BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14233_g1_i1 len=1274 path=[41:0-328 370:329-331 @373@!:332-806
40:807-1273]

Length=1274
                                                                      Score     E

ref|XP_006358993.1|  PREDICTED: protein IQ-DOMAIN 1-like                292   2e-92   
ref|XP_009630326.1|  PREDICTED: protein IQ-DOMAIN 1-like                291   3e-92   
ref|XP_009785151.1|  PREDICTED: protein IQ-DOMAIN 1                     291   4e-92   
ref|XP_004251884.1|  PREDICTED: protein IQ-DOMAIN 1                     266   1e-82   
ref|XP_011098253.1|  PREDICTED: protein IQ-DOMAIN 1                     263   4e-81   
ref|XP_006451745.1|  hypothetical protein CICLE_v10009079mg             245   5e-74   
ref|XP_011044948.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     244   1e-73   
ref|XP_007021652.1|  IQ-domain 10                                       244   1e-73   
ref|XP_002316795.2|  hypothetical protein POPTR_0011s09880g             244   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011044946.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     244   1e-73   
gb|AFK44344.1|  unknown                                                 242   7e-73   
ref|XP_011000246.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     240   5e-72   
ref|XP_011000245.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     240   6e-72   
gb|AFK38907.1|  unknown                                                 238   1e-71   
ref|XP_008225192.1|  PREDICTED: protein IQ-DOMAIN 1                     238   3e-71   
ref|XP_007211719.1|  hypothetical protein PRUPE_ppa009395mg             237   5e-71   
ref|XP_004293920.1|  PREDICTED: protein IQ-DOMAIN 1-like                236   7e-71   
ref|XP_010279173.1|  PREDICTED: protein IQ-DOMAIN 1                     237   1e-70   
ref|XP_002298904.1|  calmodulin-binding family protein                  236   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_009347238.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     234   6e-70   
ref|XP_002282973.1|  PREDICTED: protein IQ-DOMAIN 1                     235   6e-70   Vitis vinifera
emb|CAN67034.1|  hypothetical protein VITISV_013534                     234   1e-69   Vitis vinifera
gb|KDP36274.1|  hypothetical protein JCGZ_09839                         234   2e-69   
ref|XP_002305760.1|  hypothetical protein POPTR_0004s05230g             233   3e-69   Populus trichocarpa [western balsam poplar]
ref|XP_008383657.1|  PREDICTED: protein IQ-DOMAIN 1-like                232   4e-69   
gb|ABK96454.1|  unknown                                                 233   5e-69   Populus trichocarpa x Populus deltoides
ref|XP_008371443.1|  PREDICTED: protein IQ-DOMAIN 1                     231   1e-68   
emb|CDY20099.1|  BnaA01g29030D                                          229   2e-68   
ref|XP_011027720.1|  PREDICTED: protein IQ-DOMAIN 1                     230   3e-68   
ref|XP_006582139.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3     230   3e-68   
ref|XP_009352817.1|  PREDICTED: protein IQ-DOMAIN 1-like                229   7e-68   
ref|XP_011045896.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     229   8e-68   
ref|XP_006582138.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     229   1e-67   
gb|KEH38641.1|  calmodulin-binding protein                              227   2e-67   
gb|EYU26346.1|  hypothetical protein MIMGU_mgv1a026164mg                225   2e-67   
ref|XP_002885066.1|  IQ-domain 10                                       227   2e-67   
ref|XP_009116509.1|  PREDICTED: protein IQ-DOMAIN 1                     226   3e-67   
gb|KEH38640.1|  calmodulin-binding protein                              228   5e-67   
ref|XP_002317436.1|  hypothetical protein POPTR_0011s07740g             227   5e-67   Populus trichocarpa [western balsam poplar]
gb|KHN36870.1|  Protein IQ-DOMAIN 1                                     226   1e-66   
ref|XP_006592925.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     226   1e-66   
emb|CDY32322.1|  BnaC01g36410D                                          224   2e-66   
ref|XP_011045897.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3     225   2e-66   
gb|AFK45555.1|  unknown                                                 226   2e-66   
ref|XP_002519560.1|  calmodulin binding protein, putative               224   4e-66   Ricinus communis
ref|XP_002522532.1|  calmodulin binding protein, putative               225   4e-66   Ricinus communis
ref|XP_011045894.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     225   5e-66   
ref|XP_010502428.1|  PREDICTED: protein IQ-DOMAIN 1-like                223   5e-66   
ref|XP_003543221.2|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     225   6e-66   
ref|XP_006594738.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     225   7e-66   
gb|KHN31794.1|  Protein IQ-DOMAIN 1                                     223   1e-65   
ref|XP_006449460.1|  hypothetical protein CICLE_v10016080mg             223   2e-65   
gb|KDO77786.1|  hypothetical protein CISIN_1g022139mg                   223   2e-65   
ref|XP_004489053.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     221   2e-65   
ref|XP_006467683.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     223   2e-65   
ref|XP_003525998.2|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     223   3e-65   
ref|XP_004489052.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     221   4e-65   
ref|XP_003593714.1|  IQ domain-containing protein                       221   9e-65   
ref|XP_006298363.1|  hypothetical protein CARUB_v10014433mg             219   1e-64   
ref|NP_188123.1|  protein IQ-domain 10                                  219   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161597.1|  hypothetical protein PHAVU_001G082800g             220   1e-64   
gb|KFK38852.1|  hypothetical protein AALP_AA3G168800                    219   1e-64   
ref|XP_007025458.1|  IQ-domain 9, putative isoform 1                    221   1e-64   
ref|XP_002272018.1|  PREDICTED: protein IQ-DOMAIN 1                     219   4e-64   Vitis vinifera
ref|XP_010686348.1|  PREDICTED: protein IQ-DOMAIN 1                     219   1e-63   
ref|XP_003546016.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          219   1e-63   
gb|KDP21056.1|  hypothetical protein JCGZ_21527                         219   1e-63   
ref|XP_006370035.1|  hypothetical protein POPTR_0001s38470g             216   1e-63   
ref|XP_010519241.1|  PREDICTED: protein IQ-DOMAIN 1                     216   2e-63   
ref|XP_010057060.1|  PREDICTED: protein IQ-DOMAIN 1                     218   3e-63   
gb|AFK49244.1|  unknown                                                 216   6e-63   
ref|XP_010487320.1|  PREDICTED: protein IQ-DOMAIN 1-like                214   8e-63   
ref|XP_010108418.1|  Protein IQ-DOMAIN 1                                217   9e-63   
ref|XP_004485866.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     215   1e-62   
ref|XP_003543012.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          215   2e-62   
ref|XP_010108277.1|  Protein IQ-DOMAIN 1                                216   2e-62   
ref|XP_007148077.1|  hypothetical protein PHAVU_006G178700g             215   2e-62   
ref|XP_009347297.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     211   1e-61   
ref|XP_004248134.1|  PREDICTED: protein IQ-DOMAIN 1                     212   3e-61   
gb|KHN47201.1|  Protein IQ-DOMAIN 1                                     212   4e-61   
gb|AFK39609.1|  unknown                                                 212   4e-61   
ref|XP_010915584.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     212   6e-61   
ref|XP_006361054.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     211   7e-61   
ref|XP_010413787.1|  PREDICTED: protein IQ-DOMAIN 1-like                209   9e-61   
ref|XP_006594294.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     209   2e-60   
ref|XP_003529361.1|  PREDICTED: protein IQ-DOMAIN 1-like isoformX2      209   2e-60   
ref|NP_180946.2|  IQ-domain 9 protein                                   208   3e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KGN49281.1|  hypothetical protein Csa_6G518360                       209   4e-60   
ref|XP_007153699.1|  hypothetical protein PHAVU_003G057400g             208   4e-60   
ref|XP_010469407.1|  PREDICTED: protein IQ-DOMAIN 1-like                207   6e-60   
gb|KHG08166.1|  Protein IQ-DOMAIN 1 -like protein                       208   9e-60   
ref|XP_010509802.1|  PREDICTED: protein IQ-DOMAIN 1-like                207   9e-60   
ref|XP_008439774.1|  PREDICTED: protein IQ-DOMAIN 1                     208   1e-59   
ref|XP_004134936.1|  PREDICTED: protein IQ-DOMAIN 1-like                208   2e-59   
emb|CDO96736.1|  unnamed protein product                                207   3e-59   
gb|KHG04803.1|  Protein IQ-DOMAIN 1 -like protein                       206   5e-59   
ref|XP_011096410.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          206   7e-59   
ref|XP_006295584.1|  hypothetical protein CARUB_v10024692mg             206   8e-59   
gb|KHN30995.1|  Protein IQ-DOMAIN 1                                     205   1e-58   
ref|XP_011096412.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          204   2e-58   
ref|XP_002881318.1|  IQ-domain 9                                        203   4e-58   
ref|XP_006655806.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     204   1e-57   
ref|XP_006410544.1|  hypothetical protein EUTSA_v10017065mg             200   4e-57   
ref|XP_008784249.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     201   4e-57   
ref|XP_009802744.1|  PREDICTED: protein IQ-DOMAIN 1-like                201   4e-57   
ref|XP_007133164.1|  hypothetical protein PHAVU_011G157000g             200   1e-56   
gb|EYU28055.1|  hypothetical protein MIMGU_mgv1a010650mg                200   1e-56   
ref|XP_009803285.1|  PREDICTED: protein IQ-DOMAIN 1-like                200   2e-56   
ref|XP_004964808.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     200   2e-56   
ref|XP_008783926.1|  PREDICTED: protein IQ-DOMAIN 1                     200   4e-56   
ref|XP_009143817.1|  PREDICTED: protein IQ-DOMAIN 1-like                197   5e-56   
gb|AAB67617.1|  putative SF16 protein {Helianthus annuus}               196   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009618388.1|  PREDICTED: protein IQ-DOMAIN 1-like                197   9e-56   
gb|EEC80043.1|  hypothetical protein OsI_21733                          198   1e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_009389986.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     197   1e-55   
ref|XP_010549376.1|  PREDICTED: protein IQ-DOMAIN 1                     197   2e-55   
ref|NP_001149799.1|  LOC100283426                                       197   2e-55   Zea mays [maize]
ref|XP_006852506.1|  hypothetical protein AMTR_s00021p00158910          197   3e-55   
emb|CDY27925.1|  BnaCnng05100D                                          195   3e-55   
ref|XP_010060656.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     195   4e-55   
emb|CDY17214.1|  BnaA05g09740D                                          194   4e-55   
ref|XP_004137215.1|  PREDICTED: protein IQ-DOMAIN 1-like                194   6e-55   
ref|NP_001056849.1|  Os06g0155300                                       197   7e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451703.1|  PREDICTED: protein IQ-DOMAIN 1-like                194   8e-55   
ref|XP_010060657.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     194   9e-55   
gb|KCW67461.1|  hypothetical protein EUGRSUZ_F01203                     192   2e-54   
ref|XP_004232951.1|  PREDICTED: protein IQ-DOMAIN 1                     192   2e-53   
ref|XP_010915586.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     189   5e-53   
ref|XP_009404499.1|  PREDICTED: protein IQ-DOMAIN 1-like                190   7e-53   
ref|XP_008784325.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     187   3e-52   
gb|ABK24642.1|  unknown                                                 189   6e-52   Picea sitchensis
ref|XP_008657461.1|  PREDICTED: protein IQ-DOMAIN 1-like                188   1e-51   
ref|XP_009607452.1|  PREDICTED: protein IQ-DOMAIN 1-like                187   1e-51   
emb|CDY62768.1|  BnaC04g44330D                                          182   2e-50   
ref|XP_003564310.1|  PREDICTED: protein IQ-DOMAIN 1-like                184   5e-50   
ref|XP_009389987.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     179   3e-49   
gb|EMT06677.1|  hypothetical protein F775_25983                         179   2e-48   
gb|EMS51544.1|  Protein IQ-DOMAIN 1                                     179   2e-48   
gb|KDO77788.1|  hypothetical protein CISIN_1g022139mg                   160   6e-43   
gb|KDO77789.1|  hypothetical protein CISIN_1g022139mg                   160   7e-43   
gb|EPS68276.1|  hypothetical protein M569_06495                         152   1e-39   
emb|CDP05980.1|  unnamed protein product                                145   3e-37   
ref|XP_009141354.1|  PREDICTED: protein IQ-DOMAIN 1-like                137   1e-34   
gb|ACU17572.1|  unknown                                                 135   4e-34   Glycine max [soybeans]
gb|KCW67458.1|  hypothetical protein EUGRSUZ_F01203                     135   2e-33   
gb|KCW67457.1|  hypothetical protein EUGRSUZ_F01203                     135   3e-33   
gb|KCW67456.1|  hypothetical protein EUGRSUZ_F01203                     135   4e-33   
ref|XP_004169423.1|  PREDICTED: protein IQ-DOMAIN 1-like                132   8e-33   
ref|XP_003540276.1|  PREDICTED: protein IQ-DOMAIN 1 isoformX1           137   1e-32   
ref|XP_006592786.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          137   1e-32   
ref|XP_010045169.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     132   9e-31   
ref|NP_001276234.1|  uncharacterized protein LOC100819346               131   2e-30   
ref|XP_010045168.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     130   3e-30   
ref|XP_009368414.1|  PREDICTED: protein IQ-DOMAIN 1-like                127   3e-29   
ref|XP_008385579.1|  PREDICTED: protein IQ-DOMAIN 1                     127   5e-29   
ref|XP_010937801.1|  PREDICTED: protein IQ-DOMAIN 1-like                126   1e-28   
ref|XP_009410027.1|  PREDICTED: protein IQ-DOMAIN 1-like                126   1e-28   
ref|XP_002976100.1|  hypothetical protein SELMODRAFT_104616             120   3e-28   
ref|XP_002970253.1|  hypothetical protein SELMODRAFT_67789              119   4e-28   
gb|ACN35371.1|  unknown                                                 124   7e-28   Zea mays [maize]
ref|NP_001141032.1|  uncharacterized protein LOC100273111               124   7e-28   Zea mays [maize]
gb|KHN17990.1|  Protein IQ-DOMAIN 1                                     123   7e-28   
ref|XP_002968277.1|  hypothetical protein SELMODRAFT_68032              118   8e-28   
ref|XP_006587474.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     123   8e-28   
ref|XP_001772157.1|  predicted protein                                  118   1e-27   
ref|XP_010046779.1|  PREDICTED: protein IQ-DOMAIN 1-like                123   2e-27   
ref|XP_010922527.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     123   2e-27   
ref|XP_001753107.1|  predicted protein                                  117   2e-27   
ref|XP_010922523.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     123   2e-27   
ref|XP_007150009.1|  hypothetical protein PHAVU_005G118200g             122   2e-27   
gb|AFR23353.1|  IQ-DOMAIN 1-like isoform 1                              122   2e-27   
ref|XP_006587475.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     121   2e-27   
ref|XP_010922528.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3     122   3e-27   
gb|AFR23354.1|  IQ-DOMAIN 1-like isoform 4                              121   5e-27   
ref|XP_007009749.1|  IQ-domain 3 isoform 5                              120   7e-27   
ref|XP_010906025.1|  PREDICTED: protein IQ-DOMAIN 1-like                120   7e-27   
gb|KHN48320.1|  Protein IQ-DOMAIN 1                                     120   9e-27   
emb|CDP04285.1|  unnamed protein product                                119   1e-26   
ref|XP_003541403.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     120   2e-26   
ref|XP_007009747.1|  IQ-domain 3 isoform 3                              120   2e-26   
ref|XP_006340461.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     119   2e-26   
ref|XP_004251217.1|  PREDICTED: protein IQ-DOMAIN 1                     119   2e-26   
ref|XP_006601026.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     119   3e-26   
ref|XP_009333751.1|  PREDICTED: protein IQ-DOMAIN 1-like                119   3e-26   
ref|XP_006340462.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     119   4e-26   
ref|XP_010319837.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X4     118   5e-26   
ref|XP_010319835.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     118   5e-26   
ref|XP_004237517.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     118   5e-26   
ref|XP_007009745.1|  IQ-domain 3 isoform 1                              119   5e-26   
gb|KDP29080.1|  hypothetical protein JCGZ_16469                         119   5e-26   
ref|XP_001778214.1|  predicted protein                                  116   6e-26   
ref|XP_011102231.1|  PREDICTED: protein IQ-DOMAIN 1-like                118   6e-26   
ref|XP_010247740.1|  PREDICTED: protein IQ-DOMAIN 1-like                118   6e-26   
ref|XP_007012312.1|  IQ-domain 6                                        118   6e-26   
ref|XP_010319836.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3     118   8e-26   
gb|KHN36509.1|  Protein IQ-DOMAIN 1                                     117   8e-26   
ref|XP_006594910.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     117   8e-26   
ref|XP_003543406.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     117   8e-26   
ref|XP_006340320.1|  PREDICTED: protein IQ-DOMAIN 1-like                117   8e-26   
emb|CDY10618.1|  BnaA05g17440D                                          117   9e-26   
gb|KDP42966.1|  hypothetical protein JCGZ_23908                         117   1e-25   
ref|XP_009145423.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          117   1e-25   
ref|XP_009145424.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          117   1e-25   
gb|KHG05214.1|  Protein IQ-DOMAIN 1 -like protein                       117   1e-25   
ref|XP_010253551.1|  PREDICTED: protein IQ-DOMAIN 1-like                117   2e-25   
ref|XP_008446903.1|  PREDICTED: protein IQ-DOMAIN 1                     117   2e-25   
ref|XP_004291529.1|  PREDICTED: uncharacterized protein LOC101308834    116   2e-25   
ref|XP_006644964.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     117   2e-25   
ref|XP_011005472.1|  PREDICTED: protein IQ-DOMAIN 1-like                116   2e-25   
emb|CDY37387.1|  BnaC05g30430D                                          115   2e-25   
ref|XP_010681705.1|  PREDICTED: protein IQ-DOMAIN 1-like                117   3e-25   
gb|KCW51631.1|  hypothetical protein EUGRSUZ_J01122                     116   3e-25   
ref|NP_001044716.1|  Os01g0833800                                       117   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002513725.1|  calmodulin binding protein, putative               116   3e-25   Ricinus communis
ref|XP_002314260.2|  calmodulin-binding family protein                  115   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_003569041.1|  PREDICTED: protein IQ-DOMAIN 1-like                116   4e-25   
ref|XP_010032228.1|  PREDICTED: protein IQ-DOMAIN 1-like                116   4e-25   
gb|KHG12811.1|  Protein IQ-DOMAIN 1 -like protein                       115   4e-25   
ref|XP_004970476.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     116   4e-25   
gb|KHG20568.1|  Protein IQ-DOMAIN 1                                     115   4e-25   
ref|XP_006833285.1|  hypothetical protein AMTR_s00109p00027450          115   5e-25   
ref|XP_011012762.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X4     115   6e-25   
ref|XP_011012761.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3     115   7e-25   
ref|XP_011012759.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     114   7e-25   
emb|CDY24286.1|  BnaC03g42590D                                          114   8e-25   
ref|XP_011012760.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     114   8e-25   
gb|AER62605.1|  hypothetical protein                                    110   8e-25   
ref|XP_011102119.1|  PREDICTED: protein IQ-DOMAIN 1-like                115   8e-25   
ref|XP_009336410.1|  PREDICTED: protein IQ-DOMAIN 1-like                114   8e-25   
ref|XP_002298262.2|  hypothetical protein POPTR_0001s22260g             114   8e-25   Populus trichocarpa [western balsam poplar]
emb|CDP15562.1|  unnamed protein product                                114   9e-25   
ref|XP_010232517.1|  PREDICTED: protein IQ-DOMAIN 1-like                115   1e-24   
ref|XP_007015643.1|  IQ-domain 5 isoform 1                              114   1e-24   
ref|XP_007027263.1|  IQ-domain 1                                        115   1e-24   
ref|XP_008776608.1|  PREDICTED: protein IQ-DOMAIN 1-like                114   1e-24   
ref|XP_009421378.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     114   1e-24   
ref|XP_009135780.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     114   1e-24   
ref|XP_009135782.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     114   1e-24   
ref|XP_007015644.1|  IQ-domain 5 isoform 2                              112   1e-24   
ref|XP_009410599.1|  PREDICTED: protein IQ-DOMAIN 1-like                114   1e-24   
ref|XP_009392714.1|  PREDICTED: protein IQ-DOMAIN 1-like                114   1e-24   
ref|XP_002315282.2|  hypothetical protein POPTR_0010s22510g             114   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011044606.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     114   1e-24   
gb|AER62607.1|  hypothetical protein                                    112   1e-24   
gb|AER62593.1|  hypothetical protein                                    112   2e-24   
ref|XP_011044601.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     114   2e-24   
ref|XP_004960343.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     114   2e-24   
gb|AFW80825.1|  hypothetical protein ZEAMMB73_814741                    114   2e-24   
gb|EEC78429.1|  hypothetical protein OsI_18263                          114   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_010031573.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...    113   2e-24   
ref|XP_010263052.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          112   2e-24   
gb|AER62595.1|  hypothetical protein                                    111   2e-24   
gb|KCW50934.1|  hypothetical protein EUGRSUZ_J00581                     113   3e-24   
ref|XP_010544323.1|  PREDICTED: protein IQ-DOMAIN 1                     112   3e-24   
gb|EYU39546.1|  hypothetical protein MIMGU_mgv1a006621mg                113   3e-24   
ref|XP_009785649.1|  PREDICTED: protein IQ-DOMAIN 1                     113   3e-24   
ref|XP_009592510.1|  PREDICTED: protein IQ-DOMAIN 1                     113   3e-24   
ref|XP_006653992.1|  PREDICTED: protein IQ-DOMAIN 1-like                113   3e-24   
ref|XP_010263050.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          112   3e-24   
gb|KHG19387.1|  Protein IQ-DOMAIN 1 -like protein                       113   4e-24   
gb|ABR18434.1|  unknown                                                 112   4e-24   Picea sitchensis
gb|AER62597.1|  hypothetical protein                                    111   4e-24   
emb|CDX92933.1|  BnaA03g36550D                                          112   4e-24   
ref|XP_004142411.1|  PREDICTED: protein IQ-DOMAIN 1-like                113   4e-24   
ref|XP_002315283.2|  calmodulin-binding family protein                  112   5e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010089800.1|  Protein IQ-DOMAIN 1                                112   5e-24   
ref|XP_001783650.1|  predicted protein                                  112   5e-24   
ref|XP_011090294.1|  PREDICTED: protein IQ-DOMAIN 1                     112   6e-24   
ref|XP_010669670.1|  PREDICTED: protein IQ-DOMAIN 1-like                112   6e-24   
gb|KDO48489.1|  hypothetical protein CISIN_1g011478mg                   112   6e-24   
dbj|BAK03986.1|  predicted protein                                      113   6e-24   
gb|AAV33309.1|  putative SF16 protein                                   112   6e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EYU36022.1|  hypothetical protein MIMGU_mgv1a018723mg                111   6e-24   
ref|NP_001054511.1|  Os05g0123200                                       110   7e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AER62601.1|  hypothetical protein                                    110   7e-24   
gb|AER62598.1|  hypothetical protein                                    110   7e-24   
gb|KDP32549.1|  hypothetical protein JCGZ_14761                         112   7e-24   
gb|AER62591.1|  hypothetical protein                                    110   7e-24   
gb|AER62590.1|  hypothetical protein                                    110   7e-24   
gb|ACF82478.1|  unknown                                                 112   7e-24   
gb|AER62602.1|  hypothetical protein                                    110   8e-24   
ref|XP_002265745.2|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          112   8e-24   
gb|AER62609.1|  hypothetical protein                                    110   8e-24   
ref|XP_007151791.1|  hypothetical protein PHAVU_004G075300g             112   8e-24   
gb|AER62594.1|  hypothetical protein                                    110   8e-24   
ref|NP_001142271.1|  IQD1 isoform 1                                     112   8e-24   
gb|AER62611.1|  hypothetical protein                                    110   9e-24   
ref|XP_001778752.1|  predicted protein                                  107   9e-24   
gb|AER62608.1|  hypothetical protein                                    110   9e-24   
gb|AER62606.1|  hypothetical protein                                    107   9e-24   
gb|AER62610.1|  hypothetical protein                                    110   1e-23   
ref|XP_011019421.1|  PREDICTED: protein IQ-DOMAIN 1                     111   1e-23   
gb|AER62604.1|  hypothetical protein                                    108   1e-23   
ref|XP_008355249.1|  PREDICTED: protein IQ-DOMAIN 1-like                111   1e-23   
ref|XP_006487845.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     111   1e-23   
ref|XP_006487851.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X7     111   1e-23   
ref|XP_010108462.1|  Protein IQ-DOMAIN 1                                112   1e-23   
gb|KDO48967.1|  hypothetical protein CISIN_1g013629mg                   111   1e-23   
gb|AER62596.1|  hypothetical protein                                    108   1e-23   
ref|XP_003537265.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     111   1e-23   
ref|XP_006424069.1|  hypothetical protein CICLE_v10028475mg             111   2e-23   
ref|XP_007151793.1|  hypothetical protein PHAVU_004G075300g             111   2e-23   
gb|AER62603.1|  hypothetical protein                                    109   2e-23   
ref|XP_009421376.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     111   2e-23   
ref|XP_006650348.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     110   2e-23   
ref|XP_010685457.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          110   2e-23   
gb|ACN33378.1|  unknown                                                 110   2e-23   
gb|KGN66607.1|  hypothetical protein Csa_1G641010                       108   2e-23   
gb|AER62600.1|  hypothetical protein                                    108   2e-23   
gb|ACR34785.1|  unknown                                                 110   2e-23   
gb|KHG03798.1|  Protein IQ-DOMAIN 1 -like protein                       109   2e-23   
ref|XP_004154661.1|  PREDICTED: protein IQ-DOMAIN 1-like                110   2e-23   
ref|XP_011026998.1|  PREDICTED: protein IQ-DOMAIN 1                     111   2e-23   
ref|XP_010685454.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          110   3e-23   
ref|XP_009397417.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     110   3e-23   
ref|XP_010526054.1|  PREDICTED: protein IQ-DOMAIN 1-like                110   3e-23   
ref|XP_010908563.1|  PREDICTED: protein IQ-DOMAIN 1-like                110   3e-23   
ref|XP_002464165.1|  hypothetical protein SORBIDRAFT_01g013400          109   4e-23   
ref|XP_003521377.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     110   4e-23   
ref|XP_007205131.1|  hypothetical protein PRUPE_ppa005071mg             110   4e-23   
gb|KHN09477.1|  Protein IQ-DOMAIN 1                                     110   4e-23   
ref|XP_003605986.1|  IQ domain-containing protein                       109   4e-23   
ref|XP_003605985.1|  IQ domain-containing protein                       109   4e-23   
ref|XP_008443629.1|  PREDICTED: protein IQ-DOMAIN 1                     109   4e-23   
gb|AES88183.2|  IQ calmodulin-binding motif protein                     109   5e-23   
ref|XP_006406201.1|  hypothetical protein EUTSA_v10020807mg             109   5e-23   
gb|KEH25666.1|  IQ calmodulin-binding motif protein                     109   5e-23   
ref|XP_008229969.1|  PREDICTED: protein IQ-DOMAIN 1                     109   5e-23   
gb|ACU21464.1|  unknown                                                 104   5e-23   
ref|XP_009399005.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     109   6e-23   
ref|XP_009399007.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     109   6e-23   
gb|EPS66736.1|  hypothetical protein M569_08039                         106   6e-23   
ref|XP_007205221.1|  hypothetical protein PRUPE_ppa005948mg             109   6e-23   
ref|XP_008233362.1|  PREDICTED: protein IQ-DOMAIN 1                     110   7e-23   
ref|XP_006382010.1|  hypothetical protein POPTR_0006s24310g             109   7e-23   
ref|XP_010658434.1|  PREDICTED: protein IQ-DOMAIN 1                     109   7e-23   
ref|XP_007219044.1|  hypothetical protein PRUPE_ppa004623mg             109   8e-23   
ref|XP_003554363.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     109   8e-23   
ref|XP_011006951.1|  PREDICTED: protein IQ-DOMAIN 1-like                109   8e-23   
ref|XP_006297752.1|  hypothetical protein CARUB_v10013787mg             108   9e-23   
ref|XP_006843305.1|  hypothetical protein AMTR_s00080p00182120          109   9e-23   
ref|XP_009385554.1|  PREDICTED: protein IQ-DOMAIN 1-like                109   9e-23   
ref|XP_004489843.1|  PREDICTED: protein IQ-DOMAIN 1-like                108   1e-22   
emb|CBI31498.3|  unnamed protein product                                107   1e-22   
emb|CAN66644.1|  hypothetical protein VITISV_018782                     108   1e-22   
ref|NP_188858.4|  protein IQ-domain 5                                   108   1e-22   
ref|XP_010097046.1|  Protein IQ-DOMAIN 1                                108   1e-22   
gb|KHG12813.1|  Protein IQ-DOMAIN 1 -like protein                       108   1e-22   
ref|XP_010925464.1|  PREDICTED: protein IQ-DOMAIN 1-like                108   1e-22   
ref|XP_006436242.1|  hypothetical protein CICLE_v10031367mg             108   2e-22   
ref|XP_009381387.1|  PREDICTED: protein IQ-DOMAIN 1-like                108   2e-22   
dbj|BAJ84844.1|  predicted protein                                      108   2e-22   
ref|XP_006296019.1|  hypothetical protein CARUB_v10025164mg             109   2e-22   
ref|XP_009358171.1|  PREDICTED: protein IQ-DOMAIN 1                     108   2e-22   
gb|EMS54439.1|  Protein IQ-DOMAIN 1                                     108   2e-22   
emb|CDY58749.1|  BnaCnng33700D                                          108   2e-22   
ref|XP_004493952.1|  PREDICTED: protein IQ-DOMAIN 1-like                108   2e-22   
ref|XP_006826445.1|  hypothetical protein AMTR_s00004p00174140          107   2e-22   
ref|XP_009398343.1|  PREDICTED: protein IQ-DOMAIN 1-like                108   2e-22   
gb|KDO48488.1|  hypothetical protein CISIN_1g011478mg                   108   2e-22   
ref|XP_003525719.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     107   3e-22   
ref|XP_010466489.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     107   3e-22   
ref|XP_008789056.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          107   3e-22   
ref|XP_010466487.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     107   3e-22   
ref|XP_004496328.1|  PREDICTED: protein IQ-DOMAIN 1-like                108   3e-22   
gb|EMT32282.1|  hypothetical protein F775_28939                         107   3e-22   
ref|XP_006594911.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3     106   3e-22   
ref|XP_010488233.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          107   3e-22   
ref|XP_006381489.1|  hypothetical protein POPTR_0006s13330g             107   3e-22   
gb|AFW57424.1|  hypothetical protein ZEAMMB73_426020                    102   3e-22   
gb|EPS73313.1|  hypothetical protein M569_01446                         106   3e-22   
ref|XP_002885486.1|  hypothetical protein ARALYDRAFT_898681             107   3e-22   
ref|XP_009342547.1|  PREDICTED: protein IQ-DOMAIN 1-like                107   4e-22   
ref|XP_010488235.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          107   4e-22   
ref|XP_009378114.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     107   4e-22   
ref|XP_009378113.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     107   5e-22   
ref|XP_008678027.1|  PREDICTED: calmodulin binding protein isofor...    107   5e-22   
ref|XP_009388572.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     107   5e-22   
ref|XP_004968513.1|  PREDICTED: protein IQ-DOMAIN 1-like                106   5e-22   
ref|XP_008678065.1|  PREDICTED: calmodulin binding protein isofor...    106   5e-22   
ref|XP_007162725.1|  hypothetical protein PHAVU_001G175100g             107   5e-22   
ref|XP_007143677.1|  hypothetical protein PHAVU_007G092300g             107   5e-22   
ref|XP_010472671.1|  PREDICTED: protein IQ-DOMAIN 1-like                107   6e-22   
ref|XP_004307412.1|  PREDICTED: protein IQ-DOMAIN 1-like                107   6e-22   
ref|XP_002880788.1|  predicted protein                                  107   6e-22   
gb|EPS60830.1|  hypothetical protein M569_13972                         103   6e-22   
ref|XP_009763567.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     106   6e-22   
ref|XP_004151472.1|  PREDICTED: protein IQ-DOMAIN 1-like                107   7e-22   
ref|XP_006363674.1|  PREDICTED: protein IQ-DOMAIN 1-like                106   7e-22   
ref|XP_011004180.1|  PREDICTED: protein IQ-DOMAIN 1-like                106   7e-22   
ref|XP_009593794.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     106   7e-22   
ref|XP_008789058.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          106   7e-22   
gb|AFW67424.1|  hypothetical protein ZEAMMB73_784412                    105   7e-22   
ref|XP_009388573.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     106   8e-22   
ref|XP_007144538.1|  hypothetical protein PHAVU_007G164300g             106   8e-22   
ref|XP_009133938.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     107   8e-22   
ref|XP_004249598.1|  PREDICTED: protein IQ-DOMAIN 1-like                106   8e-22   
ref|XP_003625589.1|  IQ domain-containing protein                       106   9e-22   
ref|XP_009133940.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     107   9e-22   
ref|XP_009763560.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     106   9e-22   
gb|EMT30132.1|  hypothetical protein F775_12288                         106   9e-22   
gb|AFW67423.1|  hypothetical protein ZEAMMB73_784412                    105   9e-22   
ref|XP_006589441.1|  PREDICTED: protein IQ-DOMAIN 1-like                106   9e-22   
ref|XP_004304403.1|  PREDICTED: protein IQ-DOMAIN 1-like                106   1e-21   
ref|XP_010419361.1|  PREDICTED: protein IQ-DOMAIN 1-like                106   1e-21   
ref|XP_002455012.1|  hypothetical protein SORBIDRAFT_03g002990          105   1e-21   
ref|XP_009593793.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     105   1e-21   
ref|XP_008672998.1|  PREDICTED: calmodulin binding protein isofor...    105   1e-21   
emb|CDX83237.1|  BnaA03g22690D                                          106   1e-21   
gb|ACN34159.1|  unknown                                                 105   1e-21   
ref|NP_001151471.1|  calmodulin binding protein                         105   1e-21   
gb|AFW67422.1|  hypothetical protein ZEAMMB73_784412                    105   1e-21   
ref|XP_001758831.1|  predicted protein                                  105   1e-21   
ref|XP_010920914.1|  PREDICTED: protein IQ-DOMAIN 1-like                105   2e-21   
ref|XP_008792097.1|  PREDICTED: protein IQ-DOMAIN 1-like                105   2e-21   
gb|EYU42588.1|  hypothetical protein MIMGU_mgv1a006493mg                105   2e-21   
gb|KHN17114.1|  Protein IQ-DOMAIN 1                                     104   2e-21   
ref|XP_001763354.1|  predicted protein                                  103   2e-21   
ref|XP_006606230.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X4     105   2e-21   
ref|XP_004157326.1|  PREDICTED: protein IQ-DOMAIN 1-like                105   2e-21   
emb|CDY38525.1|  BnaC03g26720D                                          104   2e-21   
ref|XP_008793214.1|  PREDICTED: protein IQ-DOMAIN 1-like                105   2e-21   
dbj|BAJ85087.1|  predicted protein                                      105   2e-21   
dbj|BAJ92558.1|  predicted protein                                      105   2e-21   
ref|NP_180209.4|  protein IQ-domain 4                                   105   2e-21   
gb|KDO77790.1|  hypothetical protein CISIN_1g022139mg                 99.8    2e-21   
gb|EMT20604.1|  hypothetical protein F775_15358                         104   2e-21   
ref|XP_004506232.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     104   3e-21   
gb|EMS54162.1|  Protein IQ-DOMAIN 1                                     104   3e-21   
ref|XP_004506238.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X7     104   3e-21   
ref|XP_004506237.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X6     104   3e-21   
ref|XP_010511037.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     104   3e-21   
gb|AAC14491.1|  putative SF16 protein {Helianthus annuus}               105   3e-21   
ref|XP_006403817.1|  hypothetical protein EUTSA_v10010395mg             104   3e-21   
ref|XP_004506240.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X9     104   3e-21   
ref|XP_010511030.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     104   3e-21   
ref|XP_008643755.1|  PREDICTED: expp1 protein isoform X1                105   4e-21   
ref|XP_002308551.2|  calmodulin-binding family protein                  104   4e-21   
ref|XP_003556217.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     104   4e-21   
ref|XP_003577271.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     103   4e-21   
ref|XP_010236999.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     103   4e-21   
ref|XP_009789870.1|  PREDICTED: protein IQ-DOMAIN 1-like                104   5e-21   
ref|NP_001042285.1|  Os01g0194200                                       103   5e-21   
ref|XP_010547387.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          104   5e-21   
ref|XP_002323455.1|  hypothetical protein POPTR_0016s08760g             104   5e-21   
ref|XP_011081675.1|  PREDICTED: protein IQ-DOMAIN 1                     103   5e-21   
gb|ABF97898.1|  IQ calmodulin-binding motif family protein, expre...    103   5e-21   
ref|XP_010547388.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X3          104   6e-21   
ref|XP_010651661.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          103   6e-21   
gb|EPS70508.1|  hypothetical protein M569_04247                         101   6e-21   
dbj|BAK03690.1|  predicted protein                                      103   7e-21   
ref|XP_010547386.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          103   7e-21   
ref|XP_006645595.1|  PREDICTED: protein IQ-DOMAIN 1-like                103   8e-21   
gb|AAU89191.2|  expressed protein                                       103   9e-21   
dbj|BAJ86943.1|  predicted protein                                      103   1e-20   
ref|XP_010244962.1|  PREDICTED: protein IQ-DOMAIN 1-like                103   1e-20   
ref|XP_006296365.1|  hypothetical protein CARUB_v10025537mg             102   1e-20   
gb|EAY94673.1|  hypothetical protein OsI_16452                          103   1e-20   
ref|XP_009135783.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3     102   1e-20   
ref|NP_001050778.2|  Os03g0648300                                       103   1e-20   
tpg|DAA50287.1|  TPA: hypothetical protein ZEAMMB73_674862              102   1e-20   
gb|AFW57422.1|  hypothetical protein ZEAMMB73_426020                    104   1e-20   
ref|XP_004982305.1|  PREDICTED: protein IQ-DOMAIN 1-like                102   2e-20   
ref|XP_010262062.1|  PREDICTED: protein IQ-DOMAIN 1-like                102   2e-20   
ref|XP_008649119.1|  PREDICTED: uncharacterized protein LOC100193...    102   2e-20   
gb|AES62219.2|  IQ calmodulin-binding motif protein                     102   2e-20   
ref|XP_010503967.1|  PREDICTED: protein IQ-DOMAIN 1-like                102   2e-20   
ref|XP_010107587.1|  Protein IQ-DOMAIN 1                                102   3e-20   
ref|XP_009117012.1|  PREDICTED: protein IQ-DOMAIN 1                     102   3e-20   
ref|XP_011077051.1|  PREDICTED: protein IQ-DOMAIN 1-like                102   3e-20   
ref|XP_003591968.1|  IQ domain-containing protein                       102   3e-20   
ref|XP_010685364.1|  PREDICTED: protein IQ-DOMAIN 1-like                101   3e-20   
emb|CDY35313.1|  BnaA04g15340D                                          101   3e-20   
emb|CDY11485.1|  BnaA09g40510D                                          102   3e-20   
ref|XP_009593795.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3     100   3e-20   
ref|XP_010558271.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     102   3e-20   
ref|XP_009140728.1|  PREDICTED: protein IQ-DOMAIN 1                     100   3e-20   
emb|CDX77034.1|  BnaC04g38290D                                          100   3e-20   
ref|XP_002463771.1|  hypothetical protein SORBIDRAFT_01g005870          101   4e-20   
ref|XP_008783719.1|  PREDICTED: protein IQ-DOMAIN 1-like                102   4e-20   
ref|XP_003564834.1|  PREDICTED: protein IQ-DOMAIN 1-like                101   4e-20   
ref|XP_006408862.1|  hypothetical protein EUTSA_v10001997mg             100   5e-20   
emb|CDX80849.1|  BnaC03g01030D                                          100   5e-20   
gb|ACU17771.1|  unknown                                               96.3    6e-20   
ref|XP_002279479.1|  PREDICTED: protein IQ-DOMAIN 1-like                101   6e-20   
gb|ACU18259.1|  unknown                                               97.8    6e-20   
emb|CDY11238.1|  BnaA03g00740D                                          100   6e-20   
emb|CDM81614.1|  unnamed protein product                                100   7e-20   
ref|XP_003545385.1|  PREDICTED: protein IQ-DOMAIN 1-like                100   7e-20   
ref|XP_009397424.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   99.4    8e-20   
emb|CBI32695.3|  unnamed protein product                              98.6    9e-20   
ref|NP_180187.1|  IQ-domain 6 protein                                   100   9e-20   
ref|XP_004139079.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...    100   1e-19   
ref|XP_001751312.1|  predicted protein                                  101   1e-19   
ref|XP_006450867.1|  hypothetical protein CICLE_v10008250mg             100   1e-19   
ref|XP_008463575.1|  PREDICTED: protein IQ-DOMAIN 1-like                100   1e-19   
emb|CDP06708.1|  unnamed protein product                                101   1e-19   
ref|XP_010417398.1|  PREDICTED: protein IQ-DOMAIN 14-like             99.8    1e-19   
dbj|BAB03067.1|  unnamed protein product                              99.8    1e-19   
ref|XP_010472643.1|  PREDICTED: protein IQ-DOMAIN 14-like             99.8    1e-19   



>ref|XP_006358993.1| PREDICTED: protein IQ-DOMAIN 1-like [Solanum tuberosum]
Length=296

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 171/290 (59%), Positives = 197/290 (68%), Gaps = 35/290 (12%)
 Frame = +2

Query  179  RKITGLKTRKNGPSKWLQSVRTE----------------ANGGSS-----KNNELTEEIA  295
            + I GLK  K   SK L+   T                 +NG SS     +  + T   A
Sbjct  6    KTIIGLKRNKRRKSKQLKVTSTSTSDEPNGEVQVPSAHYSNGTSSSKKITRKTKFTHNTA  65

Query  296  ATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKA  475
            AT+IQ AFRA+   RKA+RR+RG V+FQG IE   SVN+Q+A TLK IH WS+IQSEI+A
Sbjct  66   ATKIQTAFRAH-LARKALRRVRGAVRFQGVIEG-LSVNNQIAGTLKQIHCWSKIQSEIRA  123

Query  476  RRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERA  655
            RRL MVTQG  KQKKIQNQ KL+AKLHEL+VEWSS +ET+EEILQK+QQREEAA+KRERA
Sbjct  124  RRLNMVTQGHNKQKKIQNQQKLEAKLHELEVEWSSSAETIEEILQKLQQREEAAIKRERA  183

Query  656  MAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP---------  808
            MAYAFSHQWRANS  YFGQAYY+LGKESWGWSW ERWIAVRPWE RVQ +P         
Sbjct  184  MAYAFSHQWRANSNQYFGQAYYDLGKESWGWSWMERWIAVRPWETRVQTNPIVPKISHSQ  243

Query  809  ---KKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQE  949
               K   K  +LGP+KLVVS+ N  +SNGK ST  RK S    E Q  QE
Sbjct  244  QVAKITSKATNLGPMKLVVSIKNLSISNGKESTKGRKLSITTNENQVSQE  293



>ref|XP_009630326.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana tomentosiformis]
Length=286

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 181/238 (76%), Gaps = 18/238 (8%)
 Frame = +2

Query  266  KNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHS  445
            K  + TE  AAT+IQ AFRA+   RKA+RR+RG V+FQG IE   SVN+Q+  TLK IH 
Sbjct  54   KTYKFTESTAATKIQTAFRAH-LARKALRRVRGAVRFQGVIEG-LSVNNQIVGTLKQIHC  111

Query  446  WSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQR  625
            WS+IQSEI+ARRL MVTQGR KQKKIQNQ KLDAKLHEL+VEWSSG+ETMEEI+QK+QQR
Sbjct  112  WSKIQSEIRARRLSMVTQGRDKQKKIQNQQKLDAKLHELEVEWSSGAETMEEIIQKLQQR  171

Query  626  EEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            EEAA+KRERAMAYAFSHQWRANS  YFGQAYY+LGK+SWGWSW ERWIA+RPWE RVQ  
Sbjct  172  EEAAIKRERAMAYAFSHQWRANSNRYFGQAYYDLGKDSWGWSWMERWIAIRPWETRVQIS  231

Query  806  PK----------KAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQE  949
                        K  KT +LGP+KLVVSV NP +SNG      RK S   PE Q  QE
Sbjct  232  ENSKISHTHQIAKITKTTNLGPMKLVVSVKNPSISNG------RKLSISVPENQASQE  283



>ref|XP_009785151.1| PREDICTED: protein IQ-DOMAIN 1 [Nicotiana sylvestris]
Length=288

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 185/242 (76%), Gaps = 16/242 (7%)
 Frame = +2

Query  248  ANGGSSK----NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            +NG SSK      + TE  AA RIQ AFRA+   RK++RR+R  V+FQG IE   SVN+Q
Sbjct  48   SNGNSSKRIARKTKFTESTAAIRIQTAFRAH-LARKSLRRVRCAVRFQGVIEG-LSVNNQ  105

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
            V  TLK IH WS+IQSEI+ARRL MVTQ   KQKKIQNQ KLDAKLHEL+VEWSSG+ETM
Sbjct  106  VVGTLKQIHCWSKIQSEIRARRLSMVTQDHNKQKKIQNQQKLDAKLHELEVEWSSGAETM  165

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            EEI+QK+QQREEAA+KRERAMAYAFSHQWRANS  YFGQAYY+LGK+SWGWSW ERWIA+
Sbjct  166  EEIIQKLQQREEAAIKRERAMAYAFSHQWRANSNRYFGQAYYDLGKDSWGWSWMERWIAI  225

Query  776  RPWEIRVQ--ADPK--------KAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHN  925
            RPWE RVQ   +PK        K  KT +LGP+KLVVSV NP +SNGK ST  RK S   
Sbjct  226  RPWETRVQNPVNPKISHSNQVAKITKTTNLGPMKLVVSVKNPSISNGKESTKGRKLSISL  285

Query  926  PE  931
            PE
Sbjct  286  PE  287



>ref|XP_004251884.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
Length=268

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 178/247 (72%), Gaps = 20/247 (8%)
 Frame = +2

Query  182  KITGLKTRKNGPSKWLQSVRTEANGGSSKNNELT------EEIAATRIQRAFRAYKQGRK  343
            KIT   T  + P   +Q      + G+S + ++T         AAT+IQ A+RA+   RK
Sbjct  23   KITSTSTAFDEPKGDVQVPSAHYSNGTSSSKKITCKTKFTHNTAATKIQTAYRAH-LARK  81

Query  344  AIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkki  523
             +RR+RG V+FQG IE   SVN+Q++ TLK IH WS+IQSEI+ARRL MVTQG  KQKKI
Sbjct  82   TLRRVRGAVRFQGVIEG-LSVNNQISGTLKQIHCWSKIQSEIRARRLNMVTQGHNKQKKI  140

Query  524  qnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHY  703
            QNQ KL+AKLHEL+VEWSS +ET+EEILQK+QQREEAA KRERAMAYAFSHQWRANS  Y
Sbjct  141  QNQQKLEAKLHELEVEWSSSAETIEEILQKLQQREEAATKRERAMAYAFSHQWRANSNKY  200

Query  704  FGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP------------KKAGKTASLGPVK  847
            FGQAYY+LGKESWGWSW ERWIAVRPWE RVQ +P            K   K  +LGP+K
Sbjct  201  FGQAYYDLGKESWGWSWMERWIAVRPWETRVQTNPIVPKTSHSQQVAKITSKATNLGPMK  260

Query  848  LVVSVNN  868
            LVVS+ N
Sbjct  261  LVVSIKN  267



>ref|XP_011098253.1| PREDICTED: protein IQ-DOMAIN 1 [Sesamum indicum]
Length=286

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 182/279 (65%), Gaps = 27/279 (10%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANG----------------GSSKNN----E  277
            MG   W++ I  LK  K    K  Q    ++NG                G+SK N     
Sbjct  1    MGSGDWFKAIISLKRSKEDKHKQAQHSGKKSNGSKGKQPSSKEGRILANGTSKKNVKSRH  60

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            LTE+ AATRIQ A+RAYK  RK +RRL+G V+F+  IE  +SV +Q  + L HIH WSRI
Sbjct  61   LTEDAAATRIQTAYRAYK-ARKTLRRLKGVVRFREVIEEGHSVKNQAMSALNHIHFWSRI  119

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+EI+AR L MVT+ R +QKK++NQ+KL+AKLHEL+ EWS G ETMEEIL +IQQREEAA
Sbjct  120  QAEIRARWLSMVTESRTRQKKLENQLKLEAKLHELEAEWSGGPETMEEILNRIQQREEAA  179

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
             KRERAMAYAFSHQWRANS  YFGQAYY+L KESWGWSW+ERW+AVRPWE R Q  P  A
Sbjct  180  AKRERAMAYAFSHQWRANSNQYFGQAYYDLSKESWGWSWRERWVAVRPWENRFQTRPSLA  239

Query  818  ------GKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
                   KT  +       +   P  SNGK+ST ARK S
Sbjct  240  KKVEAKHKTTEITKSTPTKTTAKPVSSNGKVSTHARKLS  278



>ref|XP_006451745.1| hypothetical protein CICLE_v10009079mg [Citrus clementina]
 ref|XP_006485681.1| PREDICTED: protein IQ-DOMAIN 1-like [Citrus sinensis]
 gb|ESR64985.1| hypothetical protein CICLE_v10009079mg [Citrus clementina]
 gb|KDO58491.1| hypothetical protein CISIN_1g036720mg [Citrus sinensis]
Length=291

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 185/288 (64%), Gaps = 37/288 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKN--------------------GPSKWLQSVRTEANGGSSKNNE  277
            MG   W+R I  LK  K                      PS+   +     NGGS  +  
Sbjct  1    MGSGHWFRSIICLKKGKQDRSKQGKVQSATEKSNDSNESPSESSGNANANTNGGSDPHIN  60

Query  278  ------LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHI  439
                    EE AATRIQ+AFRAY+  RK+IRRLRGT +F   I+  +SV  Q ++ + +I
Sbjct  61   PGFLRISVEERAATRIQKAFRAYR-ARKSIRRLRGTGRFNILIQD-HSVQKQTSSAINNI  118

Query  440  HSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQ  619
            HSW  IQ++I+ RRLCMVT+GR+K KK++NQ+KL+AKLH+L+VEW +GSETMEEIL +IQ
Sbjct  119  HSWCNIQTQIRNRRLCMVTEGRIKHKKLENQLKLEAKLHDLEVEWHNGSETMEEILSRIQ  178

Query  620  QREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQ  799
            QREEAA+KRERAMAYAFSHQWRANS  Y GQAYY++ K++WGWSW ERWIA RPWE+RV 
Sbjct  179  QREEAAIKRERAMAYAFSHQWRANSSQYLGQAYYSICKDNWGWSWMERWIAARPWEVRVN  238

Query  800  ADPKK--AGKTAS-----LGPVKLVVSVNNPPLSNGKISTPARKPSDH  922
            A P K   GK  S        ++L VSV+  P  NG  +T A+K   H
Sbjct  239  AKPTKKIKGKQVSNADKFANQLELKVSVSATP--NGNKTTKAKKSPPH  284



>ref|XP_011044948.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Populus euphratica]
 ref|XP_011044949.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Populus euphratica]
Length=303

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 163/226 (72%), Gaps = 6/226 (3%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E IAA RIQ+AFRAYK  RKA+ RL+G V+F   I        Q ++TL HIHSWS IQ+
Sbjct  66   EYIAAVRIQQAFRAYK-ARKAVHRLKGAVRFNVLIHGQ-DTQKQASSTLSHIHSWSNIQT  123

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR  +V +GR+KQKK++NQ+KLDAKL EL+VEW  GS+TMEEIL +IQQREEAAVK
Sbjct  124  QIRARRHHLVAEGRIKQKKLENQLKLDAKLQELEVEWCGGSDTMEEILSRIQQREEAAVK  183

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
            RERAMAYAFSHQWRAN   Y GQAYY LGKE+WGWSWKERW+A RPWE+RV A+P    K
Sbjct  184  RERAMAYAFSHQWRANPTQYLGQAYYILGKENWGWSWKERWVAARPWEVRVHAEPSNLKK  243

Query  824  T----ASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQE  949
                  S   +K+ V    P LSNGK++  A++ S    + Q  Q+
Sbjct  244  VHSRQGSKTEIKIPVLPTKPALSNGKVNAKAKRLSSPAMDYQATQD  289



>ref|XP_007021652.1| IQ-domain 10 [Theobroma cacao]
 gb|EOY13177.1| IQ-domain 10 [Theobroma cacao]
Length=283

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 183/285 (64%), Gaps = 34/285 (12%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKW--LQSVRTEANG-----------------GSSKNNEL  280
            MG   W+R I   K  K+  SK   + S   + NG                 GS  +  L
Sbjct  1    MGSGNWFRSIICRKKSKSARSKHAKVHSANEKPNGEGSHDAPEEARSPATTAGSQSSPGL  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 EEIAA RIQ+AFRAY+  RKA+RRLR   +F   I+  ++V  Q  +TL ++HSW
Sbjct  61   PGMPVEEIAAVRIQKAFRAYR-ARKAVRRLRDAGRFNILIQG-HTVKKQTTSTLSYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
              +QS+I+ARR+CMVT+GRLKQKK++NQ+KL+AKLHEL+VEW  GSETMEEIL +IQQRE
Sbjct  119  CNVQSQIRARRICMVTEGRLKQKKMENQLKLEAKLHELEVEWCGGSETMEEILSRIQQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP  808
            EAAVKRERAMAYAFSHQWRAN+  Y GQA Y LGKE+WGWSW ERWIA RPWE+RV   P
Sbjct  179  EAAVKRERAMAYAFSHQWRANASQYLGQASYGLGKENWGWSWMERWIAARPWEVRVHFQP  238

Query  809  KKAGKT------ASLGPVKLVVSVNNPPLSNGKISTPARK--PSD  919
                KT       S   +K  VSV  P L NGK +   +K  P+D
Sbjct  239  IHPRKTHARQASKSEKEIKAPVSV-KPALPNGKAAPKVKKVAPTD  282



>ref|XP_002316795.2| hypothetical protein POPTR_0011s09880g [Populus trichocarpa]
 gb|EEE97407.2| hypothetical protein POPTR_0011s09880g [Populus trichocarpa]
Length=303

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 164/226 (73%), Gaps = 6/226 (3%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E IAA RIQ+AFRAYK  RKA++RL+G V+F   I        Q ++TL HIHSWS IQ+
Sbjct  66   EYIAAVRIQKAFRAYK-ARKAVQRLKGAVRFNVQIHGQ-DTQKQASSTLSHIHSWSNIQT  123

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR  MVT+GR+KQKK++NQ+KLDAKL EL+VEW  GS+TMEEIL +IQQREEAAVK
Sbjct  124  QIRARRHHMVTEGRIKQKKLENQLKLDAKLQELEVEWCGGSDTMEEILSRIQQREEAAVK  183

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
            RERAMAYAFSHQWRAN   Y GQAYY LG+E+WGWSWKERW+A RPWE+RV A+P    K
Sbjct  184  RERAMAYAFSHQWRANPTRYLGQAYYILGEENWGWSWKERWVAARPWEVRVHAEPNNLKK  243

Query  824  T----ASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQE  949
                  S   +K+ V      LSNGK++  A+K S    + Q  Q+
Sbjct  244  VHSRQGSKTEIKIPVLSTKHALSNGKVNAKAKKLSSPAVDYQATQD  289



>ref|XP_011044946.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
Length=306

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 163/226 (72%), Gaps = 6/226 (3%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E IAA RIQ+AFRAYK  RKA+ RL+G V+F   I        Q ++TL HIHSWS IQ+
Sbjct  69   EYIAAVRIQQAFRAYK-ARKAVHRLKGAVRFNVLIHGQ-DTQKQASSTLSHIHSWSNIQT  126

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR  +V +GR+KQKK++NQ+KLDAKL EL+VEW  GS+TMEEIL +IQQREEAAVK
Sbjct  127  QIRARRHHLVAEGRIKQKKLENQLKLDAKLQELEVEWCGGSDTMEEILSRIQQREEAAVK  186

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
            RERAMAYAFSHQWRAN   Y GQAYY LGKE+WGWSWKERW+A RPWE+RV A+P    K
Sbjct  187  RERAMAYAFSHQWRANPTQYLGQAYYILGKENWGWSWKERWVAARPWEVRVHAEPSNLKK  246

Query  824  T----ASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQE  949
                  S   +K+ V    P LSNGK++  A++ S    + Q  Q+
Sbjct  247  VHSRQGSKTEIKIPVLPTKPALSNGKVNAKAKRLSSPAMDYQATQD  292



>gb|AFK44344.1| unknown [Lotus japonicus]
Length=289

 Score =   242 bits (617),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 143/286 (50%), Positives = 174/286 (61%), Gaps = 37/286 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKN-------------NE-------  277
            MG + W+  I   K RK   SK  +   T  N   S N             NE       
Sbjct  3    MGPKKWFMIIVKRKKRKEDKSKQEKVQSTPENSNKSPNGMQSTHEESNIIPNESLMRDRT  62

Query  278  ----LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHS  445
                L ++IAATRIQ AFR++   R+ I+ LRG VKF+  I+  +   +Q A TL +IHS
Sbjct  63   VPSRLIDDIAATRIQNAFRSF-MARRTIQHLRGAVKFEALIQD-HMAREQTATTLSYIHS  120

Query  446  WSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQR  625
            WSRIQ +IKARR CM+T+ ++KQ+K++NQ KL+AKLHEL+VEW SGSETMEEIL +I QR
Sbjct  121  WSRIQDQIKARRFCMITEAKIKQRKLENQFKLEAKLHELKVEWCSGSETMEEILSRIHQR  180

Query  626  EEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE--IRVQ  799
            EEAA+KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERWIA RPWE  +RVQ
Sbjct  181  EEAAIKRERAMAYAFSHQWRPNCSQYFGQASYSLGKESWGWSWMERWIAARPWEVRVRVQ  240

Query  800  ADPKKAGKTASLGPVKLVVSVNN---------PPLSNGKISTPARK  910
              PK           KL    NN         P +SNG  +   +K
Sbjct  241  QSPKTKKLNGQQQKAKLDKMNNNNESKVCLAKPAMSNGDKTDKGKK  286



>ref|XP_011000246.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Populus euphratica]
Length=298

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 167/233 (72%), Gaps = 23/233 (10%)
 Frame = +2

Query  248  ANGGSSKNNEL----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            ANG    N+ +     E +AA RIQ AFRAYK  RKA+ RL+G V+F   I   +    Q
Sbjct  50   ANGDLESNHVVPGLSAEYMAAVRIQDAFRAYK-ARKAMHRLKGAVRFNVLIHG-HDTQKQ  107

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             ++TL HIHSWS IQ++I+ARR  MVT+GR+KQKK++NQ+KL+AKL E++VEW  GS+TM
Sbjct  108  ASSTLSHIHSWSNIQAQIRARRHHMVTEGRIKQKKLENQLKLEAKLQEIEVEWCGGSDTM  167

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            EEIL +IQQREEAAVKRERAMAYAFSHQWRAN   Y GQAYY+LGKE+WGWSWKERWIA 
Sbjct  168  EEILSRIQQREEAAVKRERAMAYAFSHQWRANPTQYLGQAYYSLGKENWGWSWKERWIAA  227

Query  776  RPWEIRVQAD--------PKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARK  910
            RPWEIRV A+        PK+  KTA   P K       P LSNGK++  ++K
Sbjct  228  RPWEIRVHAELHNPKKAHPKQESKTAL--PTK-------PALSNGKVTAKSKK  271



>ref|XP_011000245.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
Length=301

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 167/233 (72%), Gaps = 23/233 (10%)
 Frame = +2

Query  248  ANGGSSKNNEL----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            ANG    N+ +     E +AA RIQ AFRAYK  RKA+ RL+G V+F   I   +    Q
Sbjct  53   ANGDLESNHVVPGLSAEYMAAVRIQDAFRAYK-ARKAMHRLKGAVRFNVLIHG-HDTQKQ  110

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             ++TL HIHSWS IQ++I+ARR  MVT+GR+KQKK++NQ+KL+AKL E++VEW  GS+TM
Sbjct  111  ASSTLSHIHSWSNIQAQIRARRHHMVTEGRIKQKKLENQLKLEAKLQEIEVEWCGGSDTM  170

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            EEIL +IQQREEAAVKRERAMAYAFSHQWRAN   Y GQAYY+LGKE+WGWSWKERWIA 
Sbjct  171  EEILSRIQQREEAAVKRERAMAYAFSHQWRANPTQYLGQAYYSLGKENWGWSWKERWIAA  230

Query  776  RPWEIRVQAD--------PKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARK  910
            RPWEIRV A+        PK+  KTA   P K       P LSNGK++  ++K
Sbjct  231  RPWEIRVHAELHNPKKAHPKQESKTAL--PTK-------PALSNGKVTAKSKK  274



>gb|AFK38907.1| unknown [Lotus japonicus]
Length=289

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 142/286 (50%), Positives = 173/286 (60%), Gaps = 37/286 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKN-------------NE-------  277
            MG + W+  I   K RK   SK  +   T  N   S N             NE       
Sbjct  3    MGPKKWFMIIVKRKKRKEDKSKQEKVQSTPENSNKSPNGMQSTHEESNIIPNESLMRDRT  62

Query  278  ----LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHS  445
                L ++IAATRIQ AFR++   R+ I+ LRG VKF+  I+  +   +Q A TL +IHS
Sbjct  63   VPSRLIDDIAATRIQNAFRSF-MARRTIQHLRGVVKFEALIQD-HMAREQTATTLSYIHS  120

Query  446  WSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQR  625
            WSRIQ +IKARR CM+T+ ++KQ+K++NQ KL+AKLHEL+VEW SGSETMEEIL +I QR
Sbjct  121  WSRIQDQIKARRFCMITEAKIKQRKLENQFKLEAKLHELEVEWCSGSETMEEILSRIHQR  180

Query  626  EEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE--IRVQ  799
            EEAA+KRERAMAYAFSHQW  N   YFGQA Y+LGKESWGWSW ERWIA RPWE  +RVQ
Sbjct  181  EEAAIKRERAMAYAFSHQWGPNCSQYFGQASYSLGKESWGWSWMERWIAARPWEVRVRVQ  240

Query  800  ADPKKAGKTASLGPVKLVVSVNN---------PPLSNGKISTPARK  910
              PK           KL    NN         P +SNG  +   +K
Sbjct  241  QSPKTKKLNGQQQKAKLDKMNNNNESKVCLAKPAMSNGDKTDKGKK  286



>ref|XP_008225192.1| PREDICTED: protein IQ-DOMAIN 1 [Prunus mume]
 ref|XP_008225193.1| PREDICTED: protein IQ-DOMAIN 1 [Prunus mume]
 ref|XP_008225194.1| PREDICTED: protein IQ-DOMAIN 1 [Prunus mume]
Length=294

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 182/273 (67%), Gaps = 23/273 (8%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ--SVRTEANG--------GSSKNNEL-TEEIAATR  304
            MG   W++ + GLK  K+G SK L+  SV  ++N          + KN  L  EEIAA R
Sbjct  1    MGSGYWFKALIGLKKSKDGSSKRLKGPSVNGKSNSIKLKKSSFANGKNLGLPDEEIAAIR  60

Query  305  IQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRL  484
            IQ AFRAY   RKA+RRL+G V+ Q  +  AY V  Q   TL ++HSWSRIQ EI+ARRL
Sbjct  61   IQTAFRAY-VARKALRRLKGIVRLQ-ILTQAYPVTKQATTTLSYLHSWSRIQDEIRARRL  118

Query  485  CMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAY  664
             MVT+GR+KQKK++NQ KL+AKLH+++ EW  GSETM+EIL +I QREEAAVKRERAMAY
Sbjct  119  YMVTEGRIKQKKLENQHKLEAKLHDIEAEWCGGSETMDEILARIYQREEAAVKRERAMAY  178

Query  665  AFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA-DPK--------KA  817
            AFSHQWRAN     G   Y LGK +WGWSWKERWIA RPWE RVQ+  PK        K 
Sbjct  179  AFSHQWRANCSQSQGLGNYELGKANWGWSWKERWIAARPWESRVQSPSPKKVPSKQASKV  238

Query  818  GKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
            GK+ +    K  VSV  P  SNGK +T AR+ S
Sbjct  239  GKSTNSPTPKTPVSVKLPS-SNGKGTTRARRLS  270



>ref|XP_007211719.1| hypothetical protein PRUPE_ppa009395mg [Prunus persica]
 ref|XP_007211720.1| hypothetical protein PRUPE_ppa009395mg [Prunus persica]
 gb|EMJ12918.1| hypothetical protein PRUPE_ppa009395mg [Prunus persica]
 gb|EMJ12919.1| hypothetical protein PRUPE_ppa009395mg [Prunus persica]
Length=294

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 181/273 (66%), Gaps = 23/273 (8%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ--SVRTEANG--------GSSKNNEL-TEEIAATR  304
            MG   W++ + GLK  K+G SK L+  SV  ++N          + KN  L  EEIAA R
Sbjct  1    MGSGYWFKALIGLKKSKDGSSKRLKGPSVNGKSNSIKLKKSSFANGKNLGLPDEEIAAIR  60

Query  305  IQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRL  484
            IQ AFRAY   RKA+RRL+G V+ Q  +  AY V  Q   TL ++HSWSRIQ EI+ARRL
Sbjct  61   IQTAFRAY-VARKALRRLKGIVRLQ-ILTQAYPVTKQATTTLSYLHSWSRIQDEIRARRL  118

Query  485  CMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAY  664
             MVT+GR+KQKK++NQ KL+AKLH+++ EW  GSETM+EIL +I QREEAAVKRERAMAY
Sbjct  119  YMVTEGRIKQKKLENQHKLEAKLHDIEAEWCGGSETMDEILARIYQREEAAVKRERAMAY  178

Query  665  AFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA-DPK--------KA  817
            AFSHQWRAN     G   Y LGK +WGWSWKERWIA RPWE RVQ+  PK        K 
Sbjct  179  AFSHQWRANCSQSQGLGNYELGKANWGWSWKERWIAARPWESRVQSPSPKKVPSKQASKV  238

Query  818  GKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
            GK  +    K  VSV  P  SNGK +T AR+ S
Sbjct  239  GKNTNSPTPKTPVSVKLPS-SNGKGTTRARRLS  270



>ref|XP_004293920.1| PREDICTED: protein IQ-DOMAIN 1-like [Fragaria vesca subsp. vesca]
Length=282

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 184/277 (66%), Gaps = 16/277 (6%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ-SVRTEANGGSSKN----NELTEEIAATRIQRAFR  322
            MG   W++ +T L+  K G SK ++ S    ANG ++K     +   E+IAA RIQ AFR
Sbjct  1    MGSGNWFKALTSLRKAKFGSSKRVKGSTINFANGTTNKKLGSLDMPVEDIAAIRIQTAFR  60

Query  323  AYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQG  502
            A+   RKA+RRL+G V+ Q  +   Y V  Q   TL ++HSWSRIQ++I+ RRLCMVT+G
Sbjct  61   AH-VARKALRRLKGIVRLQ-MLTQQYPVRKQATTTLSYLHSWSRIQTDIRTRRLCMVTEG  118

Query  503  RLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQW  682
            R+KQKKI+NQ KL+AKLH+++VEWSSGSETM++IL +I QREEAAVKRERAMAYAFSHQW
Sbjct  119  RIKQKKIENQNKLEAKLHDIEVEWSSGSETMDDILARIYQREEAAVKRERAMAYAFSHQW  178

Query  683  RANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQ-ADPKK--AGKTASLG-----  838
            RAN         Y LGK +WGWSWKERWIAVRPWE RVQ A PKK  A + + +G     
Sbjct  179  RANCSQSQSLGSYELGKANWGWSWKERWIAVRPWESRVQSASPKKVQAKQASKVGKNINS  238

Query  839  PVKLVVSVNNPPLSNGKISTPARKPS-DHNPETQTPQ  946
            P     ++   P  NGK +  AR+ S   N E   P 
Sbjct  239  PTSNTSAIVKLPSPNGKGTPRARRLSYTSNEEKPVPH  275



>ref|XP_010279173.1| PREDICTED: protein IQ-DOMAIN 1 [Nelumbo nucifera]
 ref|XP_010279174.1| PREDICTED: protein IQ-DOMAIN 1 [Nelumbo nucifera]
Length=320

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 148/297 (50%), Positives = 186/297 (63%), Gaps = 40/297 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLK---------------TRKNGPSKWLQSVRTE----ANGGSSKN---  271
            MG   W++ I  L+               T K+   KW    R E    +NG SS N   
Sbjct  1    MGSGYWFKAIISLRKQKEDRLKQVKESTTTEKSNGFKWKHRSRKETSNFSNGASSGNPSA  60

Query  272  -NELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
             +   E+IAATRIQ AFRAY   RKA+RRL+G V+ Q +I   + V  Q + TL ++HSW
Sbjct  61   LSAPVEDIAATRIQTAFRAY-MARKALRRLKGIVRLQ-SITQGHDVKKQASTTLSYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            SRIQ++IKARRLCMVT+GR++QKK++NQ+KL+ KLHEL+VEWS GS+TMEEIL +IQQRE
Sbjct  119  SRIQAQIKARRLCMVTEGRIRQKKLENQLKLEEKLHELEVEWSGGSDTMEEILARIQQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP  808
            EAAVKRERAMAYAFSHQWRANS    GQ  Y L   +WGWSW +RWIA RPWE RV +  
Sbjct  179  EAAVKRERAMAYAFSHQWRANSNQNQGQFPYGLANANWGWSWMDRWIAARPWESRVPSQS  238

Query  809  -----------KKAGKTASLGPVKLVVSVNNPPLSNGKISTPARK---PSDHNPETQ  937
                        K G++ +   VK+ VSV  P +SNG+  T  R+   P+   P  Q
Sbjct  239  VSSKKVQSKQVSKVGRSPNSPAVKISVSV-KPIVSNGRGVTKPRRLSYPTADKPSVQ  294



>ref|XP_002298904.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEE83709.1| calmodulin-binding family protein [Populus trichocarpa]
Length=302

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 159/216 (74%), Gaps = 19/216 (9%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E IAA RIQ AFRAYK  RKA+ RL+G V+F   I   +    Q ++TL HIHSWS IQ+
Sbjct  70   EYIAAVRIQDAFRAYK-ARKAMHRLKGAVRFNVLIHG-HDTQKQASSTLSHIHSWSNIQA  127

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR  MVT+GR+KQKK++NQ+KL+A+L E++VEW  GS+TMEEIL +IQQREEAAVK
Sbjct  128  QIRARRHHMVTEGRIKQKKLENQLKLEARLQEIEVEWCGGSDTMEEILSRIQQREEAAVK  187

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD------  805
            RERAMAYAFSHQWRAN   Y GQAYY+LGKE+WGWSWKERWIA RPWEIRV A+      
Sbjct  188  RERAMAYAFSHQWRANPTQYLGQAYYSLGKENWGWSWKERWIAARPWEIRVHAELHNLKK  247

Query  806  --PKKAGKTASLGPVKLVVSVNNPPLSNGKISTPAR  907
              PK+  KT    P K       P LSNGK++  ++
Sbjct  248  AHPKQESKTTL--PTK-------PALSNGKVTAKSK  274



>ref|XP_009347238.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Pyrus x bretschneideri]
Length=296

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 172/272 (63%), Gaps = 21/272 (8%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNNELT-----------EEIAATR  304
            MG   W++   G K  K+  SK L+         S K  + T           E+IAA R
Sbjct  1    MGSGCWFKVFFGTKKSKDDSSKQLKGSSAHGKSNSIKLKKSTFANGKNIGLPIEDIAAIR  60

Query  305  IQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRL  484
            IQ AFRAY   RK++RRL+G V+ Q  +  AY V  Q   TL ++HSWS+IQ+E+KARRL
Sbjct  61   IQTAFRAY-VARKSLRRLKGIVRLQ-IMTQAYPVTKQTTTTLSYLHSWSKIQAEVKARRL  118

Query  485  CMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAY  664
            CMVT+GR+KQKKI++Q KL+AKLHE++ EW  GSETM+EIL +I QREEAAVKRERAMAY
Sbjct  119  CMVTEGRIKQKKIESQQKLEAKLHEIEAEWCGGSETMDEILARIYQREEAAVKRERAMAY  178

Query  665  AFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKTASLGPV  844
            AFSHQWRAN         Y LGK +WGWSWKERWIA RPWE RVQ+   +  ++    PV
Sbjct  179  AFSHQWRANCSQNQSLGNYELGKANWGWSWKERWIAARPWESRVQSPSPRKVQSKQASPV  238

Query  845  KLVVSVNNP--------PLSNGKISTPARKPS  916
               ++   P        P SNGK +T AR+ S
Sbjct  239  GKNINSPTPKAAVLVKLPSSNGKPTTKARRLS  270



>ref|XP_002282973.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
 ref|XP_010644141.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
 ref|XP_010644142.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
 ref|XP_010644143.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
 ref|XP_010644144.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
 ref|XP_010644145.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
 emb|CBI20219.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 180/284 (63%), Gaps = 38/284 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLK---------------TRKNGPSKWLQSVRTE----ANGGSSKNNEL  280
            MG  GW++ I  L+               T K+  SK    +  E    ANG   K+  +
Sbjct  1    MGAGGWFKMIISLRKVKEDRSKPAKVHSTTEKSSNSKGKHHIDKESSSLANGALGKSAGV  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 EE AA +IQ  +RAYK  RK + RLRGTV+FQ   +    V  Q + TL +IH+W
Sbjct  61   HKIPVEERAAIQIQTTYRAYK-ARKNLHRLRGTVRFQVMTQGDI-VRKQASTTLSYIHAW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            SRIQ++I ARR CM  +GR++QKK++NQ+KL+AKLHEL+VEW  GSETMEEIL +IQQRE
Sbjct  119  SRIQAQISARRHCMAQEGRVRQKKLENQLKLEAKLHELEVEWCGGSETMEEILSRIQQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD-  805
            EAAVKRERAMAYAFSHQWRAN+  Y G  YY+LGKE+WGWSW ERWIA RPWE RV A  
Sbjct  179  EAAVKRERAMAYAFSHQWRANNSQYLGHTYYDLGKENWGWSWMERWIAARPWETRVHAQS  238

Query  806  --PKKA--------GKTASLGPVKLVVSVNNPPLSNGKIST-PA  904
              PKKA        GK  +   +K  V V  P LSNGK +T PA
Sbjct  239  TLPKKAQTKHVIKVGKITNPQTMKTPVLV-RPALSNGKGTTKPA  281



>emb|CAN67034.1| hypothetical protein VITISV_013534 [Vitis vinifera]
Length=309

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 176/284 (62%), Gaps = 38/284 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNNELT------------------  283
            MG  GW++ I  L+  K   SK  +   T     +SK    T                  
Sbjct  1    MGAGGWFKMIISLRKVKXDRSKPAKVHSTTEKSSNSKGKHHTDKEXSSLANGALGKSAGV  60

Query  284  -----EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 EE AA +IQ  +RAYK  RK + RLRGTV+FQ   +    V  Q + TL +IH+W
Sbjct  61   HKIPVEERAAIQIQTTYRAYK-ARKNLHRLRGTVRFQVMTQGDI-VRKQASTTLSYIHAW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            SRIQ++I ARR CM  +GR++QKK++NQ+KL+AKLHEL+VEW  GSETMEEIL +IQQRE
Sbjct  119  SRIQAQISARRHCMAQEGRVRQKKLENQLKLEAKLHELEVEWCGGSETMEEILSRIQQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD-  805
            EAAVKRERAMAYAFSHQWRAN+  Y G  YY+LGKE+WGWSW ERWIA RPWE RV A  
Sbjct  179  EAAVKRERAMAYAFSHQWRANNSQYLGHTYYDLGKENWGWSWMERWIAARPWETRVHAQS  238

Query  806  --PKKA--------GKTASLGPVKLVVSVNNPPLSNGKIST-PA  904
              PKKA        GK  +   +K  V V  P LSNGK +T PA
Sbjct  239  TLPKKAQTKHVIKVGKITNPQTMKTPVLV-RPALSNGKGTTKPA  281



>gb|KDP36274.1| hypothetical protein JCGZ_09839 [Jatropha curcas]
Length=308

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 185/291 (64%), Gaps = 37/291 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEA---------------------NGGSSKNN  274
            MG  G +R I  L+  K   SK ++ V ++A                     NG +  NN
Sbjct  1    MGSGGCFRSIISLRKAKEDRSKKVK-VHSDAEKTNGAEESSNSHIESNIPVVNGTTEVNN  59

Query  275  EL----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIH  442
             +    +E  AA RIQ AFRAY   +K + R +G V+F   I+       Q ++TL HIH
Sbjct  60   GVPEISSEHKAAIRIQTAFRAY-LAKKTMSRFKGAVRFNVLIQG-NDTQKQASSTLNHIH  117

Query  443  SWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQ  622
            SWS IQ++I+ARR  MVT+GR+KQKK++NQIKL+AKL EL+ EW  GSETMEEIL ++QQ
Sbjct  118  SWSNIQAQIRARRHHMVTEGRIKQKKLENQIKLEAKLQELEEEWCGGSETMEEILSRLQQ  177

Query  623  REEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
            REEAAVKRERAMAYAFSHQWRAN   Y GQAYY++GKE+WGWSWKERWIA RPWEIRV A
Sbjct  178  REEAAVKRERAMAYAFSHQWRANPTQYLGQAYYSIGKENWGWSWKERWIAARPWEIRVHA  237

Query  803  DPK--KAGKTASLGPVKLVVSVN-NPPLSNGKISTPARKPS------DHNP  928
             P   K G T+ L   ++ V++   P +SNGK +  A++ S      DH P
Sbjct  238  LPNNTKKGHTSQLSKPEVRVTLTIKPTMSNGKGAPKAKRLSSSNIALDHEP  288



>ref|XP_002305760.1| hypothetical protein POPTR_0004s05230g [Populus trichocarpa]
 gb|EEE86271.1| hypothetical protein POPTR_0004s05230g [Populus trichocarpa]
Length=312

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 145/287 (51%), Positives = 181/287 (63%), Gaps = 37/287 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSK---------------WLQSVRTE----ANGGSSKNNEL  280
            MG   W++ +  +K  K+  SK               W   +R E    ANG S  N   
Sbjct  1    MGSGDWFKTMISMKKVKDDSSKQPKGSTTSAKSNGFKWKNKLRKESAIFANGSSRANPRF  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E++AAT+IQ AFRAY   RK +RRL+GTV+ Q  I   YSV  Q A TL +IHSW
Sbjct  61   IDMPVEDVAATQIQTAFRAY-MARKTLRRLKGTVRLQ-IITKNYSVKKQAATTLNYIHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            S+IQ++I+ARRLCMVT+ RL+QKK++NQ+KL+AKLH+L+VEW  G +TMEE L +I  RE
Sbjct  119  SQIQAQIRARRLCMVTESRLRQKKLENQLKLEAKLHDLEVEWCGGFDTMEETLARIHLRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV---Q  799
            EAAVKRERAMAYAFSHQWRA+SGH  G   + LGK +WGWSWKERWIA RPWE RV    
Sbjct  179  EAAVKRERAMAYAFSHQWRASSGHSLGLVNFELGKANWGWSWKERWIAARPWESRVPVKS  238

Query  800  ADP--------KKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
            A P        KK  +   L   K  VS + P LSNG+++  AR+ S
Sbjct  239  ASPKKVKNKQAKKVDENTKLQTKKTPVS-SKPSLSNGRVNPTARRLS  284



>ref|XP_008383657.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
 ref|XP_008383658.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
Length=294

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 179/274 (65%), Gaps = 25/274 (9%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANG------------GSSKNNEL-TEEIAA  298
            MG   W+R + GLK  K+G SK L+   + A+G             + +N  L  E+IAA
Sbjct  1    MGSGRWFRVLIGLKKAKDGNSKQLKG--SSAHGKSSSIKLKKSSFANGQNLGLPIEDIAA  58

Query  299  TRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKAR  478
             RIQ AFRAY   RKA+RRL+G VK Q  I+A + +  Q   TL ++HSWS+IQ E+KAR
Sbjct  59   IRIQTAFRAYA-ARKALRRLKGIVKLQLMIQA-FPITKQATTTLSYLHSWSKIQDEVKAR  116

Query  479  RLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAM  658
            RLCMVT+GR+KQKKI++Q KL+AKLH+++ +W  GSETM+E+L +I QREEAAVKRERAM
Sbjct  117  RLCMVTEGRIKQKKIESQQKLEAKLHDIEADWCGGSETMDEVLARIYQREEAAVKRERAM  176

Query  659  AYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKTASLG  838
            AYAFSHQWRAN         Y LGK +WGWSWK+RWIA RPWE RVQ+   +  ++    
Sbjct  177  AYAFSHQWRANCSQSQILGNYELGKANWGWSWKDRWIAARPWESRVQSPSPRKVQSKQAS  236

Query  839  PVKLVVSVNNP--------PLSNGKISTPARKPS  916
            PV   ++   P        P SNGK +T A++ S
Sbjct  237  PVGKNINSPTPKASVIVKLPSSNGKATTKAQRLS  270



>gb|ABK96454.1| unknown [Populus trichocarpa x Populus deltoides]
Length=312

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 181/287 (63%), Gaps = 37/287 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSK---------------WLQSVRTE----ANGGSSKNNEL  280
            MG   W++ +  +K  K+  SK               W   +R E    ANG S  N   
Sbjct  1    MGSVDWFKTMISMKKVKDDSSKQPKGCTTSAKSNGFKWKNKLRKESAIFANGSSRANPRF  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E++AAT+IQ AFRAY   RK +RRL+GTV+ Q  I   YSV  Q A TL ++HSW
Sbjct  61   IDMPVEDVAATQIQTAFRAY-MARKTLRRLKGTVRLQ-IITKNYSVKKQAATTLNYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            S+IQ++I+ARRLCMVT+ RL+QKK++NQ+KL+AKLH+L+VEW  G +TMEE L +I  RE
Sbjct  119  SQIQAQIRARRLCMVTESRLRQKKLENQLKLEAKLHDLEVEWCGGFDTMEETLARIHLRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV---Q  799
            EAAVKRERAMAYAFSHQWRA+SGH  G   + LGK +WGWSWKERWIA RPWE RV    
Sbjct  179  EAAVKRERAMAYAFSHQWRASSGHSLGLVNFELGKTNWGWSWKERWIAARPWESRVPVKS  238

Query  800  ADP--------KKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
            A P        KK  +   L   K  VS + P LSNG+++  AR+ S
Sbjct  239  ASPKKVKNKQAKKVDENTKLQTKKTPVS-SKPSLSNGRVNPTARRLS  284



>ref|XP_008371443.1| PREDICTED: protein IQ-DOMAIN 1 [Malus domestica]
 ref|XP_008345904.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
Length=294

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 171/272 (63%), Gaps = 21/272 (8%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNNELT-----------EEIAATR  304
            MG   W++   G K  K+  SK L+         S K  + T           E+IAA R
Sbjct  1    MGSGCWFKVCFGTKKSKDDSSKQLKVSSAHGKSNSIKLKKSTFANGKNLGLPIEDIAAIR  60

Query  305  IQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRL  484
            IQ AFRAY   RK++R L+G V+ Q  +  AY V  Q   TL ++HSWS+IQ+E+KARRL
Sbjct  61   IQTAFRAY-VARKSLRXLKGIVRLQ-IMTQAYPVAKQTTTTLSYLHSWSKIQAEVKARRL  118

Query  485  CMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAY  664
            CMVT+GR+KQKKI++Q KL+AKLH+++ EW  GSETM+EIL +I QREEAAVKRERAMAY
Sbjct  119  CMVTEGRIKQKKIESQQKLEAKLHDIEAEWCGGSETMDEILARIYQREEAAVKRERAMAY  178

Query  665  AFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKTASLGPV  844
            AFSHQWRAN         Y LGK +WGWSWKERWIA RPWE RVQ+   +  ++    PV
Sbjct  179  AFSHQWRANCSQSQSLGNYELGKANWGWSWKERWIAARPWESRVQSPSPRKVQSKQTSPV  238

Query  845  KLVVSVNNP--------PLSNGKISTPARKPS  916
               ++   P        P SNGK +T AR+ S
Sbjct  239  GKNINSPTPKASVVVKXPSSNGKPTTKARRLS  270



>emb|CDY20099.1| BnaA01g29030D [Brassica napus]
Length=264

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 158/225 (70%), Gaps = 8/225 (4%)
 Frame = +2

Query  257  GSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKH  436
             SS +  LT EIAATRIQ+AFRAYK  RK +  L+   +F   I+  ++V +Q +  L  
Sbjct  39   SSSASTTLTVEIAATRIQKAFRAYK-ARKRLCSLKSARRFNALIQG-HTVRNQTSIALNV  96

Query  437  IHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKI  616
            +HSW  IQS+I+ARR+ MVTQGRL+ K+++N++KL+ KLHE++VEW  GSETMEEIL +I
Sbjct  97   MHSWCDIQSQIRARRMYMVTQGRLQNKRLENRLKLEIKLHEIEVEWCGGSETMEEILARI  156

Query  617  QQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
            QQREEA VKRERAMAYAFSHQWRAN+  Y GQA +NL KE+WGWSWKERWIA RPWEIR 
Sbjct  157  QQREEATVKRERAMAYAFSHQWRANATQYLGQASFNLDKENWGWSWKERWIAARPWEIRA  216

Query  797  QADPKKAGKTAS----LGP--VKLVVSVNNPPLSNGKISTPARKP  913
            Q    K  K A+    L P  V    +   P L N K +  +RKP
Sbjct  217  QCQVTKPIKPATKPEKLSPPNVSTKKTSTKPSLPNIKEAAKSRKP  261



>ref|XP_011027720.1| PREDICTED: protein IQ-DOMAIN 1 [Populus euphratica]
 ref|XP_011027721.1| PREDICTED: protein IQ-DOMAIN 1 [Populus euphratica]
Length=305

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 142/287 (49%), Positives = 179/287 (62%), Gaps = 37/287 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSK---------------WLQSVRTE----ANGGSSKNNEL  280
            MG   W++ +  +K  K+  SK               W   +R E    ANG S  N   
Sbjct  1    MGSGDWFKTMISIKKVKDDSSKQPKGCTTSAKSNGFKWKNKLRKESAIFANGSSRANPRF  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E++AAT+IQ AFRAY   RK +RRL+GTV+ Q  I   YSV  Q A TL ++HSW
Sbjct  61   IDMPVEDVAATQIQTAFRAY-MARKTLRRLKGTVRLQ-IITKNYSVKKQAATTLNYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            S+IQ++I+ARRLCMVT+ RL+QKK++NQ+KL+AKLH+L+VEW  GS+TMEE L +I  RE
Sbjct  119  SQIQAQIRARRLCMVTESRLRQKKLENQLKLEAKLHDLEVEWCGGSDTMEETLARIHLRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR-----  793
            EAAVKRERAMAYAFSHQWRA+SGH  G   + LGK +WGWSWKERWIA RPWE R     
Sbjct  179  EAAVKRERAMAYAFSHQWRASSGHSLGLVNFELGKANWGWSWKERWIAARPWESRVPVKS  238

Query  794  ------VQADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
                       KK  +   L   K  VS + P LSNG+++  AR+ S
Sbjct  239  SSPKKVKSKQAKKVDENTKLQTKKTPVS-SKPSLSNGRVNPTARRLS  284



>ref|XP_006582139.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Glycine max]
Length=296

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 159/238 (67%), Gaps = 26/238 (11%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKW--LQSVRTEANGGSSKNNE------------------  277
            M  + W++ I  L+  K   SK   +QS   ++N  S +  E                  
Sbjct  1    MSPKKWFKAIIRLRKPKEDKSKLAKVQSTPEKSNESSEEKQEDTLEEALSIPSEGLAVER  60

Query  278  -----LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIH  442
                 L E+IAATRIQ AFRA+ Q R+ +  LRG VKF+  I+  +   +Q    L +IH
Sbjct  61   TVPTRLIEDIAATRIQNAFRAFLQARRTLHHLRGAVKFEALIQD-HMAREQTVTALNYIH  119

Query  443  SWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQ  622
            +WSR+Q +IKARRL M+T+ R+KQK+++NQ+KL+AK+HELQVEWS GSETMEEIL ++ Q
Sbjct  120  TWSRMQDQIKARRLYMITEARIKQKRLENQLKLEAKIHELQVEWSGGSETMEEILSRLHQ  179

Query  623  REEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
            REEAAVKRERAMAYA+SHQWR N   Y G A Y+LGKESWGWSWKERW+A RPWEIRV
Sbjct  180  REEAAVKRERAMAYAYSHQWRPNCSQYLGHATYSLGKESWGWSWKERWVAARPWEIRV  237



>ref|XP_009352817.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009352818.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
Length=294

 Score =   229 bits (584),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 138/282 (49%), Positives = 176/282 (62%), Gaps = 25/282 (9%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ-------------SVRTEANGGSSKNNELTEEIAA  298
            MG   W++ + GL   K+G SK L+                + ANG   K     E+ AA
Sbjct  1    MGSGRWFKVLIGLNKAKDGNSKRLKGSSAHGKSSSIKLKKSSSANG--QKLGLPIEDTAA  58

Query  299  TRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKAR  478
             RIQ AFRAY   RKA+RRL+G VK Q  +  A+ +  Q   TL ++HSWS+IQ E+KAR
Sbjct  59   IRIQTAFRAY-AARKALRRLKGIVKLQ-LMTQAFPITKQATTTLSYLHSWSKIQDEVKAR  116

Query  479  RLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAM  658
            RLCMVT+GR+KQKKI++Q KL+AKLH+++ EW  GSETM+E+L +I QREEAAVKRERAM
Sbjct  117  RLCMVTEGRIKQKKIESQQKLEAKLHDIEAEWCGGSETMDEVLARIYQREEAAVKRERAM  176

Query  659  AYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKTASLG  838
            AYAFSHQWRAN         Y LGK +WGWSWK+RWIA RPWE RVQ+   +  ++    
Sbjct  177  AYAFSHQWRANCSQSQILGNYELGKANWGWSWKDRWIAARPWESRVQSPSPRKVQSKQAS  236

Query  839  PVKLVVSVNNP--------PLSNGKISTPARKPSDHNPETQT  940
            PV   ++   P        P SNGK +T AR+ S    E +T
Sbjct  237  PVGKNINSPTPKSSVIVKLPSSNGKATTKARRLSYSAVEEKT  278



>ref|XP_011045896.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Populus euphratica]
Length=312

 Score =   229 bits (585),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 179/287 (62%), Gaps = 37/287 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSK---------------WLQSVRTE----ANGGSSKNNEL  280
            MG   W++ I  +K  K+  SK               W   +R E    ANG +  N   
Sbjct  1    MGSGDWFKTIISIKKVKDDTSKQAKGSSTSAKSNGFTWKNKLRKESASFANGSNRANPRF  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E++AATRIQ AFRAY+  RK +R L+G V+ Q  I   YS   Q A TL ++HSW
Sbjct  61   PDMPVEDLAATRIQTAFRAYR-ARKTLRCLKGKVRLQ-IITQNYSFKKQAATTLNYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            S+IQ++I+ARRLCMVT+ RL+QKK++NQ+KL+AKLH+L+V+WS GSETME+IL +I QRE
Sbjct  119  SKIQAQIRARRLCMVTESRLRQKKLENQLKLEAKLHDLEVDWSGGSETMEKILARIHQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA--  802
            EAAVKRERAMAYAFSHQWRA+ GH  G   Y LGK  WGWSWKERWIA RPWE R  A  
Sbjct  179  EAAVKRERAMAYAFSHQWRASYGHDLGVVNYELGKAYWGWSWKERWIAARPWESRAAAKS  238

Query  803  -DPK--------KAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
              PK        K  +T  L   K  VS + P L NGK +  A++ S
Sbjct  239  VSPKKMKSRQANKVDETTKLPTRKTPVS-SKPSLFNGKGNPTAQRLS  284



>ref|XP_006582138.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Glycine max]
Length=314

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 160/239 (67%), Gaps = 26/239 (11%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKW--LQSVRTEANGGSSKNNE------------------  277
            M  + W++ I  L+  K   SK   +QS   ++N  S +  E                  
Sbjct  19   MSPKKWFKAIIRLRKPKEDKSKLAKVQSTPEKSNESSEEKQEDTLEEALSIPSEGLAVER  78

Query  278  -----LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIH  442
                 L E+IAATRIQ AFRA+ Q R+ +  LRG VKF+  I+  +   +Q    L +IH
Sbjct  79   TVPTRLIEDIAATRIQNAFRAFLQARRTLHHLRGAVKFEALIQD-HMAREQTVTALNYIH  137

Query  443  SWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQ  622
            +WSR+Q +IKARRL M+T+ R+KQK+++NQ+KL+AK+HELQVEWS GSETMEEIL ++ Q
Sbjct  138  TWSRMQDQIKARRLYMITEARIKQKRLENQLKLEAKIHELQVEWSGGSETMEEILSRLHQ  197

Query  623  REEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQ  799
            REEAAVKRERAMAYA+SHQWR N   Y G A Y+LGKESWGWSWKERW+A RPWEIRV+
Sbjct  198  REEAAVKRERAMAYAYSHQWRPNCSQYLGHATYSLGKESWGWSWKERWVAARPWEIRVR  256



>gb|KEH38641.1| calmodulin-binding protein [Medicago truncatula]
Length=256

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L   IAATRIQ AFR++   R+  + LRG   F+  I+  +   DQ A TL +IHSWSRI
Sbjct  11   LIHNIAATRIQNAFRSF-MARRTFQHLRGAENFEALIQD-HMARDQTATTLNYIHSWSRI  68

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q +I+ARR+CM+T  R+KQK++++Q+K++AK++EL+VEW SGSETMEEIL +I QREEAA
Sbjct  69   QDQIRARRMCMITAARIKQKRLESQLKIEAKINELEVEWCSGSETMEEILSRIHQREEAA  128

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            +KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE+RVQ    K 
Sbjct  129  IKRERAMAYAFSHQWRPNCNQYFGQASYSLGKESWGWSWMERWVAARPWEVRVQVQSPKK  188

Query  818  GK  823
             K
Sbjct  189  NK  190



>gb|EYU26346.1| hypothetical protein MIMGU_mgv1a026164mg, partial [Erythranthe 
guttata]
Length=202

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = +2

Query  266  KNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHS  445
            KN++LT++ AAT+IQ A+RAYK  RK +RRL+G V+F+     ++ V  Q  + L HIH 
Sbjct  15   KNSKLTQDFAATKIQSAYRAYK-ARKTLRRLKGIVRFREEGHYSHCVEKQTISALNHIHL  73

Query  446  WSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQR  625
            WS+IQ+EI+AR L MV + R  QKK+ NQ KLDAKLH+L+VEW+ GSE MEEIL KIQ R
Sbjct  74   WSKIQAEIRARWLAMVIESRSTQKKLDNQFKLDAKLHQLEVEWNGGSENMEEILNKIQCR  133

Query  626  EEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
            E AA KRER MAYAFSHQWRANS  YFGQ YY+L KESWGWSWKERW+AVRPWE R Q 
Sbjct  134  ETAAAKRERTMAYAFSHQWRANSSQYFGQCYYDLSKESWGWSWKERWVAVRPWENRCQT  192



>ref|XP_002885066.1| IQ-domain 10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61325.1| IQ-domain 10 [Arabidopsis lyrata subsp. lyrata]
Length=259

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 155/228 (68%), Gaps = 7/228 (3%)
 Frame = +2

Query  233  SVRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVND  412
            S R +    SS + +LT E+A  RIQ+AFRA+K  RK +  L+   +F   I+  ++V +
Sbjct  31   SNRVKPVESSSASTKLTAEVAVIRIQKAFRAFK-ARKRLCSLKSARRFNALIQG-HTVKN  88

Query  413  QVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSET  592
            Q +  L  IHSW  IQS+++ARRL MVTQGRL+ K+++N++KL+ KLHEL+VEW  GSET
Sbjct  89   QTSTALNVIHSWCDIQSQVRARRLYMVTQGRLQHKRLENRLKLEIKLHELEVEWCGGSET  148

Query  593  MEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIA  772
            MEEIL KIQQREEA VKRERAMAYAFSHQWRAN+  Y GQA +NLGKESWGWSWKERWIA
Sbjct  149  MEEILAKIQQREEATVKRERAMAYAFSHQWRANATQYLGQASFNLGKESWGWSWKERWIA  208

Query  773  VRPWEIRVQA-----DPKKAGKTASLGPVKLVVSVNNPPLSNGKISTP  901
             RPWEIR Q        K A K     P  +++  +  P   G    P
Sbjct  209  ARPWEIRAQCYVSNKPIKPAKKPEKSSPNNVIIKTSAKPDEVGNSKKP  256



>ref|XP_009116509.1| PREDICTED: protein IQ-DOMAIN 1 [Brassica rapa]
Length=264

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 158/225 (70%), Gaps = 8/225 (4%)
 Frame = +2

Query  257  GSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKH  436
             SS +  LT EIAATRIQ+AFRAYK  RK +  L+   +F   I+  ++V +Q +  L  
Sbjct  39   SSSASTTLTVEIAATRIQKAFRAYK-ARKRLCSLKSARRFNALIQG-HTVRNQTSIALNV  96

Query  437  IHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKI  616
            +HSW  IQS+I+ARR+ MVTQGRL+ K+++N++KL+ KLHE++VEW  GSETM+EIL +I
Sbjct  97   MHSWCDIQSQIRARRMYMVTQGRLQNKRLENRLKLEIKLHEIEVEWCGGSETMDEILARI  156

Query  617  QQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
            QQREEA VKRERAMAYAFSHQWRAN+  Y GQA +NL KE+WGWSWKERWIA RPWEIR 
Sbjct  157  QQREEATVKRERAMAYAFSHQWRANATQYLGQASFNLDKENWGWSWKERWIAARPWEIRT  216

Query  797  Q---ADP-KKAGKTASLGP--VKLVVSVNNPPLSNGKISTPARKP  913
            Q   A P K A K   L P  V    +   P L N K +  +R P
Sbjct  217  QCLVAKPIKPATKREKLSPPNVSTKKTSAKPGLPNTKEAAKSRTP  261



>gb|KEH38640.1| calmodulin-binding protein [Medicago truncatula]
Length=316

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L   IAATRIQ AFR++   R+  + LRG   F+  I+  +   DQ A TL +IHSWSRI
Sbjct  71   LIHNIAATRIQNAFRSF-MARRTFQHLRGAENFEALIQD-HMARDQTATTLNYIHSWSRI  128

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q +I+ARR+CM+T  R+KQK++++Q+K++AK++EL+VEW SGSETMEEIL +I QREEAA
Sbjct  129  QDQIRARRMCMITAARIKQKRLESQLKIEAKINELEVEWCSGSETMEEILSRIHQREEAA  188

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            +KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE+RVQ    K 
Sbjct  189  IKRERAMAYAFSHQWRPNCNQYFGQASYSLGKESWGWSWMERWVAARPWEVRVQVQSPKK  248

Query  818  GK  823
             K
Sbjct  249  NK  250



>ref|XP_002317436.1| hypothetical protein POPTR_0011s07740g [Populus trichocarpa]
 gb|EEE98048.1| hypothetical protein POPTR_0011s07740g [Populus trichocarpa]
Length=312

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 180/287 (63%), Gaps = 37/287 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSK---------------WLQSVRTE----ANGGSSKNNEL  280
            MG   W++ I  +K  K+  SK               W   ++ E    ANG +  N   
Sbjct  1    MGSGDWFKTIISIKKVKDDSSKQAKGSSTSEKSNGFKWKHKLQKESASFANGSNRANPRF  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E++AATRIQ AFRAY+  RK +R L+G V+ Q  I   YS   Q A TL ++HSW
Sbjct  61   PDMPVEDLAATRIQTAFRAYR-ARKTLRCLKGKVRLQ-IITQNYSFKKQAATTLNYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            S+IQ++I+ARRL MVT+GRL+QKK++NQ+KL+AKLH+L+VEWS G ETME+IL +I QRE
Sbjct  119  SQIQAQIRARRLFMVTEGRLRQKKLENQLKLEAKLHDLEVEWSGGCETMEKILARIHQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA--  802
            EAAVKRERAMAYAFSHQWRA+ GH  G   Y LGK +WGWSWKERWIA RPWE RV A  
Sbjct  179  EAAVKRERAMAYAFSHQWRASYGHDLGVVNYELGKANWGWSWKERWIATRPWESRVAAKS  238

Query  803  -DPK--------KAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
              PK        K  +T  L   K  VS + P L NGK +  A++ S
Sbjct  239  VSPKKMKGRQANKVDETTKLPTRKTPVS-SKPSLFNGKGTPTAQRLS  284



>gb|KHN36870.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=295

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 154/215 (72%), Gaps = 11/215 (5%)
 Frame = +2

Query  272  NELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWS  451
            ++L ++IAATRIQ AFR++   R+ +  LRG  KF+  I+  +   +Q A  L +IHSWS
Sbjct  63   SKLMDDIAATRIQNAFRSF-MARRTLHHLRGAEKFEALIQD-HLAREQTATALSYIHSWS  120

Query  452  RIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREE  631
            RIQ +I+ RR+CM+T+ R+KQKK++ Q+K++AK+HEL+VEW +GSETMEEI+ ++ QREE
Sbjct  121  RIQEQIRVRRICMITEARIKQKKLETQLKIEAKIHELEVEWCNGSETMEEIISRLHQREE  180

Query  632  AAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPK  811
            AA+KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE+RV+    
Sbjct  181  AAIKRERAMAYAFSHQWRPNCSQYFGQASYSLGKESWGWSWTERWVAARPWEVRVRVQTT  240

Query  812  KA---------GKTASLGPVKLVVSVNNPPLSNGK  889
            K           K   +   +  V++  P LSNGK
Sbjct  241  KTKNLNGQVQKTKLDKMNHNESKVALAKPTLSNGK  275



>ref|XP_006592925.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Glycine max]
 ref|XP_006592926.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Glycine max]
Length=294

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 152/215 (71%), Gaps = 13/215 (6%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L ++IAATRIQ AFR++   R+ +  LRG  KF+  I+  +   +Q A  L +IHSWSR 
Sbjct  63   LMDDIAATRIQNAFRSF-MARRTLHHLRGAEKFEALIQD-HLAREQTATALSYIHSWSRT  120

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q +I+ARR+CM+T+ R+KQKK++ Q+K++AK+ EL+VEW +GSETMEEI+ ++ QREEAA
Sbjct  121  QEQIRARRICMITEARIKQKKLETQLKIEAKIQELEVEWCNGSETMEEIISRLHQREEAA  180

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            +KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE+RV+    K 
Sbjct  181  IKRERAMAYAFSHQWRPNCSQYFGQASYSLGKESWGWSWTERWVAARPWEVRVRGQTTKT  240

Query  818  GKTASLGPVKLV-----------VSVNNPPLSNGK  889
             K    G V+             V++  P LSNGK
Sbjct  241  TKLNGHGQVQKTKLDKMNQNESKVALAKPTLSNGK  275



>emb|CDY32322.1| BnaC01g36410D [Brassica napus]
Length=259

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 154/222 (69%), Gaps = 5/222 (2%)
 Frame = +2

Query  257  GSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKH  436
             SS +  LT EIAA RIQ+AFRAYK  RK +  L+   +F   ++  ++V +Q +  L  
Sbjct  39   SSSASTTLTVEIAAIRIQKAFRAYK-ARKRLCSLKSARRFNALVQG-HTVRNQTSIALNV  96

Query  437  IHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKI  616
            +HSW  IQS+I+ARR+ MVTQGRL+ K+++N++KL+ KLHE++VEW  GSETMEEIL +I
Sbjct  97   MHSWCDIQSQIRARRIYMVTQGRLQNKRLENRLKLEIKLHEIEVEWCGGSETMEEILARI  156

Query  617  QQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
            Q REEA VKRERAMAYAFSHQWRAN+  Y GQA +NL KE+WGWSWKERWIA RPWEIR 
Sbjct  157  QHREEATVKRERAMAYAFSHQWRANATQYLGQASFNLDKENWGWSWKERWIAARPWEIRA  216

Query  797  QAD-PKKAGKTASLGPVKLVVS--VNNPPLSNGKISTPARKP  913
            Q    K A K   L P  +        P L N K +  +RKP
Sbjct  217  QCQVTKPARKPEKLSPPNVATKKISAKPGLPNTKEAAKSRKP  258



>ref|XP_011045897.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Populus euphratica]
Length=298

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 167/250 (67%), Gaps = 22/250 (9%)
 Frame = +2

Query  224  WLQSVRTE----ANGGSSKNNEL----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQ  379
            W   +R E    ANG +  N        E++AATRIQ AFRAY+  RK +R L+G V+ Q
Sbjct  24   WKNKLRKESASFANGSNRANPRFPDMPVEDLAATRIQTAFRAYR-ARKTLRCLKGKVRLQ  82

Query  380  GAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHE  559
              I   YS   Q A TL ++HSWS+IQ++I+ARRLCMVT+ RL+QKK++NQ+KL+AKLH+
Sbjct  83   -IITQNYSFKKQAATTLNYLHSWSKIQAQIRARRLCMVTESRLRQKKLENQLKLEAKLHD  141

Query  560  LQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKES  739
            L+V+WS GSETME+IL +I QREEAAVKRERAMAYAFSHQWRA+ GH  G   Y LGK  
Sbjct  142  LEVDWSGGSETMEKILARIHQREEAAVKRERAMAYAFSHQWRASYGHDLGVVNYELGKAY  201

Query  740  WGWSWKERWIAVRPWEIRVQA---DPK--------KAGKTASLGPVKLVVSVNNPPLSNG  886
            WGWSWKERWIA RPWE R  A    PK        K  +T  L   K  VS + P L NG
Sbjct  202  WGWSWKERWIAARPWESRAAAKSVSPKKMKSRQANKVDETTKLPTRKTPVS-SKPSLFNG  260

Query  887  KISTPARKPS  916
            K +  A++ S
Sbjct  261  KGNPTAQRLS  270



>gb|AFK45555.1| unknown [Medicago truncatula]
Length=311

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L   IAATRIQ AFR++   R+  + LRG   F+  I+  +   DQ A TL +IHSWSRI
Sbjct  66   LIHNIAATRIQNAFRSF-MARRTFQHLRGAENFEALIQD-HMARDQTATTLNYIHSWSRI  123

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q +I+ARR+CM+T  R+KQK++++Q+K++AK++EL+VEW SGSETMEEIL +I QREEAA
Sbjct  124  QDQIRARRMCMITAARIKQKRLESQLKIEAKINELEVEWCSGSETMEEILSRIHQREEAA  183

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            +KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE RVQ    K 
Sbjct  184  IKRERAMAYAFSHQWRPNCNQYFGQASYSLGKESWGWSWMERWVAARPWEARVQVQSPKK  243

Query  818  GK  823
             K
Sbjct  244  NK  245



>ref|XP_002519560.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF42809.1| calmodulin binding protein, putative [Ricinus communis]
Length=277

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = +2

Query  293  AATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIK  472
            AA RIQ AFR Y   RK++RRL+G V+F   ++       Q ++TL HIHSWS IQ++IK
Sbjct  86   AAIRIQTAFRTY-MARKSLRRLKGAVRFNVLVQGN-DTQKQASSTLSHIHSWSYIQAQIK  143

Query  473  ARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRER  652
            ARR  MVT GR+KQKK++NQ+KL+AKL EL+VEW+ GS+TMEEIL +IQQREEAAVKRER
Sbjct  144  ARRHHMVTDGRIKQKKLENQLKLEAKLQELEVEWNGGSDTMEEILCRIQQREEAAVKRER  203

Query  653  AMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKTAS  832
            AMAYAFSHQWRAN   Y GQAYY++GKE+WGWSWKERWIA RPWEIRV A P    K  S
Sbjct  204  AMAYAFSHQWRANPTQYLGQAYYSIGKENWGWSWKERWIAARPWEIRVHAQPSYPKKGHS  263

Query  833  LGPVKLVVSVNNPP  874
                K  + V   P
Sbjct  264  TQASKSEMKVTIRP  277



>ref|XP_002522532.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF39832.1| calmodulin binding protein, putative [Ricinus communis]
Length=310

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 159/239 (67%), Gaps = 22/239 (9%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ--SVRTEANGGSSKN---------------NELTE  286
            MG   W++ I  LK  K+  SK ++  S   ++NG   KN               +   E
Sbjct  1    MGSGDWFKTIISLKKVKDDSSKRVKDSSAAAKSNGFKWKNQPRKKSATSCNPRVLDMPVE  60

Query  287  EIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSE  466
            + AATRIQ AFRAY   RK++ RL+G V+ Q  +   YS+  Q A TL H+HSWS+IQ +
Sbjct  61   DFAATRIQTAFRAY-MARKSLHRLKGAVRLQN-LTQNYSIKKQAATTLNHLHSWSKIQGQ  118

Query  467  IKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKR  646
            I+ RR CMV +GRL+QK+++NQ+KL+A+LH L+VEWS GSETMEE L +I QREEAAVKR
Sbjct  119  IRDRRHCMVREGRLRQKRLENQLKLEAELHHLEVEWSDGSETMEETLARIHQREEAAVKR  178

Query  647  ERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA---DPKK  814
            ERAMAYAFSHQWRANS  Y G   Y LGK +WGWSW ERWIA RPWE RV A    PKK
Sbjct  179  ERAMAYAFSHQWRANSSQYLGLVNYELGKANWGWSWTERWIAARPWESRVPAHSISPKK  237



>ref|XP_011045894.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
 ref|XP_011045895.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
Length=323

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 144/298 (48%), Positives = 179/298 (60%), Gaps = 48/298 (16%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSK--------------------------WLQSVRTE----  247
            MG   W++ I  +K  K+  SK                          W   +R E    
Sbjct  1    MGSGDWFKTIISIKKVKDDTSKQAKMLPHLFLQSEQGSSTSAKSNGFTWKNKLRKESASF  60

Query  248  ANGGSSKNNEL----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            ANG +  N        E++AATRIQ AFRAY+  RK +R L+G V+ Q  I   YS   Q
Sbjct  61   ANGSNRANPRFPDMPVEDLAATRIQTAFRAYR-ARKTLRCLKGKVRLQ-IITQNYSFKKQ  118

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             A TL ++HSWS+IQ++I+ARRLCMVT+ RL+QKK++NQ+KL+AKLH+L+V+WS GSETM
Sbjct  119  AATTLNYLHSWSKIQAQIRARRLCMVTESRLRQKKLENQLKLEAKLHDLEVDWSGGSETM  178

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            E+IL +I QREEAAVKRERAMAYAFSHQWRA+ GH  G   Y LGK  WGWSWKERWIA 
Sbjct  179  EKILARIHQREEAAVKRERAMAYAFSHQWRASYGHDLGVVNYELGKAYWGWSWKERWIAA  238

Query  776  RPWEIRVQA---DPK--------KAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
            RPWE R  A    PK        K  +T  L   K  VS + P L NGK +  A++ S
Sbjct  239  RPWESRAAAKSVSPKKMKSRQANKVDETTKLPTRKTPVS-SKPSLFNGKGNPTAQRLS  295



>ref|XP_010502428.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=261

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 167/260 (64%), Gaps = 17/260 (7%)
 Frame = +2

Query  170  GWY-RKITGLK-------TRKNGPSKWLQSVRTEANGGSSKNNELTEEIAATRIQRAFRA  325
            GW  R IT L         R N PS+   S R +  G S+ +  LT E+A  RIQ+AFRA
Sbjct  4    GWLLRSITCLNGPKKNKPNRGNVPSE--TSNRIKPVGSSTASTRLTTEVAVIRIQKAFRA  61

Query  326  YKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGR  505
            +K  RK +  L    +F   I+    +++Q +  L  +H+W  IQS+I+ RRL MVTQGR
Sbjct  62   FK-ARKRLCSLMSARRFNSLIQG-NKLSNQTSTALNVMHTWCDIQSQIRERRLYMVTQGR  119

Query  506  LkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWR  685
            L+ K+++ ++KL+ KL EL+VEW  GSETMEEIL KIQQ+EEA VKRERAMAYAFSHQWR
Sbjct  120  LQNKRLEKRLKLEIKLQELEVEWCGGSETMEEILAKIQQKEEATVKRERAMAYAFSHQWR  179

Query  686  ANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKTASLGPVKLVVSVN  865
            AN+  Y GQA +NLGKESWGWSWKERWIA RPWEIR Q    K  K A   P KL  +V+
Sbjct  180  ANATQYLGQASFNLGKESWGWSWKERWIAARPWEIRAQCHVTKPIKPAK-KPEKLSPNVS  238

Query  866  ----NPPLSNGKISTPARKP  913
                 P L N K    ++KP
Sbjct  239  KTSTKPGLPNTKEVKNSKKP  258



>ref|XP_003543221.2| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Glycine max]
Length=341

 Score =   225 bits (574),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 154/215 (72%), Gaps = 11/215 (5%)
 Frame = +2

Query  272  NELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWS  451
            ++L ++IAATRIQ AFR++   R+ +  LRG  KF+  I+  +   +Q A  L +IHSWS
Sbjct  109  SKLMDDIAATRIQNAFRSF-MARRTLHHLRGAEKFEALIQD-HLAREQTATALSYIHSWS  166

Query  452  RIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREE  631
            RIQ +I+ RR+CM+T+ R+KQKK++ Q+K++AK+HEL+VEW +GSETMEEI+ ++ QREE
Sbjct  167  RIQEQIRVRRICMITEARIKQKKLETQLKIEAKIHELEVEWCNGSETMEEIISRLHQREE  226

Query  632  AAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPK  811
            AA+KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE+RV+    
Sbjct  227  AAIKRERAMAYAFSHQWRPNCSQYFGQASYSLGKESWGWSWTERWVAARPWEVRVRVQTT  286

Query  812  KA---------GKTASLGPVKLVVSVNNPPLSNGK  889
            K           K   +   +  V++  P LSNGK
Sbjct  287  KTKNLNGQVQKTKLDKMNHNESKVALAKPTLSNGK  321



>ref|XP_006594738.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Glycine max]
Length=343

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 154/215 (72%), Gaps = 11/215 (5%)
 Frame = +2

Query  272  NELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWS  451
            ++L ++IAATRIQ AFR++   R+ +  LRG  KF+  I+  +   +Q A  L +IHSWS
Sbjct  111  SKLMDDIAATRIQNAFRSF-MARRTLHHLRGAEKFEALIQD-HLAREQTATALSYIHSWS  168

Query  452  RIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREE  631
            RIQ +I+ RR+CM+T+ R+KQKK++ Q+K++AK+HEL+VEW +GSETMEEI+ ++ QREE
Sbjct  169  RIQEQIRVRRICMITEARIKQKKLETQLKIEAKIHELEVEWCNGSETMEEIISRLHQREE  228

Query  632  AAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPK  811
            AA+KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE+RV+    
Sbjct  229  AAIKRERAMAYAFSHQWRPNCSQYFGQASYSLGKESWGWSWTERWVAARPWEVRVRVQTT  288

Query  812  KA---------GKTASLGPVKLVVSVNNPPLSNGK  889
            K           K   +   +  V++  P LSNGK
Sbjct  289  KTKNLNGQVQKTKLDKMNHNESKVALAKPTLSNGK  323



>gb|KHN31794.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=295

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 159/239 (67%), Gaps = 27/239 (11%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKW--LQSVRTEANGGSSKNNE------------------  277
            M  + W++ I  L+  K   SK   +QS   ++N  S +  E                  
Sbjct  1    MSPKKWFKAIIRLRKPKEDKSKLAKVQSTPEKSNESSEEKQEDTLEEALSIPSEGLAVER  60

Query  278  -----LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIH  442
                 L E+IAATRIQ AFRA+   R+ +  LRG VKF+  I+  +   +Q    L +IH
Sbjct  61   TVPTRLIEDIAATRIQNAFRAF-LARRTLHHLRGAVKFEALIQD-HMAREQTVTALNYIH  118

Query  443  SWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQ  622
            +WSR+Q +IKARRL M+T+ R+KQK+++NQ+KL+AK+HELQVEWS GSETMEEIL ++ Q
Sbjct  119  TWSRMQDQIKARRLYMITEARIKQKRLENQLKLEAKIHELQVEWSGGSETMEEILSRLHQ  178

Query  623  REEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQ  799
            REEAAVKRERAMAYA+SHQWR N   Y G A Y+LGKESWGWSWKERW+A RPWEIRV+
Sbjct  179  REEAAVKRERAMAYAYSHQWRPNCSQYLGHATYSLGKESWGWSWKERWVAARPWEIRVR  237



>ref|XP_006449460.1| hypothetical protein CICLE_v10016080mg [Citrus clementina]
 gb|ESR62700.1| hypothetical protein CICLE_v10016080mg [Citrus clementina]
Length=302

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 162/234 (69%), Gaps = 17/234 (7%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
             E++AA RIQ AFRAYK  RK  RRL+GT++ QG +   +SV  Q   TL ++H+WS++Q
Sbjct  58   VEDVAAIRIQTAFRAYK-ARKTFRRLKGTIRLQG-VSQRHSVQKQATTTLSYLHTWSKLQ  115

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            +EI+ARRLCMV +GRL+QKK++NQ+KLDAKL+ L+++WS G ETMEEIL +I QRE+AAV
Sbjct  116  AEIRARRLCMVKEGRLRQKKLENQLKLDAKLNSLEIDWSGGPETMEEILSRINQREKAAV  175

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV--------  796
            KRERAMAYAFSHQWRAN         Y LGK  WGWSWKERWIA RPWEIRV        
Sbjct  176  KRERAMAYAFSHQWRANPNPL---GKYELGKADWGWSWKERWIAARPWEIRVPSPSISQK  232

Query  797  ---QADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQE  949
               +    K+GK ++    K  VSV  P +SNGK ++ AR+ S  + E  +  E
Sbjct  233  KVQRTQAGKSGKDSNSPTPKSSVSV-KPSISNGKGTSKARRLSFLDAEKPSSSE  285



>gb|KDO77786.1| hypothetical protein CISIN_1g022139mg [Citrus sinensis]
 gb|KDO77787.1| hypothetical protein CISIN_1g022139mg [Citrus sinensis]
Length=302

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 162/234 (69%), Gaps = 17/234 (7%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
             E++AA RIQ AFRAYK  RK  RRL+GT++ QG +   +SV  Q   TL ++H+WS++Q
Sbjct  58   VEDVAAIRIQTAFRAYK-ARKTFRRLKGTIRLQG-VSQRHSVQKQATTTLSYLHTWSKLQ  115

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            +EI+ARRLCMV +GRL+QKK++NQ+KLDAKL+ L+++WS G ETMEEIL +I QRE+AAV
Sbjct  116  AEIRARRLCMVKEGRLRQKKLENQLKLDAKLNSLEIDWSGGPETMEEILSRINQREKAAV  175

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV--------  796
            KRERAMAYAFSHQWRAN         Y LGK  WGWSWKERWIA RPWEIRV        
Sbjct  176  KRERAMAYAFSHQWRANPNPL---GKYELGKADWGWSWKERWIAARPWEIRVPSPSISQK  232

Query  797  ---QADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQE  949
               +    K+GK ++    K  VSV  P +SNGK ++ AR+ S  + E  +  E
Sbjct  233  KVQRTQAGKSGKDSNSPTPKSSVSV-KPSISNGKGTSKARRLSFPDAEKPSSSE  285



>ref|XP_004489053.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Cicer arietinum]
Length=233

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 155/222 (70%), Gaps = 11/222 (5%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L ++IAATRIQ AFR++   R+  +  +G  KF+  I+  +   +Q + TL +IHSWSRI
Sbjct  10   LIDDIAATRIQNAFRSF-MARRTFQHRQGAEKFEALIQD-HMAREQTSTTLNYIHSWSRI  67

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q +IKARR+CM+T+  +KQKK++NQ+KL++K++EL+VEW SGSETMEEIL +I QREEAA
Sbjct  68   QDQIKARRVCMITEATIKQKKLENQLKLESKINELEVEWCSGSETMEEILSRIHQREEAA  127

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA-DPKK  814
            +KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE+RVQ   PK 
Sbjct  128  IKRERAMAYAFSHQWRPNCSQYFGQASYSLGKESWGWSWMERWVAARPWEVRVQVQSPKT  187

Query  815  AGKTASLGPVKLVVSVNNPP--------LSNGKISTPARKPS  916
                      KL    +N          LSNGK +   +K S
Sbjct  188  KKLNGQQQKTKLDKMNHNETKSPLAKAALSNGKETEKGKKHS  229



>ref|XP_006467683.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Citrus sinensis]
 ref|XP_006467684.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Citrus sinensis]
 ref|XP_006467685.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Citrus sinensis]
Length=302

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 162/234 (69%), Gaps = 17/234 (7%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
             E++AA RIQ AFRAYK  RK  RRL+GT++ QG +   +SV  Q   TL ++H+WS++Q
Sbjct  58   VEDVAAIRIQTAFRAYK-ARKTFRRLKGTIRLQG-VSQRHSVQKQATTTLSYLHTWSKLQ  115

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            +EI+ARRLCMV +GRL+QKK++NQ+KLDAKL+ L+++WS G ETMEEIL +I QRE+AAV
Sbjct  116  AEIRARRLCMVKEGRLRQKKLENQLKLDAKLNSLEIDWSGGPETMEEILSRINQREKAAV  175

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV--------  796
            KRERAMAYAFSHQWRAN         Y LGK  WGWSWKERWIA RPWEIRV        
Sbjct  176  KRERAMAYAFSHQWRANPNPL---GKYELGKADWGWSWKERWIAARPWEIRVPSPSISQK  232

Query  797  ---QADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQE  949
               +    K+GK ++    K  VSV  P +SNGK ++ AR+ S  + E  +  E
Sbjct  233  KVQRTQAGKSGKDSNSPTPKSSVSV-KPSISNGKGTSKARRLSFPDAEKPSSSE  285



>ref|XP_003525998.2| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Glycine max]
Length=313

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 159/239 (67%), Gaps = 27/239 (11%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKW--LQSVRTEANGGSSKNNE------------------  277
            M  + W++ I  L+  K   SK   +QS   ++N  S +  E                  
Sbjct  19   MSPKKWFKAIIRLRKPKEDKSKLAKVQSTPEKSNESSEEKQEDTLEEALSIPSEGLAVER  78

Query  278  -----LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIH  442
                 L E+IAATRIQ AFRA+   R+ +  LRG VKF+  I+  +   +Q    L +IH
Sbjct  79   TVPTRLIEDIAATRIQNAFRAF-LARRTLHHLRGAVKFEALIQD-HMAREQTVTALNYIH  136

Query  443  SWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQ  622
            +WSR+Q +IKARRL M+T+ R+KQK+++NQ+KL+AK+HELQVEWS GSETMEEIL ++ Q
Sbjct  137  TWSRMQDQIKARRLYMITEARIKQKRLENQLKLEAKIHELQVEWSGGSETMEEILSRLHQ  196

Query  623  REEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQ  799
            REEAAVKRERAMAYA+SHQWR N   Y G A Y+LGKESWGWSWKERW+A RPWEIRV+
Sbjct  197  REEAAVKRERAMAYAYSHQWRPNCSQYLGHATYSLGKESWGWSWKERWVAARPWEIRVR  255



>ref|XP_004489052.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Cicer arietinum]
Length=288

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 163/246 (66%), Gaps = 26/246 (11%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ-----SVRTEANGG--------SSKNNE-------  277
            MG + W++ I   K  K   SK  Q      +  E++ G        SS  NE       
Sbjct  1    MGPKKWFKIIIRRKKPKEDKSKQEQVHSTAEIPNESSNGKQSPHEESSSTPNEGLMLDGT  60

Query  278  ----LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHS  445
                L ++IAATRIQ AFR++   R+  +  +G  KF+  I+  +   +Q + TL +IHS
Sbjct  61   VPSRLIDDIAATRIQNAFRSF-MARRTFQHRQGAEKFEALIQD-HMAREQTSTTLNYIHS  118

Query  446  WSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQR  625
            WSRIQ +IKARR+CM+T+  +KQKK++NQ+KL++K++EL+VEW SGSETMEEIL +I QR
Sbjct  119  WSRIQDQIKARRVCMITEATIKQKKLENQLKLESKINELEVEWCSGSETMEEILSRIHQR  178

Query  626  EEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            EEAA+KRERAMAYAFSHQWR N   YFGQA Y+LGKESWGWSW ERW+A RPWE+RVQ  
Sbjct  179  EEAAIKRERAMAYAFSHQWRPNCSQYFGQASYSLGKESWGWSWMERWVAARPWEVRVQVQ  238

Query  806  PKKAGK  823
              K  K
Sbjct  239  SPKTKK  244



>ref|XP_003593714.1| IQ domain-containing protein [Medicago truncatula]
 gb|AES63965.1| calmodulin-binding protein [Medicago truncatula]
Length=295

 Score =   221 bits (563),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 158/236 (67%), Gaps = 18/236 (8%)
 Frame = +2

Query  248  ANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAAT  427
            ANG  ++N    E IAATRIQ AFRAYK  RKA+RRL+G  K +   E  YSV  Q + T
Sbjct  50   ANGIQNENLGSVETIAATRIQTAFRAYK-ARKALRRLKGFTKLKILTEG-YSVQKQASTT  107

Query  428  LKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEIL  607
            + ++HSWS+IQ  I+ARR+CMVT+ R+++KK ++Q+KL+ KLH+ +VEWS G ETMEE L
Sbjct  108  ITYLHSWSKIQGAIRARRVCMVTEDRIRRKKQESQLKLEEKLHDFEVEWSGGPETMEETL  167

Query  608  QKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE  787
             +I QR EAAVKRERAMAYAFSHQWRANS    G   Y LGK SWGWSWKERWIA RPWE
Sbjct  168  GRIHQRGEAAVKRERAMAYAFSHQWRANSSQSLGS--YELGKASWGWSWKERWIAARPWE  225

Query  788  IRV-QADPK--------KAGKTASLGPVKLVVSVNNPPLSNG----KISTPARKPS  916
             RV    PK        K  K  +    K  VSV  PP SN     K+ST AR+ S
Sbjct  226  SRVANISPKKVQNKQSYKVQKDKNTSTSKTPVSV-TPPTSNAKGTPKVSTKARRLS  280



>ref|XP_006298363.1| hypothetical protein CARUB_v10014433mg [Capsella rubella]
 gb|EOA31261.1| hypothetical protein CARUB_v10014433mg [Capsella rubella]
Length=259

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 155/229 (68%), Gaps = 5/229 (2%)
 Frame = +2

Query  233  SVRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVND  412
            S R +  G +S +  LT E+A  RIQ+AFRA+K  RK +  L    +F   I+  +++ +
Sbjct  31   SNRVKPVGSTSASTNLTAEVAVIRIQKAFRAFK-ARKRLCSLMSARRFNSLIQG-HTLRN  88

Query  413  QVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSET  592
            Q +  LK +HSW  IQS+I+ RRL MVTQGRL+ K+++N++KL+ KL EL+VEW  GSET
Sbjct  89   QTSTALKVMHSWCDIQSQIRERRLYMVTQGRLQHKRLENRLKLEIKLQELEVEWCGGSET  148

Query  593  MEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIA  772
            ME+IL KIQQ+EEA VKRERAMAYAFSHQWRAN+  Y GQA +NLG ESWGWSWKERWIA
Sbjct  149  MEDILAKIQQKEEATVKRERAMAYAFSHQWRANATQYLGQASFNLGTESWGWSWKERWIA  208

Query  773  VRPWEIRVQADPKKAGKTASLGPVKLV--VSVNNPPLSNGKISTPARKP  913
             RPWEIR Q    K  K A   P KL   V+   P L   K     +KP
Sbjct  209  ARPWEIRAQCHVSKPIKPAK-KPEKLPPNVTKTKPGLPTTKEVKKFKKP  256



>ref|NP_188123.1| protein IQ-domain 10 [Arabidopsis thaliana]
 dbj|BAA97068.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE75610.1| protein IQ-domain 10 [Arabidopsis thaliana]
Length=259

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 152/218 (70%), Gaps = 6/218 (3%)
 Frame = +2

Query  260  SSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHI  439
            S+ + +LT E+A  RIQ+AFRA+K  RK +  L+   +F   I+  ++V +Q +  L  I
Sbjct  41   SAASTKLTVEVAVIRIQKAFRAFK-ARKRLCSLKSARRFNSLIQG-HTVMNQTSTALNVI  98

Query  440  HSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQ  619
            HSW  IQ++I+ARRL MVTQGRL+ K+++N++KL+ KLHEL+VEW  GSETMEEIL KIQ
Sbjct  99   HSWYDIQNQIRARRLYMVTQGRLQHKRLENRLKLEIKLHELEVEWCGGSETMEEILAKIQ  158

Query  620  QREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQ  799
            Q+EEA VKRERAMAYAFSHQWRAN+  Y GQA +NLGKESWGWSWKERWIA RPWEIR Q
Sbjct  159  QKEEATVKRERAMAYAFSHQWRANATQYLGQASFNLGKESWGWSWKERWIAARPWEIRAQ  218

Query  800  A---DP-KKAGKTASLGPVKLVVSVNNPPLSNGKISTP  901
                 P K + K     P  ++   +  P   G    P
Sbjct  219  CYVVKPIKPSKKPEKSSPNNVITKTSAKPDEVGNSKKP  256



>ref|XP_007161597.1| hypothetical protein PHAVU_001G082800g [Phaseolus vulgaris]
 gb|ESW33591.1| hypothetical protein PHAVU_001G082800g [Phaseolus vulgaris]
Length=286

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            +++AATRIQ AFR++   R+ +  LRG VKF+  I+  +   +Q A  L +IHSWS IQ 
Sbjct  65   DDVAATRIQNAFRSF-MARRTLHHLRGAVKFEALIQD-HLAREQTATALNYIHSWSTIQE  122

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR+CM+T+ R+K++K++NQ+KL+AK+ EL+VEW SGSETMEEIL ++ QREEAA+K
Sbjct  123  QIRARRICMITEARIKKRKLENQLKLEAKIQELEVEWCSGSETMEEILCRLHQREEAAIK  182

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
            RERAMAYAFSHQWR N   YFGQA Y LGKESWGWSW ERW++ RPWE++V+  P K  K
Sbjct  183  RERAMAYAFSHQWRPNCSQYFGQASYCLGKESWGWSWTERWVSARPWEVQVRVQPSKTKK  242



>gb|KFK38852.1| hypothetical protein AALP_AA3G168800 [Arabis alpina]
Length=262

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 158/234 (68%), Gaps = 8/234 (3%)
 Frame = +2

Query  233  SVRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVND  412
            S R +    SS +  L  EIA  RIQ+AFRAYK  RK +  L+   +F   I+  ++V +
Sbjct  31   SNRVKPIESSSASTTLPVEIAVIRIQKAFRAYK-ARKRLSSLKCAKRFNSLIQN-HNVRN  88

Query  413  QVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSET  592
            Q +  L  IHSW  IQS+I+ARRL MVTQGRL+ K+++N++KL+ KLHE++VEW  GSET
Sbjct  89   QTSTALNVIHSWCDIQSQIRARRLYMVTQGRLQHKRLENRLKLEIKLHEIEVEWCGGSET  148

Query  593  MEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIA  772
            MEEIL +IQQREEA VKRERAMAYAFSHQWRAN+  Y GQ  +NL KE+WGWSWKERWI+
Sbjct  149  MEEILARIQQREEATVKRERAMAYAFSHQWRANATQYLGQDSFNLDKENWGWSWKERWIS  208

Query  773  VRPWEIRVQADPKKAGKTASLGPVKLV---VSVNNPPLSNGKISTPA--RKPSD  919
             RPWEIR Q+   K  K A   P KL+    S   P L N K    A  +KPS 
Sbjct  209  ARPWEIRAQSQVIKPIKPAK-KPEKLIRKKTSAAKPGLPNTKEEEAAKSKKPSS  261



>ref|XP_007025458.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 ref|XP_007025459.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 ref|XP_007025460.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 ref|XP_007025461.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 ref|XP_007025462.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 gb|EOY28080.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 gb|EOY28081.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 gb|EOY28082.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 gb|EOY28083.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
 gb|EOY28084.1| IQ-domain 9, putative isoform 1 [Theobroma cacao]
Length=312

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 154/234 (66%), Gaps = 18/234 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E++AA RIQ AFRAY+  RK++RRL+GTV+ Q   +  YS+  Q   TL ++HSWS IQ+
Sbjct  62   EDLAAIRIQTAFRAYR-ARKSLRRLKGTVRLQAKTQT-YSIEKQATTTLNYLHSWSNIQA  119

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARRLCMVT+G L+QKKI NQ+KL+AKLH+L+VEWS G ETME IL KI QREEAAVK
Sbjct  120  QIRARRLCMVTEGHLRQKKIANQLKLEAKLHDLEVEWSGGPETMETILTKIHQREEAAVK  179

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV---------  796
            RER MAYAFSHQWRA +    G   Y L K +WGWSW ERWIAVRPWE R+         
Sbjct  180  RERTMAYAFSHQWRAPNSKNNGLGNYELAKANWGWSWVERWIAVRPWESRLSIQSITPKK  239

Query  797  ----QADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARK---PSDHNPETQ  937
                Q    KAGK ++    K   SV  P   NGK +   R+   P    P T+
Sbjct  240  VQNTQISKSKAGKNSNSPKPKASASVKPPSFPNGKGALKPRRLSYPGAEKPTTR  293



>ref|XP_002272018.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
 emb|CBI30653.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 155/226 (69%), Gaps = 17/226 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E+IAATRIQ AFRA+   RK +RRL+G V+ Q  +     V  Q + TL ++ SWSRIQ+
Sbjct  66   EDIAATRIQTAFRAF-MARKTLRRLKGIVRLQ-KLTQGDCVRKQASTTLSYLSSWSRIQT  123

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARRLCMVT+GR++QKK++NQ+KLDAKLH+L+VEW  G ETMEEIL +I  REEAAVK
Sbjct  124  QIRARRLCMVTEGRIRQKKLENQLKLDAKLHDLEVEWCGGPETMEEILARIYHREEAAVK  183

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA--  817
            RERA+AYAFSHQWRANSG   G     L K +WGWSW ERWIA RPWE RV   PKKA  
Sbjct  184  RERALAYAFSHQWRANSGQNQGPNKSGLSKANWGWSWMERWIAARPWESRVHISPKKAQS  243

Query  818  ------GKTASLGPVKLVVSVNNPPLSNGKISTPARK---PSDHNP  928
                  GK       K+ V+VN     NGK +T AR+   PS   P
Sbjct  244  RQKNKVGKNIISPTTKVPVTVN----PNGKGTTKARRLSYPSAEKP  285



>ref|XP_010686348.1| PREDICTED: protein IQ-DOMAIN 1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686349.1| PREDICTED: protein IQ-DOMAIN 1 [Beta vulgaris subsp. vulgaris]
Length=310

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/271 (50%), Positives = 174/271 (64%), Gaps = 26/271 (10%)
 Frame = +2

Query  188  TGLKTRKNGPSKWLQSVRTEANGGS--SKNN----ELTEEIAATRIQRAFRAYKQGRKAI  349
            TG KT+K       +S +  A GG   S+ N    +++E++AATRIQ AFRAY   RKA 
Sbjct  34   TGSKTKK-------KSEKANAKGGRGISRTNGTPVKISEDVAATRIQTAFRAY-MARKAF  85

Query  350  RRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqn  529
            RR++G ++FQ  +    SV  Q   TL H+HSWS IQ++I+ RR CMVT GRLKQKK++N
Sbjct  86   RRMKGIIRFQ-KLTQFQSVKKQSTNTLNHLHSWSMIQTQIRHRRQCMVTDGRLKQKKLEN  144

Query  530  qikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFG  709
            Q+KL+AKLH+L+VEW+ G+ TM+EIL +I QREEAAVKRER +AYAFSHQWRANSG   G
Sbjct  145  QMKLEAKLHDLEVEWNGGANTMDEILARIHQREEAAVKRERTLAYAFSHQWRANSGQNQG  204

Query  710  QAYYNLGKESWGWSWKERWIAVRPWEIRVQA---DPKKA-------GKTASLGPVKLVVS  859
                 LGK  WGWSWKERWIA RPWE RV +   +PKK         + +S    +  + 
Sbjct  205  SNASELGKADWGWSWKERWIAARPWESRVPSQSINPKKGQNKLTSKAQKSSNSTTQKSIP  264

Query  860  VNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
            V +  L NGK    AR+ S      +  QEP
Sbjct  265  VKSTVL-NGKTHGKARRSSFPGTGKKAEQEP  294



>ref|XP_003546016.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Glycine max]
 ref|XP_006597475.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Glycine max]
 gb|KHN18930.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=308

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/285 (46%), Positives = 170/285 (60%), Gaps = 39/285 (14%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNNEL-------------------  280
            MG   W++ I  L+  K G SK  + + T+    +SK+N                     
Sbjct  1    MGSGDWFKTIISLRKSKEGRSKKAKGILTQEKLNASKSNNYPGKESSGLTNGIKSENLVS  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E IAATRIQ AFRAYK  RKA+RR++G  K +   E  +SV  Q +  + ++HSW
Sbjct  61   AGVSVETIAATRIQTAFRAYK-ARKALRRMKGFTKLKILTEG-FSVKKQASTAVTYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            S+IQ+EI+ARR+CMVT+ R+++KK+++Q+KL+AKLH+L+VEW  GSETMEEIL +I  RE
Sbjct  119  SKIQAEIRARRICMVTEDRIRRKKLESQLKLEAKLHDLEVEWCGGSETMEEILGRIHHRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV----  796
            EAAVKRERAMAYAFSHQWRANS        Y L K +WGWSWKE WIA RPWE R+    
Sbjct  179  EAAVKRERAMAYAFSHQWRANSSQNQLLGNYELSKANWGWSWKECWIAARPWESRIPSLS  238

Query  797  ---------QADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPA  904
                     Q  P K  K  +    K  VS   PP +N K + P+
Sbjct  239  VTPEKAQHKQPSPSKVQKDKNTSTPKTPVSF-KPPSANAKGTPPS  282



>gb|KDP21056.1| hypothetical protein JCGZ_21527 [Jatropha curcas]
Length=313

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 158/242 (65%), Gaps = 25/242 (10%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ--SVRTEANGGSSKNNEL-----------------  280
            MG   W++ I  LK  K   SK ++  S   ++NG   K N                   
Sbjct  1    MGSGDWFKAIIRLKKVKGDSSKQVKGSSASAKSNGFKWKKNRSHKQSTSSSSDNPRVLHM  60

Query  281  -TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
              E++AA RIQ AFRAY   RK +RRL+G V+ Q  +   YSV  Q   TL  +HSWS+I
Sbjct  61   PVEDLAAIRIQTAFRAY-MARKTLRRLKGAVRLQ-TLTQKYSVKKQATTTLNFLHSWSKI  118

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q++I+ARR CMV +GRL++KK++NQ+KL+AKLH+L+VEW SGSETMEE+L ++ QREEAA
Sbjct  119  QAQIRARRQCMVIEGRLRRKKLENQVKLEAKLHDLEVEWCSGSETMEEVLARLHQREEAA  178

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA---DP  808
            VKRERAMAYAFSHQWRAN     G   + LGKE+WGWSW +RWIA RPWE RV A    P
Sbjct  179  VKRERAMAYAFSHQWRANCSQSLGAVNFELGKENWGWSWMDRWIAARPWESRVPALSISP  238

Query  809  KK  814
            KK
Sbjct  239  KK  240



>ref|XP_006370035.1| hypothetical protein POPTR_0001s38470g [Populus trichocarpa]
 gb|ERP66604.1| hypothetical protein POPTR_0001s38470g [Populus trichocarpa]
Length=240

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 146/200 (73%), Gaps = 18/200 (9%)
 Frame = +2

Query  332  QGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLk  511
              RKA+ RL+G V+F   I   +    Q ++TL HIHSWS IQ++I+ARR  MVT+GR+K
Sbjct  23   HARKAMHRLKGAVRFNVLIHG-HDTQKQASSTLSHIHSWSNIQAQIRARRHHMVTEGRIK  81

Query  512  qkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRAN  691
            QKK++NQ+KL+A+L E++VEW  GS+TMEEIL +IQQREEAAVKRERAMAYAFSHQWRAN
Sbjct  82   QKKLENQLKLEARLQEIEVEWCGGSDTMEEILSRIQQREEAAVKRERAMAYAFSHQWRAN  141

Query  692  SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD--------PKKAGKTASLGPVK  847
               Y GQAYY+LGKE+WGWSWKERWIA RPWEIRV A+        PK+  KT    P K
Sbjct  142  PTQYLGQAYYSLGKENWGWSWKERWIAARPWEIRVHAELHNLKKAHPKQESKTTL--PTK  199

Query  848  LVVSVNNPPLSNGKISTPAR  907
                   P LSNGK++  ++
Sbjct  200  -------PALSNGKVTAKSK  212



>ref|XP_010519241.1| PREDICTED: protein IQ-DOMAIN 1 [Tarenaya hassleriana]
 ref|XP_010519242.1| PREDICTED: protein IQ-DOMAIN 1 [Tarenaya hassleriana]
Length=270

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 165/261 (63%), Gaps = 26/261 (10%)
 Frame = +2

Query  158  MGWRGWYRKITGLKT-----------RKNG--PSKWLQSVRTEANGGSSKNNELTEEIAA  298
            MG   W+R + G K            R NG  P +            S++     EE+AA
Sbjct  1    MGSGRWFRCLKGAKEDKTNRGKVHSERSNGTKPRESTAPFTALIGSSSARTGMPIEEVAA  60

Query  299  TRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKAR  478
              IQ+A RA+   RK I RL+   +F   I   +++ +Q +  L  +HSW  IQS+I+AR
Sbjct  61   VIIQKAIRAF-MARKRIYRLKSADRFNSLIRG-HTIKNQTSVALSVMHSWCDIQSQIRAR  118

Query  479  RLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAM  658
            RL MVT+GRL+QK+++N++KL+AKL EL+VEW  GSETM+EIL +IQQREEAAVKRERAM
Sbjct  119  RLYMVTEGRLQQKRLENRLKLEAKLQELEVEWCGGSETMDEILARIQQREEAAVKRERAM  178

Query  659  AYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKTASLG  838
            AYAFSHQWRAN+ HY GQA + LGKE+WGWSWKERWI+ RPWE+RVQ+          + 
Sbjct  179  AYAFSHQWRANATHYLGQASFGLGKENWGWSWKERWISARPWEVRVQSQ--------DIK  230

Query  839  PVKLVVSVNNPPLSNGKISTP  901
            P K +    + P    KI+TP
Sbjct  231  PKKCLTKPTSKP---DKITTP  248



>ref|XP_010057060.1| PREDICTED: protein IQ-DOMAIN 1 [Eucalyptus grandis]
 ref|XP_010057062.1| PREDICTED: protein IQ-DOMAIN 1 [Eucalyptus grandis]
 ref|XP_010057063.1| PREDICTED: protein IQ-DOMAIN 1 [Eucalyptus grandis]
 gb|KCW74043.1| hypothetical protein EUGRSUZ_E02667 [Eucalyptus grandis]
 gb|KCW74044.1| hypothetical protein EUGRSUZ_E02667 [Eucalyptus grandis]
 gb|KCW74045.1| hypothetical protein EUGRSUZ_E02667 [Eucalyptus grandis]
 gb|KCW74046.1| hypothetical protein EUGRSUZ_E02667 [Eucalyptus grandis]
 gb|KCW74047.1| hypothetical protein EUGRSUZ_E02667 [Eucalyptus grandis]
Length=315

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 175/290 (60%), Gaps = 40/290 (14%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSK-------------------WLQSVRTEA----NGGSSK  268
            MG   W++ I  LK  KN  SK                   W      E+    NG ++ 
Sbjct  1    MGSGNWFKSIINLKRVKNNGSKQSKPGKQASSSPGKSNSFKWKTHSNKESTTLENGATAG  60

Query  269  NNEL---TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHI  439
             + L    E  AA RIQ AFRAY   RK +RRL+G V+ Q  +   +SV  Q   TL ++
Sbjct  61   KSSLGMSLENRAALRIQTAFRAY-MARKMLRRLKGIVRLQ-ILTQNFSVKKQATTTLGYL  118

Query  440  HSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQ  619
            HSWS+IQS+++ RRLCMVT+GR+KQKK++NQ+KL+AKLH+L+V+W  GSETMEEIL +I 
Sbjct  119  HSWSKIQSQVRERRLCMVTEGRIKQKKLENQMKLEAKLHDLEVDWCGGSETMEEILARIH  178

Query  620  QREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQ  799
            QREEAAVKRER+MAYAF+HQWRA+S +  G   Y LGK  WGWSW ERWIA RPWE RV 
Sbjct  179  QREEAAVKRERSMAYAFNHQWRADS-NTNGLKNYELGKAGWGWSWMERWIAARPWESRVP  237

Query  800  A---DPKK--------AGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
                 PKK          K+ +    K V S   PP SNGK +T AR+ S
Sbjct  238  VQTISPKKPLNKQGSNVAKSLNQQTPKAVTSPKPPPSSNGKATTKARRLS  287



>gb|AFK49244.1| unknown [Medicago truncatula]
Length=295

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 155/234 (66%), Gaps = 18/234 (8%)
 Frame = +2

Query  248  ANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAAT  427
            ANG  ++N    E  AATRIQ AFRAYK  RKA+RRL+G  K +   E  YSV  Q + T
Sbjct  50   ANGIQNENLGSVETTAATRIQTAFRAYK-ARKALRRLKGFTKLKILTEG-YSVQKQASTT  107

Query  428  LKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEIL  607
            + ++HSWS+IQ  I+ARR+CMVT+ R+++KK ++Q+KL+ KLH+ +V WS G ETMEE L
Sbjct  108  ITYLHSWSKIQGAIRARRVCMVTEDRIRRKKQESQLKLEEKLHDFEVAWSGGPETMEETL  167

Query  608  QKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE  787
             +I QR EAAVKRERAMAYAFSHQWRANS    G   Y LGK SWGWSWKERWIA RPWE
Sbjct  168  GRIHQRGEAAVKRERAMAYAFSHQWRANSSQSLGS--YELGKASWGWSWKERWIAARPWE  225

Query  788  IRV-QADPK--------KAGKTASLGPVKLVVSVNNPPLSNG----KISTPARK  910
             RV    PK        K  K  +    K  VSV  PP SN     K+ST AR+
Sbjct  226  SRVANISPKKVQNKQSYKVQKDKNTSTSKTPVSV-TPPTSNAKGTPKVSTKARR  278



>ref|XP_010487320.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=261

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 133/258 (52%), Positives = 168/258 (65%), Gaps = 13/258 (5%)
 Frame = +2

Query  170  GWY-RKITGLK-TRKNGPSKW----LQSVRTEANGGSSKNNELTEEIAATRIQRAFRAYK  331
            GW  R IT L   +KN P++       S R +  G SS +  LT E+A  RIQ+AFRA+K
Sbjct  4    GWLLRSITCLNGPKKNKPNRGNVHSETSNRIKPVGSSSASTTLTSEVAVIRIQKAFRAFK  63

Query  332  QGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLk  511
              RK +  L    +F   I+  + +++Q +  L  +H+W  IQS+I+ RRL MVTQGRL+
Sbjct  64   -ARKRLCSLMSARRFNSLIQG-HKLSNQTSTALNVMHTWCDIQSQIRERRLYMVTQGRLQ  121

Query  512  qkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRAN  691
             K+++N++KL+ KL EL+VEW  GSETMEEIL KIQQ+EEA VKRERAMAYAFSHQWRAN
Sbjct  122  NKRLENRLKLEIKLQELEVEWCGGSETMEEILAKIQQKEEATVKRERAMAYAFSHQWRAN  181

Query  692  SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKK----AGKTASLGPVKLVVS  859
            +  Y GQA +NLGKESWGWSWKERWIA RPWEIR Q    K    A K   L P  +  +
Sbjct  182  ATQYLGQASFNLGKESWGWSWKERWIAARPWEIRTQCHSTKPIKPAKKPEQLSP-NVTKT  240

Query  860  VNNPPLSNGKISTPARKP  913
               P L N K    ++KP
Sbjct  241  STKPGLPNTKEVKNSKKP  258



>ref|XP_010108418.1| Protein IQ-DOMAIN 1 [Morus notabilis]
 gb|EXC19446.1| Protein IQ-DOMAIN 1 [Morus notabilis]
Length=325

 Score =   217 bits (552),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 140/282 (50%), Positives = 173/282 (61%), Gaps = 34/282 (12%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNG--PSKWLQSVRTEANGGSSKNNE--------------LTEE  289
            MG   W++ +  LK  K G  P K   S   ++NG   KNN                 E+
Sbjct  1    MGSGNWFKTVFRLKKVKVGSKPVKE-SSALAKSNGVKVKNNTRKGSSSLLNGSLNMPIED  59

Query  290  IAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEI  469
            +AA RIQ AFRAYK  RKA+RRL+G ++ Q  +   Y V  Q   TL  +HSW  +Q +I
Sbjct  60   VAAIRIQTAFRAYK-ARKALRRLKGILRLQ-ILTQGYPVQKQSTTTLNLLHSWCNLQMQI  117

Query  470  KARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRE  649
            +ARRLCMVT+GR+KQKK++NQ KL+AKLH+++VEW +GSETM+E+L +I QREEAAVKRE
Sbjct  118  RARRLCMVTEGRIKQKKLENQQKLEAKLHDIEVEWCAGSETMDEVLSRIYQREEAAVKRE  177

Query  650  RAMAYAFSH------QWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV-----  796
            RAMAYAFSH      QWRAN     G     LGK +WGWSWKERWIA RPWE RV     
Sbjct  178  RAMAYAFSHQKTSPVQWRANCSQSQGLGNDELGKANWGWSWKERWIAARPWESRVAPQFT  237

Query  797  --QADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
              + D  K    A   P K  +SV  PP SNGK +T AR+ S
Sbjct  238  SPKKDQSKQANKAVKTP-KTPISV-KPPSSNGKEATKARRLS  277



>ref|XP_004485866.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Cicer arietinum]
 ref|XP_004485867.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Cicer arietinum]
 ref|XP_004485868.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Cicer arietinum]
Length=303

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = +2

Query  248  ANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAAT  427
            ANG  + N    E IAATRIQ AFRAYK  RKA+RRL+G  K +  +   YSV  Q + T
Sbjct  49   ANGIQNDNLVAIETIAATRIQTAFRAYK-ARKALRRLKGFTKLK-ILTQGYSVQKQASTT  106

Query  428  LKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEIL  607
            + ++HSWS+IQ EI+ARR+CMVT+ R+K+KK ++Q+KL+ KLH+L+VEWS G ETMEE L
Sbjct  107  ITYLHSWSKIQGEIRARRICMVTEDRIKRKKQESQLKLEEKLHDLEVEWSGGPETMEETL  166

Query  608  QKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE  787
             +I  REEAAVKRERAMAYAFSHQWRANS        Y LGK +WGWSWKERWIA RPWE
Sbjct  167  GRIHHREEAAVKRERAMAYAFSHQWRANSSQSQVLGSYELGKANWGWSWKERWIAARPWE  226

Query  788  IRVQA--DPKK  814
             RV +   PKK
Sbjct  227  SRVASSTSPKK  237



>ref|XP_003543012.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Glycine max]
 ref|XP_006594561.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Glycine max]
 ref|XP_006594562.1| PREDICTED: protein IQ-DOMAIN 1 isoform X3 [Glycine max]
 gb|KHN08464.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=299

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/289 (46%), Positives = 171/289 (59%), Gaps = 39/289 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNNEL-------------------  280
            MG   W++ I  L+  K G SK  + +  +    +SK+N                     
Sbjct  1    MGSGDWFKTIISLRKSKQGRSKKAKGILAQEKLNASKSNSYPGKESGGLANGTKSENLVS  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E IAA RIQ AFRAYK  RKA+RR++G  K +   E  +SV  Q +  + ++HSW
Sbjct  61   AGVSVETIAAKRIQTAFRAYK-ARKALRRMKGFTKLKILTEG-FSVKKQASTAITYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            S+IQ EI+ARR+CMVT+ ++++KK+++Q+KL+AKLH+L+VEW  GSET EEIL +I  RE
Sbjct  119  SKIQVEIRARRICMVTEDKIRRKKLESQLKLEAKLHDLEVEWCGGSETKEEILGRIHDRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV----  796
            EAAVKRERAMAYAFSHQWRANS        Y L K +WGWSWKERWIA RPWE RV    
Sbjct  179  EAAVKRERAMAYAFSHQWRANSSQSQLLGNYELSKANWGWSWKERWIAARPWESRVPSLS  238

Query  797  ---------QADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
                     Q  P K  K  +    K  VSV  PP +N K ++ AR+ S
Sbjct  239  ITPKKSQHKQPSPSKVQKDKNTSTPKTPVSV-KPPSANAKGTSKARRLS  286



>ref|XP_010108277.1| Protein IQ-DOMAIN 1 [Morus notabilis]
 gb|EXC18517.1| Protein IQ-DOMAIN 1 [Morus notabilis]
Length=310

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 170/275 (62%), Gaps = 49/275 (18%)
 Frame = +2

Query  209  NGPSKWLQSVRTEANGGSSKNN--ELTEEI-AATRIQRAFRAYKQGRKAIRRLRGTV---  370
            NG +K L S    +NG SS  N     E+I A TRIQ AFR++   RKA   L+GTV   
Sbjct  31   NGSNKDLCS---PSNGDSSGKNATPFHEQITAVTRIQAAFRSF-LARKAFHSLKGTVEPP  86

Query  371  ----------------------------KFQGAIEAAYSVNDQVAATLKHIHSWSRIQSE  466
                                        +FQ  ++  ++V DQ  + L+HIHSWS IQ +
Sbjct  87   DLDQDQTSNVQATATTAASTVDGVKGFVRFQELVQD-HTVKDQAISALRHIHSWSIIQDQ  145

Query  467  IKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKR  646
            I+ARRLCMV + R++QKK++NQ+KL+AKLHEL+VEW  GSETMEEI+ +IQQREEA++KR
Sbjct  146  IRARRLCMVKEARIRQKKVENQLKLEAKLHELEVEWCGGSETMEEIISRIQQREEASIKR  205

Query  647  ERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKT  826
            ERAMAYA+ HQWRANS  Y GQA +++GKE+WGWSW ERW+A RPWEIRV + P  + K+
Sbjct  206  ERAMAYAYLHQWRANSSQYLGQASFSIGKENWGWSWVERWVAARPWEIRVVSYPTTSKKS  265

Query  827  ASLGPVKLVVSVN----------NPPLSNGKISTP  901
             +    KL   +N          +P LSNG    P
Sbjct  266  QTKLLSKLDKVLNEAENKIPVSEDPILSNGNCKIP  300



>ref|XP_007148077.1| hypothetical protein PHAVU_006G178700g [Phaseolus vulgaris]
 gb|ESW20071.1| hypothetical protein PHAVU_006G178700g [Phaseolus vulgaris]
Length=306

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 157/234 (67%), Gaps = 18/234 (8%)
 Frame = +2

Query  248  ANGGSSKN----NELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            ANG  S+N        E IAATRIQ AFRAYK  RKA+RR++G  K +   E  ++V  Q
Sbjct  49   ANGIKSENLVSPGVSVETIAATRIQTAFRAYK-ARKALRRMKGFSKLKILTEG-FTVTKQ  106

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             +A + ++HSWS+IQ EI+ RR+CMVT+ R+++KK+++Q+KL+AKLH+L+VEWS GSETM
Sbjct  107  ASAAITYLHSWSKIQGEIRDRRICMVTEDRIRRKKLESQLKLEAKLHDLEVEWSGGSETM  166

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            EEIL KI QREEAAVKRERAMAYAFSHQWRANS        Y + K +WGWSWKERWIA 
Sbjct  167  EEILGKIHQREEAAVKRERAMAYAFSHQWRANSSQSQVLGSYEVSKANWGWSWKERWIAA  226

Query  776  RPWEIRVQA-----------DPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPA  904
            RPWE R+ +            P K  K  +    K  VSV  PPL+  K   P+
Sbjct  227  RPWESRISSLSVTPEKAQHKQPNKVEKDKNASTPKTPVSV-KPPLAIAKGPPPS  279



>ref|XP_009347297.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Pyrus x bretschneideri]
Length=252

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 143/203 (70%), Gaps = 9/203 (4%)
 Frame = +2

Query  332  QGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLk  511
            + RK++RRL+G V+ Q  +  AY V  Q   TL ++HSWS+IQ+E+KARRLCMVT+GR+K
Sbjct  25   KARKSLRRLKGIVRLQ-IMTQAYPVTKQTTTTLSYLHSWSKIQAEVKARRLCMVTEGRIK  83

Query  512  qkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRAN  691
            QKKI++Q KL+AKLHE++ EW  GSETM+EIL +I QREEAAVKRERAMAYAFSHQWRAN
Sbjct  84   QKKIESQQKLEAKLHEIEAEWCGGSETMDEILARIYQREEAAVKRERAMAYAFSHQWRAN  143

Query  692  SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGKTASLGPVKLVVSVNNP  871
                     Y LGK +WGWSWKERWIA RPWE RVQ+   +  ++    PV   ++   P
Sbjct  144  CSQNQSLGNYELGKANWGWSWKERWIAARPWESRVQSPSPRKVQSKQASPVGKNINSPTP  203

Query  872  --------PLSNGKISTPARKPS  916
                    P SNGK +T AR+ S
Sbjct  204  KAAVLVKLPSSNGKPTTKARRLS  226



>ref|XP_004248134.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
 ref|XP_004248135.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
 ref|XP_010327044.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
 ref|XP_010327045.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
 ref|XP_010327046.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
 ref|XP_010327047.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
 ref|XP_010327048.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
 ref|XP_010327049.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
Length=304

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 168/261 (64%), Gaps = 22/261 (8%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSV---RTE-----------ANGGS-SKNNEL---T  283
            MG   W +K+  L+  K+G SK L+     R E            NG S  K+ E+   +
Sbjct  1    MGSGYWLKKVISLRKAKDGRSKRLKGTSIGRKEDEHSQKEPSRRTNGASVKKHREMGIPS  60

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E+ AA RIQ AFRAY   RK +RRL+   + +  I+   SV  Q + TL  +HSW+RIQ+
Sbjct  61   EDNAAIRIQTAFRAY-MARKTLRRLKRISRLRSMIQGP-SVKKQASTTLSALHSWNRIQA  118

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            EI+A R+ MV +GRLKQKK++NQ+KL+AKLH L+VEW+ G ETME +L +I QRE AAVK
Sbjct  119  EIRACRVRMVIEGRLKQKKLENQLKLEAKLHNLEVEWNGGPETMEVVLSRIHQREAAAVK  178

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE--IRVQADPKKA  817
            RER MAYAFSHQWRANS   FG + ++LGK +WGWSWK+RWIA RPWE  I VQ+ PK A
Sbjct  179  RERTMAYAFSHQWRANSNPMFGSSIHDLGKANWGWSWKDRWIAARPWESRIPVQSSPKIA  238

Query  818  GKTASLGPVKLVVSVNNPPLS  880
             +TAS  P          P+S
Sbjct  239  NRTASKTPKSYKTQTTKTPVS  259



>gb|KHN47201.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=309

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 179/308 (58%), Gaps = 47/308 (15%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQS---------VRTE----------ANGGSSKNNEL  280
            MG   W++ I   +  K G SK L+          ++T+          ANG  SKN E 
Sbjct  1    MGSGDWFKTIISSRKSKEGRSKKLKGSLASWRLIVLQTKIYTRKKSNGLANGIKSKNLES  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E IAATRIQ AFRAYK  RK + RLRG  K +   + + S   Q   T+ ++HSW
Sbjct  61   DGVSVETIAATRIQTAFRAYK-ARKYLHRLRGFTKLKIQTQGS-SAKKQAVTTITYLHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            S+IQ+EI+ARR+CMVT+ R+++K I +Q+KL+AK+H+L+VEW SGSET +EIL ++ QRE
Sbjct  119  SKIQAEIRARRICMVTEDRIRRKIIHSQLKLEAKIHDLEVEWCSGSETKKEILSRLHQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA--  802
            EAAVKRER MAYAFSHQWRA+S    G   Y LGK SW WSWK+RWIA RPWE RV +  
Sbjct  179  EAAVKRERTMAYAFSHQWRASSSQGLGN--YELGKASWSWSWKDRWIAARPWESRVPSVT  236

Query  803  ----------DPKKAGKTASLGPVKLVVSVNNP--------PLSNGKISTPARKPSDHNP  928
                       P+K  K  +    K  VSV  P        PLSN K +T AR+   +  
Sbjct  237  NTSPEKDQNKKPRKVQKDRNSPTSKKPVSVKTPSANAKGTKPLSNAKGTTKARRRLSYPA  296

Query  929  ETQTPQEP  952
             T+    P
Sbjct  297  ATEKKAVP  304



>gb|AFK39609.1| unknown [Lotus japonicus]
Length=309

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 157/241 (65%), Gaps = 21/241 (9%)
 Frame = +2

Query  251  NGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATL  430
            NG  ++N    E IAA RIQ AFRA+K  RKA+RRL+   K +  I+  YSV  Q   T+
Sbjct  51   NGVKNENLVSVETIAAIRIQTAFRAHK-ARKALRRLKRFTKLKVQIQG-YSVKKQAGTTI  108

Query  431  KHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQ  610
             ++HSWS+IQ+EI+ARR+CMVT+ +++Q+K+++Q+KL+AKLH+L+VEWS GSETMEE L 
Sbjct  109  TYLHSWSKIQAEIRARRICMVTEDKVRQRKLESQLKLEAKLHDLEVEWSGGSETMEETLG  168

Query  611  KIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEI  790
            +I QREEAAVKRER +AYAFSHQWRANS          LGK +WGWSWK+RWIA RPWE 
Sbjct  169  RIHQREEAAVKRERTLAYAFSHQWRANSSQSQMLGNCELGKANWGWSWKDRWIAARPWES  228

Query  791  RVQ-----------ADPKKAGKTASLGPVKLVVSVN--------NPPLSNGKISTPARKP  913
            R+                K  K  S+   K  VS           PPL NGK +T AR+ 
Sbjct  229  RIHNINLKKSPSPNKQSSKVQKDKSISTPKTPVSATPNSSNAKGTPPLENGKGTTKARRL  288

Query  914  S  916
            S
Sbjct  289  S  289



>ref|XP_010915584.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Elaeis guineensis]
 ref|XP_010915585.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Elaeis guineensis]
Length=319

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 129/275 (47%), Positives = 171/275 (62%), Gaps = 31/275 (11%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTE-ANG----------------GSSKNNELTE  286
            MG   W++ I   K  K   SK ++S  ++ +NG                G+S  N   E
Sbjct  1    MGSGDWFKTIISRKKTKKDQSKQVKSTSSQQSNGFKWRNQSHRKSHKLYNGASGGNMSIE  60

Query  287  EIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSE  466
            ++AA RIQ AFR ++  RK  R L+G  + Q  +   +SV  Q + TL ++ SW +IQ++
Sbjct  61   DLAAIRIQTAFRGFR-ARKKFRSLKGVQRLQ-VLAQGHSVKHQASTTLSYLQSWGKIQAQ  118

Query  467  IKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKR  646
            I+ARR+CMVT+GR++QKK  NQ+KL+AKLH+L+VEW  GSETMEEI+ +IQQREEAA+KR
Sbjct  119  IRARRICMVTEGRMRQKKQDNQLKLEAKLHDLEVEWCGGSETMEEIIARIQQREEAAIKR  178

Query  647  ERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV---QADPKKA  817
            ERA+AYAFSHQWRAN G   G   Y  GK +WGWSW +RWIA RPWE R+    A PKKA
Sbjct  179  ERALAYAFSHQWRANPGLNQGPFVYECGKGNWGWSWMDRWIAARPWETRLPTHSAIPKKA  238

Query  818  --------GKTASLGPVKLVVSVNNPPLSNGKIST  898
                    G  A+    K+  SV  P  ++GK ST
Sbjct  239  QTKATSKVGNDANPSAQKVSESV-KPAAADGKGST  272



>ref|XP_006361054.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006361055.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006361056.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Solanum tuberosum]
Length=304

 Score =   211 bits (537),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 165/261 (63%), Gaps = 22/261 (8%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSV---RTE-----------ANGGS-SKNNEL---T  283
            MG   W + +  L+  K+G SK L+     R E            NG S  K+ E+   +
Sbjct  1    MGSGYWLKNVISLRKAKDGRSKRLKRTSIGRKEDENSQKEPSRRTNGASVKKHREMGIPS  60

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E+ AA RIQ AFRAY   RK +RRL+G  +     +   SV  Q + TL  +HSW+RIQ+
Sbjct  61   EDNAAIRIQTAFRAY-MARKTLRRLKGISRLHSMTQGP-SVKKQASTTLSALHSWNRIQA  118

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            EI+A R+ MV +GRLKQKK++NQ+KL+AKLH L+VEWS G ETME +L +I QREEAAVK
Sbjct  119  EIRACRVRMVIEGRLKQKKLENQLKLEAKLHNLEVEWSGGPETMEVVLSRIHQREEAAVK  178

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR--VQADPKKA  817
            RER MAYAFSHQWRANS   FG + ++LGK +WGWSW +RWIA RPWE R  VQ+ PK  
Sbjct  179  RERTMAYAFSHQWRANSNPMFGSSIHDLGKANWGWSWTDRWIAARPWESRIPVQSSPKIV  238

Query  818  GKTASLGPVKLVVSVNNPPLS  880
             +TAS  P          P+S
Sbjct  239  NRTASKTPKSYKTQTTKTPVS  259



>ref|XP_010413787.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
 ref|XP_010413788.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=271

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 156/215 (73%), Gaps = 13/215 (6%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            TE+ AATRIQ AF+AYK  RK++RRL+G  + + + E  +SV +Q   TL+++HSWS+IQ
Sbjct  47   TEDWAATRIQTAFKAYK-ARKSLRRLKGIARAKLSTEK-HSVKNQAVVTLRYLHSWSKIQ  104

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            SEIKARR+CMVT+ RLK K++++Q KL+AKLH+++VEW+ GSET +EIL++I QREEA +
Sbjct  105  SEIKARRVCMVTEWRLKNKRLEHQQKLEAKLHDVEVEWNGGSETKDEILERILQREEATI  164

Query  641  KRERAMAYAFSHQWRAN-SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            KRERA+AYAFSHQW+A+    + G   Y LG  +WGWSWKERWI+ RPWE+R  A PKK 
Sbjct  165  KRERALAYAFSHQWKADGKTQWLGS--YELGNTNWGWSWKERWISARPWEVRYTATPKKP  222

Query  818  --------GKTASLGPVKLVVSVNNPPLSNGKIST  898
                     +T S  P K V+S+++ P     + T
Sbjct  223  KSSKTFCKSETNSNSPAKRVMSLSSVPAKASSLGT  257



>ref|XP_006594294.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Glycine max]
 ref|XP_006594295.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Glycine max]
Length=257

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 159/248 (64%), Gaps = 30/248 (12%)
 Frame = +2

Query  227  LQSVRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSV  406
            ++S   E++G S       E IAATRIQ AFRAYK  RK + RLRG  K +   + + S 
Sbjct  1    MKSENLESDGVS------VETIAATRIQTAFRAYK-ARKYLHRLRGFTKLKIQTQGS-SA  52

Query  407  NDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGS  586
              Q   T+ ++HSWS+IQ+EI+ARR+CMVT+ R+++K I +Q+KL+AK+H+L+VEW SGS
Sbjct  53   KKQAVTTITYLHSWSKIQAEIRARRICMVTEDRIRRKIIHSQLKLEAKIHDLEVEWCSGS  112

Query  587  ETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERW  766
            ET +EIL ++ QREEAAVKRER MAYAFSHQWRA+S    G   Y LGK SW WSWK+RW
Sbjct  113  ETKKEILSRLHQREEAAVKRERTMAYAFSHQWRASSSQGLGN--YELGKASWSWSWKDRW  170

Query  767  IAVRPWEIRVQA------------DPKKAGKTASLGPVKLVVSVNNP--------PLSNG  886
            IA RPWE RV +             P+K  K  +    K  VSV  P        PLSN 
Sbjct  171  IAARPWESRVPSVTNTSPEKDQNKKPRKVQKDRNSPTSKKPVSVKTPSANAKGTKPLSNA  230

Query  887  KISTPARK  910
            K +T AR+
Sbjct  231  KGTTKARR  238



>ref|XP_003529361.1| PREDICTED: protein IQ-DOMAIN 1-like isoformX2 [Glycine max]
 ref|XP_006583842.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Glycine max]
Length=290

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 154/224 (69%), Gaps = 15/224 (7%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQS-VRTE------ANGGSSKNNEL----TEEIAATR  304
            MG   W++ I   +  K G SK +++ + T       ANG  SKN E      E IAATR
Sbjct  1    MGSGDWFKTIISSRKSKEGTSKKVKTKIYTRKKSNGLANGIKSKNLESDGVSVETIAATR  60

Query  305  IQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRL  484
            IQ AFRAYK  RK + RLRG  K +   + + SV  Q A T+ ++HSWS+IQ+EI+ARR+
Sbjct  61   IQTAFRAYK-ARKYLHRLRGFTKLKIQTQGS-SVQKQAATTITYLHSWSKIQAEIRARRI  118

Query  485  CMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAY  664
            CMVT+ R+++K I +Q+KL++K+H+L+VEW  GSET +EIL ++  REEAAVKRER MAY
Sbjct  119  CMVTEDRIRRKIIHSQLKLESKIHDLEVEWCGGSETKKEILARLHHREEAAVKRERTMAY  178

Query  665  AFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
            AFSHQWRANS    G   Y+LGK SW WSWK+RWIA RPWE RV
Sbjct  179  AFSHQWRANSSQGLGN--YDLGKASWSWSWKDRWIATRPWESRV  220



>ref|NP_180946.2| IQ-domain 9 protein [Arabidopsis thaliana]
 dbj|BAF01251.1| putative SF16 protein {Helianthus annuus} [Arabidopsis thaliana]
 gb|AEC08904.1| IQ-domain 9 protein [Arabidopsis thaliana]
Length=263

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 152/201 (76%), Gaps = 7/201 (3%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E+ AATRIQ AF+AYK  RK++RRL+G  + + + E   SV +Q   TL+++HSWS+IQ
Sbjct  45   SEDWAATRIQTAFKAYK-ARKSLRRLKGIARAKLSTEK-QSVKNQAVVTLRYLHSWSKIQ  102

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            SEIKARR+CMVT+ RLK K++++Q KL+AKLH+++VEW+ GSET +EIL++I QREEA +
Sbjct  103  SEIKARRVCMVTEWRLKNKRLEHQQKLEAKLHDVEVEWNGGSETKDEILERILQREEATI  162

Query  641  KRERAMAYAFSHQWRAN-SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPK--  811
            KRERA+AYAFSHQW+A+    + G   Y LG  +WGWSWKERWI+ RPWE+R    PK  
Sbjct  163  KRERALAYAFSHQWKADGKTQWLGS--YELGNTNWGWSWKERWISARPWEVRYSVTPKKP  220

Query  812  KAGKTASLGPVKLVVSVNNPP  874
            K+ KT S  P K  VS+++ P
Sbjct  221  KSSKTDSNSPAKRTVSLSSVP  241



>gb|KGN49281.1| hypothetical protein Csa_6G518360 [Cucumis sativus]
Length=310

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 126/274 (46%), Positives = 169/274 (62%), Gaps = 23/274 (8%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ---------SVRTEANGGSSKNNELT---EEIAAT  301
            MG   W++ +  LK  K   SK  +         S R +++G +  +  L+   E++AA 
Sbjct  1    MGSGRWFKAVIRLKKVKTSSSKQTKEKLDDFQKDSPRFKSDGANGNSKSLSMPIEDVAAV  60

Query  302  RIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARR  481
            RIQ A+RAY+  RK +R L+G  + Q  +   +SV     +TL ++HSWS IQ++I+ARR
Sbjct  61   RIQTAYRAYR-ARKNLRLLKGAFRLQN-LTQGHSVRKHATSTLGYLHSWSHIQAQIRARR  118

Query  482  LCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMA  661
            LCMVT+GR +QK+++NQ KL+AKLH+++VEW  G+++M+ IL +I  REEAAVKRERAMA
Sbjct  119  LCMVTEGRQRQKRLENQRKLEAKLHDIEVEWCGGADSMDGILSRIHDREEAAVKRERAMA  178

Query  662  YAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA---DPKKAGKTAS  832
            YAFSHQWRANS   +G     LGK  WGWSWKERWIA RPWE RV +    PKK+    S
Sbjct  179  YAFSHQWRANSNEMYGLGKDELGKADWGWSWKERWIAARPWESRVPSQFVSPKKSTIRQS  238

Query  833  L------GPVKLVVSVNNPPLSNGKISTPARKPS  916
                    P         PP  NGK S  AR+ S
Sbjct  239  SKVSKRNSPSPKARGPMKPPSPNGKSSAKARRLS  272



>ref|XP_007153699.1| hypothetical protein PHAVU_003G057400g [Phaseolus vulgaris]
 ref|XP_007153700.1| hypothetical protein PHAVU_003G057400g [Phaseolus vulgaris]
 gb|ESW25693.1| hypothetical protein PHAVU_003G057400g [Phaseolus vulgaris]
 gb|ESW25694.1| hypothetical protein PHAVU_003G057400g [Phaseolus vulgaris]
Length=285

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 152/227 (67%), Gaps = 21/227 (9%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKN-------NELTEE-------IA  295
            MG   W++ +   +  K G SK    V+T+   G   N       +E+ E        IA
Sbjct  1    MGSGDWFKSMISSRKSKEGRSK---KVKTKIYKGKKSNGLANGIKSEILESAGVSIETIA  57

Query  296  ATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKA  475
            ATRIQ AFRAYK  RK +RRLRG  K +   +   SV  Q + T+ H+HSWS+IQ+EI+A
Sbjct  58   ATRIQTAFRAYK-ARKYLRRLRGFTKLKTLTQGC-SVQKQASTTVTHLHSWSKIQAEIRA  115

Query  476  RRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERA  655
            RR+CMVT+ RLK++K+++Q+KL+AK+H+L+VEW  GSETMEE + ++  REEAAVKRER 
Sbjct  116  RRICMVTEDRLKRQKLRSQLKLEAKIHDLEVEWCGGSETMEETIARLHLREEAAVKRERT  175

Query  656  MAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
            MAYAFSHQWRAN     G   Y LGK SW WSWK+RWIAVRPWE RV
Sbjct  176  MAYAFSHQWRANCSQGLGN--YELGKASWSWSWKDRWIAVRPWESRV  220



>ref|XP_010469407.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
 ref|XP_010469408.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=271

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 153/207 (74%), Gaps = 13/207 (6%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            TE+ AATRIQ AF+AYK  RK++RRL+G  + + + E  +SV +Q   TL+++HSWS+IQ
Sbjct  47   TEDWAATRIQTAFKAYK-ARKSLRRLKGIARAKLSTEK-HSVKNQAVVTLRYLHSWSKIQ  104

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            SEIKARR+CMVT+ RLK K++++Q KL+AKLH+++VEW+ GSET +EIL++I QREEA +
Sbjct  105  SEIKARRVCMVTEWRLKNKRLEHQQKLEAKLHDVEVEWNGGSETKDEILERILQREEATI  164

Query  641  KRERAMAYAFSHQWRAN-SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            KRERA+AYAFSHQW+A+    + G   Y LG  +WGWSWKERWI+ RPWE+R    PKK 
Sbjct  165  KRERALAYAFSHQWKADGKTQWLGS--YELGTTNWGWSWKERWISARPWEVRYTVTPKKP  222

Query  818  --------GKTASLGPVKLVVSVNNPP  874
                     +T S  P K V+S+++ P
Sbjct  223  KSSKTFCKSETNSNSPAKRVMSLSSVP  249



>gb|KHG08166.1| Protein IQ-DOMAIN 1 -like protein [Gossypium arboreum]
Length=311

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 154/234 (66%), Gaps = 18/234 (8%)
 Frame = +2

Query  233  SVRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVND  412
            S+RT+    S+      E++AATRIQ AFRAY+  RK +R L+G V+ Q      YS+  
Sbjct  44   SMRTKFIRDSAALGMSIEDLAATRIQTAFRAYR-ARKKLRLLKGIVRLQAKTRT-YSIKK  101

Query  413  QVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSET  592
            Q   TL ++HSWS IQ++I+ARRLCMVT+G L+QKKI NQ+KL+AKLHEL+VEWS G  T
Sbjct  102  QATTTLHYLHSWSNIQAQIRARRLCMVTEGHLRQKKIANQLKLEAKLHELEVEWSGGPGT  161

Query  593  MEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIA  772
            MEE+L KI Q+E AAVKRER MAYAFSHQWRA +    G   Y L K +WGWSW ERWIA
Sbjct  162  MEEVLTKIHQKEAAAVKRERTMAYAFSHQWRAPNSINNGLGSYRLAKANWGWSWVERWIA  221

Query  773  VRPWEIRV-------QADPK--------KAGKTASLGPVKLVVSVNNPPLSNGK  889
            VRPWE R+       ++ PK        K  K ++    K  VSV  PPLSN K
Sbjct  222  VRPWERRLPTPSTTPKSTPKEPQNKQTSKGSKNSNSPKPKASVSV-KPPLSNAK  274



>ref|XP_010509802.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=272

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 153/208 (74%), Gaps = 14/208 (7%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            TE+ AATRIQ AF+AYK  RK++RRL+G  + + + E  +SV +Q   TL+++HSWS+IQ
Sbjct  47   TEDWAATRIQTAFKAYK-ARKSLRRLKGIARAKLSTEK-HSVKNQAVVTLRYLHSWSKIQ  104

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            SEIKARR+CMVT+ RLK K++++Q KL+AKLH+++VEW+ GSET +EIL++I QREEA +
Sbjct  105  SEIKARRVCMVTEWRLKNKRLEHQQKLEAKLHDVEVEWNGGSETKDEILERILQREEATI  164

Query  641  KRERAMAYAFSHQWRAN-SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            KRERA+AYAFSHQW+A+    + G   Y LG  +WGWSWKERWI+ RPWE+R    PKK 
Sbjct  165  KRERALAYAFSHQWKADGKTQWLGS--YELGNTNWGWSWKERWISARPWEVRYTVTPKKP  222

Query  818  ---------GKTASLGPVKLVVSVNNPP  874
                      +T S  P K V+S+++ P
Sbjct  223  KSSKTTFCKSETNSNSPAKRVMSLSSVP  250



>ref|XP_008439774.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
 ref|XP_008439775.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
 ref|XP_008439777.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
 ref|XP_008439778.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
 ref|XP_008439779.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
Length=310

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 170/281 (60%), Gaps = 37/281 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ---------SVRTEANGGSSKNNEL---TEEIAAT  301
            MG   W++ +  LK  K   SK  +         S R + +G + K+       E++AA 
Sbjct  1    MGSGRWFKAVIRLKKVKTSSSKQTKEKLDDLQKDSPRFKNDGANGKSKSFGMPIEDVAAV  60

Query  302  RIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARR  481
            RIQ A+RAY+  RK +R L+G  + Q  +   +SV     +TL ++HSWS IQ++I+ARR
Sbjct  61   RIQTAYRAYR-ARKNLRLLKGAFRLQN-LTQGHSVRKHATSTLGYLHSWSHIQAQIRARR  118

Query  482  LCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMA  661
            LCMVT+GR +QK+++NQ KL+AKLH+++VEW  G+++M+ IL +I  REEAAVKRERA+A
Sbjct  119  LCMVTEGRQRQKRLENQRKLEAKLHDIEVEWCGGADSMDGILSRIHDREEAAVKRERALA  178

Query  662  YAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA---DPKKAG----  820
            YAFSHQWRANS   +G     LGK  WGWSWKERWIA RPWE RV +    PKK+     
Sbjct  179  YAFSHQWRANSNEMYGLGKDELGKADWGWSWKERWIAARPWESRVPSQFVSPKKSTIRQS  238

Query  821  ---------KTASLGPVKLVVSVNNPPLSNGKISTPARKPS  916
                        + GPVK       PP  NGK S  AR+ S
Sbjct  239  SKVSKRNSPSPKARGPVK-------PPSPNGKSSVKARRLS  272



>ref|XP_004134936.1| PREDICTED: protein IQ-DOMAIN 1-like [Cucumis sativus]
Length=326

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 159/253 (63%), Gaps = 28/253 (11%)
 Frame = +2

Query  248  ANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAAT  427
            ANG S   +   E++AA RIQ A+RAY+  RK +R L+G  + Q  +   +SV     +T
Sbjct  59   ANGNSKSLSMPIEDVAAVRIQTAYRAYR-ARKNLRLLKGAFRLQN-LTQGHSVRKHATST  116

Query  428  LKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEIL  607
            L ++HSWS IQ++I+ARRLCMVT+GR +QK+++NQ KL+AKLH+++VEW  G+++M+ IL
Sbjct  117  LGYLHSWSHIQAQIRARRLCMVTEGRQRQKRLENQRKLEAKLHDIEVEWCGGADSMDGIL  176

Query  608  QKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE  787
             +I  REEAAVKRERAMAYAFSHQWRANS   +G     LGK  WGWSWKERWIA RPWE
Sbjct  177  SRIHDREEAAVKRERAMAYAFSHQWRANSNEMYGLGKDELGKADWGWSWKERWIAARPWE  236

Query  788  IRVQA---DPKKAGKTAS-------------LGPVKLVVSVNNPPLSNGKISTPARK---  910
             RV +    PKK+    S              GP+K       PP  NGK S  AR+   
Sbjct  237  SRVPSQFVSPKKSTIRQSSKVSKRNSPSPKARGPMK-------PPSPNGKSSAKARRLSY  289

Query  911  PSDHNPETQTPQE  949
            P+    E    QE
Sbjct  290  PATEKAEKLATQE  302



>emb|CDO96736.1| unnamed protein product [Coffea canephora]
Length=305

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 151/205 (74%), Gaps = 10/205 (5%)
 Frame = +2

Query  248  ANGGSSKNNEL----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            AN  S KN  +    TE++AA RIQ AFR +   RK  R  +G ++ Q  ++  +SV  Q
Sbjct  49   ANDISIKNERVPCIPTEDVAAIRIQTAFRGF-MARKKFRYSKGVLRLQALLQG-HSVKKQ  106

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             ++TL ++HSWS++Q+ I+ARR+CMVT+GRL+QKK++NQ+KL+AKLH+++VEW+ GSETM
Sbjct  107  ASSTLSYLHSWSKMQAHIRARRICMVTEGRLRQKKLENQLKLEAKLHDVEVEWNGGSETM  166

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            EE+L +I QREEAA KRERAMAYAFSHQWRAN+   FG     LGK +WGWSW +RWIA 
Sbjct  167  EEVLARIHQREEAAGKRERAMAYAFSHQWRANTNPNFGWGSTELGKTNWGWSWMDRWIAA  226

Query  776  RPWEIR--VQADPKKAG--KTASLG  838
            RPWE R  VQ+ PKK+   KT+  G
Sbjct  227  RPWECRVAVQSSPKKSNGKKTSKTG  251



>gb|KHG04803.1| Protein IQ-DOMAIN 1 -like protein [Gossypium arboreum]
Length=306

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 136/180 (76%), Gaps = 5/180 (3%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E++AATRIQ AFRAY+  RK +RRL+G ++ Q A     S+  Q   TL ++HSWS IQ+
Sbjct  62   EDLAATRIQTAFRAYR-ARKQLRRLKGIIRLQ-AQTLNSSIKKQATTTLNYLHSWSNIQA  119

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARRLCMVT+G L+QKKI NQIKL+AKLH+++VEWS G ETMEEIL KI  REEAAVK
Sbjct  120  QIRARRLCMVTEGHLRQKKIANQIKLEAKLHDIEVEWSCGPETMEEILTKIHNREEAAVK  179

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD---PKK  814
            RER MAYAFSHQWRA + +  G   Y L K +WGWSW ERWIAVRPWE R+ A    PKK
Sbjct  180  RERTMAYAFSHQWRAPNSNNNGIGNYELAKANWGWSWVERWIAVRPWESRLPAQSITPKK  239



>ref|XP_011096410.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Sesamum indicum]
 ref|XP_011096411.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Sesamum indicum]
Length=311

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 152/228 (67%), Gaps = 8/228 (4%)
 Frame = +2

Query  248  ANGGSSKNN----ELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            ANG S  N        E+ AAT+IQ A+RAY   RK  R +RG V+ Q  ++   SV  Q
Sbjct  50   ANGASVDNQGRLGRSLEDAAATQIQTAYRAY-LARKTFRHMRGMVRLQNMVQRD-SVMKQ  107

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             + TL  +HSWSRIQ++I+ARR+ MV +GRL+QKK++NQ+KL+AKLH+L+VEWS GSET+
Sbjct  108  ASTTLSRLHSWSRIQAQIRARRVHMVLEGRLRQKKLENQLKLEAKLHDLEVEWSGGSETI  167

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            +E L +I QRE AAVKRERAMAYAFSHQWRANS   FG     L K +WGWSWK+RWIA 
Sbjct  168  DEALARIHQREAAAVKRERAMAYAFSHQWRANSNPSFGSGNEELSKANWGWSWKDRWIAA  227

Query  776  RPWEIRVQA--DPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKP  913
            RPWE RV A   PKKA    +    K + S  +      K+ +P  KP
Sbjct  228  RPWESRVAASESPKKAQSRQANKTTKTMFSPTSKAPDKVKLISPTGKP  275



>ref|XP_006295584.1| hypothetical protein CARUB_v10024692mg, partial [Capsella rubella]
 gb|EOA28482.1| hypothetical protein CARUB_v10024692mg, partial [Capsella rubella]
Length=328

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 156/222 (70%), Gaps = 22/222 (10%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            TE+ AATRIQ AF+AYK  RK +RRL+G  + + + E  +SV +Q   TL+++HSWS+IQ
Sbjct  104  TEDWAATRIQTAFKAYK-ARKILRRLKGIARAKLSTEK-HSVKNQAVVTLRYLHSWSKIQ  161

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            SEIKARR+CMVT+ RLK K++++Q KL+AKLH+++VEW+ GSET +EIL++I QREEA +
Sbjct  162  SEIKARRVCMVTEWRLKNKRLEHQQKLEAKLHDVEVEWNGGSETKDEILERILQREEATI  221

Query  641  KRERAMAYAFSHQWRANS-GHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            KRERA+AYAFSHQW+A+    + G   Y LG  +WGWSWKERWI+ RPWE+R    PKK 
Sbjct  222  KRERALAYAFSHQWKADGKTQWLGS--YELGNTNWGWSWKERWISARPWEVRYSVTPKKP  279

Query  818  --------GKTASLGPVKLVVSVNNPPLSNGKISTPARKPSD  919
                     +T S  P K V+S++         S PA+ PS 
Sbjct  280  KSLKTLCKSETNSNSPAKRVMSLS---------SVPAKAPSS  312



>gb|KHN30995.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=302

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 138/187 (74%), Gaps = 8/187 (4%)
 Frame = +2

Query  248  ANGGSSKNNEL----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            ANG  SKN E      E IAATRIQ AFRAYK  RK + RLRG  K +   + + SV  Q
Sbjct  50   ANGIKSKNLESDGVSVETIAATRIQTAFRAYK-ARKYLHRLRGFTKLKIQTQGS-SVQKQ  107

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             A T+ ++HSWS+IQ+EI+ARR+CMVT+ R+++K I +Q+KL++K+H+L+VEW  GSET 
Sbjct  108  AATTITYLHSWSKIQAEIRARRICMVTEDRIRRKIIHSQLKLESKIHDLEVEWCGGSETK  167

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            +EIL ++  REEAAVKRER MAYAFSHQWRANS    G   Y+LGK SW WSWK+RWIA 
Sbjct  168  KEILARLHHREEAAVKRERTMAYAFSHQWRANSSQGLGN--YDLGKASWSWSWKDRWIAT  225

Query  776  RPWEIRV  796
            RPWE RV
Sbjct  226  RPWESRV  232



>ref|XP_011096412.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Sesamum indicum]
Length=278

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 147/212 (69%), Gaps = 4/212 (2%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E+ AAT+IQ A+RAY   RK  R +RG V+ Q  ++   SV  Q + TL  +HSWSRIQ+
Sbjct  33   EDAAATQIQTAYRAY-LARKTFRHMRGMVRLQNMVQRD-SVMKQASTTLSRLHSWSRIQA  90

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR+ MV +GRL+QKK++NQ+KL+AKLH+L+VEWS GSET++E L +I QRE AAVK
Sbjct  91   QIRARRVHMVLEGRLRQKKLENQLKLEAKLHDLEVEWSGGSETIDEALARIHQREAAAVK  150

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA--DPKKA  817
            RERAMAYAFSHQWRANS   FG     L K +WGWSWK+RWIA RPWE RV A   PKKA
Sbjct  151  RERAMAYAFSHQWRANSNPSFGSGNEELSKANWGWSWKDRWIAARPWESRVAASESPKKA  210

Query  818  GKTASLGPVKLVVSVNNPPLSNGKISTPARKP  913
                +    K + S  +      K+ +P  KP
Sbjct  211  QSRQANKTTKTMFSPTSKAPDKVKLISPTGKP  242



>ref|XP_002881318.1| IQ-domain 9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57577.1| IQ-domain 9 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 149/200 (75%), Gaps = 10/200 (5%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E+ AATRIQ AF+AYK  RK++RRL+G  + + + E  +SV +Q   TL+++HSWS+IQ
Sbjct  50   SEDWAATRIQTAFKAYK-ARKSLRRLKGIARAKLSTEK-HSVKNQAVVTLRYLHSWSKIQ  107

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            SEIKARR+CMVT+ RLK K++++Q KL+AKLH+++VEW+ GSET +EIL++I QREEA +
Sbjct  108  SEIKARRVCMVTEWRLKNKRLEHQQKLEAKLHDVEVEWNGGSETKDEILERILQREEATI  167

Query  641  KRERAMAYAFSHQWRAN-SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            KRERA+AYAFSHQW+A+    + G   Y LG  +WGWSWKERWI+ RPWE+R    PKK 
Sbjct  168  KRERALAYAFSHQWKADGKTQWLGS--YELGNTNWGWSWKERWISARPWEVRYSVTPKKP  225

Query  818  GKTASL-----GPVKLVVSV  862
              + ++      P K  VS+
Sbjct  226  KSSKTVYSNSNSPAKRTVSL  245



>ref|XP_006655806.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Oryza brachyantha]
 ref|XP_006655807.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Oryza brachyantha]
Length=369

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 146/217 (67%), Gaps = 14/217 (6%)
 Frame = +2

Query  209  NGPSKWLQSVRTEANGGSS----KNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKF  376
            NGP+    SV  ++NG SS    ++N   EE AATRIQ AFR YK  RK +R L+G  + 
Sbjct  32   NGPN----SVNQKSNGPSSSSDPEDNAALEEWAATRIQNAFRCYK-ARKTLRCLKGVRRL  86

Query  377  QGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLH  556
               I     VN Q A TL +I SW+++Q+EI+ RR  MVT+GR ++KK +NQ+KL+AKLH
Sbjct  87   H-IIGQTNPVNKQTATTLNYIQSWNKLQAEIRNRRAFMVTEGRNRKKKQENQMKLEAKLH  145

Query  557  ELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKE  736
             LQVEW+ GS+TMEEIL +IQQREEAAVKRERAMAYAF+HQWRA S    G   Y +GK 
Sbjct  146  NLQVEWNGGSDTMEEILGRIQQREEAAVKRERAMAYAFNHQWRARSATSLGSFNYEVGKG  205

Query  737  SWGWSWKERWIAVRPWEIRVQADPKKAGKTASLGPVK  847
             WGWSW +RWIA RPWE R    P+   K    GP K
Sbjct  206  GWGWSWMDRWIAARPWEPRSMVHPENPKK----GPAK  238



>ref|XP_006410544.1| hypothetical protein EUTSA_v10017065mg [Eutrema salsugineum]
 gb|ESQ51997.1| hypothetical protein EUTSA_v10017065mg [Eutrema salsugineum]
Length=273

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 144/202 (71%), Gaps = 12/202 (6%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E+ AATRIQ AF+AYK  RK +RRL+G  + +   E  +SV  Q   TL+++HSWS IQ
Sbjct  50   SEDWAATRIQAAFKAYK-ARKILRRLQGIARARLLTEK-HSVKKQAVVTLRYLHSWSNIQ  107

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            S+IKARR+CMVT+ RL  K+++NQ KL+AKLH+++VEW+ GSET EEIL++I QREEA +
Sbjct  108  SQIKARRVCMVTESRLLHKRLENQQKLEAKLHDIEVEWNGGSETKEEILERIHQREEATI  167

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA-  817
            KRERA+AYAFSHQW+A+ G       Y LG  +WGWSWKERWIA RPWE+R    PKK  
Sbjct  168  KRERALAYAFSHQWKAD-GKTQWLGGYELGNTNWGWSWKERWIAARPWEVRYSVTPKKPK  226

Query  818  --------GKTASLGPVKLVVS  859
                    G+T S  P K VVS
Sbjct  227  SSKTVCCKGETKSNSPGKRVVS  248



>ref|XP_008784249.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Phoenix dactylifera]
Length=315

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 167/271 (62%), Gaps = 27/271 (10%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGG-------SSKNNEL--------TEEI  292
            MG   W++ I   K  K   SK ++    + + G         K+ +L         E++
Sbjct  1    MGSGDWFKTIICRKKTKQDQSKQVKGTSCQQSNGFKWRNQSHRKSKKLYNGCGSMSIEDL  60

Query  293  AATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIK  472
            AA +IQ AFR ++  RK +R L+GT + Q  +   +SV  Q ++TL +I SWS+IQ++I 
Sbjct  61   AAIQIQTAFRGFR-ARKNLRSLKGTERLQ-VLAQGHSVKKQTSSTLSYIQSWSKIQAQIG  118

Query  473  ARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRER  652
            ARR+CMVT+GR++QKK  NQ+KL+AK+H+L+VEW  GSETMEEIL +IQQREEAA+KRER
Sbjct  119  ARRICMVTEGRIRQKKQDNQLKLEAKIHDLEVEWCGGSETMEEILARIQQREEAAIKRER  178

Query  653  AMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV------QADPK-  811
            AMAYAFSHQWRAN G   G   Y  GK +W WSW +RWIA RPWE R+      QA  K 
Sbjct  179  AMAYAFSHQWRANPGLNQGPFVYECGKGNWRWSWMDRWIAGRPWETRLPTVIPKQAQTKA  238

Query  812  --KAGKTASLGPVKLVVSVNNPPLSNGKIST  898
              K GK  +        SV  P  ++GK ST
Sbjct  239  TSKVGKNTNPSAETASDSV-KPAATDGKGST  268



>ref|XP_009802744.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana sylvestris]
Length=303

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 147/204 (72%), Gaps = 8/204 (4%)
 Frame = +2

Query  248  ANGGSSKNNE----LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            ++G S +NN       E+ AAT+IQ AFRAY   RK +R L+   + Q   +++ SV  Q
Sbjct  44   SSGTSIRNNREPGMALEDKAATKIQAAFRAY-VARKTLRCLKRISRLQSMTQSS-SVKKQ  101

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             +ATL ++HSW+RIQ+EI+ARR+ MV +GRLKQKK++NQ+KL+AKLH ++VEWS G ETM
Sbjct  102  ASATLNNLHSWNRIQTEIRARRISMVIEGRLKQKKLENQLKLEAKLHNVEVEWSGGPETM  161

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            E +L +I QREEAAVKRER MAYAFSHQWRANS   FG + +++ K +WGWSW +RWIA 
Sbjct  162  EVVLARIHQREEAAVKRERTMAYAFSHQWRANSNPIFGSSNHDISKANWGWSWTDRWIAA  221

Query  776  RPWE--IRVQADPKKAGKTASLGP  841
            RPWE  I V + PK A + A   P
Sbjct  222  RPWESRITVPSTPKMAKRIARKTP  245



>ref|XP_007133164.1| hypothetical protein PHAVU_011G157000g [Phaseolus vulgaris]
 gb|ESW05158.1| hypothetical protein PHAVU_011G157000g [Phaseolus vulgaris]
Length=298

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 165/285 (58%), Gaps = 48/285 (17%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKW--LQSVRTEANGGSSKN--------------------  271
            M  + W+R I  LK RK   S+   +QS   ++N  S +                     
Sbjct  1    MSPKKWFRTILRLKKRKEDKSEQAKVQSTPEKSNESSEEKQEETHEESNSIPSEGLVLQE  60

Query  272  ----NELTEEIAATRIQRAFRAYKQGRKAIRRLRGTV--------KFQGAIEAAYSVNDQ  415
                    ++IAATRIQ AFRA    R+ +  LR T           +GA++   ++ D 
Sbjct  61   RALPTRFIQDIAATRIQNAFRAL-LARRTLHHLRDTALDYTIIIAPSKGAVKLEATIQDH  119

Query  416  VA-----ATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSS  580
            +A       L +IH WSR+Q +IKARRL M+++ R+KQKK++NQ+KL AK+HELQ EW  
Sbjct  120  MAKEQTVTALNYIHLWSRMQEQIKARRLHMLSEARIKQKKLENQLKLAAKIHELQEEWCG  179

Query  581  GSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKE  760
            GS+TMEEI+ +I QREEAA KRERAMAYAFSHQWR N   Y GQA Y+LGKE WGWSWKE
Sbjct  180  GSDTMEEIVSRIHQREEAAFKRERAMAYAFSHQWRPNCRQYLGQAIYSLGKEGWGWSWKE  239

Query  761  RWIAVRPWEIRV--QADPKKAGKTASLGPVKLVVSVNNPPLSNGK  889
            RW+A RPWEIRV   ADP     + S  P      ++N  LSN +
Sbjct  240  RWVAARPWEIRVGFAADPMTKKSSDSKVP------LSNSELSNTR  278



>gb|EYU28055.1| hypothetical protein MIMGU_mgv1a010650mg [Erythranthe guttata]
Length=306

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 153/226 (68%), Gaps = 12/226 (5%)
 Frame = +2

Query  248  ANGGSS-KNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAA  424
            +NG S+ +     E+ AA  IQ A+RAY   R   RR+RGTV+ Q  ++   S+  Q   
Sbjct  50   SNGASAVRRRPSIEDAAAITIQTAYRAY-SARGIFRRMRGTVRLQNLVQCD-SIKKQALT  107

Query  425  TLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEI  604
            TL H+HSWSR QS+I+ RR+ MVT+GR++QKK+++Q+KL+AKLH+L+VEWS GSET  + 
Sbjct  108  TLSHLHSWSRTQSQIRERRVHMVTEGRIRQKKLESQLKLEAKLHDLEVEWSGGSETFGQA  167

Query  605  LQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPW  784
            L KI QREEA+V+RERAMAYAFSHQWRANS   FG   + + K +WGWSW +RWIA RPW
Sbjct  168  LAKIHQREEASVRRERAMAYAFSHQWRANSNPSFGSGNHEISKANWGWSWMDRWIAARPW  227

Query  785  EIRV--QADPKKA--GKTASLGPVKLVVSVNNPPLSNGKISTPARK  910
            E R+  Q  PKKA  GK     P+K ++S      +  K+ +P  K
Sbjct  228  ESRIAAQESPKKAQIGK-----PIKKMISPKCKSAAKVKLVSPTGK  268



>ref|XP_009803285.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana sylvestris]
Length=308

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 174/286 (61%), Gaps = 35/286 (12%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ--SVRTEANGGSSKN------------------NE  277
            MG   W + + G++  K+G SK L+  S   ++NG    +                   E
Sbjct  1    MGSADWLKNVIGMRKSKDGKSKKLKGTSAIKKSNGCKGDDPLQKEPSKITNGVLIKNQRE  60

Query  278  L---TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            L    ++ AA +IQ AFRAY   RK++RRL+G  + Q ++    SV  Q ++ L +IHSW
Sbjct  61   LGMPIDDRAAIKIQTAFRAY-VARKSLRRLKGNARLQ-SLTQRPSVKKQASSALNYIHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +R+Q+EI  RR+ MVT+GRL++KK++NQ+KL+AKL  L+VEWS G ETME IL +I QRE
Sbjct  119  NRMQTEIIDRRVRMVTEGRLERKKLENQLKLEAKLQNLEVEWSGGPETMEVILARIHQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR--VQA  802
            EAA KRERAMAYAFSHQWRANS   FG   + + K +WGWSW +RW+A RPWE R  V  
Sbjct  179  EAATKRERAMAYAFSHQWRANSSPVFGSGNHEMSKANWGWSWTDRWVAARPWESRVPVHT  238

Query  803  DPKKAGKTA-------SLGPVKLVVSVNNPPLSNGKISTPARKPSD  919
             PKK    A       +    K  +SV +  L NGK++  A+KP++
Sbjct  239  SPKKVNGKASKTTKSSTTPTKKTPISVKS-SLPNGKVTVKAKKPNE  283



>ref|XP_004964808.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Setaria italica]
 ref|XP_004964809.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Setaria italica]
Length=342

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/255 (49%), Positives = 157/255 (62%), Gaps = 15/255 (6%)
 Frame = +2

Query  209  NGPSKWLQSVRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAI  388
            NG S+  Q     ++    ++N   EE AATRIQ AFR YK  RK +R LRG  + +  +
Sbjct  32   NGGSQTNQKSNGPSSSSDHEDNAALEEWAATRIQNAFRKYK-ARKTLRCLRGIKRLR-VV  89

Query  389  EAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQV  568
              A  V  Q AATL +I SW+++QSEI+ RR  MVT+GR ++KK +NQ+KL+AKLH LQV
Sbjct  90   GQANPVKKQTAATLSYIQSWNKLQSEIRNRRAFMVTEGRNRKKKQENQMKLEAKLHNLQV  149

Query  569  EWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGW  748
            EW+ GS+TM+EIL +IQQREEAAVKRERAMAYAF+HQWRA S    G   Y +GK  WGW
Sbjct  150  EWNGGSDTMDEILARIQQREEAAVKRERAMAYAFNHQWRARSATSLGNFSYEVGKGGWGW  209

Query  749  SWKERWIAVRPWEIRVQADP--------KKAGKTASLGPVKLVVSVNNPPLSN--GKIST  898
            SW +RWIA RPWE R    P        KK     +   +KL  S+    LSN       
Sbjct  210  SWMDRWIAARPWEPRSLVHPENPKKAQAKKDNSNTNPSALKLQGSIT---LSNNVNDRKA  266

Query  899  PARKPSDHNPETQTP  943
            P +KPS    + + P
Sbjct  267  PKKKPSPLTADQKKP  281



>ref|XP_008783926.1| PREDICTED: protein IQ-DOMAIN 1 [Phoenix dactylifera]
 ref|XP_008783927.1| PREDICTED: protein IQ-DOMAIN 1 [Phoenix dactylifera]
Length=339

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 164/280 (59%), Gaps = 36/280 (13%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEA------------------NGGSSKNNEL-  280
            MG   W++ I G K  K   SK ++   +E                   NG SS   +  
Sbjct  16   MGSGYWFKTIIGRKKTKKDQSKQVKGNSSEQSNGFKLRNQSHRKSHKLYNGASSGKTDYG  75

Query  281  ---TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWS  451
                E+ AA RIQ AFR ++  RK +R L+G  + Q  +   +SV  Q + TL ++ SW 
Sbjct  76   SVRIEDSAAIRIQTAFRGFR-ARKKLRSLKGIQRLQ-VLAQGHSVKQQASTTLSYLQSWG  133

Query  452  RIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREE  631
            +IQ++I+ARR+CMVT+GR++QKK  NQ+KL+AKLH+L+VEW  GSETMEEI+ +IQQREE
Sbjct  134  KIQAQIRARRICMVTEGRIRQKKQDNQLKLEAKLHDLEVEWCGGSETMEEIIARIQQREE  193

Query  632  AAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV---QA  802
            AA+KRER +AYAFSHQWRAN G   G   Y  GK +WGWSW +RWIA RPWE R+     
Sbjct  194  AAIKRERTLAYAFSHQWRANPGLNQGPFVYECGKGNWGWSWMDRWIAARPWETRLPTRSV  253

Query  803  DPK--------KAGKTASLGPVKLVVSVNNPPLSNGKIST  898
             PK        K G        K+  SV  P  ++GK ST
Sbjct  254  IPKKEQTKATSKVGNDTDPSAQKVSESV-KPAAADGKGST  292



>ref|XP_009143817.1| PREDICTED: protein IQ-DOMAIN 1-like [Brassica rapa]
 ref|XP_009143818.1| PREDICTED: protein IQ-DOMAIN 1-like [Brassica rapa]
Length=265

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 147/218 (67%), Gaps = 12/218 (6%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E+ AATRIQ AFRAYK  RK +RRL+G  + +   E  + V  Q A TLK++HSWS+IQ
Sbjct  45   SEDWAATRIQSAFRAYK-ARKMLRRLKGIARAKELTEK-HPVKKQAAVTLKYLHSWSKIQ  102

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            S+IKARR+ MV + RL  K+++NQ KL+AKLH+++VEW+ G+ET +EIL +I QREEA +
Sbjct  103  SQIKARRVGMVMESRLMHKRLENQQKLEAKLHDVEVEWNGGAETKDEILGRIHQREEATI  162

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA-  817
            KRERA+AYAFSHQW+A  G       Y LG  +WGWSWKERWIAVRPWE+R    PKK  
Sbjct  163  KRERALAYAFSHQWKAE-GKTQWLGGYELGNTNWGWSWKERWIAVRPWEVRYSLTPKKPK  221

Query  818  --------GKTASLGPVKLVVSVNNPPLSNGKISTPAR  907
                     +T S  P K V SV+    S+G    P R
Sbjct  222  SLKTVCCKSETKSNSPAKRVSSVSAKAPSSGAAVKPRR  259



>gb|AAB67617.1| putative SF16 protein {Helianthus annuus} [Arabidopsis thaliana]
Length=249

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 145/200 (73%), Gaps = 19/200 (10%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E+ AATRIQ AF+AYK  RK++RRL+G  + + + E   SV +Q   TL+++HSWS+IQ
Sbjct  45   SEDWAATRIQTAFKAYK-ARKSLRRLKGIARAKLSTEK-QSVKNQAVVTLRYLHSWSKIQ  102

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            SEIKARR+CMVT+ RLK K++++Q KL+AKLH+++VEW+ GSET +EIL++I QREEA +
Sbjct  103  SEIKARRVCMVTEWRLKNKRLEHQQKLEAKLHDVEVEWNGGSETKDEILERILQREEATI  162

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPK--K  814
            KRERA+AYAFSHQ               LG  +WGWSWKERWI+ RPWE+R    PK  K
Sbjct  163  KRERALAYAFSHQ---------------LGNTNWGWSWKERWISARPWEVRYSVTPKKPK  207

Query  815  AGKTASLGPVKLVVSVNNPP  874
            + KT S  P K  VS+++ P
Sbjct  208  SSKTDSNSPAKRTVSLSSVP  227



>ref|XP_009618388.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana tomentosiformis]
 ref|XP_009618389.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana tomentosiformis]
Length=304

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 147/204 (72%), Gaps = 8/204 (4%)
 Frame = +2

Query  248  ANGGSSKNN-EL---TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            ++G S KN+ EL    E+ AAT+IQ AFRAY   RK +R L+   + Q   + + SV  Q
Sbjct  45   SSGASIKNHRELEMPLEDKAATKIQTAFRAY-VARKTLRCLKRIARLQSMTQGS-SVKKQ  102

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             +ATL ++ SW+RIQ+EI+ARR+ MV +GRLKQKK++NQ+KL+AKLH ++VEWS G ETM
Sbjct  103  ASATLSNLQSWNRIQTEIRARRVSMVIEGRLKQKKVENQLKLEAKLHNVEVEWSCGPETM  162

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            E +L +I QREEAAVKRER MAYAFSHQWRANS   F  + +++ K +WGWSW +RWIA 
Sbjct  163  EVVLARIHQREEAAVKRERTMAYAFSHQWRANSNPIFRSSNHDISKANWGWSWTDRWIAA  222

Query  776  RPWEIR--VQADPKKAGKTASLGP  841
            RPWE R  VQ+ P+ + K A   P
Sbjct  223  RPWECRIPVQSTPRMSNKVARKTP  246



>gb|EEC80043.1| hypothetical protein OsI_21733 [Oryza sativa Indica Group]
Length=334

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 146/222 (66%), Gaps = 13/222 (6%)
 Frame = +2

Query  173  WYRKITGLKTRKNGPSKWLQSVRTEANGGSS-----KNNELTEEIAATRIQRAFRAYKQG  337
            W  K+ G     NGP+    S   ++N G S     ++N   EE AATRIQ AFR YK  
Sbjct  3    WSVKVAG--QVPNGPN----STNQKSNNGPSSSSDPEDNAALEEWAATRIQNAFRCYK-A  55

Query  338  RKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqk  517
            +K +R L+G VK    I     VN Q AATL +I SW+++Q+EI+ RR  MVT+GR ++K
Sbjct  56   KKTLRCLKG-VKRLHIIGQTNPVNKQTAATLNYIQSWNKLQAEIRNRRAFMVTEGRNRKK  114

Query  518  kiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSG  697
            K +NQ+KL+AKL  LQVEW+ GS+TMEEIL +IQQREEAAVKRERAMAYAF+HQWRA S 
Sbjct  115  KQENQMKLEAKLQNLQVEWNGGSDTMEEILGRIQQREEAAVKRERAMAYAFNHQWRARSA  174

Query  698  HYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
               G   Y +GK  WGWSW +RWIA RPWE R    P+   K
Sbjct  175  TSLGNFNYEVGKGGWGWSWMDRWIAARPWEPRSLVHPENLKK  216



>ref|XP_009389986.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 159/256 (62%), Gaps = 17/256 (7%)
 Frame = +2

Query  194  LKTRK-NGPSKWLQSVRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTV  370
            LK+R  N P+K L       NG S       E IAA RIQ AFR +K  RK +  LR T 
Sbjct  32   LKSRSHNDPNKLLNGA---LNGNSQDCGMTIEIIAAIRIQTAFRGFK-ARKTLGSLRRTQ  87

Query  371  KFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAK  550
            K Q A     SV  Q   TL H+H+WS+IQ+EI+ARR  MV +GR++QKK  NQ+KL+AK
Sbjct  88   KLQ-AFTYHNSVKKQTTNTLIHVHAWSKIQAEIRARRANMVAEGRIRQKKHDNQLKLEAK  146

Query  551  LHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLG  730
            LH+L+V+W+ GSET EEI+ +IQQREEAAVKRERAMAYAFSHQWRANSG   G   + L 
Sbjct  147  LHDLEVDWNGGSETKEEIIARIQQREEAAVKRERAMAYAFSHQWRANSGMNQGPFVFELA  206

Query  731  KESWGWSWKERWIAVRPWEIRVQADPK---KAGKTASLGPVKLVVSVNNPPLSNGKISTP  901
            K +W WSW ++WIA +PWE R     K   + GK A     KL  SV +  +   +    
Sbjct  207  KGNWEWSWVDKWIAAQPWETRPSTLTKVVNRVGKGA-----KLPSSVKHASIDGKEF---  258

Query  902  ARKPSDHNPETQTPQE  949
            A+KPS  + E  T QE
Sbjct  259  AKKPSKQSDEETTNQE  274



>ref|XP_010549376.1| PREDICTED: protein IQ-DOMAIN 1 [Tarenaya hassleriana]
 ref|XP_010549377.1| PREDICTED: protein IQ-DOMAIN 1 [Tarenaya hassleriana]
 ref|XP_010549378.1| PREDICTED: protein IQ-DOMAIN 1 [Tarenaya hassleriana]
 ref|XP_010549379.1| PREDICTED: protein IQ-DOMAIN 1 [Tarenaya hassleriana]
Length=297

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 158/237 (67%), Gaps = 20/237 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E++AATRIQ AFRAYK  RKA+R L+G  + +   E  Y V  Q A TL+++HSWS+IQS
Sbjct  62   EDLAATRIQTAFRAYK-ARKALRHLKGIARAKLLAEKHY-VKKQAAVTLRYLHSWSQIQS  119

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            ++KARR+CMVT+ RLKQK I+NQ KL+AKLH+++VEW+ G++T EEIL +I QREEAAVK
Sbjct  120  QVKARRICMVTEDRLKQKNIENQQKLEAKLHDVEVEWNGGTDTKEEILGRIHQREEAAVK  179

Query  644  RERAMAYAFSHQWRANS-GHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA---DPK  811
            RERA+AYAF+HQWR +    + G   Y LG  SWGWSWKERWI  RPWE R  +    PK
Sbjct  180  RERALAYAFTHQWRVDGRTQWLGN--YELGNTSWGWSWKERWIGSRPWETRHPSPSITPK  237

Query  812  K--AGKTASLG------PVKLVVSVNN-PPLSNGKISTPARK---PSDHNPETQTPQ  946
            K  +GK A         P    +SV++   + NGK +   R+   P    P T+  Q
Sbjct  238  KPQSGKPACKNDKNGKSPSMKSLSVSDKASVPNGKTAAKGRRLSFPGAEKPATREVQ  294



>ref|NP_001149799.1| LOC100283426 [Zea mays]
 gb|ACG36845.1| calmodulin binding protein [Zea mays]
Length=335

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 153/240 (64%), Gaps = 20/240 (8%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            +N   EE AATRIQ AFR YK  RK +R L+G  + +  +  A  V  Q AATL +I SW
Sbjct  53   DNAALEEWAATRIQNAFRKYK-ARKTLRCLKGVKRLR-VVGQANPVKKQTAATLSYIQSW  110

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++QSEI+ RR  MVT+GR ++KK +NQ+KL+AKLH LQ+EW+ GS+TM+EIL +IQQRE
Sbjct  111  NKLQSEIRNRRAFMVTEGRNRKKKQENQMKLEAKLHNLQIEWNGGSDTMDEILARIQQRE  170

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA--  802
            EAAVKRERAMAYAF+HQWRA S    G   Y +GK  WGWSW +RWIA RPWE R     
Sbjct  171  EAAVKRERAMAYAFNHQWRARSATSLGNFSYEVGKGGWGWSWMDRWIAARPWEPRSMVHP  230

Query  803  -DPKKAG----KTASLGPVKLVVSVNNPPLSNG--------KISTPARKPSDHNPETQTP  943
             +PKKA      T +   +KL  S+    LSN         K   P+  P+D    + +P
Sbjct  231  ENPKKAQAKKENTTNPSALKLQGSIT---LSNNINDRKTLKKKPLPSASPADQKKPSPSP  287



>ref|XP_006852506.1| hypothetical protein AMTR_s00021p00158910 [Amborella trichopoda]
 gb|ERN13973.1| hypothetical protein AMTR_s00021p00158910 [Amborella trichopoda]
Length=318

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +2

Query  272  NELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWS  451
            ++  +E AA  IQ AFRAY   RK + R++G V+FQ  +   Y+V  Q   TL ++  W+
Sbjct  64   DDSIKEKAAIIIQTAFRAY-LARKTLHRMKGIVRFQ-LLAQGYTVQRQAPITLGYLKLWN  121

Query  452  RIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREE  631
            ++QS ++ RR CMVT+GRL++KK  N +KL+AKLHEL+VEW +GSETMEEIL +++QREE
Sbjct  122  KVQSHVRERRECMVTEGRLRRKKHDNMLKLEAKLHELEVEWCNGSETMEEILARLRQREE  181

Query  632  AAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPK  811
            AAVKRERAMAYAFSHQWRANS     Q  Y LGK +WGWSW ERWIAVRPWE R+    K
Sbjct  182  AAVKRERAMAYAFSHQWRANSRPNQFQVGYELGKPNWGWSWMERWIAVRPWESRITVSKK  241



>emb|CDY27925.1| BnaCnng05100D [Brassica napus]
Length=265

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 147/218 (67%), Gaps = 12/218 (6%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E+ AATRIQ AFRAYK  RK +RRL+G  + +   E  + V  Q A TLK++HSWS+IQ
Sbjct  45   SEDWAATRIQSAFRAYK-ARKMLRRLKGIARAKELTEK-HPVKKQAAVTLKYLHSWSKIQ  102

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            S+IKARR+ MV + RL  K+++NQ KL+AKLH+++VEW+ G+ET +EIL +I QREEA +
Sbjct  103  SQIKARRVGMVMESRLMHKRLENQQKLEAKLHDIEVEWNGGAETKDEILGRIHQREEATI  162

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA-  817
            KRERA+AYAF+HQW+A  G       Y LG  +WGWSWKERWIAVRPWE+R    PKK  
Sbjct  163  KRERALAYAFAHQWKAE-GKTQWLGGYELGNTNWGWSWKERWIAVRPWEVRHSLTPKKPR  221

Query  818  --------GKTASLGPVKLVVSVNNPPLSNGKISTPAR  907
                     +T S  P K V SV+    ++G    P R
Sbjct  222  SLKTVCCKSETKSNSPAKRVTSVSAKAPASGAAVKPRR  259



>ref|XP_010060656.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Eucalyptus grandis]
 gb|KCW67455.1| hypothetical protein EUGRSUZ_F01203 [Eucalyptus grandis]
Length=267

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 153/241 (63%), Gaps = 19/241 (8%)
 Frame = +2

Query  149  STYMGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNN---------ELTEEIAAT  301
            ST MG    +R    LK  K G S+  +     A    SK +         +  E+ AAT
Sbjct  17   STLMGPGNCFR---SLKKAKEGTSRQAKVEVCAAKSNGSKQDSQRKSGIPRKRVEDTAAT  73

Query  302  RIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARR  481
            RIQ AFRA+   R+ + RLR  V+FQ ++     V +QV+  L ++HSWSRIQ+EI+ARR
Sbjct  74   RIQAAFRAF-LARRTLYRLRCAVRFQ-SLTHGLPVTEQVSTALSYLHSWSRIQTEIRARR  131

Query  482  LCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMA  661
            + MVT+ R++QK++++Q+K +AKL +L++EW  G  T E+IL KIQQRE AA KRER +A
Sbjct  132  INMVTEARMRQKRLEDQLKFEAKLQKLELEWCGGPGTKEDILAKIQQREAAAAKRERTLA  191

Query  662  YAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA-----DPKKAGKT  826
            YAFSHQWRANS HY  +  Y L KE WGWSW E WIA RPWEIR Q+       K+ GK+
Sbjct  192  YAFSHQWRANSSHYLSRPSYCLVKECWGWSWLEHWIATRPWEIRPQSYSTEMTAKQLGKS  251

Query  827  A  829
            A
Sbjct  252  A  252



>emb|CDY17214.1| BnaA05g09740D [Brassica napus]
Length=265

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 146/219 (67%), Gaps = 14/219 (6%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
             E+ AATRIQ AFRAYK  RK +RRL+G  + +   E  + V  Q A TLK++HSWS IQ
Sbjct  45   CEDWAATRIQSAFRAYK-ARKMLRRLKGIARAKELTEK-HPVKKQAAVTLKYLHSWSNIQ  102

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            S+IKARR+ MV + RL  K+++NQ KL+AKLH+++VEW+ G+ET +EIL +I QREEA +
Sbjct  103  SQIKARRVGMVMESRLMHKRLENQQKLEAKLHDVEVEWNGGAETKDEILGRIHQREEATI  162

Query  641  KRERAMAYAFSHQWRANS-GHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            KRERA+AYAFSHQW+A     + G   Y LG  +WGWSWKERWIAVRPWE+R    PKK 
Sbjct  163  KRERALAYAFSHQWKAEGKTQWLGG--YELGNTNWGWSWKERWIAVRPWEVRYSLTPKKP  220

Query  818  ---------GKTASLGPVKLVVSVNNPPLSNGKISTPAR  907
                      +T S  P K V SV+    ++G    P R
Sbjct  221  KSLKTVCCKSETKSNSPAKRVSSVSAKAPASGAAVKPRR  259



>ref|XP_004137215.1| PREDICTED: protein IQ-DOMAIN 1-like [Cucumis sativus]
 gb|KGN53600.1| hypothetical protein Csa_4G088730 [Cucumis sativus]
Length=261

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 132/176 (75%), Gaps = 5/176 (3%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E++AATRIQ AFR +   RK I   +   + Q  ++   +   QV++    IHSWSR+Q
Sbjct  41   SEDLAATRIQNAFRTF-TARKDIHNSKVPERCQDLVQGE-TATKQVSS---FIHSWSRMQ  95

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
             EI+ARRLCMVT+ R+KQKK++NQ+KL+AK+HEL+ EWS GSET EEIL KIQQREEAAV
Sbjct  96   QEIRARRLCMVTEYRVKQKKLENQLKLEAKIHELEAEWSGGSETKEEILFKIQQREEAAV  155

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP  808
            +RERAMAYAFSHQWRANS      A Y+L KE+WGWSWKERWIA RPWEIR    P
Sbjct  156  RRERAMAYAFSHQWRANSILDLSPASYSLDKENWGWSWKERWIAARPWEIRANTHP  211



>ref|NP_001056849.1| Os06g0155300 [Oryza sativa Japonica Group]
 dbj|BAD69409.1| SF16 protein-like [Oryza sativa Japonica Group]
 dbj|BAD69297.1| SF16 protein-like [Oryza sativa Japonica Group]
 dbj|BAF18763.1| Os06g0155300 [Oryza sativa Japonica Group]
 gb|EAZ35875.1| hypothetical protein OsJ_20175 [Oryza sativa Japonica Group]
 dbj|BAG94140.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 142/210 (68%), Gaps = 11/210 (5%)
 Frame = +2

Query  209  NGPSKWLQSVRTEANGGSS-----KNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVK  373
            NGP+    S   ++N G S     ++N   EE AATRIQ AFR YK  +K +R L+G VK
Sbjct  32   NGPN----STNQKSNNGPSSSSDPEDNAALEEWAATRIQNAFRCYK-AKKTLRCLKG-VK  85

Query  374  FQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKL  553
                I     VN Q AATL +I SW+++Q+EI+ RR  MVT+GR ++KK +NQ+KL+AKL
Sbjct  86   RLHIIGQTNPVNKQTAATLNYIQSWNKLQAEIRNRRAFMVTEGRNRKKKQENQMKLEAKL  145

Query  554  HELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGK  733
              LQVEW+ GS+TMEEIL +IQQREEAAVKRERAMAYAF+HQWRA S    G   Y +GK
Sbjct  146  QNLQVEWNGGSDTMEEILGRIQQREEAAVKRERAMAYAFNHQWRARSATSLGNFNYEVGK  205

Query  734  ESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
              WGWSW +RWIA RPWE R    P+   K
Sbjct  206  GGWGWSWMDRWIAARPWEPRSLVHPENLKK  235



>ref|XP_008451703.1| PREDICTED: protein IQ-DOMAIN 1-like [Cucumis melo]
 ref|XP_008451704.1| PREDICTED: protein IQ-DOMAIN 1-like [Cucumis melo]
 ref|XP_008451705.1| PREDICTED: protein IQ-DOMAIN 1-like [Cucumis melo]
Length=261

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 132/176 (75%), Gaps = 5/176 (3%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E++AATRIQ AFR +   RK +   +   + Q  ++   +   QV++    IHSWSR+Q
Sbjct  41   SEDLAATRIQNAFRTF-TARKDVHNSKVPERCQDLVQGE-TATKQVSS---FIHSWSRMQ  95

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
             EI+ARRLCMVT+ R+KQKK++NQ+KL+AK+HEL+ EWS GSET EEIL KIQQREEAAV
Sbjct  96   QEIRARRLCMVTEYRVKQKKLENQLKLEAKIHELEAEWSGGSETKEEILFKIQQREEAAV  155

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP  808
            +RERAMAYAFSHQWRANS      A Y+L KE+WGWSWKERWIA RPWEIR    P
Sbjct  156  RRERAMAYAFSHQWRANSILDLSPASYSLDKENWGWSWKERWIAARPWEIRANTHP  211



>ref|XP_010060657.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Eucalyptus grandis]
 gb|KCW67454.1| hypothetical protein EUGRSUZ_F01203 [Eucalyptus grandis]
Length=267

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 153/241 (63%), Gaps = 19/241 (8%)
 Frame = +2

Query  149  STYMGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNN---------ELTEEIAAT  301
            ST MG    +R    LK  K G S+  +     A    SK +         +  E+ AAT
Sbjct  17   STLMGPGNCFR---SLKKAKEGTSRQAKVEVCAAKSNGSKQDSQRKSGIPRKRVEDTAAT  73

Query  302  RIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARR  481
            RIQ AFRA+   R+ + RLR  V+FQ ++     V +QV+  L ++HSWSRIQ+EI+ARR
Sbjct  74   RIQAAFRAF-LVRRTLYRLRCAVRFQ-SLTHGLPVTEQVSTALSYLHSWSRIQTEIRARR  131

Query  482  LCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMA  661
            + MVT+ R++QK++++Q+K +AKL +L++EW  G  T E+IL KIQQRE AA KRER +A
Sbjct  132  INMVTEARMRQKRLEDQLKFEAKLQKLELEWCGGPGTKEDILAKIQQREAAAAKRERTLA  191

Query  662  YAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA-----DPKKAGKT  826
            YAFSHQWRANS HY  +  Y L KE WGWSW E WIA RPWEIR Q+       K+ GK+
Sbjct  192  YAFSHQWRANSSHYLSRPSYCLVKECWGWSWLEHWIATRPWEIRPQSYSTEMTAKQLGKS  251

Query  827  A  829
            A
Sbjct  252  A  252



>gb|KCW67461.1| hypothetical protein EUGRSUZ_F01203 [Eucalyptus grandis]
Length=248

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 135/187 (72%), Gaps = 7/187 (4%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E+ AATRIQ AFRA+   R+ + RLR  V+FQ ++     V +QV+  L ++HSWSRIQ+
Sbjct  49   EDTAATRIQAAFRAF-LARRTLYRLRCAVRFQ-SLTHGLPVTEQVSTALSYLHSWSRIQT  106

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            EI+ARR+ MVT+ R++QK++++Q+K +AKL +L++EW  G  T E+IL KIQQRE AA K
Sbjct  107  EIRARRINMVTEARMRQKRLEDQLKFEAKLQKLELEWCGGPGTKEDILAKIQQREAAAAK  166

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA-----DP  808
            RER +AYAFSHQWRANS HY  +  Y L KE WGWSW E WIA RPWEIR Q+       
Sbjct  167  RERTLAYAFSHQWRANSSHYLSRPSYCLVKECWGWSWLEHWIATRPWEIRPQSYSTEMTA  226

Query  809  KKAGKTA  829
            K+ GK+A
Sbjct  227  KQLGKSA  233



>ref|XP_004232951.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
Length=302

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/285 (43%), Positives = 168/285 (59%), Gaps = 33/285 (12%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQ--SVRTEANGGSSKN------NELT----------  283
            MG   W + + G++  K+G SK  +  S   ++NG    N      +++T          
Sbjct  1    MGSADWLKNVIGMRKAKDGRSKKNKGTSANKKSNGCKGHNPLQKEPSKITNIVLIKNQRE  60

Query  284  -----EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 E+ AA +IQ AFRAY   RK +RRL+G  + Q ++    SV  Q ++ L +I SW
Sbjct  61   MGIPIEDRAAIKIQTAFRAY-LARKTLRRLKGHTRLQ-SLTQRPSVKKQASSALNYICSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            + +Q+EI+ARR+ MV +G LK+KK +NQ+KL+ KL  +++EWS G ETME IL +I QRE
Sbjct  119  NTMQNEIRARRVHMVMEGHLKRKKHENQLKLETKLQNIEIEWSGGPETMEVILARIHQRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR--VQA  802
            EAAVKRERAMAYAFSHQWRANS   FG     + K +WGWSWK+RW+A RPWE R  V A
Sbjct  179  EAAVKRERAMAYAFSHQWRANSNPVFGSGNNEMNKANWGWSWKDRWVAARPWESRALVHA  238

Query  803  DPKKAGKTASLGPVKLVVSVNNPPLS------NGKISTPARKPSD  919
             PKK    A+         +   P+S      NGK +  A+K ++
Sbjct  239  SPKKVNDKANKNTKSTTSPIKKTPVSVILTSLNGKGTIKAKKSNE  283



>ref|XP_010915586.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Elaeis guineensis]
Length=269

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 137/200 (69%), Gaps = 13/200 (7%)
 Frame = +2

Query  332  QGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLk  511
            + RK  R L+G  + Q  +   +SV  Q + TL ++ SW +IQ++I+ARR+CMVT+GR++
Sbjct  25   KARKKFRSLKGVQRLQ-VLAQGHSVKHQASTTLSYLQSWGKIQAQIRARRICMVTEGRMR  83

Query  512  qkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRAN  691
            QKK  NQ+KL+AKLH+L+VEW  GSETMEEI+ +IQQREEAA+KRERA+AYAFSHQWRAN
Sbjct  84   QKKQDNQLKLEAKLHDLEVEWCGGSETMEEIIARIQQREEAAIKRERALAYAFSHQWRAN  143

Query  692  SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV---QADPKKA--------GKTASLG  838
             G   G   Y  GK +WGWSW +RWIA RPWE R+    A PKKA        G  A+  
Sbjct  144  PGLNQGPFVYECGKGNWGWSWMDRWIAARPWETRLPTHSAIPKKAQTKATSKVGNDANPS  203

Query  839  PVKLVVSVNNPPLSNGKIST  898
              K+  SV  P  ++GK ST
Sbjct  204  AQKVSESV-KPAAADGKGST  222



>ref|XP_009404499.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009404500.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
Length=294

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 153/258 (59%), Gaps = 22/258 (9%)
 Frame = +2

Query  158  MGWRGWYRKITGLK-TRKNGPSKWLQSVRTEANG----GSSKNNE----------LTEEI  292
            MG   W + I   K  +++G  K   S   ++NG    G S+ +            +E+I
Sbjct  1    MGSGDWLKTIINRKKAKQDGAKKLTGSSNQQSNGFELKGQSRKDPGKLFGGADGMASEDI  60

Query  293  AATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIK  472
            AATRIQ AFR +K  RKA R L+   + Q A     SV  Q + T  H+ SWS++Q+EI+
Sbjct  61   AATRIQTAFRGFK-ARKAFRSLKRVQRLQ-AFTHRKSVQKQASNTWSHVQSWSKMQAEIR  118

Query  473  ARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRER  652
            ARR  MV +GR +QKK  N+ KL+AKLH+L +EW+ GSET EEI+ +IQQREEAAVKRER
Sbjct  119  ARRANMVAEGRFRQKKHDNRSKLEAKLHDLALEWNGGSETKEEIVARIQQREEAAVKRER  178

Query  653  AMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA-----DPKKA  817
            AMAYAFSHQWR NSG   G   Y L K +W WSW +RWIA RPWE R  +        KA
Sbjct  179  AMAYAFSHQWRVNSGVSQGPFVYELAKGNWEWSWVDRWIAARPWETRPSSHSMAKTASKA  238

Query  818  GKTASLGPVKLVVSVNNP  871
            GK AS    K   S   P
Sbjct  239  GKNASPSGQKAQGSTKKP  256



>ref|XP_008784325.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Phoenix dactylifera]
Length=267

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 136/198 (69%), Gaps = 11/198 (6%)
 Frame = +2

Query  332  QGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLk  511
            + RK +R L+GT + Q  +   +SV  Q ++TL +I SWS+IQ++I ARR+CMVT+GR++
Sbjct  25   KARKNLRSLKGTERLQ-VLAQGHSVKKQTSSTLSYIQSWSKIQAQIGARRICMVTEGRIR  83

Query  512  qkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRAN  691
            QKK  NQ+KL+AK+H+L+VEW  GSETMEEIL +IQQREEAA+KRERAMAYAFSHQWRAN
Sbjct  84   QKKQDNQLKLEAKIHDLEVEWCGGSETMEEILARIQQREEAAIKRERAMAYAFSHQWRAN  143

Query  692  SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV------QADPK---KAGKTASLGPV  844
             G   G   Y  GK +W WSW +RWIA RPWE R+      QA  K   K GK  +    
Sbjct  144  PGLNQGPFVYECGKGNWRWSWMDRWIAGRPWETRLPTVIPKQAQTKATSKVGKNTNPSAE  203

Query  845  KLVVSVNNPPLSNGKIST  898
                SV  P  ++GK ST
Sbjct  204  TASDSV-KPAATDGKGST  220



>gb|ABK24642.1| unknown [Picea sitchensis]
Length=340

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 134/189 (71%), Gaps = 2/189 (1%)
 Frame = +2

Query  254  GGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLK  433
            G  +K   L EE AA  IQ  FR Y   RK++R+++G V+ Q A+     V  Q A+TL 
Sbjct  53   GMFNKYGPLKEEKAAIHIQTEFRGY-LARKSLRKMKGMVRLQ-ALVGGNEVKKQAASTLH  110

Query  434  HIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQK  613
             + SW RIQ++++ARR CMV + R+KQ+K ++Q+KL+A+LHEL+V+W  G+ETMEEIL +
Sbjct  111  SMQSWIRIQAQVRARRSCMVAEARIKQQKREHQLKLEAELHELEVDWLDGAETMEEILAR  170

Query  614  IQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            ++QREEA++KRERAMAYAFSHQWRANS    G A Y   K +WGWSW ERWIA RPWE R
Sbjct  171  VRQREEASLKRERAMAYAFSHQWRANSRTNHGYAGYEADKTNWGWSWMERWIAARPWENR  230

Query  794  VQADPKKAG  820
            + A   K G
Sbjct  231  LLAQSMKDG  239



>ref|XP_008657461.1| PREDICTED: protein IQ-DOMAIN 1-like [Zea mays]
Length=348

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            +N   EE AATRIQ AFR YK  RK +R L+G VK    +  A  V  Q AATL +I SW
Sbjct  53   DNAALEEWAATRIQNAFRKYK-ARKTLRCLKG-VKRLRVVGQANPVKKQTAATLSYIQSW  110

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++QSEI+ RR  MVT+GR ++KK +NQ+KL+AKLH LQ+EW+ GS+TM+EIL +IQQ E
Sbjct  111  NKLQSEIRNRRAFMVTEGRNRKKKQENQMKLEAKLHNLQIEWNGGSDTMDEILVRIQQLE  170

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP  808
            EA VKRERAMAY F+HQWRA S    G   Y +GK  WGWSW +RWI  RPWE R    P
Sbjct  171  EAVVKRERAMAYTFNHQWRARSATSLGNFSYEVGKGGWGWSWMDRWIVARPWESRSMVHP  230

Query  809  KKAGK  823
            +   K
Sbjct  231  ENPKK  235



>ref|XP_009607452.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana tomentosiformis]
 ref|XP_009607453.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana tomentosiformis]
Length=311

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 149/249 (60%), Gaps = 28/249 (11%)
 Frame = +2

Query  158  MGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNNEL-------------------  280
            MG   W + + G++  K+G SK L+           K +E                    
Sbjct  1    MGSADWLKNVIGMRKAKDGKSKKLKGTSAIKKSNGCKGDEPLQKEPSKITNGVLIKNQRE  60

Query  281  ----TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
                 ++  A +IQ AFRAY   RK +RRL+G  + Q   +   SV  Q ++ L +IHSW
Sbjct  61   LGMPIDDRVAIKIQTAFRAY-VARKTLRRLKGNARLQFLTQHP-SVKKQASSALNYIHSW  118

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +R+Q+EI+ RR+ MVT+GRL++KK++NQ+KL+AKL  L+VEWS G ETME IL +I  RE
Sbjct  119  NRMQTEIRDRRVRMVTEGRLERKKLENQLKLEAKLQNLEVEWSGGPETMEVILARIHHRE  178

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA--  802
            EAA KRERAMAYAFSHQWRANS   FG + + + K +WGWSW +RW+A RPWE RV    
Sbjct  179  EAATKRERAMAYAFSHQWRANSSPVFG-SCHEMSKANWGWSWTDRWVAARPWESRVPVLT  237

Query  803  DPKKAGKTA  829
             PKK    A
Sbjct  238  SPKKVNGKA  246



>emb|CDY62768.1| BnaC04g44330D [Brassica napus]
Length=277

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 147/228 (64%), Gaps = 15/228 (7%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L+E+ AATRIQ AF+AYK  RK +RRL+G  + +   E    V  Q A TLK++HSWS I
Sbjct  46   LSEDRAATRIQTAFKAYK-ARKMLRRLKGIARAKLLTEK-QPVKKQAAVTLKYLHSWSNI  103

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            QS+IKARR+ MV +GRL  K+++NQ KL+AKLH+++VEW+ G+ET +EIL++I QREEA 
Sbjct  104  QSQIKARRVGMVMEGRLIFKRLENQQKLEAKLHDIEVEWNGGTETKDEILERIHQREEAM  163

Query  638  VKRERAMAYAFS--------HQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            +KRERA+AYAFS         QW+A+ G       Y LG  +WGWSWKERWIA RPW++R
Sbjct  164  IKRERALAYAFSLSSVTLSCEQWKAD-GKTQWLGGYELGNTNWGWSWKERWIAARPWKVR  222

Query  794  VQADPKKAGKTASLGPVKLVVSVNNPP---LSNGKISTPARKPSDHNP  928
                PKK     ++   K     N+P    +S   +S  A  P   NP
Sbjct  223  YSLTPKKPKNLKTVC-CKSETKPNSPAKRGVSLSSVSAKAPIPGAVNP  269



>ref|XP_003564310.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
 ref|XP_010228021.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
Length=340

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 133/197 (68%), Gaps = 6/197 (3%)
 Frame = +2

Query  245  EANGGSS----KNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVND  412
            + NG SS    ++N   EE AATRIQ AFR YK  R+ +R L+G  + +  +  +  V  
Sbjct  39   KPNGPSSSSDPEDNAALEEWAATRIQNAFRRYK-ARRKLRCLKGLKRLR-IVGQSNPVTK  96

Query  413  QVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSET  592
            Q +ATL +I SW+++Q+EI+ RR  MVT+GR ++KK +NQ+KLDAKL  LQVEW+ GS T
Sbjct  97   QTSATLSYIQSWNKLQAEIRNRRAFMVTEGRNRKKKQENQVKLDAKLQNLQVEWNGGSNT  156

Query  593  MEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIA  772
            M+EIL +I  REEAAVKRERAMAYAF+HQWRA S    G   Y +G   WGWSW +RWIA
Sbjct  157  MDEILARIHLREEAAVKRERAMAYAFNHQWRARSATSQGNFNYEVGNAGWGWSWMDRWIA  216

Query  773  VRPWEIRVQADPKKAGK  823
             RPWE R    P+   K
Sbjct  217  ARPWEPRSMVHPENPKK  233



>ref|XP_009389987.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 137/210 (65%), Gaps = 12/210 (6%)
 Frame = +2

Query  329  KQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRL  508
            KQ RK +  LR T K Q A     SV  Q   TL H+H+WS+IQ+EI+ARR  MV +GR+
Sbjct  22   KQARKTLGSLRRTQKLQ-AFTYHNSVKKQTTNTLIHVHAWSKIQAEIRARRANMVAEGRI  80

Query  509  kqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRA  688
            +QKK  NQ+KL+AKLH+L+V+W+ GSET EEI+ +IQQREEAAVKRERAMAYAFSHQWRA
Sbjct  81   RQKKHDNQLKLEAKLHDLEVDWNGGSETKEEIIARIQQREEAAVKRERAMAYAFSHQWRA  140

Query  689  NSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPK---KAGKTASLGPVKLVVS  859
            NSG   G   + L K +W WSW ++WIA +PWE R     K   + GK A     KL  S
Sbjct  141  NSGMNQGPFVFELAKGNWEWSWVDKWIAAQPWETRPSTLTKVVNRVGKGA-----KLPSS  195

Query  860  VNNPPLSNGKISTPARKPSDHNPETQTPQE  949
            V +  +   +    A+KPS  + E  T QE
Sbjct  196  VKHASIDGKEF---AKKPSKQSDEETTNQE  222



>gb|EMT06677.1| hypothetical protein F775_25983 [Aegilops tauschii]
Length=327

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 150/245 (61%), Gaps = 23/245 (9%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            +N   E+ AATRIQ AFR +K  R+ +R LRG VK    +  +  V  Q +ATL +I SW
Sbjct  53   DNAALEDWAATRIQNAFRRHK-ARRTLRCLRG-VKRLRIVGQSNPVTKQTSATLSYIQSW  110

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++Q+E++ RR  MVT+GR ++KK +NQ+KLDAKL  LQV W+ GS TM+EI+ +I  RE
Sbjct  111  NKLQAELRNRRAFMVTEGRNRKKKQENQVKLDAKLQNLQVAWNGGSNTMDEIVARIHLRE  170

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP  808
            EAAVKRERAMAYAF+HQWRA S    G   Y +G   WGWSW +RWIA RPWE R    P
Sbjct  171  EAAVKRERAMAYAFNHQWRAKSATSQGNFNYGVGNGGWGWSWMDRWIAARPWEPRSMVTP  230

Query  809  --------KKAGKTASLGPVKLVVSVNNPPLSNG--------KISTPARKPSDHNPETQT  940
                    KK   + +   +KL  +++   LSN         K S+P+  P    P  +T
Sbjct  231  ENPKKGQSKKDNTSTNQSALKLQGAIS---LSNNTSDRKVPKKKSSPS--PDKKKPAAKT  285

Query  941  PQEPV  955
             Q+PV
Sbjct  286  EQKPV  290



>gb|EMS51544.1| Protein IQ-DOMAIN 1 [Triticum urartu]
Length=327

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 150/245 (61%), Gaps = 23/245 (9%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            +N   E+ AATRIQ AFR +K  R+ +R LRG VK    +  +  V  Q +ATL +I SW
Sbjct  53   DNAALEDWAATRIQNAFRRHK-ARRTLRCLRG-VKRLRIVGQSNPVTKQTSATLSYIQSW  110

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++Q+E++ RR  MVT+GR ++KK +NQ+KLDAKL  LQV W+ GS TM+EI+ +I  RE
Sbjct  111  NKLQAELRNRRAFMVTEGRNRKKKQENQVKLDAKLQNLQVAWNGGSNTMDEIVARIHLRE  170

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP  808
            EAAVKRERAMAYAF+HQWRA S    G   Y +G   WGWSW +RWIA RPWE R    P
Sbjct  171  EAAVKRERAMAYAFNHQWRAKSATSQGNFNYGVGNGGWGWSWMDRWIAARPWEPRSMVTP  230

Query  809  --------KKAGKTASLGPVKLVVSVNNPPLSNG--------KISTPARKPSDHNPETQT  940
                    KK   + +   +KL  +++   LSN         K S+P+  P    P  +T
Sbjct  231  ENPKKGQSKKDNTSTNQSALKLQGAIS---LSNNTSDRKVPKKKSSPS--PDKKKPVAKT  285

Query  941  PQEPV  955
             Q+PV
Sbjct  286  EQKPV  290



>gb|KDO77788.1| hypothetical protein CISIN_1g022139mg [Citrus sinensis]
Length=189

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
             E++AA RIQ AFRAYK  RK  RRL+GT++ QG +   +SV  Q   TL ++H+WS++Q
Sbjct  58   VEDVAAIRIQTAFRAYK-ARKTFRRLKGTIRLQG-VSQRHSVQKQATTTLSYLHTWSKLQ  115

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            +EI+ARRLCMV +GRL+QKK++NQ+KLDAKL+ L+++WS G ETMEEIL +I QRE+AAV
Sbjct  116  AEIRARRLCMVKEGRLRQKKLENQLKLDAKLNSLEIDWSGGPETMEEILSRINQREKAAV  175

Query  641  KRERAMAYAFSHQ  679
            KRERAMAYAFSHQ
Sbjct  176  KRERAMAYAFSHQ  188



>gb|KDO77789.1| hypothetical protein CISIN_1g022139mg [Citrus sinensis]
Length=202

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E++AA RIQ AFRAYK  RK  RRL+GT++ QG +   +SV  Q   TL ++H+WS++Q+
Sbjct  59   EDVAAIRIQTAFRAYK-ARKTFRRLKGTIRLQG-VSQRHSVQKQATTTLSYLHTWSKLQA  116

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            EI+ARRLCMV +GRL+QKK++NQ+KLDAKL+ L+++WS G ETMEEIL +I QRE+AAVK
Sbjct  117  EIRARRLCMVKEGRLRQKKLENQLKLDAKLNSLEIDWSGGPETMEEILSRINQREKAAVK  176

Query  644  RERAMAYAFSHQ  679
            RERAMAYAFSHQ
Sbjct  177  RERAMAYAFSHQ  188



>gb|EPS68276.1| hypothetical protein M569_06495, partial [Genlisea aurea]
Length=195

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 122/184 (66%), Gaps = 10/184 (5%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E+IAATRIQ A+RA+   R+A+R ++G  + Q  ++  +SV  Q + TL  +H WS  Q+
Sbjct  15   EDIAATRIQAAYRAH-LARRALRNVKGMRRLQDLVKR-HSVKKQASRTLNLLHKWSTAQA  72

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ RR  MV +GRL+Q++++NQ+KL+ K H+LQ EWS G ETM E + +I +REEAA +
Sbjct  73   QIRERRAHMVNEGRLRQRRLENQLKLENKFHDLQAEWSGGPETMGEAVARIHRREEAASR  132

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKE------SWGWSWKERWIAVRPWEIRVQAD  805
            RERAMAYAFSHQWRA       Q   + G E      SWGWSW +RWIA RPWE R    
Sbjct  133  RERAMAYAFSHQWRAAGS--TAQPRPSGGDEAAAAKWSWGWSWMDRWIAARPWEDRRNVV  190

Query  806  PKKA  817
            P  A
Sbjct  191  PPPA  194



>emb|CDP05980.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAY-KQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSR  454
            +TE+ AATRIQ AFR Y    RKA+ RLR   + +GAI AA +   Q ++ L HIH W++
Sbjct  66   ITEDTAATRIQTAFRRYVASARKAVHRLRAIGRCRGAI-AALTAEKQASSALIHIHFWNK  124

Query  455  IQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEA  634
            +Q+EIKARR  MV + R++QKK +N++KL+AKL EL+V+W  GSETMEEILQ+IQQRE A
Sbjct  125  MQAEIKARRQGMVNENRIQQKKQENRLKLEAKLQELEVDWCGGSETMEEILQRIQQREVA  184

Query  635  AVKRERAMAYAFSHQ  679
            AVKRERAMAYAFSHQ
Sbjct  185  AVKRERAMAYAFSHQ  199



>ref|XP_009141354.1| PREDICTED: protein IQ-DOMAIN 1-like [Brassica rapa]
 ref|XP_009141355.1| PREDICTED: protein IQ-DOMAIN 1-like [Brassica rapa]
Length=181

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L+E+ AATRIQ  F+AYK  RK +RRL+G  + +   E    V  Q A TLK++HSWS I
Sbjct  46   LSEDRAATRIQTTFKAYK-ARKMLRRLKGIARAKLLTEKQ-PVKKQAAVTLKYLHSWSNI  103

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            QS+IKARR+ MV +GRL  K+++NQ KL+AKLH+++VEW+ G+ET +EIL++I QREEA 
Sbjct  104  QSQIKARRVGMVMEGRLIFKRLENQQKLEAKLHDIEVEWNGGTETKDEILERIHQREEAM  163

Query  638  VKRERAMAYAFS  673
            +KRERA+AYAFS
Sbjct  164  IKRERALAYAFS  175



>gb|ACU17572.1| unknown [Glycine max]
Length=147

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 94/140 (67%), Gaps = 14/140 (10%)
 Frame = +2

Query  488  MVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYA  667
            MVT+ R+++K I +Q+KL+AK+H+L+VEW SGSET +EIL ++ QREEAAVKRER MAYA
Sbjct  1    MVTEDRIRRKIIHSQLKLEAKIHDLEVEWCSGSETKKEILSRLHQREEAAVKRERTMAYA  60

Query  668  FSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA------------DPK  811
            FSHQWRA+S    G   Y LGK SW WSWK+RWIA RPWE RV +             P+
Sbjct  61   FSHQWRASSSQGLGN--YELGKASWSWSWKDRWIAARPWESRVPSVTNTSPEKDQNKKPR  118

Query  812  KAGKTASLGPVKLVVSVNNP  871
            K  K  +    K  VSV  P
Sbjct  119  KVQKDRNSPTSKKPVSVKTP  138



>gb|KCW67458.1| hypothetical protein EUGRSUZ_F01203 [Eucalyptus grandis]
Length=201

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 118/186 (63%), Gaps = 14/186 (8%)
 Frame = +2

Query  149  STYMGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNN---------ELTEEIAAT  301
            ST MG    +R    LK  K G S+  +     A    SK +         +  E+ AAT
Sbjct  17   STLMGPGNCFR---SLKKAKEGTSRQAKVEVCAAKSNGSKQDSQRKSGIPRKRVEDTAAT  73

Query  302  RIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARR  481
            RIQ AFRA+   R+ + RLR  V+FQ ++     V +QV+  L ++HSWSRIQ+EI+ARR
Sbjct  74   RIQAAFRAF-LARRTLYRLRCAVRFQ-SLTHGLPVTEQVSTALSYLHSWSRIQTEIRARR  131

Query  482  LCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMA  661
            + MVT+ R++QK++++Q+K +AKL +L++EW  G  T E+IL KIQQRE AA KRER +A
Sbjct  132  INMVTEARMRQKRLEDQLKFEAKLQKLELEWCGGPGTKEDILAKIQQREAAAAKRERTLA  191

Query  662  YAFSHQ  679
            YAFSHQ
Sbjct  192  YAFSHQ  197



>gb|KCW67457.1| hypothetical protein EUGRSUZ_F01203 [Eucalyptus grandis]
Length=231

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 118/186 (63%), Gaps = 14/186 (8%)
 Frame = +2

Query  149  STYMGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNN---------ELTEEIAAT  301
            ST MG    +R    LK  K G S+  +     A    SK +         +  E+ AAT
Sbjct  17   STLMGPGNCFR---SLKKAKEGTSRQAKVEVCAAKSNGSKQDSQRKSGIPRKRVEDTAAT  73

Query  302  RIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARR  481
            RIQ AFRA+   R+ + RLR  V+FQ ++     V +QV+  L ++HSWSRIQ+EI+ARR
Sbjct  74   RIQAAFRAF-LARRTLYRLRCAVRFQ-SLTHGLPVTEQVSTALSYLHSWSRIQTEIRARR  131

Query  482  LCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMA  661
            + MVT+ R++QK++++Q+K +AKL +L++EW  G  T E+IL KIQQRE AA KRER +A
Sbjct  132  INMVTEARMRQKRLEDQLKFEAKLQKLELEWCGGPGTKEDILAKIQQREAAAAKRERTLA  191

Query  662  YAFSHQ  679
            YAFSHQ
Sbjct  192  YAFSHQ  197



>gb|KCW67456.1| hypothetical protein EUGRSUZ_F01203 [Eucalyptus grandis]
Length=226

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 118/186 (63%), Gaps = 14/186 (8%)
 Frame = +2

Query  149  STYMGWRGWYRKITGLKTRKNGPSKWLQSVRTEANGGSSKNN---------ELTEEIAAT  301
            ST MG    +R    LK  K G S+  +     A    SK +         +  E+ AAT
Sbjct  17   STLMGPGNCFR---SLKKAKEGTSRQAKVEVCAAKSNGSKQDSQRKSGIPRKRVEDTAAT  73

Query  302  RIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARR  481
            RIQ AFRA+   R+ + RLR  V+FQ ++     V +QV+  L ++HSWSRIQ+EI+ARR
Sbjct  74   RIQAAFRAF-LARRTLYRLRCAVRFQ-SLTHGLPVTEQVSTALSYLHSWSRIQTEIRARR  131

Query  482  LCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMA  661
            + MVT+ R++QK++++Q+K +AKL +L++EW  G  T E+IL KIQQRE AA KRER +A
Sbjct  132  INMVTEARMRQKRLEDQLKFEAKLQKLELEWCGGPGTKEDILAKIQQREAAAAKRERTLA  191

Query  662  YAFSHQ  679
            YAFSHQ
Sbjct  192  YAFSHQ  197



>ref|XP_004169423.1| PREDICTED: protein IQ-DOMAIN 1-like, partial [Cucumis sativus]
Length=168

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 102/133 (77%), Gaps = 5/133 (4%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E++AATRIQ AFR +   RK +   +   + Q  ++   +   QV++    IHSWSR+Q
Sbjct  41   SEDLAATRIQNAFRTFT-ARKDVHNSKVPERCQDLVQGE-TATKQVSS---FIHSWSRMQ  95

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
             EI+ARRLCMVT+ R+KQKK++NQ+KL+AK+HEL+ EWS GSET EEIL KIQQREEAAV
Sbjct  96   QEIRARRLCMVTEYRVKQKKLENQLKLEAKIHELEAEWSGGSETKEEILFKIQQREEAAV  155

Query  641  KRERAMAYAFSHQ  679
            +RERAMAYAFSHQ
Sbjct  156  RRERAMAYAFSHQ  168



>ref|XP_003540276.1| PREDICTED: protein IQ-DOMAIN 1 isoformX1 [Glycine max]
Length=421

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 111/176 (63%), Gaps = 3/176 (2%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N ++ EE+AA RIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  86   NQQMREELAAIRIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCMQAL  143

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++AR +CM  + +  Q+K Q  +  +A++ E +  W     ++EEI  KI +R+
Sbjct  144  VRVQARVRARHVCMALETQASQQKHQQNLANEARVRETEEGWCDSVGSVEEIQAKILKRQ  203

Query  629  EAAVKRERAMAYAFSHQWRANSGHY-FGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA SHQW+A S         +   K SWGW+W ERW+AVRPWE R
Sbjct  204  EAAAKRERAMAYALSHQWQAGSRQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  259



>ref|XP_006592786.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Glycine max]
 ref|XP_006592787.1| PREDICTED: protein IQ-DOMAIN 1 isoform X3 [Glycine max]
 ref|XP_006592788.1| PREDICTED: protein IQ-DOMAIN 1 isoform X4 [Glycine max]
Length=422

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 113/179 (63%), Gaps = 3/179 (2%)
 Frame = +2

Query  260  SSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHI  439
            ++ N ++ EE+AA RIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ +
Sbjct  83   AAHNQQMREELAAIRIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCM  140

Query  440  HSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQ  619
             +  R+Q+ ++AR +CM  + +  Q+K Q  +  +A++ E +  W     ++EEI  KI 
Sbjct  141  QALVRVQARVRARHVCMALETQASQQKHQQNLANEARVRETEEGWCDSVGSVEEIQAKIL  200

Query  620  QREEAAVKRERAMAYAFSHQWRANSGHY-FGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            +R+EAA KRERAMAYA SHQW+A S         +   K SWGW+W ERW+AVRPWE R
Sbjct  201  KRQEAAAKRERAMAYALSHQWQAGSRQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  259



>ref|XP_010045169.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Eucalyptus grandis]
 gb|KCW87325.1| hypothetical protein EUGRSUZ_B03811 [Eucalyptus grandis]
Length=417

 Score =   132 bits (332),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 108/172 (63%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L EE+AATRIQ AFR +   R+A+  L+G V+ Q  I   +SV  Q A TL+ + +  R+
Sbjct  96   LREELAATRIQTAFRGF-LARRALSALKGLVRLQALIRG-HSVRKQAAMTLRCMQALVRV  153

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  ++K + Q   +A++ +++  W     + EEI  K+ +R+EAA
Sbjct  154  QAHVRARRVRLALESQTAEQKFKQQTAKEAQVRQIEEGWCDHIGSAEEIQAKLVKRQEAA  213

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERAMAY+ +HQW+A S        +   K SWGW+W ERW+AVRPWE R
Sbjct  214  AKRERAMAYSLAHQWQAGSKQLAAPTGFEPDKSSWGWTWLERWMAVRPWENR  265



>ref|NP_001276234.1| uncharacterized protein LOC100819346 [Glycine max]
 gb|AFR23355.1| IQ-DOMAIN 1-like isoform 3 [Glycine max]
Length=424

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 110/176 (63%), Gaps = 3/176 (2%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N ++ EE AA  IQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  83   NQQMREEWAAIHIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCMQAL  140

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++AR +CM  + +  Q+K Q  +  +A++ E++  W     ++EEI  K+ +R+
Sbjct  141  VRVQARVRARXVCMALETQASQQKHQQNLANEARVREIEEGWCDSVGSVEEIQAKLLKRQ  200

Query  629  EAAVKRERAMAYAFSHQWRANS-GHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA SHQW+A S         +   K SWGW+W ERW+AVRPWE R
Sbjct  201  EAAAKRERAMAYALSHQWQAGSRQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  256



>ref|XP_010045168.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Eucalyptus grandis]
 gb|KCW87324.1| hypothetical protein EUGRSUZ_B03811 [Eucalyptus grandis]
Length=418

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 109/173 (63%), Gaps = 3/173 (2%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L EE+AATRIQ AFR +   R+A+  L+G V+ Q  I   +SV  Q A TL+ + +  R+
Sbjct  96   LREELAATRIQTAFRGF-LARRALSALKGLVRLQALIRG-HSVRKQAAMTLRCMQALVRV  153

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVE-WSSGSETMEEILQKIQQREEA  634
            Q+ ++ARR+ +  + +  ++K + Q   +A++ +++ E W     + EEI  K+ +R+EA
Sbjct  154  QAHVRARRVRLALESQTAEQKFKQQTAKEAQVRQIEQEGWCDHIGSAEEIQAKLVKRQEA  213

Query  635  AVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            A KRERAMAY+ +HQW+A S        +   K SWGW+W ERW+AVRPWE R
Sbjct  214  AAKRERAMAYSLAHQWQAGSKQLAAPTGFEPDKSSWGWTWLERWMAVRPWENR  266



>ref|XP_009368414.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009368423.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009368429.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009368436.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
Length=433

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 110/170 (65%), Gaps = 2/170 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AATRIQ  FR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+Q+
Sbjct  92   EEWAATRIQTTFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRVQA  149

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++AR + +  +G+  Q+++Q Q+  + ++ E++  W     +++EI  K+ +R+EAA K
Sbjct  150  RVRARHVRLALEGQTVQQRLQQQLANEVRVREIEEGWCDSVGSVQEIQAKLLKRQEAAAK  209

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            RERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R
Sbjct  210  RERAMAYALAHQWQAGSRQLLAPSGFEPDKSSWGWNWLERWMAVRPWENR  259



>ref|XP_008385579.1| PREDICTED: protein IQ-DOMAIN 1 [Malus domestica]
 ref|XP_008385580.1| PREDICTED: protein IQ-DOMAIN 1 [Malus domestica]
 ref|XP_008359181.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
 ref|XP_008359182.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
Length=433

 Score =   127 bits (318),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 112/171 (65%), Gaps = 2/171 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AATRIQ  FR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+Q+
Sbjct  92   EEWAATRIQTTFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRVQA  149

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++AR + +  +G++ Q+++Q Q+  + ++ E++  W     +++EI  K+ +R+EAA K
Sbjct  150  RVRARHVRLALEGQMAQQRLQQQLANEVRVREIEEGWCDSVGSVQEIQAKLLKRQEAAAK  209

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
            RERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R+
Sbjct  210  RERAMAYALAHQWQAGSRQLPAPSGFEPDKSSWGWNWLERWMAVRPWENRL  260



>ref|XP_010937801.1| PREDICTED: protein IQ-DOMAIN 1-like [Elaeis guineensis]
Length=484

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 125/232 (54%), Gaps = 17/232 (7%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AA +IQ AFR Y   R+A+R LRG V+ +  I    SV  Q   TL+ + + +R+QS
Sbjct  113  EEVAAIKIQTAFRGY-MARRALRALRGLVRLKSLIHE-NSVKRQATTTLRCMQTLARVQS  170

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I++RR+ M  + +  Q+++  + + + +   +  EW    ++ E+I   +  ++EA ++
Sbjct  171  QIRSRRIRMQEENQALQRQLLLKHERELESLRMDEEWDDSMQSKEQIEASLLSKQEATIR  230

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
            RERA+AYAFSHQW+ N+       + +     WGWSW ERW+A RPWE R   D +    
Sbjct  231  RERALAYAFSHQWK-NASRSGNPMFMDPNNPHWGWSWLERWMASRPWESRSTTDRELNSD  289

Query  824  TASLGPVKLVV--------------SVNNPPLSNGKISTPARKPSDHNPETQ  937
             AS+      V              +++ P  +  K+S PAR+P    P ++
Sbjct  290  RASVKSTSYSVGGGEIMKAYAQRDSNLDRPSPTMEKLSQPARRPVPSTPNSR  341



>ref|XP_009410027.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009410028.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
Length=472

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 126/223 (57%), Gaps = 9/223 (4%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA  IQ AFRAY   R+ +R ++G V+ +  +    SV  Q   TL+ + + +R+QS
Sbjct  117  EEIAAIEIQTAFRAY-MARRELRAMKGLVRLKSLMHG-NSVKRQATTTLRSMQTLARVQS  174

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ ++ + ++ Q+++  + + D +  ++  EW    ++ E+I   +  ++EAAV+
Sbjct  175  QILSRRMRLMEENQVLQRQMLLKHERDLENLKMGEEWDDSLQSREQIEASLLGKQEAAVR  234

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
            RERA+AYAFSHQW++ S       + +     WGWSW ERW A +PWE R   D + +  
Sbjct  235  RERALAYAFSHQWKSTS-KSTNPMFLDPNNLQWGWSWVERWTAAKPWETRGTTDKELSNG  293

Query  824  TASLGPV--KLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQ  946
             AS          +  NP     K+S  ARKPS   P T+TP+
Sbjct  294  RASAKSATESDACAEANP----DKLSPAARKPSTVPPPTRTPR  332



>ref|XP_002976100.1| hypothetical protein SELMODRAFT_104616, partial [Selaginella 
moellendorffii]
 gb|EFJ23005.1| hypothetical protein SELMODRAFT_104616, partial [Selaginella 
moellendorffii]
Length=197

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 119/196 (61%), Gaps = 21/196 (11%)
 Frame = +2

Query  248  ANGGSSKNNE-------LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSV  406
            A  G S NN+       + EE AA RIQ AFR++   R+A+R L+G V+ Q  +   + V
Sbjct  2    ARLGVSTNNKSHIAFRTVREEWAAIRIQSAFRSFL-SRRALRALKGLVRLQALVRG-HLV  59

Query  407  NDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGS  586
              Q A TL+ + +  R+Q+ ++AR++ M  +G+  + +I+ +  L+A+ H+ ++ W +  
Sbjct  60   RKQAAVTLRCMQALVRVQARVRARQVRMSEEGQQVRWRIEQRRMLEAQRHQAELGWCACH  119

Query  587  ETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERW  766
             T EEI  K+ Q++EAAVKRERA+AYAFSHQ R  + ++            WGWSW ERW
Sbjct  120  GTKEEIEAKLFQKQEAAVKRERALAYAFSHQVREENCNH------------WGWSWLERW  167

Query  767  IAVRPWEIRVQADPKK  814
            +A +PWE R+ A+ +K
Sbjct  168  MAAKPWENRILANQEK  183



>ref|XP_002970253.1| hypothetical protein SELMODRAFT_67789, partial [Selaginella moellendorffii]
 ref|XP_002978411.1| hypothetical protein SELMODRAFT_57847, partial [Selaginella moellendorffii]
 gb|EFJ20397.1| hypothetical protein SELMODRAFT_57847, partial [Selaginella moellendorffii]
 gb|EFJ28383.1| hypothetical protein SELMODRAFT_67789, partial [Selaginella moellendorffii]
Length=170

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 105/176 (60%), Gaps = 12/176 (7%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +E+ AA +IQ AFR Y   R+A+R L+G V+ Q  +   +SV  Q   TL+ + +  R+Q
Sbjct  2    SEDWAAIKIQTAFRGYL-ARRALRALKGLVRLQALVRG-HSVRRQAVTTLRCMQALVRVQ  59

Query  461  SEIKARRLCMVTQGRLkqkki---qnqikLDAKLHELQVEWSSGSETMEEILQKIQQREE  631
            ++++ARR+ +  +GR ++  +        LD   +     W+  ++T +E+  K+Q R+E
Sbjct  60   AKVRARRISLSEEGRKQEDLLLKPSMVSSLDPNFYG----WNDSTQTTQELQAKMQTRQE  115

Query  632  AAVKRERAMAYAFSHQ-WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
            AA+KRERA+AYAFSHQ W+           Y+  K  WGWSW ERW+A RPWE +V
Sbjct  116  AAIKRERALAYAFSHQLWKDGDAQLLMD--YDSDKPHWGWSWMERWMAARPWESKV  169



>gb|ACN35371.1| unknown [Zea mays]
 tpg|DAA56982.1| TPA: hypothetical protein ZEAMMB73_020879 [Zea mays]
Length=495

 Score =   124 bits (311),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 128/230 (56%), Gaps = 14/230 (6%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AAT+IQ AFR Y   R       G V+ +  ++   +V  Q A TL+   + +R+Q+
Sbjct  133  EELAATKIQTAFRGYLARRALRALR-GLVRLKSLVDG-NAVKRQTAHTLQCTQAMTRVQT  190

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ +  + +  Q+++Q + + + +  ++  +W    ++ E+I   +  ++EAA++
Sbjct  191  QIYSRRVKLEEEKQALQRQLQLKHQRELEKMKIDEDWDHSHQSKEQIEANLMMKQEAALR  250

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA----DPK  811
            RERA+AYAFSHQWR NSG      +   G  +WGWSW ERW+  RPWE R+ A    DPK
Sbjct  251  RERALAYAFSHQWR-NSGRTITPTFTEPGNPNWGWSWMERWMTARPWESRLAAASDKDPK  309

Query  812  K------AGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTP  943
            +      A  +A   PV   +S+  P   N     P+R+ S   P ++TP
Sbjct  310  ERAVTKNASTSAVRVPVSRAISIQRPATPNKSSRPPSRQ-SLSTPPSKTP  358



>ref|NP_001141032.1| uncharacterized protein LOC100273111 [Zea mays]
 ref|XP_008672406.1| PREDICTED: uncharacterized protein LOC100273111 isoform X1 [Zea 
mays]
 ref|XP_008672407.1| PREDICTED: uncharacterized protein LOC100273111 isoform X1 [Zea 
mays]
 ref|XP_008672408.1| PREDICTED: uncharacterized protein LOC100273111 isoform X1 [Zea 
mays]
 ref|XP_008672409.1| PREDICTED: uncharacterized protein LOC100273111 isoform X1 [Zea 
mays]
 ref|XP_008672410.1| PREDICTED: uncharacterized protein LOC100273111 isoform X1 [Zea 
mays]
 gb|ACF85223.1| unknown [Zea mays]
 gb|ACN33821.1| unknown [Zea mays]
 tpg|DAA56978.1| TPA: hypothetical protein ZEAMMB73_020879 [Zea mays]
 tpg|DAA56979.1| TPA: hypothetical protein ZEAMMB73_020879 [Zea mays]
 tpg|DAA56980.1| TPA: hypothetical protein ZEAMMB73_020879 [Zea mays]
 tpg|DAA56981.1| TPA: hypothetical protein ZEAMMB73_020879 [Zea mays]
 gb|AIB05381.1| orphans transcription factor, partial [Zea mays]
Length=498

 Score =   124 bits (311),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 128/230 (56%), Gaps = 14/230 (6%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AAT+IQ AFR Y   R       G V+ +  ++   +V  Q A TL+   + +R+Q+
Sbjct  136  EELAATKIQTAFRGYLARRALRALR-GLVRLKSLVDG-NAVKRQTAHTLQCTQAMTRVQT  193

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ +  + +  Q+++Q + + + +  ++  +W    ++ E+I   +  ++EAA++
Sbjct  194  QIYSRRVKLEEEKQALQRQLQLKHQRELEKMKIDEDWDHSHQSKEQIEANLMMKQEAALR  253

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA----DPK  811
            RERA+AYAFSHQWR NSG      +   G  +WGWSW ERW+  RPWE R+ A    DPK
Sbjct  254  RERALAYAFSHQWR-NSGRTITPTFTEPGNPNWGWSWMERWMTARPWESRLAAASDKDPK  312

Query  812  K------AGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTP  943
            +      A  +A   PV   +S+  P   N     P+R+ S   P ++TP
Sbjct  313  ERAVTKNASTSAVRVPVSRAISIQRPATPNKSSRPPSRQ-SLSTPPSKTP  361



>gb|KHN17990.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=421

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N ++ EE+AA RIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  86   NQQMREELAAIRIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCMQAL  143

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++ARR+CM  + +  Q+K Q  +  +A++ E +  W     ++EEI  KI +R+
Sbjct  144  VRVQARVRARRVCMALETQASQQKHQQNLANEARVRETEEGWCDSVGSVEEIQAKILKRQ  203

Query  629  EAAVKRERAMAYAFSHQWRANSGHY-FGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA SHQW+A S         +   K SWGW+W ERW+AVRPWE R
Sbjct  204  EAAAKRERAMAYALSHQWQAGSRQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  259



>ref|XP_002968277.1| hypothetical protein SELMODRAFT_68032, partial [Selaginella moellendorffii]
 gb|EFJ30531.1| hypothetical protein SELMODRAFT_68032, partial [Selaginella moellendorffii]
Length=180

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 113/179 (63%), Gaps = 14/179 (8%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            + EE AA RIQ AFR++   R+A+R L+G V+ Q  +   + V  Q A TL+ + +  R+
Sbjct  2    VREEWAAIRIQSAFRSFL-SRRALRALKGLVRLQALVRG-HLVRKQAAVTLRCMQALVRV  59

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++AR++ M  +G+  + +I+ +  L+A+ H+ ++ W +   T EEI  K+ Q++EAA
Sbjct  60   QARVRARQVRMSEEGQQVRWRIEQRRMLEAQRHQAELGWCACHGTKEEIEAKLFQKQEAA  119

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKK  814
            VKRERA+AYAFSHQ R  + ++            WGWSW ERW+A +PWE R+ A+ +K
Sbjct  120  VKRERALAYAFSHQVREENCNH------------WGWSWLERWMAAKPWENRILANQEK  166



>ref|XP_006587474.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Glycine max]
Length=434

 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 110/175 (63%), Gaps = 2/175 (1%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N+++ EE AA RIQ AFR +   R+A+R L+G V+ Q A+   Y+V  Q A TL+ + + 
Sbjct  89   NHQMREEWAAIRIQTAFRGF-LARRALRALKGVVRLQ-ALVRGYAVRKQAAITLRCMQAL  146

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++AR + +  + +  Q+K++ ++    ++ E +  W     ++EEI  KI +R+
Sbjct  147  VRVQARVRARHVRIALETQATQQKLKQKLANKVQVRETEEGWCDSIGSIEEIQAKILKRQ  206

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KR RAMAYA +HQW+A S      + +   K +WGW+W ERW+AVRPWE R
Sbjct  207  EAAAKRGRAMAYALAHQWQAGSRQQPVSSGFEPDKSNWGWNWLERWMAVRPWENR  261



>ref|XP_001772157.1| predicted protein [Physcomitrella patens]
 gb|EDQ62970.1| predicted protein [Physcomitrella patens]
Length=169

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 107/173 (62%), Gaps = 10/173 (6%)
 Frame = +2

Query  293  AATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIK  472
            AA RIQ AFR +   R+A+R L+G V+ Q  +   ++V  Q A TL+ + +  R+Q+ I+
Sbjct  1    AALRIQTAFRGFL-ARRALRALKGLVRLQALVRG-HTVRRQAAITLRCMQALVRVQARIR  58

Query  473  ARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRER  652
            ARR+ M  QG+  Q+ I  +   +A L E +  W + S T+E++  K+QQ++E  ++RER
Sbjct  59   ARRVRMSQQGQAVQRTIIERRCREAMLRESERGWCAHSGTLEDLQAKMQQKQEGVIRRER  118

Query  653  AMAYAFSHQW------RANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            A+AYA  +QW      R+  G+YF QA  +   + WGWSW ERW++ RPWE R
Sbjct  119  ALAYASRYQWRVPELGRSKHGYYFDQATPD--NQHWGWSWLERWMSARPWENR  169



>ref|XP_010046779.1| PREDICTED: protein IQ-DOMAIN 1-like [Eucalyptus grandis]
 ref|XP_010046781.1| PREDICTED: protein IQ-DOMAIN 1-like [Eucalyptus grandis]
 gb|KCW88835.1| hypothetical protein EUGRSUZ_A01171 [Eucalyptus grandis]
 gb|KCW88836.1| hypothetical protein EUGRSUZ_A01171 [Eucalyptus grandis]
Length=477

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 114/189 (60%), Gaps = 7/189 (4%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE  A +IQ++FR Y Q R+A+R LRG V+ +  +E   +V  QVA+TLK + + SR+QS
Sbjct  117  EEAGAIKIQKSFRGY-QARRAMRALRGLVRLKSLVEGP-TVKRQVASTLKCMQTLSRVQS  174

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ M  + +  QK++  +   + +   L  EW    ++ E+I  K+ ++ EAA++
Sbjct  175  QIHSRRIRMSEENQALQKQLLQKRATELENLRLGEEWDDSLQSKEQIEAKLLKKFEAAMR  234

Query  644  RERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR--VQADPK  811
            RERA+AY+F+HQ  W+ N        + +    +WGWSW ERW+A RPWE R   + +P 
Sbjct  235  RERALAYSFTHQQSWK-NPSKLTNHMFLDPSNPTWGWSWLERWMAARPWEGRSTTEKEPS  293

Query  812  KAGKTASLG  838
               KT+  G
Sbjct  294  NDLKTSISG  302



>ref|XP_010922527.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Elaeis guineensis]
Length=513

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 106/174 (61%), Gaps = 3/174 (2%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+ +R LRG V+ +  +E   +V  Q   TL+ + + +R+QS
Sbjct  141  EEIAAVKIQTAFRGY-MARRQLRALRGLVRLKTLVEG-NTVKRQATNTLRCMQTLARVQS  198

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I++RR+ M       Q+++Q + + D +  +L  EW    ++ E++   +  ++EAAV+
Sbjct  199  QIRSRRIRMTEDNHALQRQLQLKCERDLEGSKLGEEWDDSLQSKEQVEANLLNKQEAAVR  258

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            RERA+AYA+SHQW+++S       + +     WGWSW ERW+A RPWE    +D
Sbjct  259  RERALAYAYSHQWKSSS-RSVTPTFTDPNNPHWGWSWVERWMAARPWENHTMSD  311



>ref|XP_001753107.1| predicted protein [Physcomitrella patens]
 gb|EDQ82148.1| predicted protein, partial [Physcomitrella patens]
Length=168

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 108/172 (63%), Gaps = 9/172 (5%)
 Frame = +2

Query  293  AATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIK  472
            AA RIQ AFRA+   R+A+R L+G V+ Q  +   +++  Q A TL+ + +  R+Q+ I+
Sbjct  1    AALRIQTAFRAFL-ARRALRALKGIVRLQALVRG-HTIRRQAAITLRCMKALVRVQARIR  58

Query  473  ARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRER  652
            ARR+ M  QG+  Q+ I  +   +A++ E +  W + S T+E++  K+Q ++E  +KRER
Sbjct  59   ARRVRMSEQGQAVQRSIFERKCREARVLESERGWCAYSGTVEDLQAKLQLKKEGMIKRER  118

Query  653  AMAYAFSHQWRANS-----GHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            A+AYA  +QWR        G+YF QA  +   + WGWSW ERW+AVRPWE R
Sbjct  119  ALAYASIYQWRVPEVENPHGYYFNQARPD--NQHWGWSWLERWMAVRPWENR  168



>ref|XP_010922523.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Elaeis guineensis]
 ref|XP_010922524.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Elaeis guineensis]
 ref|XP_010922525.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Elaeis guineensis]
 ref|XP_010922526.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Elaeis guineensis]
Length=514

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 106/174 (61%), Gaps = 3/174 (2%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+ +R LRG V+ +  +E   +V  Q   TL+ + + +R+QS
Sbjct  142  EEIAAVKIQTAFRGY-MARRQLRALRGLVRLKTLVEG-NTVKRQATNTLRCMQTLARVQS  199

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I++RR+ M       Q+++Q + + D +  +L  EW    ++ E++   +  ++EAAV+
Sbjct  200  QIRSRRIRMTEDNHALQRQLQLKCERDLEGSKLGEEWDDSLQSKEQVEANLLNKQEAAVR  259

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            RERA+AYA+SHQW+++S       + +     WGWSW ERW+A RPWE    +D
Sbjct  260  RERALAYAYSHQWKSSS-RSVTPTFTDPNNPHWGWSWVERWMAARPWENHTMSD  312



>ref|XP_007150009.1| hypothetical protein PHAVU_005G118200g [Phaseolus vulgaris]
 gb|ESW22003.1| hypothetical protein PHAVU_005G118200g [Phaseolus vulgaris]
Length=430

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 128/223 (57%), Gaps = 16/223 (7%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            + ++ EE AA  IQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  87   DQQMREEWAAIHIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCMQAL  144

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++ARR+CM  + +  Q+K+Q  +  +A++ E++  W     ++E+I  KI +R+
Sbjct  145  VRVQARVRARRVCMALETQASQQKLQQNLANEARVREIEEGWCDSVGSVEDIQAKILKRQ  204

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR-----  793
            EAA KRERAMAYA SHQW+A S      + +   K SWGW+W ERW+AVRPWE R     
Sbjct  205  EAAAKRERAMAYALSHQWQAGSRQQPVSSGFEPDKSSWGWNWLERWMAVRPWENRFVDIN  264

Query  794  ------VQADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPA  904
                  V  +  K GK+   G    + S N  P S+     PA
Sbjct  265  VKDGVTVHENEAKDGKS---GTTPQLSSANKKPFSSNTHPNPA  304



>gb|AFR23353.1| IQ-DOMAIN 1-like isoform 1 [Glycine max]
Length=421

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 112/179 (63%), Gaps = 3/179 (2%)
 Frame = +2

Query  260  SSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHI  439
            ++ N ++ EE+AA RIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ +
Sbjct  83   AAHNQQMREELAAIRIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCM  140

Query  440  HSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQ  619
             +  R+++ ++AR +CM  + +  Q+K Q  +  +A++ E +  W     ++EEI  KI 
Sbjct  141  QALVRVRARVRARHVCMALETQASQQKHQQNLANEARVRETEEGWCDSVGSVEEIQAKIL  200

Query  620  QREEAAVKRERAMAYAFSHQWRANSGHY-FGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            +R+EAA KRERAMAYA SHQW+A           +   K SWGW+W ERW+AVRPWE R
Sbjct  201  KRQEAAAKRERAMAYALSHQWQAGPRQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  259



>ref|XP_006587475.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Glycine max]
Length=381

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 111/177 (63%), Gaps = 2/177 (1%)
 Frame = +2

Query  263  SKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIH  442
            + N+++ EE AA RIQ AFR +   R+A+R L+G V+ Q A+   Y+V  Q A TL+ + 
Sbjct  87   AHNHQMREEWAAIRIQTAFRGFL-ARRALRALKGVVRLQ-ALVRGYAVRKQAAITLRCMQ  144

Query  443  SWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQ  622
            +  R+Q+ ++AR + +  + +  Q+K++ ++    ++ E +  W     ++EEI  KI +
Sbjct  145  ALVRVQARVRARHVRIALETQATQQKLKQKLANKVQVRETEEGWCDSIGSIEEIQAKILK  204

Query  623  REEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            R+EAA KR RAMAYA +HQW+A S      + +   K +WGW+W ERW+AVRPWE R
Sbjct  205  RQEAAAKRGRAMAYALAHQWQAGSRQQPVSSGFEPDKSNWGWNWLERWMAVRPWENR  261



>ref|XP_010922528.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Elaeis guineensis]
Length=510

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 106/174 (61%), Gaps = 3/174 (2%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+ +R LRG V+ +  +E   +V  Q   TL+ + + +R+QS
Sbjct  138  EEIAAVKIQTAFRGY-MARRQLRALRGLVRLKTLVEG-NTVKRQATNTLRCMQTLARVQS  195

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I++RR+ M       Q+++Q + + D +  +L  EW    ++ E++   +  ++EAAV+
Sbjct  196  QIRSRRIRMTEDNHALQRQLQLKCERDLEGSKLGEEWDDSLQSKEQVEANLLNKQEAAVR  255

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            RERA+AYA+SHQW+++S       + +     WGWSW ERW+A RPWE    +D
Sbjct  256  RERALAYAYSHQWKSSS-RSVTPTFTDPNNPHWGWSWVERWMAARPWENHTMSD  308



>gb|AFR23354.1| IQ-DOMAIN 1-like isoform 4 [Glycine max]
Length=418

 Score =   121 bits (303),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 114/179 (64%), Gaps = 3/179 (2%)
 Frame = +2

Query  260  SSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHI  439
            ++ N ++ EE AA  IQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ +
Sbjct  80   AAHNQQMREEWAAIHIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCM  137

Query  440  HSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQ  619
             +  R+Q+ ++ARR+CM  + +  Q+K Q  +  +A++ E++  W     ++EEI  K+ 
Sbjct  138  QALVRVQARVRARRVCMALETQASQQKHQQNLANEARVREIEEGWCDSVGSVEEIQAKLL  197

Query  620  QREEAAVKRERAMAYAFSHQWRANSGHY-FGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            +R+EAA KRERAMAYA SHQW+A SG        +   K SWGW+W ERW+AVRPWE R
Sbjct  198  KRQEAAAKRERAMAYALSHQWQAGSGQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  256



>ref|XP_007009749.1| IQ-domain 3 isoform 5 [Theobroma cacao]
 gb|EOY18559.1| IQ-domain 3 isoform 5 [Theobroma cacao]
Length=402

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 131/235 (56%), Gaps = 18/235 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+A+R LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  31   EEIAAIKIQTAFRGYLA-RRALRALRGLVRLKSLIQG-QSVKRQATSTLRCMQTLARVQS  88

Query  464  EIKARRLCMV-----TQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +I+ARR+ M+      Q +L+QK  +   KL A + E   +W+  +++ E+I  + Q ++
Sbjct  89   QIRARRIRMLEENQALQRQLQQKCEKELEKLRASMGE---DWNDSTQSKEQIDARQQNKQ  145

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
            EAA++RERA+AYAFSHQ  W+ NS       + +     WGWSW ERW+A RPWE R   
Sbjct  146  EAAMRRERALAYAFSHQQSWK-NSSKSVNPTFMDPNNPHWGWSWLERWMAARPWENRSTT  204

Query  803  DPKKAGKTASLGPVKLVV-----SVNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
            D    G   S+G   + +     + +   L+N    +P    S   P  Q+P  P
Sbjct  205  DNHDRGSVKSMGARSMSIGEISRAYSRRDLNNDNKPSPTPPKSSRPPSRQSPSTP  259



>ref|XP_010906025.1| PREDICTED: protein IQ-DOMAIN 1-like [Elaeis guineensis]
 ref|XP_010906026.1| PREDICTED: protein IQ-DOMAIN 1-like [Elaeis guineensis]
 ref|XP_010906027.1| PREDICTED: protein IQ-DOMAIN 1-like [Elaeis guineensis]
Length=439

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 138/233 (59%), Gaps = 16/233 (7%)
 Frame = +2

Query  233  SVRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVND  412
            S++ +A+G +  N+   E+ AAT IQ AFRA+   R+A+R L+G V+ Q  +   ++V  
Sbjct  82   SLQVQASGQTELNSR--EDWAATVIQTAFRAF-LARRALRALKGLVRLQALVRG-HAVRK  137

Query  413  QVAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSET  592
            Q A TL+ + +  R+Q+ ++ARR+ M  + +L Q+K+Q Q  L+A++ E +  W     +
Sbjct  138  QAAITLRCMQALVRVQARVRARRVRMALENQLGQQKVQQQQALEARVRETEEGWCDSVGS  197

Query  593  MEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIA  772
            +EEI  K+ +R+EAA KRERAMAYA +HQW+A S      + +   K +WGW+W ERW+A
Sbjct  198  VEEIQAKLLKRQEAAAKRERAMAYALTHQWQAGSRQTVAPSGFEPDKNNWGWNWLERWMA  257

Query  773  VRPWEIRVQADPKKAGKTASLGPVKLVVSVNNPPLSNGKISTPAR-KPSDHNP  928
            VRPWE R      K G         ++V  N PP   GK  T A+ KP+   P
Sbjct  258  VRPWENRFLDINLKDG---------VMVHENGPP--EGKYGTRAQNKPAGKKP  299



>gb|KHN48320.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=470

 Score =   120 bits (302),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 109/175 (62%), Gaps = 5/175 (3%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N++ TEE+AA RIQ+AFR Y   R+ +R LRG V+ +  +E    V  Q  +TL+ + ++
Sbjct  106  NSKPTEEVAAIRIQKAFRGY-LARRELRALRGLVRLRSLMEGPV-VKRQAISTLRSMQTF  163

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            + +Q++I++RRL M+ + +  QK++  +   + +   L  EW    ++ E++  K+  + 
Sbjct  164  AHLQTQIRSRRLRMLEENQELQKQLLQKHAKELESMRLGEEWDDSIQSKEQVEAKLLSKY  223

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE  787
            EAA++RERAMAY+FSHQ  W+ N+       + +    +WGWSW ERW+A RPWE
Sbjct  224  EAAMRRERAMAYSFSHQQNWK-NASRSVNPMFMDQTNPAWGWSWLERWMAARPWE  277



>emb|CDP04285.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 117/210 (56%), Gaps = 18/210 (9%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+A+R LRG V+ +  ++   SV  Q   TL+ + + +R+QS
Sbjct  115  EEIAAIKIQTAFRGY-MARRALRALRGLVRLKTMVQG-QSVKRQATTTLRCMQALARVQS  172

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQV----EWSSGSETMEEILQKIQQREE  631
            +I ARR+ M  +    Q++IQ +   + +L +L+      W+  +++ E+    +Q + E
Sbjct  173  QIHARRIRMSEENEALQRQIQQKR--EKELEKLRTSIGDNWNDSTQSKEQHEATLQSKHE  230

Query  632  AAVKRERAMAYAFSHQW-RANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADP  808
            AA++RERA+AYA+SHQ  R NS     Q + +     WGWSW ERW+A RPWE +   D 
Sbjct  231  AAIRRERALAYAYSHQQTRRNSSKSANQTFMDPNNPQWGWSWLERWMAARPWESKTAVDK  290

Query  809  ---------KKAGKTASLGPVKLVVSVNNP  871
                     K A + AS+G  +     N P
Sbjct  291  ELNSDRASLKSATRAASVGEFRSYYDDNKP  320



>ref|XP_003541403.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Glycine max]
 ref|XP_006594122.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Glycine max]
Length=470

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 109/175 (62%), Gaps = 5/175 (3%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N++ TEE+AA RIQ+AFR Y   R+ +R LRG V+ +  +E    V  Q  +TL+ + ++
Sbjct  106  NSKPTEEVAAIRIQKAFRGY-LARRELRALRGLVRLRSLMEGPV-VKRQAISTLRSMQTF  163

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            + +Q++I++RRL M+ + +  QK++  +   + +   L  EW    ++ E++  K+  + 
Sbjct  164  AHLQTQIRSRRLRMLEENQELQKQLLQKHAKELESIRLGEEWDDSIQSKEQVEAKLLSKY  223

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE  787
            EAA++RERAMAY+FSHQ  W+ N+       + +    +WGWSW ERW+A RPWE
Sbjct  224  EAAMRRERAMAYSFSHQQNWK-NASRSVNPMFMDPTNPAWGWSWLERWMAARPWE  277



>ref|XP_007009747.1| IQ-domain 3 isoform 3 [Theobroma cacao]
 ref|XP_007009748.1| IQ-domain 3 isoform 3 [Theobroma cacao]
 gb|EOY18557.1| IQ-domain 3 isoform 3 [Theobroma cacao]
 gb|EOY18558.1| IQ-domain 3 isoform 3 [Theobroma cacao]
Length=485

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 131/235 (56%), Gaps = 18/235 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+A+R LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  114  EEIAAIKIQTAFRGYLA-RRALRALRGLVRLKSLIQG-QSVKRQATSTLRCMQTLARVQS  171

Query  464  EIKARRLCMV-----TQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +I+ARR+ M+      Q +L+QK  +   KL A + E   +W+  +++ E+I  + Q ++
Sbjct  172  QIRARRIRMLEENQALQRQLQQKCEKELEKLRASMGE---DWNDSTQSKEQIDARQQNKQ  228

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
            EAA++RERA+AYAFSHQ  W+ NS       + +     WGWSW ERW+A RPWE R   
Sbjct  229  EAAMRRERALAYAFSHQQSWK-NSSKSVNPTFMDPNNPHWGWSWLERWMAARPWENRSTT  287

Query  803  DPKKAGKTASLGPVKLVV-----SVNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
            D    G   S+G   + +     + +   L+N    +P    S   P  Q+P  P
Sbjct  288  DNHDRGSVKSMGARSMSIGEISRAYSRRDLNNDNKPSPTPPKSSRPPSRQSPSTP  342



>ref|XP_006340461.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Solanum tuberosum]
Length=460

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 107/180 (59%), Gaps = 9/180 (5%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA RIQ AFR Y   R+A++ LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  116  EEIAAIRIQTAFRGY-LARRALKALRGLVRLKTMIQG-QSVKRQATSTLRCMQTLARVQS  173

Query  464  EIKARRLCM-----VTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++ARR+ M       Q +L+QK  + Q KL A       +W+  + + E++   +Q ++
Sbjct  174  QVRARRIRMSEENQTLQRQLQQKHEKEQEKLKASSQSGD-DWNDSTRSKEQVDANLQMKQ  232

Query  629  EAAVKRERAMAYAFSHQ-WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            EAA +RERA+AYA++HQ  R N      Q + +     WGWSW ERW+A RPWE +   D
Sbjct  233  EAATRRERALAYAYTHQSTRRNPSKSTNQTFMDPNNPHWGWSWLERWMAARPWEDKCAMD  292



>ref|XP_004251217.1| PREDICTED: protein IQ-DOMAIN 1 [Solanum lycopersicum]
Length=448

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 116/172 (67%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            + EE+AA RIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  96   MREELAAIRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  153

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ M  + + +Q+K++ Q++ DA++ E++  W     ++E+I +K+ +R+EAA
Sbjct  154  QARVRARRVRMSLESQTEQQKVEQQLEHDARVREIEEGWCDSVGSVEQIQEKLLKRQEAA  213

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R
Sbjct  214  AKRERAMAYALAHQWQAGSRQQATLSGFEPDKSSWGWNWLERWMAVRPWENR  265



>ref|XP_006601026.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Glycine max]
 ref|XP_006601027.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Glycine max]
 ref|XP_006601028.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Glycine max]
 ref|XP_006601029.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X4 [Glycine max]
 ref|XP_006601030.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X5 [Glycine max]
 ref|XP_006601031.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X6 [Glycine max]
 gb|KHN28125.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=461

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 107/175 (61%), Gaps = 13/175 (7%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA ++Q AFR Y   R+A+R LRG V+ +  ++   SV  Q A+TL+ + + +R+QS
Sbjct  104  EEIAAIKVQTAFRGY-MARRALRALRGLVRLKTLVQG-QSVKRQAASTLRSMQTLARLQS  161

Query  464  EIKARRLCM-----VTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +I+ RR+ M       Q +L QK  +   KL A + E   EW   S++ E+I  K+  R+
Sbjct  162  QIRERRIRMSEENQALQRQLHQKHEKELEKLRAAVGE---EWDDSSQSKEQIEAKLLHRQ  218

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWE  787
            EAA++RERA+AY+FSHQ  W+ +S       + +     WGWSW ERW+A RPW+
Sbjct  219  EAALRRERALAYSFSHQQTWKGSS-KSLNPTFMDPNNPQWGWSWLERWMATRPWD  272



>ref|XP_009333751.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
Length=490

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 109/177 (62%), Gaps = 6/177 (3%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            +E+AA +IQ AFR +   R+A+R LRG V+ +  ++   SV  Q   TL+ + + +R+QS
Sbjct  126  QEVAAIKIQTAFRGH-MARRALRALRGLVRLKSLLQG-QSVKRQATTTLRCMQTLARVQS  183

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDA---KLHELQVEWSSGSETMEEILQKIQQREEA  634
            EI+ARR+ M  + +  Q+++Q + + +    K   +  +W    ++ E++  K+Q ++EA
Sbjct  184  EIRARRIRMSEENQAFQRQLQQKQEKELEKIKKDSMGEDWDDSIQSKEQVEAKLQMKQEA  243

Query  635  AVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            A++RERA+AY+FSHQ + NS       + +     WGWSW ERW+A RPWE R  AD
Sbjct  244  AMRRERALAYSFSHQ-KMNSSKSALPTFMDPSNPHWGWSWLERWVAARPWESRSTAD  299



>ref|XP_006340462.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Solanum tuberosum]
Length=459

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 107/180 (59%), Gaps = 10/180 (6%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA RIQ AFR Y   R+A++ LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  116  EEIAAIRIQTAFRGY-LARRALKALRGLVRLKTMIQG-QSVKRQATSTLRCMQTLARVQS  173

Query  464  EIKARRLCM-----VTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++ARR+ M       Q +L+QK  + Q KL  K      +W+  + + E++   +Q ++
Sbjct  174  QVRARRIRMSEENQTLQRQLQQKHEKEQEKL--KASSSGDDWNDSTRSKEQVDANLQMKQ  231

Query  629  EAAVKRERAMAYAFSHQ-WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            EAA +RERA+AYA++HQ  R N      Q + +     WGWSW ERW+A RPWE +   D
Sbjct  232  EAATRRERALAYAYTHQSTRRNPSKSTNQTFMDPNNPHWGWSWLERWMAARPWEDKCAMD  291



>ref|XP_010319837.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X4 [Solanum lycopersicum]
Length=457

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 106/180 (59%), Gaps = 9/180 (5%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA RIQ  FR Y   R+A++ LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  113  EEIAAIRIQTVFRGY-LARRALKALRGLVRLKAMIQG-QSVKRQATSTLRCMQTLARVQS  170

Query  464  EIKARRLCM-----VTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++ARR+ M       Q +L+QK  + Q KL A       +W+  + + E++   +Q ++
Sbjct  171  QVRARRIRMSEENQTLQRQLQQKHEKEQEKLKASSQSGD-DWNDSTRSKEQVDANLQMKQ  229

Query  629  EAAVKRERAMAYAFSHQ-WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            EAA +RERA+AYA++HQ  R N      Q + +     WGWSW ERW+A RPWE +   D
Sbjct  230  EAATRRERALAYAYTHQPTRRNPSKSTNQTFMDPNNPHWGWSWLERWMAARPWEDKCAMD  289



>ref|XP_010319835.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Solanum lycopersicum]
Length=459

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 106/180 (59%), Gaps = 9/180 (5%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA RIQ  FR Y   R+A++ LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  115  EEIAAIRIQTVFRGY-LARRALKALRGLVRLKAMIQG-QSVKRQATSTLRCMQTLARVQS  172

Query  464  EIKARRLCM-----VTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++ARR+ M       Q +L+QK  + Q KL A       +W+  + + E++   +Q ++
Sbjct  173  QVRARRIRMSEENQTLQRQLQQKHEKEQEKLKASSQSGD-DWNDSTRSKEQVDANLQMKQ  231

Query  629  EAAVKRERAMAYAFSHQ-WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            EAA +RERA+AYA++HQ  R N      Q + +     WGWSW ERW+A RPWE +   D
Sbjct  232  EAATRRERALAYAYTHQPTRRNPSKSTNQTFMDPNNPHWGWSWLERWMAARPWEDKCAMD  291



>ref|XP_004237517.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Solanum lycopersicum]
 ref|XP_010319834.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Solanum lycopersicum]
Length=460

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 106/180 (59%), Gaps = 9/180 (5%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA RIQ  FR Y   R+A++ LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  116  EEIAAIRIQTVFRGY-LARRALKALRGLVRLKAMIQG-QSVKRQATSTLRCMQTLARVQS  173

Query  464  EIKARRLCM-----VTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++ARR+ M       Q +L+QK  + Q KL A       +W+  + + E++   +Q ++
Sbjct  174  QVRARRIRMSEENQTLQRQLQQKHEKEQEKLKASSQSGD-DWNDSTRSKEQVDANLQMKQ  232

Query  629  EAAVKRERAMAYAFSHQ-WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            EAA +RERA+AYA++HQ  R N      Q + +     WGWSW ERW+A RPWE +   D
Sbjct  233  EAATRRERALAYAYTHQPTRRNPSKSTNQTFMDPNNPHWGWSWLERWMAARPWEDKCAMD  292



>ref|XP_007009745.1| IQ-domain 3 isoform 1 [Theobroma cacao]
 gb|EOY18555.1| IQ-domain 3 isoform 1 [Theobroma cacao]
Length=556

 Score =   119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 131/235 (56%), Gaps = 18/235 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+A+R LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  185  EEIAAIKIQTAFRGYLA-RRALRALRGLVRLKSLIQG-QSVKRQATSTLRCMQTLARVQS  242

Query  464  EIKARRLCMV-----TQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +I+ARR+ M+      Q +L+QK  +   KL A + E   +W+  +++ E+I  + Q ++
Sbjct  243  QIRARRIRMLEENQALQRQLQQKCEKELEKLRASMGE---DWNDSTQSKEQIDARQQNKQ  299

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
            EAA++RERA+AYAFSHQ  W+ NS       + +     WGWSW ERW+A RPWE R   
Sbjct  300  EAAMRRERALAYAFSHQQSWK-NSSKSVNPTFMDPNNPHWGWSWLERWMAARPWENRSTT  358

Query  803  DPKKAGKTASLGPVKLVV-----SVNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
            D    G   S+G   + +     + +   L+N    +P    S   P  Q+P  P
Sbjct  359  DNHDRGSVKSMGARSMSIGEISRAYSRRDLNNDNKPSPTPPKSSRPPSRQSPSTP  413



>gb|KDP29080.1| hypothetical protein JCGZ_16469 [Jatropha curcas]
Length=489

 Score =   119 bits (297),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 106/176 (60%), Gaps = 5/176 (3%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AA +IQ AFR Y   R+A+R LRG V+ +  IE   +V  Q A TL+ + + +R+QS
Sbjct  125  EEVAAIKIQTAFRGY-MARRALRALRGLVRLRSLIEGP-TVKRQAAHTLQCMQTLARVQS  182

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RRL +  + +  Q+++  +   + +   +  EW    ++ E+I   +  + EAA++
Sbjct  183  QIHSRRLRISEENQALQRQLLQKHAQELEKLRMGEEWDDSLQSKEQIQANLLNKYEAAMR  242

Query  644  RERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            RERAMAY+F+HQ  W+ NS  +    + + G  SWGWSW ERW+A  PW+ R   D
Sbjct  243  RERAMAYSFTHQQTWK-NSSSHANPIFMSSGNPSWGWSWLERWMAAHPWDSRSTTD  297



>ref|XP_001778214.1| predicted protein [Physcomitrella patens]
 gb|EDQ56996.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = +2

Query  287  EIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSE  466
            E AA RIQ AFR +   R+A+R L+G V+ Q  +   ++V  Q A TL+ + +  R+Q+ 
Sbjct  17   EWAAIRIQTAFRGFL-ARRALRALKGLVRLQALVRG-HTVRRQAAITLRCMQALVRVQAR  74

Query  467  IKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKR  646
            ++ARR+ M  QG   Q+ I ++  ++A+L E ++ W + S T +++  K+QQR+E  +KR
Sbjct  75   VRARRVRMSQQGLAVQRTIGHRRLIEAQLRESELGWCASSRTKQDLQAKLQQRQEGLMKR  134

Query  647  ERAMAYAFSHQWRANSGHYFGQAYYNL--GKESWGWSWKERWIAVRPWEIRVQAD  805
            ERA+AYA SHQWR  S     Q Y+N    K  WGWSW ERW+A RPWE R   D
Sbjct  135  ERAIAYANSHQWRPESNGGSSQVYFNNEGDKPHWGWSWLERWMAARPWENRPLKD  189



>ref|XP_011102231.1| PREDICTED: protein IQ-DOMAIN 1-like [Sesamum indicum]
Length=455

 Score =   118 bits (295),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 126/232 (54%), Gaps = 20/232 (9%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+A+R LRG V+ +  I    S   Q AATLK + + +R+QS
Sbjct  115  EEIAAIKIQTAFRGYLA-RRALRALRGLVRLKSLI-GGKSAKRQSAATLKCMQTLARVQS  172

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVE----WSSGSETMEEILQKIQQREE  631
            EI+ARRL M  +      ++Q Q K + +L +L+V     W    ++ E+I   +  R+E
Sbjct  173  EIRARRLRMSDKN--SAIQLQIQQKHEKELEKLRVSIGENWDDSLQSKEQIEANLHSRQE  230

Query  632  AAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            AA +RERA+AYA+SHQ  WR NS     Q + +     WGWSW ERW+A RPWE    AD
Sbjct  231  AAKRRERALAYAYSHQQTWR-NSSSSANQTFMDPNNPRWGWSWLERWMAARPWENITAAD  289

Query  806  PKKAGKTASLGPVKLV---VSVNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
              K      L P   +   VSV    L + KI +P  K     P  Q+P  P
Sbjct  290  --KELNNDLLSPSSTINRSVSV----LGDAKIHSPTAKKQSRPPSRQSPSTP  335



>ref|XP_010247740.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
 ref|XP_010247746.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
 ref|XP_010247755.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
 ref|XP_010247761.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
 ref|XP_010247769.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
 ref|XP_010247774.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
Length=437

 Score =   118 bits (295),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 113/170 (66%), Gaps = 2/170 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+Q+
Sbjct  95   EEWAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRVQA  152

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++ARR+ M  + +++++K++ Q+  +A + E++  W     ++EEI  K+ +R+EAA K
Sbjct  153  RVRARRVRMALESQMEEQKLKKQLAHEAHVREIEEGWCDSIGSVEEIQTKLIKRKEAAAK  212

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            RERAMAYA SHQW+A S      A +   K +WGW+W ERW+AVRPWE R
Sbjct  213  RERAMAYALSHQWQAGSRQQSAPAGFEPDKSNWGWNWLERWMAVRPWENR  262



>ref|XP_007012312.1| IQ-domain 6 [Theobroma cacao]
 gb|EOY29931.1| IQ-domain 6 [Theobroma cacao]
Length=481

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 109/192 (57%), Gaps = 18/192 (9%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            +E AA RIQ AFR +   R+A+R L+G V+ Q A+     V  Q A TL+ + +  R+Q+
Sbjct  119  QEWAAIRIQTAFRGF-LARRALRALKGIVRLQ-ALVRGRQVRKQAAVTLRCMQALVRVQA  176

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++A R+ M T+G+  QK +  +      L E +  W     T+++I  K+Q R+E A K
Sbjct  177  RVRACRVRMSTEGQAVQKMLDERRSKADILKEAEDGWCDSKGTLDDIKAKLQMRQEGAFK  236

Query  644  RERAMAYAFSH-QWRANSGH---------YFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            RERA+AY+ +  QWR+N G          Y     ++  K SWGWSW ERW+A RPWE R
Sbjct  237  RERALAYSLAQKQWRSNPGSTTRTNTSIPYLKNQEFD--KNSWGWSWLERWMAARPWETR  294

Query  794  V----QADPKKA  817
            +    QADP +A
Sbjct  295  LMEQSQADPSEA  306



>ref|XP_010319836.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Solanum lycopersicum]
Length=459

 Score =   118 bits (295),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 106/180 (59%), Gaps = 10/180 (6%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA RIQ  FR Y   R+A++ LRG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  116  EEIAAIRIQTVFRGY-LARRALKALRGLVRLKAMIQG-QSVKRQATSTLRCMQTLARVQS  173

Query  464  EIKARRLCM-----VTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +++ARR+ M       Q +L+QK  + Q KL  K      +W+  + + E++   +Q ++
Sbjct  174  QVRARRIRMSEENQTLQRQLQQKHEKEQEKL--KASSSGDDWNDSTRSKEQVDANLQMKQ  231

Query  629  EAAVKRERAMAYAFSHQ-WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            EAA +RERA+AYA++HQ  R N      Q + +     WGWSW ERW+A RPWE +   D
Sbjct  232  EAATRRERALAYAYTHQPTRRNPSKSTNQTFMDPNNPHWGWSWLERWMAARPWEDKCAMD  291



>gb|KHN36509.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=424

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 111/176 (63%), Gaps = 3/176 (2%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N ++ EE AA  IQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  82   NQQMREEWAAIHIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCMQAL  139

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++ARR+CM  + +  Q+K Q  +  +A++ E++  W     ++EEI  K+ +R+
Sbjct  140  VRVQARVRARRVCMALETQASQQKHQQNLANEARVREIEEGWCDSVGSVEEIQAKLLKRQ  199

Query  629  EAAVKRERAMAYAFSHQWRANS-GHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA SHQW+A S         +   K SWGW+W ERW+AVRPWE R
Sbjct  200  EAAAKRERAMAYALSHQWQAGSRQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  255



>ref|XP_006594910.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Glycine max]
Length=425

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 111/176 (63%), Gaps = 3/176 (2%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N ++ EE AA  IQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  83   NQQMREEWAAIHIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCMQAL  140

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++ARR+CM  + +  Q+K Q  +  +A++ E++  W     ++EEI  K+ +R+
Sbjct  141  VRVQARVRARRVCMALETQASQQKHQQNLANEARVREIEEGWCDSVGSVEEIQAKLLKRQ  200

Query  629  EAAVKRERAMAYAFSHQWRANS-GHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA SHQW+A S         +   K SWGW+W ERW+AVRPWE R
Sbjct  201  EAAAKRERAMAYALSHQWQAGSRQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  256



>ref|XP_003543406.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Glycine max]
Length=424

 Score =   117 bits (293),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 111/176 (63%), Gaps = 3/176 (2%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N ++ EE AA  IQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  83   NQQMREEWAAIHIQTAFRGF-LARRALRALKGVVRLQ-ALVRGHAVRKQAAITLRCMQAL  140

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++ARR+CM  + +  Q+K Q  +  +A++ E++  W     ++EEI  K+ +R+
Sbjct  141  VRVQARVRARRVCMALETQASQQKHQQNLANEARVREIEEGWCDSVGSVEEIQAKLLKRQ  200

Query  629  EAAVKRERAMAYAFSHQWRANS-GHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA SHQW+A S         +   K SWGW+W ERW+AVRPWE R
Sbjct  201  EAAAKRERAMAYALSHQWQAGSRQQPVSSGGFEPDKNSWGWNWLERWMAVRPWENR  256



>ref|XP_006340320.1| PREDICTED: protein IQ-DOMAIN 1-like [Solanum tuberosum]
Length=447

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 115/172 (67%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            + EE+AA RIQ AFR +   R+A R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  96   MREELAAIRIQTAFRGF-LARRAFRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  153

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ M  + + +Q+K++ Q++ DA++ E++  W     ++E+I +K+ +R+EAA
Sbjct  154  QARVRARRVRMSLESQTEQQKLEQQLEHDARVREIEEGWCDSIGSVEQIQEKLLKRQEAA  213

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R
Sbjct  214  AKRERAMAYALAHQWQAGSRQQATLSGFEPDKSSWGWNWLERWMAVRPWENR  265



>emb|CDY10618.1| BnaA05g17440D [Brassica napus]
Length=406

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 116/186 (62%), Gaps = 2/186 (1%)
 Frame = +2

Query  236  VRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            V T  + G++   +  E +AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q
Sbjct  68   VSTSTSYGAANEEQRKEHMAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQ  125

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             A TL+ + +  R+Q+ ++ARR+ +  +     + +Q Q+  +A++ E++  W     ++
Sbjct  126  AAVTLRCMQALVRVQARVRARRVRLALESETGPQMLQQQLADEARVREIEEGWCDSIGSV  185

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            E+I  KI +R+EAA KRERAMAYA +HQW+A +      + +   K +WGW+W ERW+AV
Sbjct  186  EQIQAKILKRQEAAAKRERAMAYALTHQWQAGTRQLSAHSGFQPDKNNWGWNWLERWMAV  245

Query  776  RPWEIR  793
            RPWE R
Sbjct  246  RPWENR  251



>gb|KDP42966.1| hypothetical protein JCGZ_23908 [Jatropha curcas]
Length=434

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L EE AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  95   LREEWAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  152

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q+K+Q Q+  +A++ E++  W     ++EEI  K+ +R+EAA
Sbjct  153  QARVRARRVRLALESQTAQQKLQQQLANEARVREIEEGWCDSVGSVEEIQAKLLKRQEAA  212

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERAMAYA +HQW+A S  +   A +   K SWGW+W ERW+AVRPWE R
Sbjct  213  AKRERAMAYALAHQWQAGSRQHAVPAGFEPDKSSWGWNWLERWMAVRPWENR  264



>ref|XP_009145423.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Brassica rapa]
Length=406

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 116/186 (62%), Gaps = 2/186 (1%)
 Frame = +2

Query  236  VRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            V T  + G++   +  E +AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q
Sbjct  68   VSTSTSYGAANEEQRKEHMAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQ  125

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             A TL+ + +  R+Q+ ++ARR+ +  +     + +Q Q+  +A++ E++  W     ++
Sbjct  126  AAVTLRCMQALVRVQARVRARRVRLALESETGPQMLQQQLADEARVREIEEGWCDSIGSV  185

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            E+I  KI +R+EAA KRERAMAYA +HQW+A +      + +   K +WGW+W ERW+AV
Sbjct  186  EQIQAKILKRQEAAAKRERAMAYALTHQWQAGTRQLSAHSGFQPDKNNWGWNWLERWMAV  245

Query  776  RPWEIR  793
            RPWE R
Sbjct  246  RPWENR  251



>ref|XP_009145424.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Brassica rapa]
Length=404

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 116/186 (62%), Gaps = 2/186 (1%)
 Frame = +2

Query  236  VRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            V T  + G++   +  E +AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q
Sbjct  66   VSTSTSYGAANEEQRKEHMAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQ  123

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             A TL+ + +  R+Q+ ++ARR+ +  +     + +Q Q+  +A++ E++  W     ++
Sbjct  124  AAVTLRCMQALVRVQARVRARRVRLALESETGPQMLQQQLADEARVREIEEGWCDSIGSV  183

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            E+I  KI +R+EAA KRERAMAYA +HQW+A +      + +   K +WGW+W ERW+AV
Sbjct  184  EQIQAKILKRQEAAAKRERAMAYALTHQWQAGTRQLSAHSGFQPDKNNWGWNWLERWMAV  243

Query  776  RPWEIR  793
            RPWE R
Sbjct  244  RPWENR  249



>gb|KHG05214.1| Protein IQ-DOMAIN 1 -like protein [Gossypium arboreum]
Length=474

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 119/235 (51%), Gaps = 18/235 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA RIQ AFR Y   R       G V+ +  I    SV  Q   TL+ + + +R+QS
Sbjct  108  EEIAAIRIQTAFRGYLARRALRALR-GLVRLKSLIRG-QSVKRQATTTLRCMQTLARLQS  165

Query  464  EIKARRLCM-----VTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            EI ARR+ M       Q +L+QK  +   KL A + E   +W+  +++ E+I  +   ++
Sbjct  166  EISARRIRMSEENQALQRQLQQKCQKELEKLRAPMRE---DWNDSTQSKEQIEARQHNKQ  222

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
             A +KRERA+AYA+ HQ  W+ N      Q + +     WGWSW ERW+A RPWE++   
Sbjct  223  GATMKRERALAYAYCHQRSWK-NCSRSVNQTFMDPSNSHWGWSWLERWMAARPWEVQSTT  281

Query  803  DPKKAGKTASLGPVKLVVS-----VNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
            D    G   S+G   + +S      +   L+N    +P  + S   P  Q+P  P
Sbjct  282  DNNDRGSVKSMGACSISISEISRAYSRKDLNNDNKPSPTPQKSSRVPSRQSPSTP  336



>ref|XP_010253551.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
 ref|XP_010253552.1| PREDICTED: protein IQ-DOMAIN 1-like [Nelumbo nucifera]
Length=496

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 109/181 (60%), Gaps = 13/181 (7%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AA +IQ AFR Y   R+ +R LRG V+ +  I    +V  QVA TL+ + + +R+QS
Sbjct  124  EEVAAIKIQTAFRGY-LARRTLRALRGLVRLKTLING-NAVKRQVATTLQCMQTLARVQS  181

Query  464  EIKARRLCMVT-----QGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +I++RR+ M+      Q +L+QK+ +    L A + E   +W    ++ E+I   +  ++
Sbjct  182  QIRSRRIRMLEENQAHQHQLQQKREKELANLRASMGE---DWDDSLQSKEQIESNLLSKQ  238

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
             AA++RER++AYAFSHQ  W+ NS       + +     WGWSW ERW+A RPWE+R  A
Sbjct  239  VAAMRRERSLAYAFSHQQTWK-NSSRSVNPTFMDPNNPHWGWSWLERWMAARPWEVRSMA  297

Query  803  D  805
            +
Sbjct  298  E  298



>ref|XP_008446903.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
 ref|XP_008446905.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
 ref|XP_008446906.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
 ref|XP_008446907.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
 ref|XP_008446908.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
Length=464

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 105/181 (58%), Gaps = 7/181 (4%)
 Frame = +2

Query  275  ELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSR  454
            E++EE AA  IQ AFR Y   R+A+R L+  ++ +  ++   SV  QVA+TLK + + + 
Sbjct  109  EMSEETAAIMIQTAFRGYT-ARRALRALKSLMRLKTLVQG-QSVKRQVASTLKCMQTLTH  166

Query  455  IQSEIKARRLCMV--TQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
            +QSEI+ RR+ M    Q  L+Q + + +  L+     +   W+  +++  +I  K+  + 
Sbjct  167  LQSEIRVRRIRMSEENQALLRQLRNKREKDLEKLKFTMDGNWNHSTQSKAQIEAKLLNKH  226

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
            EAA++RERA+AYA+SHQ  WR NS         +     WGWSW ERW+A RPWE R   
Sbjct  227  EAAIRRERALAYAYSHQQTWR-NSSKTATPTVMDPNNPHWGWSWLERWMAARPWESRSTT  285

Query  803  D  805
            D
Sbjct  286  D  286



>ref|XP_004291529.1| PREDICTED: uncharacterized protein LOC101308834 [Fragaria vesca 
subsp. vesca]
Length=421

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 112/170 (66%), Gaps = 2/170 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AAT IQ +FR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+Q+
Sbjct  92   EEFAATCIQTSFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRVQA  149

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++ARR+ +  +G   ++++Q Q+  +A++ E++  W     ++EEI  K+ +R+EAAVK
Sbjct  150  RVRARRVRLALEGETTEERLQQQLANEARVREIEEGWCDSVGSVEEIQAKLLKRQEAAVK  209

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            RERAMAYA +HQW+A +      + +   K SWGW+W ERW+AVRPWE R
Sbjct  210  RERAMAYALAHQWQAGTRQQSAPSGFEPDKNSWGWNWLERWMAVRPWENR  259



>ref|XP_006644964.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Oryza brachyantha]
 ref|XP_006644965.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Oryza brachyantha]
Length=512

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 125/237 (53%), Gaps = 15/237 (6%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AA +IQ AFR Y   R       G V+ +  ++   +V  Q A TL    + +R+Q+
Sbjct  141  EELAAIKIQTAFRGYLARRALRALR-GLVRLKSLVDG-NAVKRQTAHTLHCTQTMTRVQT  198

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ M  + +  Q++ Q + + + +  ++  +W    ++ E++   +  ++EAA++
Sbjct  199  QIYSRRVKMEEEKQALQRQQQLKHQRELEKMKIDEDWDHSHQSKEQVEASLMMKQEAALR  258

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD------  805
            RERA+AYAFSHQW+ NSG      + + G  +WGWSW ERW+  RPWE R+ +D      
Sbjct  259  RERALAYAFSHQWK-NSGRNVAPTFTDQGNPNWGWSWMERWMTSRPWESRMVSDKEPKDH  317

Query  806  --PKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQEPV*TRKI  970
               K    +AS   V   +S+  P   N      +R PS  +P T   + P  T KI
Sbjct  318  YLTKNPSTSASRTYVPRAISIQRPATPNKS----SRPPSRQSPSTPPSRAPSVTGKI  370



>ref|XP_011005472.1| PREDICTED: protein IQ-DOMAIN 1-like [Populus euphratica]
Length=431

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 110/202 (54%), Gaps = 13/202 (6%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AA RIQ AFR +   R+A+R L+G V+ Q AI     V  Q A  L+ + +  R+Q+
Sbjct  88   EEWAAIRIQTAFRGF-LARRALRALKGVVRLQ-AIVRGRLVRKQAAVMLRCMRALVRVQA  145

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++A  + M  +G+  Q  +  +      L   + EW  G+ T+E++  K+Q R+E A+K
Sbjct  146  RVRAHPVRMSIEGQAVQNMLNERHSKADLLKHAEEEWCDGTGTLEDVKSKLQMRQEGALK  205

Query  644  RERAMAYAFSH-QWRAN-------SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQ  799
            RERA+AY+ S  QWR+N       +   +        K SWGWSW ERW+A +PWE R+ 
Sbjct  206  RERAIAYSLSQKQWRSNPSSNIRTNSSVYSFKNQEFDKNSWGWSWLERWMAAKPWESRLM  265

Query  800  ADPKKAGKTASLGPVKLVVSVN  865
               +++    S+ P K  V VN
Sbjct  266  ---EQSHTDPSVTPSKCCVDVN  284



>emb|CDY37387.1| BnaC05g30430D [Brassica napus]
Length=384

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 116/186 (62%), Gaps = 2/186 (1%)
 Frame = +2

Query  236  VRTEANGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQ  415
            V T  + G++   +  E +AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q
Sbjct  68   VSTSTSYGAANEEQRKEHMAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQ  125

Query  416  VAATLKHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETM  595
             A TL+ + +  R+Q+ ++ARR+ +  +     + +Q Q+  +A++ E++  W     ++
Sbjct  126  AAVTLRCMQALVRVQARVRARRVRLALESETGPQILQQQLADEARVREIEEGWCYSIGSV  185

Query  596  EEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAV  775
            E+I  KI +R+EAA KRERAMAYA +HQW+A +      + +   K +WGW+W ERW+AV
Sbjct  186  EQIQAKILKRQEAAAKRERAMAYALTHQWQAGTRQLSAHSGFQPDKNNWGWNWLERWMAV  245

Query  776  RPWEIR  793
            RPWE R
Sbjct  246  RPWENR  251



>ref|XP_010681705.1| PREDICTED: protein IQ-DOMAIN 1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010681706.1| PREDICTED: protein IQ-DOMAIN 1-like [Beta vulgaris subsp. vulgaris]
Length=490

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 104/181 (57%), Gaps = 10/181 (6%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AA +IQ AFR Y  GR+ +R LRG ++ +  ++   ++  Q A TLK + + +R+Q+
Sbjct  126  EEAAAIKIQTAFRGY-MGRRTLRALRGLMRLKTVMQG-QAIKRQTANTLKSMQTLARVQT  183

Query  464  EIKARRLCMVTQ--GRLkqkkiqnqikLDAKLHELQVE---WSSGSETMEEILQKIQQRE  628
            ++  RR  M  +   R K  + +   +   +L +LQ     W S  +T +EI  K+Q R 
Sbjct  184  QVHERRQRMAEENLARQKHIQQKYAKEQAKELDKLQQNGDGWDSSGKTKKEIEAKMQSRH  243

Query  629  EAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA  802
            EAA++RER MAYAF+HQ  W+A+S       + ++    WGWSW ERW+A RPWE     
Sbjct  244  EAAIRRERTMAYAFTHQQAWKASS-MSANTMFMDVNNPHWGWSWLERWLAARPWETATTP  302

Query  803  D  805
            D
Sbjct  303  D  303



>gb|KCW51631.1| hypothetical protein EUGRSUZ_J01122 [Eucalyptus grandis]
Length=447

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 131/237 (55%), Gaps = 19/237 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+A+R LRG V+ +  I+   SV  Q   TL+ + + +R+QS
Sbjct  119  EEIAAIKIQTAFRGYLA-RRALRALRGLVRLKTLIQG-QSVKRQANTTLRCMQTLARVQS  176

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR+ M  + +  Q+++Q + + + +   L  EW++  ++ E+I   +  ++EAA++
Sbjct  177  QIRARRIRMSEENQALQRQLQQKCEKELEKLGLGDEWNASVQSKEQIEANLLSKQEAAMR  236

Query  644  RERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            RERA+AYAFSHQ  WR+NS       + +     WGWSW ERW+A RPWE R   +    
Sbjct  237  RERALAYAFSHQQTWRSNS-KSTNPTFMDPHNPHWGWSWLERWMAARPWETRSTVEYSDQ  295

Query  818  GKT-------ASLGPVKLVVSVNNPPLSNGKISTPA-----RKPSDHNPETQTPQEP  952
            G          SLG +    S  N  L N    +PA     R PS H+P T   + P
Sbjct  296  GSVRSTTNYALSLGEISRAYSRRN--LDNDNKPSPAAHRPGRAPSRHSPSTPPSKAP  350



>ref|NP_001044716.1| Os01g0833800 [Oryza sativa Japonica Group]
 dbj|BAD73780.1| putative SF16 protein [Oryza sativa Japonica Group]
 dbj|BAF06630.1| Os01g0833800 [Oryza sativa Japonica Group]
 gb|EEC71750.1| hypothetical protein OsI_04322 [Oryza sativa Indica Group]
 gb|EEE55631.1| hypothetical protein OsJ_03977 [Oryza sativa Japonica Group]
Length=500

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 126/237 (53%), Gaps = 15/237 (6%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            +E+AA +IQ AFR Y   R       G V+ +  ++   +V  Q A TL    + +R+Q+
Sbjct  141  DELAAIKIQTAFRGYLARRALRALR-GLVRLKSLVDGN-AVKRQTAHTLHCTQTMTRVQT  198

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ M  + +  Q+++Q + + + +  ++  +W    ++ E++   +  ++EAA++
Sbjct  199  QIYSRRVKMEEEKQALQRQLQLKHQRELEKMKIDEDWDHSHQSKEQVETSLMMKQEAALR  258

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD------  805
            RERA+AYAFSHQW+ NSG      + + G  +WGWSW ERW+  RPWE RV +D      
Sbjct  259  RERALAYAFSHQWK-NSGRTITPTFTDQGNPNWGWSWMERWMTSRPWESRVISDKDPKDH  317

Query  806  --PKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQEPV*TRKI  970
               K    +AS   V   +S+  P   N      +R PS  +P T   + P  T KI
Sbjct  318  YSTKNPSTSASRTYVPRAISIQRPATPNKS----SRPPSRQSPSTPPSRVPSVTGKI  370



>ref|XP_002513725.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF48672.1| calmodulin binding protein, putative [Ricinus communis]
Length=435

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 113/172 (66%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L EE AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  93   LREEWAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  150

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ M  + +  Q+K+Q Q+  +A++ E++  W     ++EEI  K+ +R+EAA
Sbjct  151  QARVRARRVRMALESQTAQQKLQQQLANEARVREIEEGWCDSVGSVEEIQAKLLKRQEAA  210

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R
Sbjct  211  AKRERAMAYALAHQWQAGSRQQAVLSGFEPDKSSWGWNWLERWMAVRPWENR  262



>ref|XP_002314260.2| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEE88215.2| calmodulin-binding family protein [Populus trichocarpa]
Length=428

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 114/173 (66%), Gaps = 2/173 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            + EE+AATRIQ AFR +   R+A+R L+G V+ Q  +   ++V  Q A TL+ + +  R+
Sbjct  98   MREELAATRIQTAFRGF-LARRALRALKGLVRLQALVRG-HAVRKQAAITLRCMQALVRV  155

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q+K+Q Q+  +A++ E++  W     ++E+I  K+ +R+EAA
Sbjct  156  QARVRARRVRLALESQTAQQKLQQQLANEARVREIEEGWCDSVGSVEQIQAKLLKRQEAA  215

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV  796
             KRERA+AYA +HQW+A S H    + +   K SWGW+W ERW+AVRPWE R 
Sbjct  216  AKRERAIAYALAHQWQAGSRHQAVPSGFEPDKSSWGWNWLERWMAVRPWENRF  268



>ref|XP_003569041.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
Length=474

 Score =   116 bits (290),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 126/227 (56%), Gaps = 12/227 (5%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            +E+AA +IQ AFR Y   R      RG V+ +  +E   SV  Q A+TL+ + + +R+QS
Sbjct  105  DELAAIKIQTAFRGYLARRALRAL-RGLVRLKSLVEG-NSVKRQAASTLRCMQTLARVQS  162

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I++RRL M  + +  Q+++  + +LD+    +   W   +++ E+I   +  R+EAA++
Sbjct  163  QIRSRRLKMSEENQALQRQLLLKQELDS--LRMGEHWDDSTQSKEKIEASLVSRQEAAIR  220

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
            RERA+AYAFSHQW+++S       + +     WGWSW ERW+A +PWE R   D +    
Sbjct  221  RERALAYAFSHQWKSSS-RSSNPMFVDPNNPHWGWSWLERWMAAKPWEGRTGNDKE---S  276

Query  824  TASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQEPV*TR  964
                G VK  +S+N   L  G+I+    +     P+  +P  P  TR
Sbjct  277  NIDRGSVK-SISLN---LGEGEITKAFNRRGSSKPDKSSPTTPKLTR  319



>ref|XP_010032228.1| PREDICTED: protein IQ-DOMAIN 1-like [Eucalyptus grandis]
 ref|XP_010032229.1| PREDICTED: protein IQ-DOMAIN 1-like [Eucalyptus grandis]
 ref|XP_010032230.1| PREDICTED: protein IQ-DOMAIN 1-like [Eucalyptus grandis]
 ref|XP_010032231.1| PREDICTED: protein IQ-DOMAIN 1-like [Eucalyptus grandis]
 ref|XP_010032232.1| PREDICTED: protein IQ-DOMAIN 1-like [Eucalyptus grandis]
 gb|KCW51632.1| hypothetical protein EUGRSUZ_J01122 [Eucalyptus grandis]
Length=479

 Score =   116 bits (290),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 131/237 (55%), Gaps = 19/237 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+A+R LRG V+ +  I+   SV  Q   TL+ + + +R+QS
Sbjct  119  EEIAAIKIQTAFRGYLA-RRALRALRGLVRLKTLIQG-QSVKRQANTTLRCMQTLARVQS  176

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR+ M  + +  Q+++Q + + + +   L  EW++  ++ E+I   +  ++EAA++
Sbjct  177  QIRARRIRMSEENQALQRQLQQKCEKELEKLGLGDEWNASVQSKEQIEANLLSKQEAAMR  236

Query  644  RERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKA  817
            RERA+AYAFSHQ  WR+NS       + +     WGWSW ERW+A RPWE R   +    
Sbjct  237  RERALAYAFSHQQTWRSNS-KSTNPTFMDPHNPHWGWSWLERWMAARPWETRSTVEYSDQ  295

Query  818  GKT-------ASLGPVKLVVSVNNPPLSNGKISTPA-----RKPSDHNPETQTPQEP  952
            G          SLG +    S  N  L N    +PA     R PS H+P T   + P
Sbjct  296  GSVRSTTNYALSLGEISRAYSRRN--LDNDNKPSPAAHRPGRAPSRHSPSTPPSKAP  350



>gb|KHG12811.1| Protein IQ-DOMAIN 1 -like protein [Gossypium arboreum]
Length=466

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+A  +IQ AFR Y   ++A+R LRG V+ +  +E   +V  QV +TL+ + + SR+Q 
Sbjct  106  EEVAVIKIQTAFRVY-MAKRALRALRGLVRLKSLMEGP-AVKRQVTSTLRCMQTLSRVQC  163

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ RR+ M  + +  Q++I  +   +    ++  +W    ++ E+I   +  + EAA++
Sbjct  164  QIRMRRIRMTEENQALQRQILQKHAKELVNLQMGEDWDDSLQSKEQIEASLLSKHEAAMR  223

Query  644  RERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            RERAMAY+F+HQ  W+ N        + ++   +WGWSW ERW+A RPWE R
Sbjct  224  RERAMAYSFTHQQTWK-NGSKSMNPLFMDMNNLTWGWSWLERWMAARPWEGR  274



>ref|XP_004970476.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Setaria italica]
 ref|XP_004970477.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Setaria italica]
 ref|XP_004970478.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Setaria italica]
 ref|XP_004970479.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X4 [Setaria italica]
 ref|XP_004970480.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X5 [Setaria italica]
Length=498

 Score =   116 bits (290),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 132/236 (56%), Gaps = 12/236 (5%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AA +IQ AFR Y   R       G V+ +  ++   +V  Q A TL    + +R+Q+
Sbjct  138  EELAAIKIQTAFRGYLARRALRALR-GLVRLKSLVDG-NAVKRQTAHTLHCTQTMARVQT  195

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ +  + +  Q+++Q + + + +  ++  +W    ++ E+I   +  ++EAA++
Sbjct  196  KIYSRRVKLEEEKQALQRQLQLKHQRELEKMKIDEDWDHSHQSKEQIEASLIMKQEAALR  255

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQA---DPKK  814
            RERA+AYAFSHQWR NSG      +   G  +WGWSW ERW++ RPWE R+ A   DPK+
Sbjct  256  RERALAYAFSHQWR-NSGRTITPTFTEPGNPNWGWSWMERWMSARPWESRLAASDKDPKE  314

Query  815  AGKTASLGPVKLVVSVNNP-PLSNGKISTP---ARKPSDHNPETQTPQEPV*TRKI  970
              +T +  P    V  + P  +S  + +TP   +R PS  +P T   + P  + KI
Sbjct  315  --RTLTKNPSTSAVRTSVPRAISIQRPATPNKSSRPPSRQSPSTPPSKAPSTSGKI  368



>gb|KHG20568.1| Protein IQ-DOMAIN 1 [Gossypium arboreum]
 gb|KHG20569.1| Protein IQ-DOMAIN 1 [Gossypium arboreum]
Length=434

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 112/175 (64%), Gaps = 2/175 (1%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N    EE AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  88   NEHAREEWAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQAL  145

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++ARR+ +  + +  Q+K+Q Q+  +A + E++  W     ++EEI  K+ +R+
Sbjct  146  VRVQARVRARRVRLALENQTAQQKLQQQLANEAHVKEIEEGWCDSIGSVEEIQAKLLKRQ  205

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA +HQW+A S      A +   K SWGW+W ERW+AVRPWE R
Sbjct  206  EAAAKRERAMAYALAHQWQAGSRQQSVPAGFEPDKSSWGWNWLERWMAVRPWENR  260



>ref|XP_006833285.1| hypothetical protein AMTR_s00109p00027450 [Amborella trichopoda]
 gb|ERM98563.1| hypothetical protein AMTR_s00109p00027450 [Amborella trichopoda]
Length=444

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 100/180 (56%), Gaps = 7/180 (4%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AA RIQ AFR +   R       G V+ Q  +     V  Q A TL+ + +  R+Q+
Sbjct  84   EEWAAIRIQTAFRGFLARRALRALR-GLVRLQALVRGRL-VRKQAAITLRCMQALVRVQA  141

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             I+ARR+ M  +G+  QK ++ +   D    E++  W     T+EEI  K+Q R+E A+K
Sbjct  142  RIRARRVRMSNEGQAIQKMLEVRRNKDNPFREVEDGWCDSQGTLEEIRAKLQMRQEGAIK  201

Query  644  RERAMAYA-FSHQWRANSGHYFGQAYYNL----GKESWGWSWKERWIAVRPWEIRVQADP  808
            RERA+AY+ +  QWR+NS      A  +L     K SWGWSW ERW+A RPWE R+   P
Sbjct  202  RERAIAYSLYQQQWRSNSNTKLNIAMNSLKHEPDKNSWGWSWLERWMAARPWENRLMEQP  261



>ref|XP_011012762.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X4 [Populus euphratica]
Length=435

 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            + E++AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  92   MREQLAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  149

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q+K+Q Q+   A++ E++  W     ++E+I  K+ +R+EAA
Sbjct  150  QARVRARRVRLALESQTAQQKLQQQLANQARVREIEEGWCDSVGSVEQIQAKLLKRQEAA  209

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERA+AYA +HQW+A S H    + +   K SWGW+W ERW+AVRPWE R
Sbjct  210  AKRERAIAYALAHQWQAGSRHQAVPSGFEPDKSSWGWNWLERWMAVRPWENR  261



>ref|XP_011012761.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Populus euphratica]
Length=436

 Score =   115 bits (287),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            + E++AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  93   MREQLAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  150

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q+K+Q Q+   A++ E++  W     ++E+I  K+ +R+EAA
Sbjct  151  QARVRARRVRLALESQTAQQKLQQQLANQARVREIEEGWCDSVGSVEQIQAKLLKRQEAA  210

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERA+AYA +HQW+A S H    + +   K SWGW+W ERW+AVRPWE R
Sbjct  211  AKRERAIAYALAHQWQAGSRHQAVPSGFEPDKSSWGWNWLERWMAVRPWENR  262



>ref|XP_011012759.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
Length=439

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            + E++AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  93   MREQLAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  150

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q+K+Q Q+   A++ E++  W     ++E+I  K+ +R+EAA
Sbjct  151  QARVRARRVRLALESQTAQQKLQQQLANQARVREIEEGWCDSVGSVEQIQAKLLKRQEAA  210

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERA+AYA +HQW+A S H    + +   K SWGW+W ERW+AVRPWE R
Sbjct  211  AKRERAIAYALAHQWQAGSRHQAVPSGFEPDKSSWGWNWLERWMAVRPWENR  262



>emb|CDY24286.1| BnaC03g42590D [Brassica napus]
Length=404

 Score =   114 bits (285),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 109/170 (64%), Gaps = 2/170 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E +AATRIQ AFRA+   R+A+R L+G V+ Q  +   + V  Q A TL+ + +  R+Q+
Sbjct  86   EHMAATRIQSAFRAFL-ARRALRALKGLVRLQALVRG-HVVRKQAAVTLRCMQALVRVQA  143

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++ARR+ +  +    Q+ +Q Q+  +A++ E++  W     ++E+I  K+ +R+EAA K
Sbjct  144  RVRARRVRLSLECETGQQTLQQQVTDEARVREIEEGWCDSIGSVEQIQAKLVKRQEAAAK  203

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            RERAMAYA +HQW+A +      + +   K SWGW+W ERW+AVRPWE R
Sbjct  204  RERAMAYALTHQWQAGTRQLSAHSGFQPDKNSWGWNWLERWMAVRPWENR  253



>ref|XP_011012760.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Populus euphratica]
Length=438

 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            + E++AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  92   MREQLAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  149

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q+K+Q Q+   A++ E++  W     ++E+I  K+ +R+EAA
Sbjct  150  QARVRARRVRLALESQTAQQKLQQQLANQARVREIEEGWCDSVGSVEQIQAKLLKRQEAA  209

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERA+AYA +HQW+A S H    + +   K SWGW+W ERW+AVRPWE R
Sbjct  210  AKRERAIAYALAHQWQAGSRHQAVPSGFEPDKSSWGWNWLERWMAVRPWENR  261



>gb|AER62605.1| hypothetical protein, partial [Henrardia persica]
Length=185

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 101/161 (63%), Gaps = 2/161 (1%)
 Frame = +2

Query  332  QGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQSEIKARRLCMVTQGRLk  511
            Q R+A+R LRG V+ +  ++   +V  Q A TL    + +R+Q++I +RR+ M  + +  
Sbjct  1    QARRALRALRGLVRLKSLVDG-NAVKRQTAHTLHCTQTMARVQTQIYSRRVKMEEEKQAL  59

Query  512  qkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRAN  691
            Q+++Q + + + +  ++  +W    ++ E+I   +  ++EAA++RERA+AYAFSHQW+ N
Sbjct  60   QRQLQLKHQRELEKMKIDEDWDHSHQSKEQIEASLMMKQEAALRRERALAYAFSHQWK-N  118

Query  692  SGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKK  814
            SG      + + G  +WGWSW ERW++ RPWE RV A+  K
Sbjct  119  SGRTVTPTFTDQGNPNWGWSWMERWMSARPWENRVVANKDK  159



>ref|XP_011102119.1| PREDICTED: protein IQ-DOMAIN 1-like [Sesamum indicum]
 ref|XP_011102120.1| PREDICTED: protein IQ-DOMAIN 1-like [Sesamum indicum]
 ref|XP_011102121.1| PREDICTED: protein IQ-DOMAIN 1-like [Sesamum indicum]
 ref|XP_011102122.1| PREDICTED: protein IQ-DOMAIN 1-like [Sesamum indicum]
 ref|XP_011102123.1| PREDICTED: protein IQ-DOMAIN 1-like [Sesamum indicum]
Length=455

 Score =   115 bits (287),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 124/230 (54%), Gaps = 16/230 (7%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR Y   R+A+R LRG V+ +  I    S   Q AATLK + + +R+QS
Sbjct  115  EEIAAIKIQTAFRGYLA-RRALRALRGLVRLKSLI-GGKSAKRQSAATLKCMQTLARVQS  172

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVE----WSSGSETMEEILQKIQQREE  631
            EI+ARRL M  +      ++Q Q K + +L +L+V     W    ++ E+I   +  R+E
Sbjct  173  EIRARRLRMSDKN--SAMQLQIQQKHEKELEKLRVSIGENWDDSLQSKEQIEANLHSRQE  230

Query  632  AAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            AA +RERA+AYA+SHQ  WR NS     Q + +     WGWSW ERW+A RPWE    AD
Sbjct  231  AAKRRERALAYAYSHQQTWR-NSSSSANQTFMDPNNPRWGWSWLERWMAARPWENISAAD  289

Query  806  PKKAGKTAS-LGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
             +      S    +    SV    L + KI +P  K     P  Q+P  P
Sbjct  290  KELNNDLVSPSSTINRSFSV----LGDAKIHSPTAKKQSRPPSRQSPSTP  335



>ref|XP_009336410.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009336411.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009336412.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
Length=435

 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 110/170 (65%), Gaps = 2/170 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AATRIQ AFR +   R+A+R L+G V+ Q  +   ++V  Q A TL+ + +  R+Q+
Sbjct  92   EEWAATRIQTAFRGF-LARRALRALKGLVRLQALVRG-HAVRKQAAITLRCMQALVRVQA  149

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++ARR+ +  +G+  Q+++  Q+  +A + E++  W     +++EI  K+ +R+EAA K
Sbjct  150  RVRARRVRLALEGQTAQQRLHEQLANEAHVREIEEGWCDSVGSVQEIQAKLLKRQEAAAK  209

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            RERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R
Sbjct  210  RERAMAYALAHQWQAGSRQLPVPSGFEPDKSSWGWNWLERWMAVRPWENR  259



>ref|XP_002298262.2| hypothetical protein POPTR_0001s22260g [Populus trichocarpa]
 gb|EEE83067.2| hypothetical protein POPTR_0001s22260g [Populus trichocarpa]
Length=437

 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 112/172 (65%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L EE AATRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+
Sbjct  94   LREEWAATRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRV  151

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q K+Q Q+  +A++ E++  W     ++E+I  K+ +R+EAA
Sbjct  152  QARVRARRVRLALESQTAQHKLQQQLANEARVQEIEEGWCDSVGSVEQIQAKLLKRQEAA  211

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R
Sbjct  212  AKRERAMAYALAHQWQAGSRLQAAPSGFEPDKSSWGWNWLERWMAVRPWENR  263



>emb|CDP15562.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 126/213 (59%), Gaps = 3/213 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AA RIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+Q+
Sbjct  95   EEWAAIRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRVQA  152

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++ARR+ M  + +  Q+K+Q Q++ DA + E++  W     ++E+I  K+ +R+EAA K
Sbjct  153  RVRARRVRMALENQTAQQKLQQQLEHDAHVREIEEGWCDSVGSVEDIQAKLLKRQEAAAK  212

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR-VQADPKKAG  820
            RERAMAYA +HQW+A S      A +   K +WGW+W ERW+AVRPWE R +  + K   
Sbjct  213  RERAMAYALAHQWQAGSRQQATPAGFEPDKSNWGWNWLERWMAVRPWENRFLDINTKDGM  272

Query  821  KTASLGPVKLVVSVNNPPLSNGKISTPARKPSD  919
                 G  +    +N    S GK S  +  P++
Sbjct  273  ALQENGSTEGKNGINTQTKSTGKKSMTSNHPNE  305



>ref|XP_010232517.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
 ref|XP_010232518.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
 ref|XP_010232519.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
 ref|XP_010232520.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
 ref|XP_010232521.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
Length=492

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 125/227 (55%), Gaps = 12/227 (5%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AA +IQ AFR Y   R       G V+ +  ++   SV  Q + TL    + +R+Q+
Sbjct  139  EELAAVKIQTAFRGYLARRALRALR-GLVRLKSLVDG-NSVKRQTSHTLHCTQTMTRVQT  196

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ +  + +  Q+++Q + + + +  ++  +W    ++ E+I   +  ++EAA++
Sbjct  197  QIYSRRVKLEEEKQALQRQLQLKHQRELEKMKIDEDWDHSHQSKEQIEASLMMKQEAALR  256

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRV--QADPKKA  817
            RERA+AYAFSHQW+ NSG      + + G  +WGWSW ERW+  RPWE RV    DPK +
Sbjct  257  RERALAYAFSHQWK-NSGRTITPTFTDQGNPNWGWSWMERWMTARPWENRVVPNKDPKDS  315

Query  818  --GKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
               K  S   ++  V      LS  + +TP++  S   P  Q+P  P
Sbjct  316  VLTKNPSTSAIRTFVPRA---LSIQRPATPSK--SSRPPSRQSPSTP  357



>ref|XP_007015643.1| IQ-domain 5 isoform 1 [Theobroma cacao]
 gb|EOY33262.1| IQ-domain 5 isoform 1 [Theobroma cacao]
Length=435

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 113/175 (65%), Gaps = 2/175 (1%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N    EE A+TRIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + + 
Sbjct  89   NEHAREEWASTRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQAL  146

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++ARR+ +  + +  Q+K+Q Q+  +A++ E++  W     ++EEI  K+ +R+
Sbjct  147  VRVQARVRARRVRLALESQTTQQKLQQQLANEARVKEIEEGWCDSIGSVEEIQAKLLKRQ  206

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA +HQW+A S      A +   K SWGW+W ERW+AVRPWE R
Sbjct  207  EAAAKRERAMAYALAHQWQAGSRQQSVPAGFEPDKSSWGWNWLERWMAVRPWENR  261



>ref|XP_007027263.1| IQ-domain 1 [Theobroma cacao]
 gb|EOY07765.1| IQ-domain 1 [Theobroma cacao]
Length=478

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 105/183 (57%), Gaps = 5/183 (3%)
 Frame = +2

Query  251  NGGSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATL  430
            N G+    +  EE AA +IQ AFR Y   ++A+R LRG  + +  +E    V  Q A+TL
Sbjct  106  NTGARFAGKSEEEAAAIKIQTAFRGY-LAKRALRALRGLFRLKSLMEGPV-VKRQAASTL  163

Query  431  KHIHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQ  610
            + + + SR+Q +I+ RR+ M  + +  Q+++  +   D    ++  EW    ++ E++  
Sbjct  164  RCMQTLSRVQCQIRTRRIRMTEENQALQRQLLQKHAKDLVNLQMGEEWDDSLQSKEQLEA  223

Query  611  KIQQREEAAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPW  784
             +  + EAA++RERAMAY+F+HQ  W+ NS       + +    SWGWSW ERW+A RPW
Sbjct  224  SLLSKHEAAMRRERAMAYSFTHQQTWK-NSSRSMSPLFMDPNNPSWGWSWLERWMAARPW  282

Query  785  EIR  793
            E R
Sbjct  283  EGR  285



>ref|XP_008776608.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008776610.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008776611.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008776612.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008776613.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
Length=438

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 126/216 (58%), Gaps = 19/216 (9%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            E+ AAT IQ AFRA+   R+A+R L+G V+ Q  +   ++V  Q A TL+ + +  R+Q+
Sbjct  97   EDWAATVIQTAFRAF-LARRALRALKGLVRLQALVRG-HAVRKQAAITLRCMQALVRVQA  154

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++ARR+ +  + +L Q+K+Q Q   +A++ E +  W     ++EEI  K+ +R+EAA K
Sbjct  155  RVRARRVRIALENQLGQQKVQQQQVHEARVRETEEGWCDSVGSVEEIQAKLLKRQEAAAK  214

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAGK  823
            RERAMAYA +HQW+A S      + +   K +WGW+W ERW+AVRPWE R      K G 
Sbjct  215  RERAMAYALTHQWQAGSRQTVAPSGFEPDKNNWGWNWLERWMAVRPWENRFLDINLKDG-  273

Query  824  TASLGPVKLVVSVNNPPLSNGKIST------PARKP  913
                    ++V  N PP  +GK  T      P +KP
Sbjct  274  --------VMVDENGPP--DGKYGTRAQNKPPGKKP  299



>ref|XP_009421378.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 125/235 (53%), Gaps = 17/235 (7%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            TEEIAA +IQ AFR +   R       G V+ +  ++   +V  Q   TL+ + + +R+Q
Sbjct  112  TEEIAAIKIQTAFRGHLARRALRALR-GLVRLKSLVDGD-TVKRQATTTLRCMQTLARVQ  169

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            S+I++RR+ M+ + +  Q+++  + + + +  ++  EW    ++ E+I   +  ++EAA+
Sbjct  170  SQIRSRRIRMLEENQALQRQMLLKHERELESLKMGEEWDDSLQSKEQIEASLLSKQEAAI  229

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAG  820
            +RERA+AYAFSHQW+++S       + +     WGWSW ERW+A RPWE R   D +   
Sbjct  230  RRERALAYAFSHQWKSSS-KPVNPLFMDPNNLQWGWSWLERWMAARPWETRSTTDREPND  288

Query  821  KTASL--------GPVKLV------VSVNNPPLSNGKISTPARKPSDHNPETQTP  943
              AS+        G V L        + + P  SN K S PA + S   P  + P
Sbjct  289  DRASIKSTMQSDGGGVILKAYACRNANPDKPSPSNQKPSRPASRQSPSTPPVKAP  343



>ref|XP_009135780.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Brassica rapa]
 ref|XP_009135781.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Brassica rapa]
Length=404

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 114/179 (64%), Gaps = 2/179 (1%)
 Frame = +2

Query  257  GSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKH  436
            G++   +  E +AATRIQ AFRA+   R+A+R L+G V+ Q A+   + V  Q A TL+ 
Sbjct  74   GAAYEEQRKEHLAATRIQTAFRAF-LARRALRALKGLVRLQ-ALVRGHVVRKQAAVTLRC  131

Query  437  IHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKI  616
            + +  R+Q+ ++ARR+ +  +    Q+ +Q Q+  +A++ E++  W     ++E+I  K+
Sbjct  132  MQALVRVQARVRARRVRLSLECETGQQTLQQQVTDEARVQEIEGGWCDSIGSVEQIRTKL  191

Query  617  QQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             +R+EAA KRERAMAYA +HQW+A +      + +   K +WGW+W ERW+AVRPWE R
Sbjct  192  VKRQEAATKRERAMAYALTHQWQAGTRKLSAHSAFQPDKNNWGWNWLERWMAVRPWENR  250



>ref|XP_009135782.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Brassica rapa]
Length=402

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 114/179 (64%), Gaps = 2/179 (1%)
 Frame = +2

Query  257  GSSKNNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKH  436
            G++   +  E +AATRIQ AFRA+   R+A+R L+G V+ Q A+   + V  Q A TL+ 
Sbjct  72   GAAYEEQRKEHLAATRIQTAFRAF-LARRALRALKGLVRLQ-ALVRGHVVRKQAAVTLRC  129

Query  437  IHSWSRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKI  616
            + +  R+Q+ ++ARR+ +  +    Q+ +Q Q+  +A++ E++  W     ++E+I  K+
Sbjct  130  MQALVRVQARVRARRVRLSLECETGQQTLQQQVTDEARVQEIEGGWCDSIGSVEQIRTKL  189

Query  617  QQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             +R+EAA KRERAMAYA +HQW+A +      + +   K +WGW+W ERW+AVRPWE R
Sbjct  190  VKRQEAATKRERAMAYALTHQWQAGTRKLSAHSAFQPDKNNWGWNWLERWMAVRPWENR  248



>ref|XP_007015644.1| IQ-domain 5 isoform 2 [Theobroma cacao]
 ref|XP_007015645.1| IQ-domain 5 isoform 2 [Theobroma cacao]
 gb|EOY33263.1| IQ-domain 5 isoform 2 [Theobroma cacao]
 gb|EOY33264.1| IQ-domain 5 isoform 2 [Theobroma cacao]
Length=312

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 112/175 (64%), Gaps = 2/175 (1%)
 Frame = +2

Query  269  NNELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSW  448
            N    EE A+TRIQ AFR +   R+A+R L+G V+ Q  +   ++V  Q A TL+ + + 
Sbjct  89   NEHAREEWASTRIQTAFRGF-LARRALRALKGLVRLQALVRG-HAVRKQAAITLRCMQAL  146

Query  449  SRIQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQRE  628
             R+Q+ ++ARR+ +  + +  Q+K+Q Q+  +A++ E++  W     ++EEI  K+ +R+
Sbjct  147  VRVQARVRARRVRLALESQTTQQKLQQQLANEARVKEIEEGWCDSIGSVEEIQAKLLKRQ  206

Query  629  EAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            EAA KRERAMAYA +HQW+A S      A +   K SWGW+W ERW+AVRPWE R
Sbjct  207  EAAAKRERAMAYALAHQWQAGSRQQSVPAGFEPDKSSWGWNWLERWMAVRPWENR  261



>ref|XP_009410599.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
Length=465

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/236 (33%), Positives = 128/236 (54%), Gaps = 9/236 (4%)
 Frame = +2

Query  275  ELTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSR  454
            E  EE+AA +IQ AFR Y   R+ +R LRG  + +  ++    V  Q   TL  +   +R
Sbjct  108  EPREEVAAIKIQTAFRGY-LARRELRILRGLFRLKRLVDGNV-VRSQTYNTLHCMQKMAR  165

Query  455  IQSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEA  634
            +Q++I+ARR+ M  + +  Q+ +Q + + + +  +++ EW     + E+I   +  R+EA
Sbjct  166  VQTQIRARRIRMTEENQALQRHLQRKYEKELEKAKIEEEWDDSLRSKEKIEANLVNRQEA  225

Query  635  AVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR--VQADP  808
            AV+RERA+AYAFSHQW+++S       + +     WGWSW ERW+A RPWE     + + 
Sbjct  226  AVRRERALAYAFSHQWKSSS-RSLTPTFTDPRNPQWGWSWLERWMAARPWENHRITETND  284

Query  809  KKAGKTASLGPVKLVVSVNNPPL--SNGKISTPARKPSDHNPETQTPQEPV*TRKI  970
              + ++A+   +   +   +  L  +   I   +R PS  +P   TPQ    +RKI
Sbjct  285  HDSIRSATFSLIGQTMKRRDTSLERTPSAIRKSSRPPSRQSP--MTPQSKPRSRKI  338



>ref|XP_009392714.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
Length=478

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 104/174 (60%), Gaps = 3/174 (2%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA +IQ AFR +   R      RG V+ +  I+   SV  Q  +TL+ + + +R+QS
Sbjct  116  EEIAAIKIQTAFRGHLARRALRAL-RGLVRLKSLIDG-NSVKRQATSTLRCMQTLARVQS  173

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I+ARR+ M+   +  QK++  + + + +  ++  EW    +T E+I   +  ++EAA++
Sbjct  174  QIRARRIRMLEDNQALQKQMLLKHERELESLKMGEEWDDSLQTKEQIEAGLLSKQEAAIR  233

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            RERA+AYAFSHQW+++S       + +     WGWSW ERW+A RPWE R   D
Sbjct  234  RERALAYAFSHQWKSSS-KSVNPMFMDPNNLQWGWSWLERWMAARPWETRSTTD  286



>ref|XP_002315282.2| hypothetical protein POPTR_0010s22510g [Populus trichocarpa]
 gb|EEF01453.2| hypothetical protein POPTR_0010s22510g [Populus trichocarpa]
Length=489

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 130/236 (55%), Gaps = 20/236 (8%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EEIAA RIQ AFR Y   R+A+R LRG V+ +  I+   SV  Q  ATL+ + + +R+QS
Sbjct  115  EEIAAIRIQTAFRGYLA-RRALRALRGLVRLKSLIQG-QSVKRQATATLRAMQTLARVQS  172

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQV----EWSSGSETMEEILQKIQQREE  631
            +I+ARR+ M  +    Q+++Q +   D +L +L+     +W    ++ EE+   + Q++E
Sbjct  173  QIRARRIRMSEENEALQRQLQQKH--DKELEKLRTSIGEQWDDSPQSKEEVEASLLQKQE  230

Query  632  AAVKRERAMAYAFSHQ--WRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD  805
            AA++RERA+AYA+SHQ  W+  S       + +     WGWSW ERW+A RPWE R   D
Sbjct  231  AAMRRERALAYAYSHQQMWK-QSSKSANATFMDPNNPRWGWSWLERWMAARPWESRSTID  289

Query  806  -------PKKAGKTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQEP  952
                        +T SLG +    S  +  L++   ++P  + S   P  Q+P  P
Sbjct  290  NNDRASVKSTTSRTMSLGEISRAYSRRD--LNHDNKASPGAQKSSRPPSRQSPSTP  343



>ref|XP_011044606.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Populus euphratica]
Length=437

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 111/172 (65%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L EE AATRIQ AFR +   R+A+R L+G V+ Q  +   ++V  Q A TL+ + +  R+
Sbjct  94   LREEWAATRIQTAFRGF-LARRALRALKGLVRLQALVRG-HAVRKQAAITLRCMQALVRV  151

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q K+Q Q+  +A++ E++  W     ++E+I  K+ +R+EAA
Sbjct  152  QARVRARRVRLALESQTAQHKLQQQLANEARVREIEEGWCDSVGSVEQIQAKLLKRQEAA  211

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R
Sbjct  212  AKRERAMAYALAHQWQAGSRLQAAPSGFEPDKSSWGWNWLERWMAVRPWENR  263



>gb|AER62607.1| hypothetical protein, partial [Triticum monococcum subsp. aegilopoides]
Length=308

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 107/179 (60%), Gaps = 3/179 (2%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AA +IQ AFR Y   R       G V+ +  ++   +V  Q A TL    + +R+Q+
Sbjct  109  EELAAVKIQTAFRGYLARRALRALR-GLVRLKSLVDG-NAVKRQTAHTLHCTQTMARVQT  166

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ M  + +  Q+++Q + + + +  ++  +W    ++ E+I   +  ++EAA++
Sbjct  167  QIYSRRVKMEEEKQALQRQLQLKHQRELEKMKIDEDWDHSHQSKEQIEASLMMKQEAALR  226

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAG  820
            RERA+AYAFSHQW+ NSG      + + G  +WGWSW ERW++ RPWE RV ++  K G
Sbjct  227  RERALAYAFSHQWK-NSGRTVTPTFTDQGNPNWGWSWMERWMSARPWENRVVSNKDKDG  284



>gb|AER62593.1| hypothetical protein, partial [Aegilops tauschii]
Length=308

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 107/179 (60%), Gaps = 3/179 (2%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE+AA +IQ AFR Y   R       G V+ +  ++   +V  Q A TL    + +R+Q+
Sbjct  109  EELAAVKIQTAFRGYLARRALRALR-GLVRLKSLVDG-NAVKRQTAHTLHCTQTMARVQT  166

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
            +I +RR+ M  + +  Q+++Q + + + +  ++  +W    ++ E+I   +  ++EAA++
Sbjct  167  QIYSRRVKMEEEKQALQRQLQLKHQRELEKMKIDEDWDHSHQSKEQIEASLMMKQEAALR  226

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAG  820
            RERA+AYAFSHQW+ NSG      + + G  +WGWSW ERW++ RPWE RV ++  K G
Sbjct  227  RERALAYAFSHQWK-NSGRTVTPTFTDQGNPNWGWSWMERWMSARPWENRVVSNKDKDG  284



>ref|XP_011044601.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
 ref|XP_011044603.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
 ref|XP_011044604.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
 ref|XP_011044605.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
Length=438

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 111/172 (65%), Gaps = 2/172 (1%)
 Frame = +2

Query  278  LTEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRI  457
            L EE AATRIQ AFR +   R+A+R L+G V+ Q  +   ++V  Q A TL+ + +  R+
Sbjct  94   LREEWAATRIQTAFRGF-LARRALRALKGLVRLQALVRG-HAVRKQAAITLRCMQALVRV  151

Query  458  QSEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAA  637
            Q+ ++ARR+ +  + +  Q K+Q Q+  +A++ E++  W     ++E+I  K+ +R+EAA
Sbjct  152  QARVRARRVRLALESQTAQHKLQQQLANEARVREIEEGWCDSVGSVEQIQAKLLKRQEAA  211

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
             KRERAMAYA +HQW+A S      + +   K SWGW+W ERW+AVRPWE R
Sbjct  212  AKRERAMAYALAHQWQAGSRLQAAPSGFEPDKSSWGWNWLERWMAVRPWENR  263



>ref|XP_004960343.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Setaria italica]
 ref|XP_004960344.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Setaria italica]
Length=471

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 131/228 (57%), Gaps = 13/228 (6%)
 Frame = +2

Query  281  TEEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQ  460
            +EE+AA +IQ AFR Y   R+A+R LRG V+ +  +E   SV  Q A+TL+ + + SR+Q
Sbjct  102  SEELAAIKIQTAFRGYLA-RRALRALRGLVRLKSLVEGD-SVKRQSASTLRCMQTLSRVQ  159

Query  461  SEIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAV  640
            S+I++RR  M  + +  Q+++  + +L+     +   W   +++ E+I   +  R+EAA+
Sbjct  160  SQIRSRRAKMSEENQALQRQLLLKQELEN--FRMGENWDDSTQSKEQIEASLISRQEAAI  217

Query  641  KRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQADPKKAG  820
            +RERA+AYAFSHQW++ S       + +     WGWSW ERW+A +PWE R  AD +   
Sbjct  218  RRERALAYAFSHQWKSTS-RSVNAMFVDPNNLQWGWSWLERWMAAKPWEGRNGADKE---  273

Query  821  KTASLGPVKLVVSVNNPPLSNGKISTPARKPSDHNPETQTPQEPV*TR  964
                 G VK  +S+N   L  G+I T A    D  PE  +P  P  TR
Sbjct  274  SNIDRGSVK-SMSLN---LGEGEI-TKAFNRRDLKPEKPSPPTPKLTR  316



>gb|AFW80825.1| hypothetical protein ZEAMMB73_814741 [Zea mays]
Length=455

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +2

Query  560  LQVEWSSGSETMEEILQKIQQREEAAVKRERAMAYAFSHQWRANSGHYFGQAYYNLGKES  739
            + +EW+ GS+TM+EIL +IQQ EEA VKRERAMAY F+HQWRA S    G   Y +GK  
Sbjct  201  ISIEWNGGSDTMDEILVRIQQLEEAVVKRERAMAYTFNHQWRARSATSLGNFSYEVGKGG  260

Query  740  WGWSWKERWIAVRPWEIRVQADPKKAGK  823
            WGWSW +RWI  RPWE R    P+   K
Sbjct  261  WGWSWMDRWIVARPWESRSMVHPENPKK  288



>gb|EEC78429.1| hypothetical protein OsI_18263 [Oryza sativa Indica Group]
Length=474

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 111/191 (58%), Gaps = 14/191 (7%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AA +IQ AFR Y   R      RG V+ +  +E   SV  Q A+TL+ + + +R+QS
Sbjct  106  EEQAAIKIQTAFRGYLARRALRAL-RGLVRLKSLVEG-NSVKRQAASTLRCMQTLARVQS  163

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQV--EWSSGSETMEEILQKIQQREEAA  637
            +I++RRL M  + +     +Q Q+ L  +L  L++  +W   +++ E+I   +  R+EAA
Sbjct  164  QIRSRRLKMSEENQ----ALQRQLLLKQELESLRMGEQWDDSTQSKEQIEASLISRQEAA  219

Query  638  VKRERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIRVQAD----  805
            V+RERA+AYAFSHQW++ S       + +     WGWSW ERW+A +PWE R   D    
Sbjct  220  VRRERALAYAFSHQWKSTS-RSVNPMFVDPNNPQWGWSWLERWMAAKPWEGRAGTDKESN  278

Query  806  -PKKAGKTASL  835
              + + K+ASL
Sbjct  279  LDRASAKSASL  289



>ref|XP_010031573.1| PREDICTED: LOW QUALITY PROTEIN: protein IQ-DOMAIN 1-like [Eucalyptus 
grandis]
Length=433

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 108/170 (64%), Gaps = 2/170 (1%)
 Frame = +2

Query  284  EEIAATRIQRAFRAYKQGRKAIRRLRGTVKFQGAIEAAYSVNDQVAATLKHIHSWSRIQS  463
            EE AA RIQ AFR +   R+A+R L+G V+ Q A+   ++V  Q A TL+ + +  R+Q+
Sbjct  92   EEWAAIRIQTAFRGF-LARRALRALKGLVRLQ-ALVRGHAVRKQAAITLRCMQALVRVQA  149

Query  464  EIKARRLCMVTQGRLkqkkiqnqikLDAKLHELQVEWSSGSETMEEILQKIQQREEAAVK  643
             ++ RR+ +  +    Q+ +Q Q+  +A++ E++  W     ++E+I  K+ +R+EAA K
Sbjct  150  RVRXRRVRLALESXTVQQNLQQQLANEARVREIEEGWCDSVGSVEQIQSKLLKRQEAAAK  209

Query  644  RERAMAYAFSHQWRANSGHYFGQAYYNLGKESWGWSWKERWIAVRPWEIR  793
            RERAMAYA +HQW+A S      A +   K SWGW+W ERW+AVRPWE R
Sbjct  210  RERAMAYALAHQWQAGSRQQALPAGFEPDKSSWGWNWLERWMAVRPWENR  259



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448