCQAYGSPPNTLAEFALNQFQNLDFIDISNIDGFNVPMEFSSVSGGCN-  141

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R + CTA+I GQCP  L+VPGGCN PC
Sbjct  142  -RVIRCTADIVGQCPNELRVPGGCNGPC  168



>gb|ABA33960.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63013.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=227

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>ref|NP_001105356.1| zeamatin precursor [Zea mays]
 sp|P33679.2|ZEAM_MAIZE RecName: Full=Zeamatin; Flags: Precursor [Zea mays]
 gb|AAA92882.1| unnamed protein product [Zea mays]
 gb|ABA33959.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33961.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33962.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33963.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33965.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33966.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33971.1| zeamatin-like protein [Zea diploperennis]
 gb|ABA33973.1| zeamatin-like protein [Zea diploperennis]
 gb|ABA33974.1| zeamatin-like protein [Zea diploperennis]
 gb|ABA33975.1| zeamatin-like protein [Zea diploperennis]
 gb|ABA33976.1| zeamatin-like protein [Zea diploperennis]
 gb|ABA33978.1| zeamatin-like protein [Zea diploperennis]
 gb|ACJ62937.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62939.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62940.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62941.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62943.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62945.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62946.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62948.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62950.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62951.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62953.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62954.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62956.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62957.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62958.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62959.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62960.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62966.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62968.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62970.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62971.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62973.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62974.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62993.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62994.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62995.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62998.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63009.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63012.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63014.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63018.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACN29098.1| unknown [Zea mays]
 tpg|DAA63292.1| TPA: putative thaumatin domain family protein [Zea mays]
Length=227

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>ref|XP_010042867.1| PREDICTED: thaumatin-like protein, partial [Eucalyptus grandis]
Length=227

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             T + AATF +RN+CPYTVWAA+ P GGGRRL RGQ+W +    GTK ARIW RTNC+FD
Sbjct  19   LTCANAATFNIRNDCPYTVWAAALP-GGGRRLARGQSWSLNVSPGTKQARIWARTNCQFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++G+G C+TGDCGGV +CT  G+PPNTLAEY LNQFG  DFFDISLVDGFN+PM F+PT 
Sbjct  78   AAGKGKCKTGDCGGVRECTSSGQPPNTLAEYELNQFGGKDFFDISLVDGFNVPMGFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPC  7
             G      + CTA+ING+CPA LK PGGCN PC
Sbjct  138  DGCTS--GIKCTADINGECPAELKAPGGCNGPC  168



>gb|ACJ62967.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=246

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>gb|ACJ62989.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=246

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>gb|ACJ63017.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=227

 Score =   213 bits (542),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT+ ARIW RT C+FD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTRAARIWARTGCQFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>gb|ACJ62976.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62980.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=246

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>gb|ACJ62977.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62979.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62986.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=246

 Score =   213 bits (543),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>ref|XP_008437223.1| PREDICTED: protein P21-like [Cucumis melo]
Length=224

 Score =   212 bits (540),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            ++ + AATFEVRNNCP+TVWAA++P GGG+ L  GQ W      GT  AR+W RTN  FD
Sbjct  18   YSHTNAATFEVRNNCPFTVWAAASP-GGGKELGSGQAWNFDVRPGTAGARVWARTNFNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SGRG C+TGDCGG+L C G+G PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT 
Sbjct  77   ASGRGHCETGDCGGLLSCQGYGAPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPTS  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G +  R + C ANING+CP  L+ PGGCNNPCT 
Sbjct  137  NGCS--RGIRCNANINGECPNELRAPGGCNNPCTV  169



>gb|ACJ63019.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=227

 Score =   213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT C+FD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCQFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>pdb|4BCT|A Chain A, Crystal Structure Of Kiwi-fruit Allergen Act D 2
Length=201

 Score =   211 bits (538),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            ATF + NNCP+TVWAA+ P GGG+RLDRGQ W I   AGTK AR+W RT C FD +GRG 
Sbjct  1    ATFNIINNCPFTVWAAAVP-GGGKRLDRGQNWIINPGAGTKGARVWPRTGCNFDGAGRGK  59

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            CQTGDC G+LQC  +G+PPNTLAEYALNQF NLDFFDISLVDGFN+ M F+PT  G    
Sbjct  60   CQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVDGFNVAMEFSPTSGGCT--  117

Query  87   RAVSCTANINGQCPAALKVPGGCNNPCTT  1
            R + CTA+INGQCP  L+ PGGCNNPCT 
Sbjct  118  RGIKCTADINGQCPNELRAPGGCNNPCTV  146



>gb|KCW77586.1| hypothetical protein EUGRSUZ_D01900 [Eucalyptus grandis]
Length=231

 Score =   213 bits (541),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             T + AATF +RN+CPYTVWAA+ P GGGRRL RGQ+W +    GTK ARIW RTNC+FD
Sbjct  19   LTCANAATFNIRNDCPYTVWAAALP-GGGRRLARGQSWSLNVSPGTKQARIWARTNCQFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++G+G C+TGDCGGV +CT  G+PPNTLAEY LNQFG  DFFDISLVDGFN+PM F+PT 
Sbjct  78   AAGKGKCKTGDCGGVRECTSSGQPPNTLAEYELNQFGGKDFFDISLVDGFNVPMGFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPC  7
             G      + CTA+ING+CPA LK PGGCN PC
Sbjct  138  DGCTS--GIKCTADINGECPAELKAPGGCNGPC  168



>gb|KGN50135.1| hypothetical protein Csa_5G155460 [Cucumis sativus]
Length=225

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 118/155 (76%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            ++ ++AATFEV NNCP+T+WAA+ P GGG++L++   W      GT  AR+W RTNC FD
Sbjct  18   YSHTHAATFEVHNNCPFTLWAAAVP-GGGQQLNQNDVWIFDVNPGTAAARVWARTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SG G C+TGDCGG+LQC G+G PPNTLAEYALNQF NLDFFDISLVDGFN+P+ F+PT 
Sbjct  77   DSGNGGCETGDCGGLLQCQGYGSPPNTLAEYALNQFNNLDFFDISLVDGFNVPLEFSPTS  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
                 CR +SC A+INGQCP  L+  GGCNNPCT 
Sbjct  137  G---DCRGISCNADINGQCPNELRASGGCNNPCTV  168



>ref|XP_008437225.1| PREDICTED: protein P21-like [Cucumis melo]
Length=225

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 117/155 (75%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            ++ ++AATFEV N CP++VWAA+ P GGG++L++   W      GT  AR+W RTNC FD
Sbjct  18   YSHTHAATFEVHNKCPFSVWAAAVP-GGGQQLNQNDIWIFDVNPGTVAARVWARTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SG G C+TGDCGG+LQC  +G PPNTLAEYALNQF NLDFFDISLVDGFN+PM F+PT 
Sbjct  77   DSGHGGCETGDCGGLLQCQAYGSPPNTLAEYALNQFNNLDFFDISLVDGFNVPMEFSPTS  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
                 CR +SC A+INGQCP  L+ PGGCNNPCT 
Sbjct  137  G---DCRGISCNADINGQCPNELRAPGGCNNPCTV  168



>gb|ACJ62949.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=227

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT C+FD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCQFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>dbj|BAF95882.1| putative thaumatin-like protein [Vitis hybrid cultivar]
Length=222

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 8/154 (5%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTS++AATF++ N C YTVWAA++P GGGRRLD GQ+W IT   GT  ARIWGRT+C FD
Sbjct  19   FTSTHAATFDILNKCTYTVWAAASP-GGGRRLDSGQSWTITVNPGTTNARIWGRTSCTFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++GRG C+TGDC G+L+C G+G PPNTLAE+ALNQ  NLD+ DISLVDGFNIPM F+   
Sbjct  78   ANGRGKCETGDCNGLLECQGYGSPPNTLAEFALNQPNNLDYIDISLVDGFNIPMDFS---  134

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
                 CR + C+A+INGQCP+ LK PGGCNNPCT
Sbjct  135  ----GCRGIQCSADINGQCPSELKAPGGCNNPCT  164



>gb|ABA33957.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33958.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33964.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33967.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33968.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33970.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ABA33977.1| zeamatin-like protein [Zea diploperennis]
 gb|ACJ62938.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62942.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62947.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62955.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62961.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62962.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62963.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62964.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62965.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62969.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62975.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62978.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62981.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62982.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62983.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62984.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62985.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62987.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62988.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62990.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62991.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62992.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62996.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62997.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ62999.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63000.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63001.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63002.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63003.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63004.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63005.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63006.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63007.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63008.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63010.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63011.1| zeamatin-like protein [Zea mays subsp. parviglumis]
 gb|ACJ63020.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=227

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT C+FD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCQFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>ref|XP_004143988.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004159977.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
Length=225

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 118/155 (76%), Gaps = 4/155 (3%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            ++ ++AATFEV NNCP+T+WAA+ P GGG++L++   W      GT  AR+W RTNC FD
Sbjct  18   YSHTHAATFEVHNNCPFTLWAAAVP-GGGQQLNQNDVWIFDVNPGTAAARVWARTNCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             SG G C+TGDCGG+LQC G+G PPNTLAEYALNQF NLDFFDISLVDGFN+P+ F+PT 
Sbjct  77   DSGNGGCETGDCGGLLQCQGYGSPPNTLAEYALNQFNNLDFFDISLVDGFNVPLEFSPTS  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
                 CR +SC A+INGQCP  L+  GGCNNPCT 
Sbjct  137  G---DCRGISCNADINGQCPNELRASGGCNNPCTV  168



>gb|ACJ62972.1| zeamatin-like protein [Zea mays subsp. parviglumis]
Length=227

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AA F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT C+FD+SGRG
Sbjct  21   AAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCQFDASGRG  80

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
            SC+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+  
Sbjct  81   SCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGC  139

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R   C  ++N +CPA L+  G CNN C
Sbjct  140  SRGPRCAVDVNARCPAELRQDGVCNNAC  167



>gb|KCW77573.1| hypothetical protein EUGRSUZ_D01887 [Eucalyptus grandis]
Length=227

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 117/150 (78%), Gaps = 4/150 (3%)
 Frame = -3

Query  453  YAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGR  274
            +AATF++ N C YTVWAA++P GGGRRLD  QTW +T   GT MARIWGRTNC FD++G+
Sbjct  24   HAATFDIVNQCTYTVWAAASP-GGGRRLDPSQTWSLTVAPGTTMARIWGRTNCNFDANGQ  82

Query  273  GSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGAN  94
            G C++GDC  +L C GWG PPNTLAE+ALNQ  N+DF DISLVDGFNIPM F+PT     
Sbjct  83   GQCESGDCNRLLDCQGWGSPPNTLAEFALNQPNNVDFLDISLVDGFNIPMDFSPTTGA--  140

Query  93   KCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             CR + C A+INGQCPA LK PGGCNNPCT
Sbjct  141  -CRGIRCAADINGQCPAELKAPGGCNNPCT  169



>ref|XP_004298786.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=226

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATF + NNCP+TVWA + P GGGR+L  GQ W +  PAGT+ ARIW RTNC FD +GRG
Sbjct  23   AATFNIINNCPFTVWAGAVP-GGGRQLGTGQAWTLNVPAGTQGARIWPRTNCNFDGAGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGG+LQC G+G+ PNTLAEYALNQF N DF+DISLVDGFN+PM F+PT  G   
Sbjct  82   RCQTGDCGGLLQCQGYGQAPNTLAEYALNQFMNRDFYDISLVDGFNVPMDFSPTSNGCT-  140

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             R + C+A+INGQCPA L+ PGGCNNPCT 
Sbjct  141  -RGIRCSADINGQCPAQLRAPGGCNNPCTV  169



>pdb|1DU5|A Chain A, The Crystal Structure Of Zeamatin.
 pdb|1DU5|B Chain B, The Crystal Structure Of Zeamatin.
Length=206

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 116/147 (79%), Gaps = 1/147 (1%)
 Frame = -3

Query  447  ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGS  268
            A F V N CP+TVWAAS PVGGGR+L+RG++WRITAPAGT  ARIW RT CKFD+SGRGS
Sbjct  1    AVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRGS  60

Query  267  CQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKC  88
            C+TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+   
Sbjct  61   CRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGCS  119

Query  87   RAVSCTANINGQCPAALKVPGGCNNPC  7
            R   C  ++N +CPA L+  G CNN C
Sbjct  120  RGPRCAVDVNARCPAELRQDGVCNNAC  146



>ref|XP_004298781.1| PREDICTED: thaumatin-like protein-like [Fragaria vesca subsp. 
vesca]
Length=226

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATF ++NNCP+TVWA + P GGG++L  GQTW I   AGTK ARIW RTNC FD +GRG
Sbjct  23   AATFNIKNNCPFTVWAGAVP-GGGKQLGTGQTWTINVAAGTKGARIWPRTNCNFDGAGRG  81

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGG+LQC G+G+PPNTLAEYALNQ+ N DF+DISL+DGFN+PM F+P   G   
Sbjct  82   RCQTGDCGGLLQCQGYGQPPNTLAEYALNQYMNRDFYDISLIDGFNVPMDFSPISNGCT-  140

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             R + CTA+INGQCPA L+ PGGCNN CT 
Sbjct  141  -RGIRCTADINGQCPAQLRAPGGCNNACTV  169



>ref|XP_006396874.1| hypothetical protein EUTSA_v10028948mg [Eutrema salsugineum]
 dbj|BAJ34101.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38327.1| hypothetical protein EUTSA_v10028948mg [Eutrema salsugineum]
Length=222

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 120/155 (77%), Gaps = 7/155 (5%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
             +++ A  F++ N C YTVWAA++P GGGRRLD GQ+W +   AGT+MARIWGRT C FD
Sbjct  18   ISTAKAVRFDILNQCGYTVWAAASP-GGGRRLDPGQSWPLDVAAGTRMARIWGRTKCNFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            SSGRG C+TGDC G LQCTGWG+PPNTLAEYALNQF N+DF+DISLVDGFNIPM F    
Sbjct  77   SSGRGRCETGDCTGGLQCTGWGQPPNTLAEYALNQFNNMDFYDISLVDGFNIPMEF----  132

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
              ++ C+ + C A+INGQCP  L+  GGCNNPCT 
Sbjct  133  --SSNCKRILCNADINGQCPNELRATGGCNNPCTV  165



>ref|XP_002276431.1| PREDICTED: protein P21 [Vitis vinifera]
Length=237

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTSSYAATF ++N C YTVWAA+ P GGG RL  GQ+W +   A T  +R+WGRT+C FD
Sbjct  19   FTSSYAATFNIQNRCSYTVWAAAIP-GGGMRLGSGQSWSLDVKAATTGSRVWGRTDCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            +SG G C+TGDCGG LQC  +G PPNTLAE+ALNQ+ NLDFFDISLVDGFN+P+ F PT 
Sbjct  78   ASGNGKCETGDCGGRLQCKAYGTPPNTLAEFALNQYSNLDFFDISLVDGFNVPIAFNPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
             G    R +SCTA+I G+CPAALK  GGCNNPCT
Sbjct  138  NGCT--RGISCTADIVGECPAALKTTGGCNNPCT  169



>gb|AAQ64678.1| osmotin-like pathognesis-related protein 5 [Gossypium hirsutum]
Length=208

 Score =   210 bits (534),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 113/139 (81%), Gaps = 4/139 (3%)
 Frame = -3

Query  417  YTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSCQTGDCGGVL  238
            YTVWAA++P GGGRRLD  Q+W I  PAGT MARIWGRTNC FD++GRG CQTGDCGG+L
Sbjct  1    YTVWAAASP-GGGRRLDPRQSWTINVPAGTAMARIWGRTNCNFDANGRGHCQTGDCGGLL  59

Query  237  QCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCRAVSCTANIN  58
            +C GWG PPNTLAEY+LNQFGN+DF+DISL+DGFNIPM F PT  G   C  + CTA++ 
Sbjct  60   ECQGWGVPPNTLAEYSLNQFGNMDFYDISLIDGFNIPMVFGPTNGG---CHNIRCTADLK  116

Query  57   GQCPAALKVPGGCNNPCTT  1
            GQCP  L+ PGGCNNPCT 
Sbjct  117  GQCPNELRAPGGCNNPCTV  135



>ref|XP_006440574.1| hypothetical protein CICLE_v10022104mg [Citrus clementina]
 gb|ESR53814.1| hypothetical protein CICLE_v10022104mg [Citrus clementina]
 gb|KDO38995.1| hypothetical protein CISIN_1g027335mg [Citrus sinensis]
Length=225

 Score =   211 bits (536),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 115/148 (78%), Gaps = 3/148 (2%)
 Frame = -3

Query  450  AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRG  271
            AATF++RNNCPYTVWAA+ P GGGRRLDRGQ W +    GTK ARIW RTNC+FD +GRG
Sbjct  24   AATFDIRNNCPYTVWAAAVP-GGGRRLDRGQNWPLNVNPGTKAARIWARTNCQFDGAGRG  82

Query  270  SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANK  91
             CQTGDCGG+LQC  +G PPNTLAE+ALNQF NLDF DIS +DGFN+PM F+    G N 
Sbjct  83   RCQTGDCGGLLQCQAYGSPPNTLAEFALNQFQNLDFIDISNIDGFNVPMEFSSVSGGCN-  141

Query  90   CRAVSCTANINGQCPAALKVPGGCNNPC  7
             R + CTA+I  QCP  L+VPGGCN PC
Sbjct  142  -RVIRCTADIVRQCPNELRVPGGCNGPC  168



>ref|XP_007040162.1| Osmotin 34 [Theobroma cacao]
 gb|EOY24663.1| Osmotin 34 [Theobroma cacao]
Length=224

 Score =   211 bits (536),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 116/155 (75%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FT + AA   +RNNCPYTVWAA+ P GGGR+LDRG  W +    GT  AR+W RT C+FD
Sbjct  18   FTVATAAIINIRNNCPYTVWAAAVP-GGGRQLDRGGVWDLNVNPGTTGARVWARTKCQFD  76

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG C+TGDCGG+LQC  +G PPNTLAEYALNQF N DFFDISLVDGFNIPM F+PT 
Sbjct  77   GAGRGRCETGDCGGLLQCQAYGAPPNTLAEYALNQFNNKDFFDISLVDGFNIPMDFSPTS  136

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G    R + CTA+I GQCP  LK PGGCNNPCT 
Sbjct  137  GGCT--RGIRCTADIIGQCPNQLKAPGGCNNPCTV  169



>ref|XP_002283042.1| PREDICTED: protein P21 [Vitis vinifera]
 emb|CAN80707.1| hypothetical protein VITISV_034657 [Vitis vinifera]
Length=225

 Score =   210 bits (535),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTS++AA F ++N C YTVWAA+ P GGGRRLD  Q+W  T   GT  ARIW RT C FD
Sbjct  19   FTSAHAAIFNIQNRCSYTVWAAAVP-GGGRRLDPRQSWSSTVNPGTTGARIWARTGCSFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
             +GRG CQTGDCGGVL+CT +G PPNTLAE+ALNQF NLDFFDISLVDGFN+PM F+PT 
Sbjct  78   GAGRGRCQTGDCGGVLECTAYGAPPNTLAEFALNQFNNLDFFDISLVDGFNVPMAFSPTS  137

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCTT  1
             G +  R + CTANI GQCP+ L+  GGCNNPCT 
Sbjct  138  NGCS--RGIRCTANIVGQCPSQLRAQGGCNNPCTV  170



>gb|AAB61590.1| VVTL1 [Vitis vinifera]
Length=222

 Score =   210 bits (535),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 121/154 (79%), Gaps = 8/154 (5%)
 Frame = -3

Query  465  FTSSYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFD  286
            FTS++AATF++ N C YTVWAA++P GGGRRLD GQ+W IT   GT  ARIWGRT+C FD
Sbjct  19   FTSTHAATFDILNKCTYTVWAAASP-GGGRRLDSGQSWTITVNPGTTNARIWGRTSCTFD  77

Query  285  SSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTK  106
            ++GRG C+TGDC G+L+C G+G PPNTLAE+ALNQ  NLD+ DISLVDGFNIPM F+   
Sbjct  78   ANGRGKCETGDCNGLLECQGYGSPPNTLAEFALNQPNNLDYIDISLVDGFNIPMDFS---  134

Query  105  AGANKCRAVSCTANINGQCPAALKVPGGCNNPCT  4
                 CR + C+ +INGQCP+ LK PGGCNNPCT
Sbjct  135  ----GCRGIQCSVDINGQCPSELKAPGGCNNPCT  164



>ref|XP_002463077.1| hypothetical protein SORBIDRAFT_02g037350 [Sorghum bicolor]
 gb|EER99598.1| hypothetical protein SORBIDRAFT_02g037350 [Sorghum bicolor]
Length=233

 Score =   211 bits (536),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 114/146 (78%), Gaps = 1/146 (1%)
 Frame = -3

Query  444  TFEVRNNCPYTVWAASTPVGGGRRLDRGQTWRITAPAGTKMARIWGRTNCKFDSSGRGSC  265
             F V N CPYTVWAAS PVGGGRRL+RG+TWRITAP GT  ARIW RT C+FD+SGRGSC
Sbjct  29   VFTVVNRCPYTVWAASVPVGGGRRLNRGETWRITAPPGTTAARIWARTGCQFDASGRGSC  88

Query  264  QTGDCGGVLQCTGWGKPPNTLAEYALNQFGNLDFFDISLVDGFNIPMRFAPTKAGANKCR  85
            +TGDCGGVLQCTG+G+ PNTLAEYAL QF NLDFFDISL+DGFN+PM F P   G+   R
Sbjct  89   RTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLP-DGGSGCSR  147

Query  84   AVSCTANINGQCPAALKVPGGCNNPC  7
               C  ++N +CPA L+  G CNN C
Sbjct  148  GPRCAVDVNARCPAELRQDGVCNNAC  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524784179000