BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14207_g2_i1 len=1183 path=[1:0-228 230:229-252 2938:253-1182]

Length=1183
                                                                      Score     E

ref|XP_009587580.1|  PREDICTED: bidirectional sugar transporter S...    386   2e-129   
ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    382   7e-128   
ref|XP_009787633.1|  PREDICTED: bidirectional sugar transporter N...    381   2e-127   
ref|XP_009796436.1|  PREDICTED: bidirectional sugar transporter S...    381   2e-127   
ref|XP_009762335.1|  PREDICTED: bidirectional sugar transporter S...    381   3e-127   
ref|XP_009794695.1|  PREDICTED: bidirectional sugar transporter N...    379   2e-126   
ref|XP_009597195.1|  PREDICTED: bidirectional sugar transporter S...    378   3e-126   
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    372   8e-124   
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    369   7e-123   
ref|XP_006347634.1|  PREDICTED: bidirectional sugar transporter S...    369   1e-122   
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    369   1e-122   
ref|XP_009605549.1|  PREDICTED: bidirectional sugar transporter S...    369   1e-122   
ref|XP_006347346.1|  PREDICTED: bidirectional sugar transporter S...    367   3e-122   
ref|XP_004235333.1|  PREDICTED: bidirectional sugar transporter S...    368   4e-122   
ref|XP_009758166.1|  PREDICTED: bidirectional sugar transporter S...    367   5e-122   
gb|ACV71016.1|  UPA16                                                   367   7e-122   Capsicum annuum
ref|XP_009599477.1|  PREDICTED: bidirectional sugar transporter S...    366   8e-122   
ref|XP_006347633.1|  PREDICTED: bidirectional sugar transporter S...    367   1e-121   
ref|XP_004241452.1|  PREDICTED: bidirectional sugar transporter S...    365   2e-121   
ref|XP_004235334.1|  PREDICTED: bidirectional sugar transporter S...    363   1e-120   
ref|XP_009802608.1|  PREDICTED: bidirectional sugar transporter S...    360   4e-119   
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    367   4e-119   
ref|XP_006363981.1|  PREDICTED: bidirectional sugar transporter S...    358   1e-118   
ref|XP_004235342.2|  PREDICTED: uncharacterized protein LOC101265905    368   3e-118   
ref|XP_004235326.1|  PREDICTED: bidirectional sugar transporter N3      357   6e-118   
ref|XP_004235339.1|  PREDICTED: bidirectional sugar transporter S...    355   2e-117   
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    356   2e-117   
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    354   6e-117   
ref|XP_009614915.1|  PREDICTED: bidirectional sugar transporter S...    350   2e-115   
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    345   3e-113   
ref|XP_009794853.1|  PREDICTED: bidirectional sugar transporter S...    338   7e-111   
ref|XP_006347347.1|  PREDICTED: bidirectional sugar transporter S...    337   4e-110   
ref|XP_009614917.1|  PREDICTED: bidirectional sugar transporter S...    336   5e-110   
ref|XP_009802195.1|  PREDICTED: bidirectional sugar transporter S...    327   3e-106   
ref|XP_004242139.1|  PREDICTED: bidirectional sugar transporter S...    319   3e-103   
ref|XP_009803865.1|  PREDICTED: bidirectional sugar transporter S...    313   7e-101   
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    308   5e-99    
ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    303   4e-97    
ref|XP_009605548.1|  PREDICTED: bidirectional sugar transporter S...    303   5e-97    
ref|XP_009801964.1|  PREDICTED: bidirectional sugar transporter S...    300   6e-96    
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    300   7e-96    
ref|XP_011073577.1|  PREDICTED: bidirectional sugar transporter S...    295   5e-94    
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    293   2e-93    
gb|EPS64389.1|  hypothetical protein M569_10392                         288   6e-92    
emb|CDP21121.1|  unnamed protein product                                289   1e-91    
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                288   4e-91    
gb|EYU43031.1|  hypothetical protein MIMGU_mgv1a011488mg                284   8e-90    
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                284   3e-89    
gb|EYU43030.1|  hypothetical protein MIMGU_mgv1a011435mg                283   3e-89    
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    280   2e-88    Vitis vinifera
emb|CAN71371.1|  hypothetical protein VITISV_023352                     280   3e-88    Vitis vinifera
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    280   4e-88    
emb|CDP21733.1|  unnamed protein product                                278   2e-87    
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    278   2e-87    
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    276   9e-87    
ref|NP_001241307.1|  uncharacterized protein LOC100810946               275   2e-86    
emb|CDP21120.1|  unnamed protein product                                273   7e-86    
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    274   8e-86    
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             272   3e-85    
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    271   3e-85    
ref|XP_004503778.1|  PREDICTED: bidirectional sugar transporter S...    271   4e-85    
ref|XP_007038076.1|  Nodulin MtN3 family protein, putative isoform 2    272   5e-85    
gb|AFK48645.1|  unknown                                                 271   6e-85    
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             268   1e-83    
ref|XP_004297512.1|  PREDICTED: bidirectional sugar transporter S...    269   1e-83    
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    268   1e-83    
gb|KHG27148.1|  Bidirectional sugar transporter SWEET10 -like pro...    267   3e-83    
ref|XP_006436900.1|  hypothetical protein CICLE_v10033645mg             266   4e-83    
ref|XP_010322967.1|  PREDICTED: bidirectional sugar transporter S...    266   4e-83    
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    266   6e-83    Vitis vinifera
emb|CAC44123.1|  N3 like protein                                        265   7e-83    Medicago truncatula
gb|KEH20983.1|  bidirectional sugar transporter                         265   1e-82    
emb|CBI32263.3|  unnamed protein product                                268   2e-82    
ref|XP_003531061.1|  PREDICTED: bidirectional sugar transporter N...    264   5e-82    
gb|AFK35161.1|  unknown                                                 263   6e-82    
ref|XP_008239633.1|  PREDICTED: bidirectional sugar transporter S...    264   6e-82    
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    265   7e-82    
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    263   9e-82    
gb|KHN39181.1|  Bidirectional sugar transporter N3                      263   1e-81    
ref|XP_007209422.1|  hypothetical protein PRUPE_ppa009422mg             264   1e-81    
ref|XP_007043874.1|  Senescence-associated gene 29                      263   2e-81    
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      263   2e-81    
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 261   2e-81    
ref|XP_002321731.1|  N3 like family protein                             263   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_002511128.1|  conserved hypothetical protein                     262   2e-81    Ricinus communis
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    261   4e-81    
ref|XP_011023934.1|  PREDICTED: bidirectional sugar transporter S...    262   4e-81    
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    262   6e-81    
ref|XP_006347482.1|  PREDICTED: bidirectional sugar transporter S...    261   6e-81    
gb|ACU23483.1|  unknown                                                 260   9e-81    Glycine max [soybeans]
ref|XP_009779208.1|  PREDICTED: bidirectional sugar transporter S...    260   1e-80    
ref|XP_009601079.1|  PREDICTED: bidirectional sugar transporter S...    260   1e-80    
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    261   1e-80    
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            261   1e-80    
ref|XP_006436901.1|  hypothetical protein CICLE_v10032313mg             260   2e-80    
ref|XP_011084749.1|  PREDICTED: bidirectional sugar transporter N...    259   5e-80    
ref|NP_001237418.1|  N3 protein                                         258   7e-80    
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter S...    259   8e-80    
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          258   1e-79    
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    258   1e-79    
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             258   3e-79    
ref|NP_001242732.1|  uncharacterized protein LOC100810962               256   3e-79    
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    257   3e-79    
gb|KHG02402.1|  Bidirectional sugar transporter SWEET10 -like pro...    256   5e-79    
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    256   1e-78    
ref|XP_006493253.1|  PREDICTED: bidirectional sugar transporter S...    256   1e-78    
gb|KFK27668.1|  hypothetical protein AALP_AA8G413300                    256   1e-78    
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    256   2e-78    
ref|XP_007159040.1|  hypothetical protein PHAVU_002G203600g             255   2e-78    
ref|XP_004310113.1|  PREDICTED: bidirectional sugar transporter S...    256   2e-78    
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    254   2e-78    
ref|XP_008392727.1|  PREDICTED: bidirectional sugar transporter S...    255   2e-78    
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    255   3e-78    
ref|XP_009132693.1|  PREDICTED: bidirectional sugar transporter S...    255   3e-78    
ref|XP_008222221.1|  PREDICTED: bidirectional sugar transporter N3      254   3e-78    
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               254   4e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    254   4e-78    
ref|XP_002865823.1|  nodulin MtN3 family protein                        254   4e-78    
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             254   6e-78    
ref|XP_002322281.2|  N3 like family protein                             254   7e-78    Populus trichocarpa [western balsam poplar]
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    254   7e-78    
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            254   7e-78    
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    253   7e-78    
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    254   8e-78    
ref|NP_001239695.1|  uncharacterized protein LOC100777741               253   9e-78    
gb|KHN24976.1|  Bidirectional sugar transporter N3                      253   9e-78    
ref|XP_009347840.1|  PREDICTED: bidirectional sugar transporter N...    254   1e-77    
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    253   1e-77    
ref|XP_010678288.1|  PREDICTED: bidirectional sugar transporter N3      254   1e-77    
ref|XP_002877629.1|  nodulin MtN3 family protein                        253   2e-77    
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                253   2e-77    
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    252   2e-77    
ref|NP_001067955.1|  Os11g0508600                                       253   2e-77    Oryza sativa Japonica Group [Japonica rice]
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    253   2e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             252   2e-77    
ref|XP_006394628.1|  hypothetical protein EUTSA_v10004719mg             252   3e-77    
ref|XP_008389921.1|  PREDICTED: bidirectional sugar transporter N...    253   3e-77    
ref|XP_003551863.1|  PREDICTED: bidirectional sugar transporter N...    251   3e-77    
ref|XP_010678287.1|  PREDICTED: bidirectional sugar transporter S...    253   3e-77    
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    251   4e-77    
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               252   4e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             251   5e-77    
ref|XP_003530901.1|  PREDICTED: bidirectional sugar transporter N...    251   5e-77    
ref|XP_011023931.1|  PREDICTED: bidirectional sugar transporter S...    250   5e-77    
gb|KHN03192.1|  Bidirectional sugar transporter N3                      251   6e-77    
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             251   7e-77    Populus trichocarpa [western balsam poplar]
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               251   7e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    251   8e-77    
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    251   9e-77    
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    251   9e-77    
gb|KFK26707.1|  hypothetical protein AALP_AA8G282900                    251   1e-76    
ref|XP_008356571.1|  PREDICTED: bidirectional sugar transporter S...    251   1e-76    
ref|XP_009150896.1|  PREDICTED: bidirectional sugar transporter S...    250   2e-76    
ref|XP_007050795.1|  Medicago truncatula MTN3                           251   2e-76    
ref|XP_003524088.1|  PREDICTED: bidirectional sugar transporter N...    250   2e-76    
ref|XP_010482380.1|  PREDICTED: bidirectional sugar transporter S...    250   2e-76    
emb|CDX68492.1|  BnaC01g25700D                                          250   2e-76    
ref|XP_006664549.1|  PREDICTED: bidirectional sugar transporter S...    249   3e-76    
gb|AHL43546.1|  nodule-specific sucrose transporter                     248   5e-76    
ref|XP_010503515.1|  PREDICTED: bidirectional sugar transporter S...    249   5e-76    
ref|XP_004235470.1|  PREDICTED: bidirectional sugar transporter S...    248   6e-76    
emb|CDX80379.1|  BnaC07g30650D                                          249   7e-76    
emb|CDX83046.1|  BnaA01g20460D                                          248   7e-76    
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    250   7e-76    
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    248   9e-76    
ref|XP_009336454.1|  PREDICTED: bidirectional sugar transporter N...    249   9e-76    
emb|CDX84877.1|  BnaA03g13530D                                          248   1e-75    
ref|XP_006347653.1|  PREDICTED: bidirectional sugar transporter S...    248   1e-75    
dbj|BAJ94651.1|  predicted protein                                      248   1e-75    
emb|CDX77928.1|  BnaC03g52910D                                          248   1e-75    
ref|XP_002514863.1|  conserved hypothetical protein                     247   1e-75    Ricinus communis
emb|CDX88041.1|  BnaA06g26320D                                          248   1e-75    
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    248   1e-75    
ref|XP_002511125.1|  conserved hypothetical protein                     248   2e-75    Ricinus communis
ref|XP_006366912.1|  PREDICTED: bidirectional sugar transporter S...    247   2e-75    
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      247   2e-75    
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    247   2e-75    
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             248   2e-75    
ref|XP_011071246.1|  PREDICTED: bidirectional sugar transporter N3      248   2e-75    
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    246   2e-75    
ref|XP_010442345.1|  PREDICTED: bidirectional sugar transporter S...    247   2e-75    
ref|XP_003602780.1|  Protein RUPTURED POLLEN GRAIN                      246   2e-75    
ref|XP_006402062.1|  hypothetical protein EUTSA_v10014273mg             247   2e-75    
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    246   3e-75    
ref|XP_009141677.1|  PREDICTED: bidirectional sugar transporter S...    246   3e-75    
ref|XP_008392764.1|  PREDICTED: bidirectional sugar transporter S...    246   4e-75    
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    248   4e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_002321730.2|  N3 like family protein                             246   4e-75    Populus trichocarpa [western balsam poplar]
ref|XP_002511126.1|  conserved hypothetical protein                     247   4e-75    Ricinus communis
ref|XP_010442555.1|  PREDICTED: bidirectional sugar transporter S...    246   5e-75    
ref|NP_001046944.1|  Os02g0513100                                       248   5e-75    Oryza sativa Japonica Group [Japonica rice]
emb|CDY05867.1|  BnaC08g20440D                                          246   5e-75    
ref|XP_006366913.1|  PREDICTED: bidirectional sugar transporter S...    249   6e-75    
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    246   6e-75    
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    245   8e-75    
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    246   9e-75    
ref|XP_008791098.1|  PREDICTED: bidirectional sugar transporter S...    246   9e-75    
ref|XP_006493252.1|  PREDICTED: bidirectional sugar transporter S...    246   9e-75    
emb|CDY08093.1|  BnaA06g16330D                                          246   9e-75    
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    247   1e-74    
emb|CDY16863.1|  BnaA09g05190D                                          245   1e-74    
ref|XP_006281748.1|  hypothetical protein CARUB_v10027907mg             246   1e-74    
emb|CDX87161.1|  BnaC09g04760D                                          245   1e-74    
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    245   1e-74    
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    245   1e-74    
ref|XP_007038078.1|  Medicago truncatula MTN3, putative                 245   1e-74    
ref|XP_008239523.1|  PREDICTED: bidirectional sugar transporter N3      245   2e-74    
emb|CDY69440.1|  BnaCnng63490D                                          243   2e-74    
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    246   2e-74    
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    243   3e-74    
ref|XP_006663471.1|  PREDICTED: bidirectional sugar transporter S...    245   3e-74    
ref|XP_003576036.1|  PREDICTED: bidirectional sugar transporter S...    244   4e-74    
ref|XP_010426372.1|  PREDICTED: bidirectional sugar transporter S...    244   4e-74    
gb|EAY83053.1|  hypothetical protein OsI_38270                          244   5e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_004501816.1|  PREDICTED: bidirectional sugar transporter S...    243   5e-74    
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         243   6e-74    
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    243   7e-74    
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    244   8e-74    
ref|XP_009403777.1|  PREDICTED: bidirectional sugar transporter S...    243   9e-74    
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    242   9e-74    
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    243   9e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-73    
ref|XP_009349481.1|  PREDICTED: bidirectional sugar transporter N...    243   1e-73    
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-73    
ref|XP_011023933.1|  PREDICTED: bidirectional sugar transporter S...    241   2e-73    
ref|XP_006291603.1|  hypothetical protein CARUB_v10017757mg             242   2e-73    
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    243   2e-73    
gb|KHG03157.1|  Bidirectional sugar transporter SWEET15 -like pro...    242   2e-73    
ref|XP_011042931.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    241   2e-73    
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             242   3e-73    
gb|EMT22394.1|  Protein RUPTURED POLLEN GRAIN 1                         242   3e-73    
dbj|BAJ85621.1|  predicted protein                                      242   3e-73    
ref|XP_011036129.1|  PREDICTED: bidirectional sugar transporter S...    241   3e-73    
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             241   3e-73    Populus trichocarpa [western balsam poplar]
gb|KDP26857.1|  hypothetical protein JCGZ_18015                         242   4e-73    
gb|KHG13555.1|  Bidirectional sugar transporter SWEET15                 241   4e-73    
ref|XP_002299333.2|  hypothetical protein POPTR_0001s13410g             241   5e-73    Populus trichocarpa [western balsam poplar]
ref|XP_010045482.1|  PREDICTED: bidirectional sugar transporter S...    241   5e-73    
ref|XP_010536596.1|  PREDICTED: bidirectional sugar transporter S...    242   5e-73    
gb|AAM65058.1|  MtN3-like protein                                       241   6e-73    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131289.1|  mtN3-like protein                                  241   6e-73    Zea mays [maize]
ref|XP_004239304.1|  PREDICTED: bidirectional sugar transporter N3      241   7e-73    
ref|XP_008340254.1|  PREDICTED: bidirectional sugar transporter N...    241   7e-73    
ref|XP_004247459.1|  PREDICTED: bidirectional sugar transporter NEC1    241   8e-73    
ref|XP_010039121.1|  PREDICTED: bidirectional sugar transporter S...    240   9e-73    
ref|XP_003602778.1|  Protein RUPTURED POLLEN GRAIN                      241   1e-72    
ref|XP_010545940.1|  PREDICTED: bidirectional sugar transporter S...    240   1e-72    
ref|XP_010550745.1|  PREDICTED: bidirectional sugar transporter S...    240   1e-72    
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               240   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337540.1|  PREDICTED: bidirectional sugar transporter NEC1    240   2e-72    
ref|XP_011015361.1|  PREDICTED: bidirectional sugar transporter S...    239   2e-72    
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         239   2e-72    
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 239   2e-72    
ref|XP_002450786.1|  hypothetical protein SORBIDRAFT_05g018110          240   2e-72    Sorghum bicolor [broomcorn]
ref|XP_007038077.1|  Medicago truncatula MTN3, putative                 239   2e-72    
gb|KHN31280.1|  Bidirectional sugar transporter SWEET14-like protein    240   3e-72    
gb|KDP28088.1|  hypothetical protein JCGZ_13859                         239   3e-72    
gb|EMT20480.1|  Protein RUPTURED POLLEN GRAIN 1                         239   3e-72    
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    239   3e-72    
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    239   3e-72    
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       238   5e-72    
ref|XP_008235079.1|  PREDICTED: bidirectional sugar transporter S...    238   5e-72    
gb|KHN23961.1|  Bidirectional sugar transporter SWEET12                 239   5e-72    
gb|ACG28570.1|  MTN3                                                    239   5e-72    Zea mays [maize]
ref|NP_001141106.1|  uncharacterized protein LOC100273190               239   5e-72    Zea mays [maize]
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             237   6e-72    
ref|XP_003526939.1|  PREDICTED: bidirectional sugar transporter S...    239   6e-72    
emb|CDP13388.1|  unnamed protein product                                239   7e-72    
ref|NP_196821.1|  senescence-associated protein 29                      238   7e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          239   8e-72    Sorghum bicolor [broomcorn]
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 241   9e-72    
ref|XP_007200238.1|  hypothetical protein PRUPE_ppa015264mg             238   1e-71    
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          238   1e-71    Sorghum bicolor [broomcorn]
ref|XP_002873602.1|  nodulin MtN3 family protein                        238   1e-71    
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    238   1e-71    
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             238   1e-71    
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    238   1e-71    
emb|CDP03543.1|  unnamed protein product                                237   1e-71    
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    238   1e-71    
ref|NP_001149028.1|  LOC100282648                                       238   1e-71    
gb|AAM65389.1|  senescence-associated protein (SAG29)                   238   1e-71    
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          238   2e-71    
ref|XP_002511127.1|  conserved hypothetical protein                     237   2e-71    
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                237   2e-71    
ref|XP_002867630.1|  nodulin MtN3 family protein                        237   2e-71    
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    237   2e-71    
gb|KDO64483.1|  hypothetical protein CISIN_1g020739mg                   237   2e-71    
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    236   2e-71    
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             236   3e-71    
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             237   3e-71    
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    237   3e-71    
gb|EMT20481.1|  Protein RUPTURED POLLEN GRAIN 1                         236   4e-71    
emb|CDX71659.1|  BnaC09g27000D                                          236   4e-71    
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         236   5e-71    
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    236   5e-71    
gb|KCW49071.1|  hypothetical protein EUGRSUZ_K02671                     235   5e-71    
ref|XP_003576225.1|  PREDICTED: bidirectional sugar transporter S...    236   5e-71    
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    235   5e-71    
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    236   6e-71    
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    236   6e-71    
ref|XP_009612477.1|  PREDICTED: bidirectional sugar transporter N...    237   6e-71    
ref|XP_010027258.1|  PREDICTED: bidirectional sugar transporter N...    236   6e-71    
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    235   7e-71    
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    235   7e-71    
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         236   7e-71    
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 236   7e-71    
ref|XP_010037362.1|  PREDICTED: bidirectional sugar transporter S...    235   7e-71    
ref|XP_004980522.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-70    
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    234   1e-70    
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    236   1e-70    
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    234   2e-70    
ref|XP_010534707.1|  PREDICTED: bidirectional sugar transporter S...    235   2e-70    
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    234   2e-70    
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 235   2e-70    
ref|XP_010943754.1|  PREDICTED: bidirectional sugar transporter S...    234   2e-70    
ref|XP_010025273.1|  PREDICTED: bidirectional sugar transporter N...    234   2e-70    
ref|XP_002865824.1|  nodulin MtN3 family protein                        234   2e-70    
ref|XP_010039124.1|  PREDICTED: bidirectional sugar transporter S...    232   3e-70    
ref|NP_001141654.1|  hypothetical protein                               234   3e-70    
ref|XP_002862913.1|  nodulin MtN3 family protein                        234   3e-70    
emb|CDY24854.1|  BnaA08g14560D                                          233   3e-70    
emb|CDY53626.1|  BnaC03g71480D                                          234   4e-70    
gb|EMT20483.1|  Protein RUPTURED POLLEN GRAIN 1                         234   6e-70    
ref|XP_010519500.1|  PREDICTED: bidirectional sugar transporter S...    233   7e-70    
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    232   9e-70    
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    232   9e-70    
ref|XP_004491681.1|  PREDICTED: bidirectional sugar transporter N...    232   9e-70    
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 234   1e-69    
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                231   1e-69    
ref|XP_003620983.1|  Protein RUPTURED POLLEN GRAIN                      232   1e-69    
gb|KHN24975.1|  Bidirectional sugar transporter N3                      232   1e-69    
ref|XP_006399805.1|  hypothetical protein EUTSA_v10014234mg             233   1e-69    
ref|XP_010112742.1|  Bidirectional sugar transporter NEC1               231   2e-69    
ref|XP_010438942.1|  PREDICTED: bidirectional sugar transporter S...    232   2e-69    
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         233   2e-69    
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    231   2e-69    
gb|KEH21447.1|  sugar efflux transporter for intercellular exchan...    231   2e-69    
emb|CDX97233.1|  BnaC09g43920D                                          232   3e-69    
ref|XP_004157602.1|  PREDICTED: bidirectional sugar transporter S...    231   3e-69    
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    231   3e-69    
ref|XP_004501726.1|  PREDICTED: bidirectional sugar transporter S...    232   3e-69    
emb|CDX92666.1|  BnaC07g39240D                                          231   3e-69    
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14                 238   4e-69    
emb|CDX78511.1|  BnaA03g04230D                                          231   4e-69    
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             231   4e-69    
ref|XP_002520679.1|  conserved hypothetical protein                     231   4e-69    
ref|XP_006444236.1|  hypothetical protein CICLE_v10023774mg             231   4e-69    
ref|XP_009777590.1|  PREDICTED: bidirectional sugar transporter N...    232   4e-69    
ref|XP_002280599.1|  PREDICTED: bidirectional sugar transporter S...    231   5e-69    
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               230   6e-69    
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    230   7e-69    
ref|NP_001149087.1|  MTN3                                               231   7e-69    
emb|CDX69663.1|  BnaA10g20120D                                          231   8e-69    
ref|XP_004140547.1|  PREDICTED: bidirectional sugar transporter S...    230   8e-69    
ref|XP_002264875.1|  PREDICTED: bidirectional sugar transporter N3      230   8e-69    
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    229   9e-69    
ref|XP_002443163.1|  hypothetical protein SORBIDRAFT_08g013620          231   1e-68    
ref|XP_007139099.1|  hypothetical protein PHAVU_008G001100g             229   1e-68    
ref|XP_008386620.1|  PREDICTED: bidirectional sugar transporter S...    230   1e-68    
ref|XP_003532319.1|  PREDICTED: bidirectional sugar transporter N...    229   1e-68    
ref|XP_007137871.1|  hypothetical protein PHAVU_009G162800g             226   2e-68    
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    230   2e-68    
gb|AFK47472.1|  unknown                                                 228   2e-68    
emb|CDY34333.1|  BnaA01g14360D                                          229   2e-68    
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             229   2e-68    
emb|CDY03395.1|  BnaC01g16870D                                          229   2e-68    
sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    228   2e-68    
ref|XP_010037364.1|  PREDICTED: bidirectional sugar transporter S...    229   2e-68    
gb|KDO64482.1|  hypothetical protein CISIN_1g047365mg                   228   2e-68    
ref|XP_007139100.1|  hypothetical protein PHAVU_008G001200g             228   2e-68    
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 229   3e-68    
gb|KFK26708.1|  hypothetical protein AALP_AA8G283000                    229   3e-68    
ref|XP_008459891.1|  PREDICTED: bidirectional sugar transporter N3      228   3e-68    
gb|KDO87388.1|  hypothetical protein CISIN_1g036251mg                   228   4e-68    
dbj|BAK07340.1|  predicted protein                                      228   4e-68    
ref|XP_006480106.1|  PREDICTED: bidirectional sugar transporter S...    228   5e-68    
gb|EMT23597.1|  Protein RUPTURED POLLEN GRAIN 1                         228   5e-68    
gb|KEH21448.1|  bidirectional sugar transporter                         227   6e-68    
ref|XP_003578398.1|  PREDICTED: bidirectional sugar transporter S...    228   6e-68    
ref|NP_001132836.1|  hypothetical protein                               229   1e-67    
ref|XP_010517242.1|  PREDICTED: bidirectional sugar transporter S...    226   1e-67    
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    226   1e-67    
ref|XP_007030240.1|  Nodulin MtN3 family protein isoform 1              228   1e-67    
ref|XP_010926783.1|  PREDICTED: bidirectional sugar transporter S...    226   2e-67    
ref|XP_002881628.1|  nodulin MtN3 family protein                        226   2e-67    
ref|XP_010696414.1|  PREDICTED: bidirectional sugar transporter S...    228   2e-67    
gb|KDO64484.1|  hypothetical protein CISIN_1g020739mg                   227   3e-67    
ref|XP_010045483.1|  PREDICTED: bidirectional sugar transporter S...    226   3e-67    
ref|XP_010037373.1|  PREDICTED: bidirectional sugar transporter S...    225   4e-67    
ref|XP_010505570.1|  PREDICTED: bidirectional sugar transporter S...    224   6e-67    
ref|XP_010025272.1|  PREDICTED: bidirectional sugar transporter N...    225   7e-67    
gb|KFK36797.1|  hypothetical protein AALP_AA4G172400                    224   8e-67    
emb|CDX91144.1|  BnaC02g04530D                                          225   8e-67    
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    225   9e-67    
emb|CBI15715.3|  unnamed protein product                                225   9e-67    
ref|XP_010674202.1|  PREDICTED: bidirectional sugar transporter N...    224   9e-67    
gb|KGN63457.1|  hypothetical protein Csa_1G001290                       224   1e-66    
ref|XP_010027262.1|  PREDICTED: bidirectional sugar transporter N...    224   1e-66    
gb|AAM63257.1|  similar to MtN3 protein                                 224   1e-66    
ref|XP_003552719.1|  PREDICTED: bidirectional sugar transporter N...    224   1e-66    
ref|NP_181439.1|  bidirectional sugar transporter SWEET9                224   1e-66    
ref|XP_009121791.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    224   2e-66    
ref|XP_009125890.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-66    
ref|XP_010027260.1|  PREDICTED: bidirectional sugar transporter N...    223   4e-66    
ref|XP_006411131.1|  hypothetical protein EUTSA_v10017080mg             223   4e-66    
ref|XP_009783143.1|  PREDICTED: bidirectional sugar transporter N...    223   4e-66    
gb|KCW61896.1|  hypothetical protein EUGRSUZ_H04589                     222   5e-66    
ref|XP_010509074.1|  PREDICTED: bidirectional sugar transporter S...    222   6e-66    
emb|CDX85668.1|  BnaA02g01450D                                          223   6e-66    
emb|CDP09549.1|  unnamed protein product                                223   6e-66    
gb|EMS51423.1|  Bidirectional sugar transporter SWEET13                 224   8e-66    
gb|KCW49087.1|  hypothetical protein EUGRSUZ_K02694                     222   9e-66    
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    223   9e-66    
ref|XP_010039128.1|  PREDICTED: bidirectional sugar transporter S...    222   1e-65    
ref|XP_010041902.1|  PREDICTED: bidirectional sugar transporter S...    222   1e-65    
gb|KEH21559.1|  bidirectional sugar transporter                         221   1e-65    
ref|XP_010027259.1|  PREDICTED: bidirectional sugar transporter N...    222   1e-65    
ref|XP_010037379.1|  PREDICTED: bidirectional sugar transporter S...    221   2e-65    
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    221   2e-65    
ref|XP_010036837.1|  PREDICTED: bidirectional sugar transporter N...    220   2e-65    
ref|XP_006296061.1|  hypothetical protein CARUB_v10025211mg             221   2e-65    
sp|P93332.1|NOD3_MEDTR  RecName: Full=Bidirectional sugar transpo...    221   2e-65    
ref|XP_004957300.1|  PREDICTED: bidirectional sugar transporter S...    221   2e-65    
emb|CDP14988.1|  unnamed protein product                                221   2e-65    
ref|XP_009103141.1|  PREDICTED: bidirectional sugar transporter S...    219   3e-65    
gb|AGL98401.1|  sucrose transporter SWEET9                              221   3e-65    
gb|KHN17298.1|  Bidirectional sugar transporter NEC1                    220   4e-65    
gb|AFK39311.1|  unknown                                                 219   5e-65    
ref|XP_006376915.1|  hypothetical protein POPTR_0012s10500g             220   5e-65    
gb|KCW61425.1|  hypothetical protein EUGRSUZ_H04154                     219   6e-65    
dbj|BAK04274.1|  predicted protein                                      221   7e-65    
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    218   9e-65    
ref|XP_010037381.1|  PREDICTED: bidirectional sugar transporter S...    219   1e-64    
ref|XP_009586714.1|  PREDICTED: bidirectional sugar transporter N...    219   1e-64    
ref|XP_010042796.1|  PREDICTED: bidirectional sugar transporter N...    219   2e-64    
ref|XP_007159991.1|  hypothetical protein PHAVU_002G283800g             219   3e-64    
emb|CDY70861.1|  BnaCnng70080D                                          215   3e-64    
gb|EMS49335.1|  Bidirectional sugar transporter SWEET14                 220   4e-64    
ref|XP_007148462.1|  hypothetical protein PHAVU_006G210800g             218   4e-64    
ref|XP_007139174.1|  hypothetical protein PHAVU_008G007600g             216   7e-64    
gb|KCW61894.1|  hypothetical protein EUGRSUZ_H04587                     216   8e-64    
ref|XP_010528779.1|  PREDICTED: bidirectional sugar transporter S...    216   1e-63    
gb|AES73031.2|  sugar efflux transporter for intercellular exchan...    214   2e-63    
gb|KCW61897.1|  hypothetical protein EUGRSUZ_H04592                     216   2e-63    
ref|NP_001288941.1|  bidirectional sugar transporter SWEET9             216   2e-63    
gb|KDP22572.1|  hypothetical protein JCGZ_26403                         216   2e-63    
gb|AGV54262.1|  bidirectional sugar transporter SWEET12                 218   3e-63    
ref|XP_004301046.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    216   3e-63    
ref|XP_010039123.1|  PREDICTED: bidirectional sugar transporter S...    214   4e-63    
ref|XP_010926782.1|  PREDICTED: bidirectional sugar transporter S...    214   9e-63    
gb|EPS72542.1|  hypothetical protein M569_02215                         211   3e-62    
ref|XP_007030241.1|  Nodulin MtN3 family protein isoform 2              213   5e-62    
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    212   5e-62    
ref|XP_003518628.1|  PREDICTED: bidirectional sugar transporter NEC1    212   5e-62    
gb|EYU24137.1|  hypothetical protein MIMGU_mgv1a022637mg                209   6e-62    
gb|EYU43028.1|  hypothetical protein MIMGU_mgv1a019383mg                208   6e-62    
gb|AFW71562.1|  hypothetical protein ZEAMMB73_472818                    213   9e-62    
ref|XP_009417933.1|  PREDICTED: bidirectional sugar transporter S...    210   2e-61    
gb|EYU43027.1|  hypothetical protein MIMGU_mgv1a022177mg                209   2e-61    
ref|XP_008389034.1|  PREDICTED: bidirectional sugar transporter N...    210   2e-61    
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    208   4e-61    
ref|XP_009391576.1|  PREDICTED: bidirectional sugar transporter S...    209   4e-61    
ref|XP_006661417.1|  PREDICTED: bidirectional sugar transporter S...    207   9e-61    
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    209   1e-60    
gb|EAZ09693.1|  hypothetical protein OsI_31976                          208   2e-60    
ref|XP_002462642.1|  hypothetical protein SORBIDRAFT_02g029430          207   3e-60    
gb|AFK36312.1|  unknown                                                 208   3e-60    
gb|EMT20482.1|  Protein RUPTURED POLLEN GRAIN 1                         209   3e-60    
gb|EAZ45313.1|  hypothetical protein OsJ_29956                          208   3e-60    
ref|XP_009601078.1|  PREDICTED: bidirectional sugar transporter S...    203   4e-60    
gb|KDP22571.1|  hypothetical protein JCGZ_26402                         207   4e-60    
ref|XP_010999465.1|  PREDICTED: bidirectional sugar transporter S...    206   5e-60    
gb|KCW49073.1|  hypothetical protein EUGRSUZ_K02673                     205   8e-60    
ref|XP_003593107.1|  Protein RUPTURED POLLEN GRAIN                      207   8e-60    
ref|XP_010045484.1|  PREDICTED: bidirectional sugar transporter S...    205   1e-59    
sp|A2XGM7.1|SWT12_ORYSI  RecName: Full=Bidirectional sugar transp...    207   1e-59    
ref|XP_009383909.1|  PREDICTED: bidirectional sugar transporter N...    207   2e-59    
ref|NP_001149496.1|  MTN3                                               206   2e-59    
dbj|BAJ99068.1|  predicted protein                                      206   3e-59    
ref|XP_004174114.1|  PREDICTED: bidirectional sugar transporter S...    202   3e-59    
gb|KHN17480.1|  Bidirectional sugar transporter SWEET15                 205   4e-59    
gb|ACJ84828.1|  unknown                                                 204   5e-59    
gb|KHN33482.1|  Bidirectional sugar transporter SWEET15                 204   5e-59    
gb|ABD78942.1|  disease resistant allele xa13                           205   8e-59    
ref|NP_001050099.1|  Os03g0347500                                       204   8e-59    
ref|XP_010037372.1|  PREDICTED: bidirectional sugar transporter S...    203   1e-58    
ref|XP_004984398.1|  PREDICTED: bidirectional sugar transporter S...    204   1e-58    
ref|XP_008218389.1|  PREDICTED: bidirectional sugar transporter N...    200   2e-58    
ref|XP_009792804.1|  PREDICTED: bidirectional sugar transporter S...    200   3e-58    
ref|XP_002267792.1|  PREDICTED: bidirectional sugar transporter NEC1    202   3e-58    
gb|EMS67211.1|  Bidirectional sugar transporter SWEET12                 203   3e-58    
ref|NP_001062354.1|  Os08g0535200                                       203   4e-58    
ref|XP_011069470.1|  PREDICTED: bidirectional sugar transporter S...    198   5e-58    
gb|EMT31030.1|  Protein RUPTURED POLLEN GRAIN 1                         200   8e-58    
emb|CDX73521.1|  BnaC08g24820D                                          201   1e-57    
ref|NP_001240121.1|  uncharacterized protein LOC100800347               201   1e-57    
gb|EMT31640.1|  Protein RUPTURED POLLEN GRAIN 1                         201   1e-57    
ref|NP_001148964.1|  LOC100282584                                       202   1e-57    
tpg|DAA48249.1|  TPA: MTN3                                              202   2e-57    
gb|KCW49075.1|  hypothetical protein EUGRSUZ_K026741                    200   2e-57    



>ref|XP_009587580.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   386 bits (992),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 212/308 (69%), Positives = 244/308 (79%), Gaps = 18/308 (6%)
 Frame = +2

Query  68   ALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYY  247
              +   WAFAFGVLGNI+SFIVFLSP+PTFY++YKKKS EGYQSIPYV+ALFS+MLWIYY
Sbjct  3    GFSTDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYY  62

Query  248  AFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaT  427
            AF+K N TTLLITINSFG+FIETIYV F++ Y+ KK RVQT+K L L V GGFGAI+L T
Sbjct  63   AFLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVT  121

Query  428  QFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWF  607
            QFLFK  +R  VVGWICLVFSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMWF
Sbjct  122  QFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWF  181

Query  608  FYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILED  787
            FYGL LKD+NIA PNVLGF+FGILQI LY++Y   +K ++KEQKLPE+    KP +IL D
Sbjct  182  FYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQKLPEIQ---KPSVILLD  238

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATA-----  952
             N  N       KLPELT+EQIIDIVKL  LVCS+K+     A+ P D   AATA     
Sbjct  239  ENMNN------KKLPELTQEQIIDIVKLSLLVCSDKVH---VASCPHDNTCAATAHENTP  289

Query  953  PKLQAVEA  976
            PKLQ VEA
Sbjct  290  PKLQTVEA  297



>ref|XP_009591687.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   382 bits (981),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 213/310 (69%), Positives = 243/310 (78%), Gaps = 19/310 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNIISFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISGHWAFAFGVLGNIISFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N TTLLITINSFG+FIETIYV F++ Y+ KK +VQT+K L L V GGFGAI+L 
Sbjct  61   YALLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  VVGWICLVFSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FGILQI LY +Y   +K ++KEQKLPE+    KP +I+ 
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQ---KPEVIVV  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATA----  952
            D N        S KLPELT+EQIIDIVKLG LVCS+K+     A+ P D      A    
Sbjct  237  DEN------MNSKKLPELTQEQIIDIVKLGLLVCSDKVN---VASLPHDTTCGVKAPKVE  287

Query  953  --PKLQAVEA  976
              PKLQ VEA
Sbjct  288  NMPKLQTVEA  297



>ref|XP_009787633.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/308 (69%), Positives = 246/308 (80%), Gaps = 17/308 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITINSFG+FIETIYV F++ Y+ KK +VQT+K L L V GGFGAI+L 
Sbjct  61   YAFLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  VVGWICLVFSLCVF+APL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAVRGQVVGWICLVFSLCVFIAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FGILQI LY++Y   +K ++KEQKLPE+    KP +I+ 
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQKLPEIQ---KPAVIVV  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKL-GTLVCSEKIQKSAAAASPFDKNPAATA---  952
               G N N K   KLPELT+EQIIDIVKL G LVCS+K+     A+ P D N        
Sbjct  237  ---GENMNKK---KLPELTQEQIIDIVKLAGLLVCSDKVH---VASCPHDTNCGVKVENI  287

Query  953  PKLQAVEA  976
            PKLQ VEA
Sbjct  288  PKLQTVEA  295



>ref|XP_009796436.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=297

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/310 (68%), Positives = 242/310 (78%), Gaps = 19/310 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNI+SFIVFLSPLPTFY ++KKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYSIFKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N TTLLITINSFG+FIETIYV F++ Y+ KK +VQT+K L L V GGFGAI+L 
Sbjct  61   YALLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  +VGWICLVFSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAVRGQIVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FGILQI LY +Y   +K ++KEQKLPE+    KP +I+ 
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQ---KPAVIVV  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATA----  952
            D N        S KLPELT+EQIIDIVKLG LVCS+K+     A+ P D      A    
Sbjct  237  DEN------MNSKKLPELTQEQIIDIVKLGLLVCSDKVN---VASRPHDTTCGVKAPKVE  287

Query  953  --PKLQAVEA  976
              PKLQ VEA
Sbjct  288  NMPKLQTVEA  297



>ref|XP_009762335.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
sylvestris]
Length=299

 Score =   381 bits (978),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/308 (68%), Positives = 243/308 (79%), Gaps = 17/308 (6%)
 Frame = +2

Query  68   ALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYY  247
              +   WAFAFGVLGNI+SFIVFLSP+PTFY++YKKKS EGYQSIPYV+ALFS+MLWIYY
Sbjct  3    GFSTDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYY  62

Query  248  AFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaT  427
            AF+K N TTLLITINSFG+FIETIYV F++ Y+ KK RVQT+K L L V GGFGAI+L T
Sbjct  63   AFLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVT  121

Query  428  QFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWF  607
            QFLFK  +R  VVGWICLVFSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMWF
Sbjct  122  QFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWF  181

Query  608  FYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILED  787
            FYGL LKD+NIA PNVLGF+FGILQI LY++Y   +  ++KEQKLPE+    K  +IL D
Sbjct  182  FYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKENAILKEQKLPEIQ---KQAVILLD  238

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAA-----TA  952
             N  N     + KLPELT+EQIIDIVKLG +VCS+   K+  A+ P D   AA     T 
Sbjct  239  ENMNN-----NKKLPELTQEQIIDIVKLGLMVCSD---KAHVASCPHDNTCAAKAHENTP  290

Query  953  PKLQAVEA  976
            PKLQ VEA
Sbjct  291  PKLQTVEA  298



>ref|XP_009794695.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   379 bits (972),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 213/308 (69%), Positives = 245/308 (80%), Gaps = 17/308 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITINSFG+FIETIYV  ++ Y+ KK RVQT+K L L V GGFGAI+L 
Sbjct  61   YAFLKTN-TTLLITINSFGVFIETIYVGVYLFYAPKKARVQTVKMLLLSVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  VVGWICLVFSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FGILQI LY++Y   +K ++KEQKLPE+    KP +I+ 
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQKLPEIQ---KPAVIVV  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKL-GTLVCSEKIQKSAAAASPFDKNPAATA---  952
            D    N N K   KLPELT+EQIIDIVKL G LVCS+K+     A+ P D   AA     
Sbjct  237  DE---NMNKK---KLPELTQEQIIDIVKLAGLLVCSDKVH---VASCPHDNTCAAKVENI  287

Query  953  PKLQAVEA  976
            P LQ V+A
Sbjct  288  PNLQTVKA  295



>ref|XP_009597195.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=291

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 243/303 (80%), Gaps = 16/303 (5%)
 Frame = +2

Query  77   AHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFV  256
            +  WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLWIYYAF+
Sbjct  2    SGHWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFL  61

Query  257  KANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFL  436
            K N TTLLITINSFG+FIETIYV F++ Y+ KK RVQTMK L L V GGFGAI+L TQFL
Sbjct  62   KTN-TTLLITINSFGVFIETIYVGFYLFYAPKKARVQTMKMLLLSVVGGFGAIVLVTQFL  120

Query  437  FKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYG  616
            FK  +R  VVGWICLVFSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMWFFYG
Sbjct  121  FKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  180

Query  617  LFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNG  796
            L LKD+NIA PNVLGF+FGI+QI LY++Y   +K  +KE KLPE+    KP +I+ D   
Sbjct  181  LLLKDINIAAPNVLGFIFGIVQIVLYVIYSKKEKANLKEPKLPEIQ---KPAVIVVDE--  235

Query  797  TNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATA---PKLQA  967
             N N K   K+PELT+EQIIDIVKLG LVC++K+     A+ P D   AA     PKLQ 
Sbjct  236  -NMNKK---KIPELTQEQIIDIVKLGLLVCADKVH---VASCPHDNTCAAKVENIPKLQT  288

Query  968  VEA  976
            V+A
Sbjct  289  VKA  291



>ref|XP_009605550.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   372 bits (955),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 206/307 (67%), Positives = 240/307 (78%), Gaps = 14/307 (5%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTL+ITINSFG FIETIYV F++ Y+ KK RVQT+K L L V GGFGAI+L 
Sbjct  61   YAFLKTN-TTLIITINSFGCFIETIYVSFYLFYAPKKARVQTVKMLVLSVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK   R   VGWICLVFSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL +KD+NIA+PNVLGF+ GILQI LY++Y   +K ++KEQKLP    +   VII++
Sbjct  180  FFYGLLVKDINIAIPNVLGFILGILQIVLYVIYNKKEKAILKEQKLP--AKIQNHVIIVD  237

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAA---TAP  955
            +NN        + KLPELTEEQIIDIVKLG+L+ S KI  ++   +      AA     P
Sbjct  238  ENN--------NQKLPELTEEQIIDIVKLGSLISSGKIHVASCLHNSTCGVEAAKVENMP  289

Query  956  KLQAVEA  976
            KLQ  EA
Sbjct  290  KLQTAEA  296



>ref|XP_009758165.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   369 bits (948),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 239/306 (78%), Gaps = 15/306 (5%)
 Frame = +2

Query  68   ALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYY  247
             ++ H WAFAFGVLGNIISFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLWIYY
Sbjct  3    GISGH-WAFAFGVLGNIISFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYY  61

Query  248  AFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaT  427
            AF+K N TTL+ITINSFG FIETIYV F++ Y+ KK RVQT+K L L V GGFG I+L T
Sbjct  62   AFLKTN-TTLIITINSFGCFIETIYVGFYLFYAPKKARVQTLKMLLLSVVGGFGVIVLVT  120

Query  428  QFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWF  607
            QFLFK   R   VGWICLVFSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLTLSAVMWF
Sbjct  121  QFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWF  180

Query  608  FYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILED  787
            FYGL +KD+NIA+PN+LGF+ GILQI LY++Y   +K ++KEQKLPE   +   VII+++
Sbjct  181  FYGLLVKDINIAIPNILGFILGILQIVLYIIYNKKEKAILKEQKLPE--KIQNHVIIVDE  238

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAA---TAPK  958
            NN        + KLPELTEE IIDIVKLG+L+ S KI  ++   +      AA     PK
Sbjct  239  NN--------NQKLPELTEEHIIDIVKLGSLISSGKIHVASCLHNSTCGVEAAKVENMPK  290

Query  959  LQAVEA  976
            LQ  EA
Sbjct  291  LQTAEA  296



>ref|XP_006347634.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/304 (65%), Positives = 242/304 (80%), Gaps = 10/304 (3%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA +A  WAF FGVLGNI+SFIVFLSPLPTFY +YKKK+ EGYQSIPYVVALFS+MLWIY
Sbjct  1    MAFSADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITIN+FG+FIETIYV F++ Y+ KK+RVQT+K L LFV GGFGAI+L 
Sbjct  61   YAFLKTN-TTLLITINTFGVFIETIYVGFYLFYAPKKSRVQTIKMLSLFVVGGFGAIILV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T+FLFK  +R  VVGWICL+FSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TEFLFKGAIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PN+LGF+FGILQ+ LY++Y   +K ++KEQKLPE+    K  +I++
Sbjct  180  FFYGLLLKDINIAAPNILGFIFGILQMILYVIYSKKEKAILKEQKLPEIQ---KAEVIVK  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQ-KSAAAASPFDKNPAATAPKL  961
            D N  NTN     K PELT+EQIIDIV+LG +VC +K+   +    +  +       PKL
Sbjct  237  DEN-MNTNK----KFPELTQEQIIDIVRLGLMVCKDKVHVATCPHGTTCEAKVDENVPKL  291

Query  962  QAVE  973
            Q +E
Sbjct  292  QTME  295



>ref|XP_009758167.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 201/307 (65%), Positives = 238/307 (78%), Gaps = 14/307 (5%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLW+Y
Sbjct  1    MAAISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWVY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTL+ITINSFG FIETIYV F++ Y+ KK R+QT+K L L V GGFG I+L 
Sbjct  61   YAFLKTN-TTLIITINSFGCFIETIYVGFYLFYAPKKARIQTVKMLVLSVVGGFGVIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK   R   VGWICLVFSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL +KD+NIA+PNVLGFV GILQI LY++Y   +K ++KE+K+PE   +   VII++
Sbjct  180  FFYGLLVKDINIAIPNVLGFVLGILQIVLYVIYNKKEKAILKEEKVPE--KIQNHVIIVD  237

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAA---AASPFDKNPAATAP  955
            D N        + KLPELTEEQIIDIVKLG+L+ S KI  ++    +    +       P
Sbjct  238  DYN--------NQKLPELTEEQIIDIVKLGSLISSGKIHVASCLHNSKCGVEAAKVENMP  289

Query  956  KLQAVEA  976
            KLQ  EA
Sbjct  290  KLQTAEA  296



>ref|XP_009605549.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 238/307 (78%), Gaps = 14/307 (5%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAAISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTL+ITINSFG FIETIYV F++ Y+ KK RVQT+K L L V GGFG I+L 
Sbjct  61   YAFLKTN-TTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK   R   VGWICLVFSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL +KD+NIA+PNVLGF+ GI Q+ LY++Y   +K  +KEQKLPE   +   VII++
Sbjct  180  FFYGLLVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKANLKEQKLPE--KIQNHVIIVD  237

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAA---TAP  955
            +NN        S KLPELTEE+IIDIVKLG+L+ S KI  ++   +      AA     P
Sbjct  238  ENN--------SQKLPELTEERIIDIVKLGSLISSGKIHVASCLHNSTCGVEAAKVENMP  289

Query  956  KLQAVEA  976
            KLQ  EA
Sbjct  290  KLQTAEA  296



>ref|XP_006347346.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=287

 Score =   367 bits (943),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 209/304 (69%), Positives = 238/304 (78%), Gaps = 17/304 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  W FAFGVLGNIISF VFLSPLPTFY +YKKKSTEGYQSIPYVVALFSAMLWIY
Sbjct  1    MAGFSDHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLL+TIN+FG FIET+YV F++ Y+ KK RVQT+K L L V GGFGAI+L 
Sbjct  61   YAFLKTN-TTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +RA +VGWICLVFSLCVFVAPL I+RQVI+TKSVE MP LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAIRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD NIA+PNVLGF+FGILQ+ LY+MY   ++ V+KEQ LPE   L   VIILE
Sbjct  180  FFYGLLLKDFNIAIPNVLGFIFGILQMILYVMYNKKEEVVIKEQNLPE---LKDHVIILE  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQ  964
            D       DK+  KLPEL+EEQII+I+KLG+LV SEK   +    +  DK       KLQ
Sbjct  237  D-------DKK--KLPELSEEQIINIMKLGSLVYSEKNYGNLNEVAKNDK----VVSKLQ  283

Query  965  AVEA  976
             VEA
Sbjct  284  TVEA  287



>ref|XP_004235333.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
lycopersicum]
Length=296

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 199/304 (65%), Positives = 241/304 (79%), Gaps = 10/304 (3%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA +A  WAF FGVLGNI+SFIVFLSPLPTFY +YKKK+ EGYQSIPYVVALFS+MLWIY
Sbjct  1    MAFSADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITIN+FG+F+ETIYVVF++ Y+ KK+RVQT+K L LFV GGFGAI+L 
Sbjct  61   YAFLKTN-TTLLITINTFGVFVETIYVVFYLIYAPKKSRVQTIKMLSLFVVGGFGAIILV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  VVGWICL+FSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGVIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PN+LGF+FG+LQ+ LY++Y   +K ++KEQKLPE+    K  +I++
Sbjct  180  FFYGLLLKDINIAAPNILGFIFGVLQMILYVIYSKKEKAILKEQKLPEIQ---KGEVIVK  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQ-KSAAAASPFDKNPAATAPKL  961
            D N     DK   K PELT+EQIIDIV+LG +VC  K+   +    +  +       PKL
Sbjct  237  DEN--MNADK---KFPELTQEQIIDIVRLGLMVCKGKVHVATCPHGTTCEPKVDENEPKL  291

Query  962  QAVE  973
            Q VE
Sbjct  292  QTVE  295



>ref|XP_009758166.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   367 bits (942),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 202/307 (66%), Positives = 238/307 (78%), Gaps = 14/307 (5%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTL+ITINSFG FIETIYV F++ Y+ KK RVQT+K L L V GGFG I+L 
Sbjct  61   YAFLKTN-TTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK   R   VGWICLVFSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL +KD+NIA+PNVLGF+ GI Q+ LY++Y   +K ++KEQKL E   +   VII++
Sbjct  180  FFYGLLVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKAILKEQKLSE--KIQNHVIIVD  237

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAA---TAP  955
            +NN        + KLPELTEEQIIDIVKLG+L+ S KI  ++   +      AA     P
Sbjct  238  ENN--------NQKLPELTEEQIIDIVKLGSLISSGKIHVASCLHNSTCGGEAAKVEKVP  289

Query  956  KLQAVEA  976
            KLQ  EA
Sbjct  290  KLQTAEA  296



>gb|ACV71016.1| UPA16 [Capsicum annuum]
Length=301

 Score =   367 bits (942),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 238/312 (76%), Gaps = 20/312 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M   +  WAFAFGVLGNIISFIVFLSP+PTFY +YKKK+ EGYQSIPYV+ALFS+MLWIY
Sbjct  1    MTGISGHWAFAFGVLGNIISFIVFLSPIPTFYTIYKKKTAEGYQSIPYVIALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N  TLLITINSFGIFIETIYV  ++ Y+ KK RV T+K L L V GGFGAI+L 
Sbjct  61   YAFLKTN-VTLLITINSFGIFIETIYVGLYLFYAPKKARVHTVKMLLLTVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  +VGWICL+F+L VFVAPL I+RQVI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGVVRGQIVGWICLIFALSVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FG+LQI LY +Y   +K ++KEQKLPE+    KP +I+ 
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGVLQIVLYAIYSKKEKVILKEQKLPEIQ---KPAVIVA  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKL-GTLVCSEKIQKSAAAASPFDKNPAATA---  952
            D+N TN N     KLPELT EQIIDIVKL G L C+E   KS  A  P D N    A   
Sbjct  237  DDN-TNANK----KLPELTHEQIIDIVKLAGLLTCTE---KSHVATCPHDVNCGVEATNV  288

Query  953  ----PKLQAVEA  976
                PKLQ VEA
Sbjct  289  ENNIPKLQTVEA  300



>ref|XP_009599477.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=282

 Score =   366 bits (940),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 204/304 (67%), Positives = 239/304 (79%), Gaps = 22/304 (7%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++ H WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYV+ALFS+MLWIY
Sbjct  1    MAISGH-WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIY  59

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITINSFG+FIETIYV F++ Y+ KK RVQT+K L L V  GFGAI+L 
Sbjct  60   YAFLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLTVVAGFGAIILI  118

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
             QFLFK   R  VVGW+CLVFSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  119  AQFLFKGVARGQVVGWVCLVFSLCVFVAPLCIVRKVIKTKSVEFMPLLLSVFLTLSAVMW  178

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PN+LG +FGILQI LY++Y   +K ++KEQ LPE   L   VIIL+
Sbjct  179  FFYGLLLKDINIAAPNILGLIFGILQIVLYVIYNKKEKHILKEQNLPE---LQNHVIILD  235

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQ  964
            DN           KLPELTEE  IDI+KLG LV S  + ++A AA+  +K      PKLQ
Sbjct  236  DNK----------KLPELTEEHKIDILKLGKLVSS--LHENACAAAKEEK-----LPKLQ  278

Query  965  AVEA  976
             V+A
Sbjct  279  TVQA  282



>ref|XP_006347633.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 238/307 (78%), Gaps = 17/307 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  ++ WAFAFGVLGNI+SFIVFLSP+PTFY +YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISNHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N   LLITINSFG+FIETIYV  ++ Y+ KK RVQT+K L L V GGFGAI+L 
Sbjct  61   YALLKTN-MPLLITINSFGMFIETIYVGLYLFYAPKKARVQTVKMLMLSVVGGFGAIILV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T+ LFK  +R  VVGWICL+FSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TELLFKGAIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FGILQI LY +Y   +K ++KEQKLPE+     P +I++
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQKLPEIQT---PGVIVK  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFD-----KNPAAT  949
            D N  +TN     KLPELT+EQIIDIVKLG LVCS+K Q    A  P D      N    
Sbjct  237  DEN-MHTNK----KLPELTQEQIIDIVKLGLLVCSDKTQ---VATCPNDTNCGINNNVVN  288

Query  950  APKLQAV  970
             PKLQ V
Sbjct  289  MPKLQTV  295



>ref|XP_004241452.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
lycopersicum]
Length=287

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 207/304 (68%), Positives = 238/304 (78%), Gaps = 17/304 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  W FAFGVLGNIISF VFLSPLPTFY +YKKKSTEGYQSIPYVVALFSAMLWIY
Sbjct  1    MAGFSDHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLL+TIN+FG FIET+YV F++ Y+ KK RVQT+K L L V GGFGAI+L 
Sbjct  61   YAFLKTN-TTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIILI  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +RA +VGWICLVFSLCVFVAPL I+RQVI+TKSVE MP LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAIRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD NIA+PNVLGF+FGILQ+ LY+MY   +K V+KEQ LPE   L   VII+E
Sbjct  180  FFYGLLLKDFNIAIPNVLGFIFGILQMILYVMYNKKEKVVIKEQNLPE---LKDHVIIIE  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQ  964
            D       DK+  KLPEL+EEQII+I+KLG+LV S+K   +    +  DK       KLQ
Sbjct  237  D-------DKK--KLPELSEEQIINIIKLGSLVYSDKNYGNLTEVAKNDK----AISKLQ  283

Query  965  AVEA  976
             +EA
Sbjct  284  TLEA  287



>ref|XP_004235334.1| PREDICTED: bidirectional sugar transporter SWEET12 [Solanum lycopersicum]
Length=298

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 235/305 (77%), Gaps = 19/305 (6%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            + WAFAFGVLGNI+SFIVFLSP+PTFY +YKKKSTEGYQSIPYVVALFS+MLWIYYA +K
Sbjct  4    NHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  63

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            +N   LLITINSFG+FIETIYV  ++ Y+  K RV T+K L L V GGFGAI+L T+FLF
Sbjct  64   SN-MPLLITINSFGMFIETIYVGLYLLYAPNKARVHTIKMLMLSVVGGFGAIVLITEFLF  122

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K  +R  +VGWICL+FSLCVFVAPL I+R+VI+TKSVE MP+LLSVFLTLSAVMWFFYGL
Sbjct  123  KGVVRGQIVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  182

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             LKD+NIA PNVLGF+FGILQI LY +Y   +K ++KEQKLPE+     P +I+++ N  
Sbjct  183  LLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQKLPEIQT---PAVIVKNENMM  239

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFD--------KNPAATAP  955
            NT    + KLPELT+EQIIDIVKLG LVCS+K Q    A  P D         N     P
Sbjct  240  NT----TKKLPELTQEQIIDIVKLGLLVCSDKTQ---VATCPNDTNCGVKDTNNNVVNMP  292

Query  956  KLQAV  970
            KLQ V
Sbjct  293  KLQTV  297



>ref|XP_009802608.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
 ref|XP_009792803.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=293

 Score =   360 bits (923),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 237/315 (75%), Gaps = 33/315 (10%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++ H WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYV+ALFS+MLWIY
Sbjct  1    MAISGH-WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIY  59

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITINSFG+FIETIYV F++ Y+ KK R+QT+K L L V GGFGAI+L 
Sbjct  60   YAFLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILI  118

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPL-----------FILRQVIRTKSVECMPVLL  571
             QFLFK   R  VVGW+CLVFSLCVFVAPL           F+ R+VI+TKSVE MP+LL
Sbjct  119  AQFLFKGVARGQVVGWVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLL  178

Query  572  SVFLTLSAVMWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEV  751
            SVFLTLSAVMWFFYGL LKD+NIA PN+LGF+FGILQI LY++Y   +K ++KEQ LPE 
Sbjct  179  SVFLTLSAVMWFFYGLLLKDINIAAPNILGFIFGILQIVLYVIYNKKEKHILKEQNLPE-  237

Query  752  TALPKPVIILEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFD  931
              L   VIIL+DN           KLPELTEEQ IDI+KL  LV S     SAAA     
Sbjct  238  --LQNHVIILDDNK----------KLPELTEEQKIDIMKLSKLVSSLHENASAAAKEE--  283

Query  932  KNPAATAPKLQAVEA  976
                   PKLQ+V+A
Sbjct  284  -----NLPKLQSVQA  293



>ref|XP_006347652.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=482

 Score =   367 bits (941),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 203/290 (70%), Positives = 238/290 (82%), Gaps = 12/290 (4%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFGVLGNIISFIVFLSP+PTFY++YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISGHWAFAFGVLGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITIN+FG+FIETIYV F++ Y+ KK RVQT+K L LFV GGFGAI++ 
Sbjct  61   YAFLKTN-TTLLITINTFGVFIETIYVGFYLFYAPKKARVQTIKMLSLFVVGGFGAIIVV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  VVGWICL+FSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TQFLFKGAIRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF FGILQI LY++Y   +K ++KEQKLPE+    K  +I+ 
Sbjct  180  FFYGLLLKDINIAAPNVLGFFFGILQIVLYVIYSKKEKAILKEQKLPEIQ---KAAVIVS  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKL-GTLVCSEKIQKSAAAASPFD  931
            D+N TN  +K   KLPELT+EQIIDIV+L G L  ++K+Q    A  P D
Sbjct  237  DDN-TNVANK---KLPELTQEQIIDIVRLAGLLANTDKVQ---VATCPHD  279


 Score =   199 bits (507),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 135/189 (71%), Gaps = 19/189 (10%)
 Frame = +2

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T+FLFK  +R  VVGWICL+FSLCVFVAPL I RQVI+TKSVE MP+LLS+FLTLSAV+W
Sbjct  306  TEFLFKGAVRGQVVGWICLIFSLCVFVAPLGI-RQVIKTKSVEYMPLLLSIFLTLSAVVW  364

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA+PNVLGF+ GILQ+ LY++Y   +K ++KEQKLPE   L   +II  
Sbjct  365  FFYGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEKAILKEQKLPE--KLQNHMII--  420

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQ-----KSAAAASPFDKNPAAT  949
                  + D+++   PELTEEQIIDIVKLG+L+ S KI        A  AS   +N   T
Sbjct  421  ------SIDEKNKNFPELTEEQIIDIVKLGSLISSGKIHIASCLHDAVCASAKIEN---T  471

Query  950  APKLQAVEA  976
               LQ VEA
Sbjct  472  PNNLQTVEA  480



>ref|XP_006363981.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=300

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 239/310 (77%), Gaps = 20/310 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+    +AFAFGVLGNI+SFIVFLSP+PTFY +YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAVDFGHYAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K+N   LLITINSFG+FIETIYV F++ Y+ KK RV T+K L L V GGFGAI+L 
Sbjct  61   YALLKSN-MPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T+FLFK  +R  +VGW+CL+FSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TEFLFKGVVRGQIVGWVCLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FGILQI LY +Y   +K ++KEQKLPE   + KP +I++
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPE---MQKPEVIVK  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKL-GTLVCSEKIQKSAAAASPFDKNPAATA---  952
            D N  N N     KLPELT+EQIIDIVKL G LV ++   K+  A  P D N    A   
Sbjct  237  DEN-MNANK----KLPELTQEQIIDIVKLAGLLVVTD---KANVATCPNDTNCGVKAAIK  288

Query  953  ----PKLQAV  970
                PKLQ V
Sbjct  289  IENMPKLQTV  298



>ref|XP_004235342.2| PREDICTED: uncharacterized protein LOC101265905 [Solanum lycopersicum]
Length=599

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 208/313 (66%), Positives = 245/313 (78%), Gaps = 21/313 (7%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFG+LGNIISFIVFLSP+PTFY++YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAGISGHWAFAFGILGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N TTLLITINSFG+FIETIYV F++ Y+ KK RVQT+K L L V GGFGAI+L 
Sbjct  61   YALLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T+FLFK  +R  VVGWICL+FSLCVFVAPL I+RQVI+TKSVE MP+LLS+FLTLSAV+W
Sbjct  120  TEFLFKGVVRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSIFLTLSAVVW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FGILQI LY++Y   +K ++KEQKLPE+    K  +I+ 
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYNKKEKVILKEQKLPEIQ---KAAVIVS  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKL-GTLVCSEKIQKSAAAASPFDK-NPAATA--  952
            D+N TN N     KLPELT+EQIIDIV+L G L  ++K+Q    A  P D  N    A  
Sbjct  237  DDN-TNVNK----KLPELTQEQIIDIVRLAGLLANTDKVQ---VATCPHDHANCGVKATP  288

Query  953  -----PKLQAVEA  976
                 PKLQ VEA
Sbjct  289  NVENMPKLQTVEA  301


 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 239/310 (77%), Gaps = 19/310 (6%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            +MA  +  WAFAFGVLGNI+SFIVFLSPLPTFY++YKKKST+GYQSIPYVVALFS+MLWI
Sbjct  302  SMAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTDGYQSIPYVVALFSSMLWI  361

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYAF+K N TTLLITINSFG+FIETIYV F++ Y+ KK RVQT+K L L V GGFGAI+L
Sbjct  362  YYAFLKTN-TTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVL  420

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             T+FLFK  +R  +VGWICL+FSLCVFVAPL I++QVI+TKSVE MP+LLS+FLTLSAV+
Sbjct  421  ITEFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVKQVIKTKSVEYMPLLLSIFLTLSAVV  480

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIIL  781
            WFFYGL LKD+NIA+PNVLGF+ GILQ+ LY++Y   +K ++KEQKLPE   L   +II 
Sbjct  481  WFFYGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEKAILKEQKLPE--KLQNHMIIS  538

Query  782  EDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQ-----KSAAAASPFDKNPAA  946
             D    N+        P LTEEQIIDIVKLG+L+ S KI        A  AS   +N   
Sbjct  539  MDEKNKNS--------PGLTEEQIIDIVKLGSLISSGKIHIASCLHDAMCASAKIEN---  587

Query  947  TAPKLQAVEA  976
            T   L+ VEA
Sbjct  588  TPNNLETVEA  597



>ref|XP_004235326.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=300

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 204/310 (66%), Positives = 238/310 (77%), Gaps = 20/310 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+    +AFAFGVLGNIISFIVFLSP+PTFY +YKKKSTEGYQSIPYVVALFS+MLWIY
Sbjct  1    MAVDFGHYAFAFGVLGNIISFIVFLSPIPTFYSIYKKKSTEGYQSIPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K+N   LLITINSFG+FIETIYV F++ Y+ KK RV T+K L L V GGFGAI+L 
Sbjct  61   YALLKSN-MPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T+FLFK  +R  +VGWICL+FSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLTLSAVMW
Sbjct  120  TEFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PNVLGF+FGILQI LY +Y   +K ++KEQKLPE+    K  +I++
Sbjct  180  FFYGLLLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEIQ---KTEVIVK  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKL-GTLVCSEKIQKSAAAASPFDKNPAATA---  952
            D N  N N     KLPELT+EQIIDIVKL G LV ++   K+  A  P D N    A   
Sbjct  237  DEN-MNANK----KLPELTQEQIIDIVKLAGLLVVTD---KTNVATCPNDTNCGVKAVNK  288

Query  953  ----PKLQAV  970
                PKLQ V
Sbjct  289  IENMPKLQTV  298



>ref|XP_004235339.1| PREDICTED: bidirectional sugar transporter SWEET10 [Solanum lycopersicum]
Length=282

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 231/304 (76%), Gaps = 22/304 (7%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+  H WAF FGVLGNIISFIVFLSP+PTF ++YKKKSTEGYQSIPYV+ALFS MLWIY
Sbjct  1    MAIAGH-WAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIY  59

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITINSFG+ IETIYV  F+ Y+ KK RV T+K L L V GGFGAI+L 
Sbjct  60   YAFLKTN-TTLLITINSFGMLIETIYVSLFLYYAPKKARVNTVKMLLLTVVGGFGAIILV  118

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  +VGWICL+FSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLT+SAVMW
Sbjct  119  TQFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMW  178

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD+NIA PN+LGF+FGILQ+ LY MY+   K +V          +  PVIIL+
Sbjct  179  FFYGLLLKDVNIAAPNILGFIFGILQMILYAMYRKKHKPIVNVN-----VEVQNPVIILD  233

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQ  964
            DN           K+PELTEEQIIDIVKLG LVCS KIQ     AS  ++N A+   K Q
Sbjct  234  DN----------KKIPELTEEQIIDIVKLGKLVCSGKIQ----MASTLNQN-ASKEVKQQ  278

Query  965  AVEA  976
              EA
Sbjct  279  TEEA  282



>ref|XP_009614916.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X2 [Nicotiana tomentosiformis]
Length=298

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 233/310 (75%), Gaps = 25/310 (8%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAF FGVLGNI+SF VFLSPLPTFY++Y+KKSTEGYQSIPYVVALFSAMLWIY
Sbjct  1    MADFSGHWAFTFGVLGNIVSFFVFLSPLPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K+N TTLLITINSFG F+ETIYV F++ Y+ KK RVQT+K L L V  GFGAI+L 
Sbjct  61   YAFLKSN-TTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQFLFK  +R  VVGWICLVFSLCVFV+PL I+RQVI+TKS E MP  LSVFLTLSAVMW
Sbjct  120  TQFLFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD NIA+PNVLGF+ GILQ+ LY+MY   ++ +VKE K PE   L   VIIL 
Sbjct  180  FFYGLLLKDFNIAIPNVLGFILGILQMVLYVMYNKKEEVIVKEHKFPE---LQNHVIILH  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLV-CSEKIQKSAAAASPFDKNPAATA---  952
                   NDK    LPELTEEQIIDIVKL +L+ C+EK       AS   +N A  A   
Sbjct  237  -------NDKN---LPELTEEQIIDIVKLASLISCTEKFN----VASYLHENVAEVAKDH  282

Query  953  ---PKLQAVE  973
               PKLQ VE
Sbjct  283  RKLPKLQPVE  292



>ref|XP_006347635.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=286

 Score =   354 bits (908),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 202/307 (66%), Positives = 235/307 (77%), Gaps = 24/307 (8%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++ H WAF FGVLGNIISFIVFLSP+PTF ++YKKKSTEGYQSIPYV+ALFS MLWIY
Sbjct  1    MAISGH-WAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIY  59

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITINSFG+ IETIYV  F+ Y+ KK RV T+K L L V GGFGAI++ 
Sbjct  60   YAFLKTN-TTLLITINSFGMLIETIYVGLFLYYAPKKARVNTVKMLLLTVVGGFGAIIVV  118

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQF+FK  +R  +VGWICL+FSLCVFVAPL I+RQVI+TKSVE MP+LLSVFLT+SAVMW
Sbjct  119  TQFVFKGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMW  178

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTA-LPKPVIIL  781
            FFYGL LKD+NIA PN+LGF+FGILQ+ LY MY+  KKD    + +  V   +  PVIIL
Sbjct  179  FFYGLLLKDVNIAAPNILGFIFGILQMILYAMYR--KKD---NKPIVNVNVEVQNPVIIL  233

Query  782  EDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAP--  955
            +DN           K+PELTEEQIIDIVKLG LVCS KIQ     AS  ++N A      
Sbjct  234  DDN----------KKIPELTEEQIIDIVKLGKLVCSGKIQ----MASTLNQNAAKEVKLT  279

Query  956  KLQAVEA  976
             LQA EA
Sbjct  280  NLQAEEA  286



>ref|XP_009614915.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana tomentosiformis]
Length=302

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 233/314 (74%), Gaps = 29/314 (9%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPL----PTFYQMYKKKSTEGYQSIPYVVALFSAM  232
            MA  +  WAF FGVLGNI+SF VFLSPL    PTFY++Y+KKSTEGYQSIPYVVALFSAM
Sbjct  1    MADFSGHWAFTFGVLGNIVSFFVFLSPLYVRRPTFYKIYRKKSTEGYQSIPYVVALFSAM  60

Query  233  LWIYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfga  412
            LWIYYAF+K+N TTLLITINSFG F+ETIYV F++ Y+ KK RVQT+K L L V  GFGA
Sbjct  61   LWIYYAFLKSN-TTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGA  119

Query  413  illaTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLS  592
            I+L TQFLFK  +R  VVGWICLVFSLCVFV+PL I+RQVI+TKS E MP  LSVFLTLS
Sbjct  120  IVLVTQFLFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLS  179

Query  593  AVMWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPV  772
            AVMWFFYGL LKD NIA+PNVLGF+ GILQ+ LY+MY   ++ +VKE K PE   L   V
Sbjct  180  AVMWFFYGLLLKDFNIAIPNVLGFILGILQMVLYVMYNKKEEVIVKEHKFPE---LQNHV  236

Query  773  IILEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLV-CSEKIQKSAAAASPFDKNPAAT  949
            IIL        NDK    LPELTEEQIIDIVKL +L+ C+EK       AS   +N A  
Sbjct  237  IILH-------NDK---NLPELTEEQIIDIVKLASLISCTEKFN----VASYLHENVAEV  282

Query  950  A------PKLQAVE  973
            A      PKLQ VE
Sbjct  283  AKDHRKLPKLQPVE  296



>ref|XP_009802194.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana sylvestris]
Length=298

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 202/310 (65%), Positives = 231/310 (75%), Gaps = 25/310 (8%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAF FGVLGNI+SF VFLSPLPTFY++YKKKSTE YQSIPYVVALFSAM WIY
Sbjct  1    MADFSGHWAFTFGVLGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K+N TTLLITINSFG FIETIYV F++ Y+ KK RVQT+K L L V GGFGAI+L 
Sbjct  61   YAFLKSN-TTLLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            TQ LFK  +R  VVGWICLVFSLCVFV+PL I+RQVI+TKSVE MP  +SVFLTLSAV W
Sbjct  120  TQLLFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD NIA+PNVLGF+ GILQ+  Y++Y   ++ +VKE K PE+      VIIL 
Sbjct  180  FFYGLLLKDFNIAIPNVLGFIVGILQMVFYVIYYKKEEVIVKEHKFPEIQ---NHVIILH  236

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLV-CSEKIQKSAAAASPFDKNPAATA---  952
                   NDK    LPELTEEQIIDIVKLG+L+ C+E        AS   +N A  A   
Sbjct  237  -------NDKN---LPELTEEQIIDIVKLGSLISCTEIFN----VASYLHENVAEAAKDH  282

Query  953  ---PKLQAVE  973
               PKLQAVE
Sbjct  283  KKLPKLQAVE  292



>ref|XP_009794853.1| PREDICTED: bidirectional sugar transporter SWEET9-like, partial 
[Nicotiana sylvestris]
Length=282

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 224/300 (75%), Gaps = 32/300 (11%)
 Frame = +2

Query  110  GNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTTLLITI  289
            GNI+SFIVFLSPLPTFY++YKKKSTEGYQSIPYV+ALFS+MLWIYYAF+K N TTLLITI
Sbjct  4    GNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTN-TTLLITI  62

Query  290  NSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMRAHVVG  469
            NSFG+FIETIYV F++ Y+ KK R+QT+K L L V GGFGAI+L  QFLFK   R  VVG
Sbjct  63   NSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQFLFKGVARGQVVG  122

Query  470  WICLVFSLCVFVAPL-----------FILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYG  616
            W+CLVFSLCVFVAPL           F+ R+VI+TKSVE MP+LLSVFLTLSAVMWFFYG
Sbjct  123  WVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  182

Query  617  LFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNG  796
            L LKD+NIA PN+LGF+FGILQI LY++Y   +K ++KEQ LPE   L   VIIL+DN  
Sbjct  183  LLLKDINIAAPNILGFIFGILQIVLYVIYNKKEKHILKEQNLPE---LQNHVIILDDNK-  238

Query  797  TNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQAVEA  976
                     KLPELTEEQ IDI+KL  LV S     SAAA            PKLQ+V+A
Sbjct  239  ---------KLPELTEEQKIDIMKLSKLVSSLHENASAAAKE-------ENLPKLQSVQA  282



>ref|XP_006347347.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
tuberosum]
Length=289

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 192/279 (69%), Positives = 224/279 (80%), Gaps = 16/279 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  W FAFGVLGNI+SF VFLSPLPTF +MYKK STEGYQSIPYVVALFSAMLWIY
Sbjct  1    MADFSVHWVFAFGVLGNIVSFFVFLSPLPTFCKMYKKNSTEGYQSIPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITIN+FG F+E IYV F++ Y++K+ RVQT+K L L V GGFGAI+L 
Sbjct  61   YAFLKTN-TTLLITINTFGCFVEIIYVGFYLFYASKEARVQTIKLLLLLVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            +QFLF+  +R  VVGWICLV SLCVFVAPL I++QVI+TKSVE MP LLSVFLTLSAVMW
Sbjct  120  SQFLFEGAVRVQVVGWICLVCSLCVFVAPLCIVKQVIKTKSVEYMPFLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK-KDVVKEQKLPEVTALPKPVIIL  781
            FFYGL LKD NIA+PNVLGF+FGILQ+ LY+MY + K ++ VKEQ LPE   L   VIIL
Sbjct  180  FFYGLLLKDFNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEQNLPE---LKNHVIIL  236

Query  782  EDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLV-CSEK  895
                    NDK   K PEL+EEQII+IVKLG+L+ C++K
Sbjct  237  H-------NDK---KFPELSEEQIIEIVKLGSLISCTQK  265



>ref|XP_009614917.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=286

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 224/302 (74%), Gaps = 19/302 (6%)
 Frame = +2

Query  68   ALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYY  247
             ++ H WA AFGVLG+I+SFIVFLSPLPTFY +YKKKSTEGYQSIPYVVALFS +LWIYY
Sbjct  3    GISVHVWASAFGVLGDIVSFIVFLSPLPTFYTIYKKKSTEGYQSIPYVVALFSCILWIYY  62

Query  248  AFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaT  427
            A + +N    +ITIN+FG FIETIYV F++ Y+ KK RVQT+K L L V GGFGAI+L T
Sbjct  63   ALLMSN-MIFIITINTFGCFIETIYVGFYLFYAPKKARVQTVKMLLLLVLGGFGAIVLVT  121

Query  428  QFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWF  607
            QFLFK  +R  +VGWICLVFSLC F APL I+R+VI+TKSVE MP LLS FLTLSAVMWF
Sbjct  122  QFLFKGAVRGQIVGWICLVFSLCTFAAPLCIVRKVIKTKSVEYMPFLLSFFLTLSAVMWF  181

Query  608  FYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILED  787
            FYGL +KD N+A+PN+LGF+FGILQ+ LY++Y   +K+++KEQKL E   L   V+I E+
Sbjct  182  FYGLLIKDKNVAIPNILGFIFGILQMILYVIYNKKEKNIIKEQKLRE---LQNHVVISEE  238

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQA  967
                         LP+LTEEQIIDIVKLG LV SEK       A+  +       PKLQ 
Sbjct  239  QKN----------LPQLTEEQIIDIVKLGALVYSEKFNARGPEAAKVE-----NMPKLQT  283

Query  968  VE  973
            V+
Sbjct  284  VQ  285



>ref|XP_009802195.1| PREDICTED: bidirectional sugar transporter SWEET9-like isoform 
X2 [Nicotiana sylvestris]
Length=297

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 222/300 (74%), Gaps = 25/300 (8%)
 Frame = +2

Query  95   AFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTT  274
             F   GNI+SF VFLSPLPTFY++YKKKSTE YQSIPYVVALFSAM WIYYAF+K+N TT
Sbjct  10   GFPFAGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLKSN-TT  68

Query  275  LLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMR  454
            LLITINSFG FIETIYV F++ Y+ KK RVQT+K L L V GGFGAI+L TQ LFK  +R
Sbjct  69   LLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFKGVVR  128

Query  455  AHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKDM  634
              VVGWICLVFSLCVFV+PL I+RQVI+TKSVE MP  +SVFLTLSAV WFFYGL LKD 
Sbjct  129  VQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFYGLLLKDF  188

Query  635  NIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTNDK  814
            NIA+PNVLGF+ GILQ+  Y++Y   ++ +VKE K PE+      VIIL        NDK
Sbjct  189  NIAIPNVLGFIVGILQMVFYVIYYKKEEVIVKEHKFPEIQ---NHVIILH-------NDK  238

Query  815  RSSKLPELTEEQIIDIVKLGTLV-CSEKIQKSAAAASPFDKNPAATA------PKLQAVE  973
                LPELTEEQIIDIVKLG+L+ C+E        AS   +N A  A      PKLQAVE
Sbjct  239  N---LPELTEEQIIDIVKLGSLISCTEIFN----VASYLHENVAEAAKDHKKLPKLQAVE  291



>ref|XP_004242139.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Solanum 
lycopersicum]
Length=289

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 186/279 (67%), Positives = 225/279 (81%), Gaps = 16/279 (6%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  W FAFGVLGNIISF VFLSPLPTFY+MYKKKSTEGYQSIPY+VALFSAMLWIY
Sbjct  1    MADFSVHWVFAFGVLGNIISFFVFLSPLPTFYKMYKKKSTEGYQSIPYIVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K N TTLLITIN+FG F+E +Y+ F++ Y++K+ RVQT+K L L V GGFGAI+L 
Sbjct  61   YAFLKTN-TTLLITINTFGCFVEIMYIGFYLFYASKEARVQTVKLLLLLVVGGFGAIVLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            +QFLF+  +R  VVG ICL+ SLCVFVAPL I+RQVI+TKSVE MP LLSVFLTLSAVMW
Sbjct  120  SQFLFEGAVRVQVVGCICLICSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-GKKDVVKEQKLPEVTALPKPVIIL  781
            FFYG+ L+D NIA+PNVLGF+FGILQ+ LY+MY +  +++ VKE+ LP+   L   VIIL
Sbjct  180  FFYGILLEDFNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEKNLPD---LKNHVIIL  236

Query  782  EDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLV-CSEK  895
                    NDK   K PEL+EEQII+IVKLG+L+ C++K
Sbjct  237  H-------NDK---KFPELSEEQIIEIVKLGSLISCTQK  265



>ref|XP_009803865.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=288

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 216/298 (72%), Gaps = 19/298 (6%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK-A  262
            W  AFGVLGNI+SF+VFLSPLPTFY +YKKKSTEGYQSIPYVVALFS +LWIYYA +   
Sbjct  9    WTSAFGVLGNIVSFMVFLSPLPTFYSIYKKKSTEGYQSIPYVVALFSCVLWIYYALLMPQ  68

Query  263  NDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFK  442
            ++   +ITIN+ G FIET YV  ++ Y+ KK RVQT+K L L V GGFGA++L  QFLFK
Sbjct  69   SNLIFIITINTIGCFIETFYVGIYLFYAPKKARVQTVKMLLLLVVGGFGAMVLVIQFLFK  128

Query  443  SEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLF  622
              +R  +VGWICLVFS+C F APL ILR+VI+TKSVE MP LLS+FLTL+AVMWFFYGL 
Sbjct  129  GAVRGQIVGWICLVFSVCTFAAPLCILRKVIKTKSVEYMPFLLSLFLTLNAVMWFFYGLL  188

Query  623  LKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTN  802
             ++  +A+PN+LGF FGILQ+ LY++Y   +K+V+KEQKL E   L   VII ++     
Sbjct  189  KRNKIVAIPNILGFTFGILQMILYVVYNKKEKNVIKEQKLRE---LQNHVIISDEQK---  242

Query  803  TNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQAVEA  976
                   KLP+LTEEQIIDIVKLG +V SEK       A+  +       PKLQ V+A
Sbjct  243  -------KLPQLTEEQIIDIVKLGAIVYSEKFNARGTEAAKVE-----NMPKLQTVDA  288



>ref|XP_011073105.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=290

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 160/270 (59%), Positives = 205/270 (76%), Gaps = 17/270 (6%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AF FG+LGNIISF+VFL+P+PTFYQ+YK+KSTEG+QS+PYVV LFSAML IYYAF+   D
Sbjct  6    AFVFGLLGNIISFMVFLAPIPTFYQIYKRKSTEGFQSLPYVVGLFSAMLLIYYAFLLP-D  64

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
            +TLLITINSFG FIET+Y+ F++ Y+ K  R+QT   L L    G G I++ T FL K  
Sbjct  65   STLLITINSFGCFIETLYICFYLFYAPKTARLQTATLLLLLNVVGMGLIVVLTHFLAKDS  124

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             RAH+VGWICLVFS+ VFVAPL ++RQVIRTKSVE MP LLS FLTLSAVMWFFYGL  K
Sbjct  125  TRAHIVGWICLVFSVSVFVAPLCVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  184

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTN  808
            D NIA+PN+LGF+FG+LQ+ LY++YK+ KK +  ++KLPE+  + +              
Sbjct  185  DYNIAIPNILGFIFGVLQMALYLVYKNAKKAI--QEKLPEIIEMEE--------------  228

Query  809  DKRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
            +K+++ +P   +EQIID++KL  +VCSE I
Sbjct  229  EKQNNTIPAELKEQIIDVMKLSAIVCSEII  258



>ref|XP_004235340.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=295

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 165/276 (60%), Positives = 201/276 (73%), Gaps = 17/276 (6%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            +T H  AF FG+LGNI+SF+V+L+P+PTFY++YKKKSTEG+QS+PYVV LFSAMLWIYYA
Sbjct  1    MTTH-LAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYA  59

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
            F+K  DTTLLITINS G FI+T Y+ FF+ Y+TKK ++ TMK L      G G I+  TQ
Sbjct  60   FLKP-DTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTMKLLLSMNVVGLGLIIFLTQ  118

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            F  K   RA +VGWICL+FS CVFVAPL +LRQVIRTKSVE MP  LS FLTLSAVMWF 
Sbjct  119  FFAKGSNRAQIVGWICLIFSFCVFVAPLGVLRQVIRTKSVEYMPFQLSFFLTLSAVMWFL  178

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDN  790
            YGL  KD NIA+PNVLGF  G++Q+ LY++YK+ KK V KE KL EVT +          
Sbjct  179  YGLLRKDYNIAIPNVLGFSLGVIQMTLYLIYKNAKK-VTKEVKL-EVTEIV---------  227

Query  791  NGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
                 +DK      E+ ++QIID+VKL  +VCSE I
Sbjct  228  ----ADDKELKLSEEILKDQIIDVVKLSAIVCSEII  259



>ref|XP_009605548.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
tomentosiformis]
Length=294

 Score =   303 bits (777),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 205/270 (76%), Gaps = 15/270 (6%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AF FG+LGNI+SF+V+L+P PTFY++YKKKSTEG+QS+PYVV LFSAMLWIYYAF+K  D
Sbjct  5    AFTFGLLGNIVSFMVYLAPAPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP-D  63

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
            TTLLITINS G  I++ Y+ FF+ Y+TKK ++ T+K L L    G G I+L TQFL KS 
Sbjct  64   TTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKSS  123

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             RA +VGWICL+FSLCVFVAPL I+RQVI+T+SVE MP LLS FLTLSAVMWFFYGL  K
Sbjct  124  NRAQIVGWICLIFSLCVFVAPLGIVRQVIKTQSVEYMPFLLSFFLTLSAVMWFFYGLLRK  183

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTN  808
            D NIA+PNVLGF  G+LQ+ LY++YK+ KK V KE K+ E           ++N  T   
Sbjct  184  DYNIAIPNVLGFTLGVLQMVLYVIYKNAKK-VTKEIKIAE-----------KENTVTIVE  231

Query  809  DKRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
            + + S+  +L +EQIID+VKL  +VCSE I
Sbjct  232  EHKLSE--DLLKEQIIDVVKLSAMVCSEII  259



>ref|XP_009801964.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=294

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/270 (60%), Positives = 205/270 (76%), Gaps = 15/270 (6%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AF FG+LGNI+SF+V+L+P+PTFY+++KKKSTEG+QS+PYVV LFSAMLWIYYAF+K  D
Sbjct  5    AFTFGLLGNIVSFMVYLAPVPTFYKIHKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP-D  63

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
            TTLLITINS G  I++ Y+ FF+ Y+TKK ++ T+K L L    G G I+L TQFL KS 
Sbjct  64   TTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKSS  123

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             RA +VGWICL+FSLCVFVAPL I+RQVI+T+SVE MP LLS FLTLSAVMWFFYGL  K
Sbjct  124  NRAQIVGWICLIFSLCVFVAPLGIVRQVIKTRSVEYMPFLLSFFLTLSAVMWFFYGLLRK  183

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTN  808
            D NIA+PNVLGF  G+LQ+ LY++YK+ KK V KE K+ E           ++N  T   
Sbjct  184  DYNIAIPNVLGFTLGVLQMVLYVIYKNAKK-VTKEVKIAE-----------KENTVTIVE  231

Query  809  DKRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
            + + S+  +  +EQIID+VKL  +VCSE I
Sbjct  232  EHKLSE--DKLKEQIIDVVKLSAMVCSEII  259



>ref|XP_006347632.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=294

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 160/270 (59%), Positives = 196/270 (73%), Gaps = 17/270 (6%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AF FG+LGNI+SF+V+L+P+PTFY++YKKKSTEG+QS+PYVV LFSAMLWIYYAF+K  D
Sbjct  6    AFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP-D  64

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
            TTLLITINS G FI+T Y+ FF+ Y+TKK ++ T+K L      G G I+L TQF  K  
Sbjct  65   TTLLITINSVGCFIQTFYICFFLFYATKKAKMDTVKLLLSMNVVGLGLIILLTQFFSKGS  124

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             RA +VGWICL+FS CVFVAPL +LRQVIR+KSVE MP  LS FLTLSAVMWFFYGL  K
Sbjct  125  NRAQIVGWICLIFSFCVFVAPLGVLRQVIRSKSVEYMPFQLSFFLTLSAVMWFFYGLLRK  184

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTN  808
            D NIA+PNVLGF  G++Q+ LY++YK+ KK V KE +L                N     
Sbjct  185  DYNIAIPNVLGFSLGVIQMTLYLIYKNAKK-VTKEVRL---------------ENTETVV  228

Query  809  DKRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
            D+      E+ +EQIID+VKL  +VCSE I
Sbjct  229  DEELKLSEEMLKEQIIDVVKLSAMVCSEII  258



>ref|XP_011073577.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
 ref|XP_011073579.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=270

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 217/295 (74%), Gaps = 35/295 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA  +  WAFAFG+LGNI+SF+VFLSP+PTFYQ+YKKK++EG+QS+PYVVALFSAMLWIY
Sbjct  1    MAGFSGHWAFAFGLLGNIVSFMVFLSPIPTFYQIYKKKTSEGFQSVPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAF+K+N TTL+ITINS G FI+TIY+ F++ Y+ KK RVQT+K L L +  GFG IL++
Sbjct  61   YAFLKSN-TTLIITINSVGCFIQTIYICFYLFYAPKKQRVQTLKLLFLLIVCGFGFILVS  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL K+ ++A+VVGWICLVFSLCVF+APL I+R+VIRTKSVE MP LLS+FLTLSAVMW
Sbjct  120  THFLVKASLQANVVGWICLVFSLCVFIAPLCIVRKVIRTKSVEYMPFLLSLFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYG  +KD NIA+PNVLGF FG+LQ+ LY+ YK+  K                  +ILE
Sbjct  180  FFYGFLIKDYNIAIPNVLGFSFGVLQMALYVKYKNAAK------------------MILE  221

Query  785  DNNGTNTNDKRSSKLPELTEEQII-DIVKLGTLVCSEKIQKSAAAASPFDKNPAA  946
            D            K+ ELT EQI+ DIVK+  L  S+K+    AA S  +   AA
Sbjct  222  DG-----------KISELTAEQIMDDIVKISALSRSDKV----AATSQMNSGGAA  261



>ref|XP_011083538.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=278

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 200/264 (76%), Gaps = 18/264 (7%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            +Q AF FG+LGN++SF+VFL+P+PTFYQ+YKKKSTEG+QS+PYVV LFSAMLWIYYAF+K
Sbjct  2    NQLAFVFGLLGNVVSFMVFLAPIPTFYQIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLK  61

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              DTTLLITINS G FI++ Y+ F++ ++ +  RVQT+K L L    GFG I++ T FL 
Sbjct  62   P-DTTLLITINSVGCFIQSAYICFYLFFAPRNARVQTVKLLLLLNTVGFGLIMVLTYFLA  120

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K   RA+ VGWICLVFSLCVFVAPL ++RQV+RTKS E MP LLS FLT+SA++WFFYG 
Sbjct  121  KGSNRANFVGWICLVFSLCVFVAPLCVVRQVLRTKSAEYMPFLLSFFLTISAIVWFFYGF  180

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
              KD NIA+PNVLGF+FG+LQ+ LY++Y++GK  V + Q+      LP  +I +ED    
Sbjct  181  LRKDYNIAIPNVLGFIFGVLQMVLYLIYRNGKTLVQENQQ------LPAGIIAVED----  230

Query  800  NTNDKRSSKLPELTEEQIIDIVKL  871
                    +LPEL  +QIID+VKL
Sbjct  231  ------EKQLPEL-RDQIIDVVKL  247



>gb|EPS64389.1| hypothetical protein M569_10392, partial [Genlisea aurea]
Length=248

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 195/273 (71%), Gaps = 30/273 (11%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
             Q AF FG+LGN ISF+VFL+P+PTFY++YKKKSTEG+Q +PY+V LFSAMLWIYYAF+K
Sbjct  1    SQLAFVFGLLGNAISFMVFLAPIPTFYKIYKKKSTEGFQCVPYIVGLFSAMLWIYYAFLK  60

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              DTTLL+TINS G F ++IY+ F++ +S+KKTRV T K L +     FG I+  T+F+ 
Sbjct  61   P-DTTLLVTINSVGCFFQSIYIGFYLYFSSKKTRVVTTKQLFVLNVASFGVIIAVTRFVV  119

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                +A VVGWICLVFSLCVFVAPL ++RQVIRTKSVECMP LLS FLTLSAVMWFFYGL
Sbjct  120  SPSQQASVVGWICLVFSLCVFVAPLCVVRQVIRTKSVECMPFLLSFFLTLSAVMWFFYGL  179

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
              KD NIA+PNVLGF+FG+LQ+ LYMMY+   +D  K +KLP                  
Sbjct  180  LRKDYNIALPNVLGFIFGVLQMLLYMMYRKVDEDSAK-KKLP------------------  220

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
                     LPEL ++QI+D VKL + +  E I
Sbjct  221  ---------LPEL-QDQILDAVKLNSAIAVEII  243



>emb|CDP21121.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/270 (60%), Positives = 202/270 (75%), Gaps = 18/270 (7%)
 Frame = +2

Query  83   QWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKA  262
            Q AF FG+LGNI+SF+V+L+PLPTFY +YKKKSTEG+QS+PYVV LFSAML IYYAF+K 
Sbjct  3    QLAFIFGLLGNIVSFMVYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFSAMLRIYYAFLKP  62

Query  263  NDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFK  442
             DTTL ITINS G F +T+Y+ +++ Y+ ++ R+QT K L L V  GFG+I+L TQ L  
Sbjct  63   -DTTLRITINSVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQLLST  121

Query  443  SEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLF  622
             + RA +VGWI LV SLCVFVAPL I+RQVI TKSVE MP L S FLTLSA+MWFFYG  
Sbjct  122  GKTRARIVGWIGLVLSLCVFVAPLAIVRQVILTKSVEYMPFLPSFFLTLSAIMWFFYGFL  181

Query  623  LKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTN  802
             +D NIA+PN+LGF FGILQ+ LY++YK+ KK V  EQKLPE+      VI+LE++    
Sbjct  182  RQDYNIAIPNILGFFFGILQMVLYLIYKNAKKAV--EQKLPEIQ---NQVIVLEEH----  232

Query  803  TNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                   KLPEL +EQ+I++VKL  LV  E
Sbjct  233  -------KLPEL-QEQVIEVVKLSALVRPE  254



>gb|EYU23059.1| hypothetical protein MIMGU_mgv1a019104mg [Erythranthe guttata]
Length=278

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 196/265 (74%), Gaps = 25/265 (9%)
 Frame = +2

Query  110  GNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTTLLITI  289
            GNI+SF+VFL+PLPTF+Q+YK+KS+EG+QS+PYVV LFSAMLWIYYA +K  DTTLLITI
Sbjct  5    GNIVSFMVFLAPLPTFHQIYKRKSSEGFQSVPYVVGLFSAMLWIYYALLKP-DTTLLITI  63

Query  290  NSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMRAHVVG  469
            NS G FI+T Y+ F++ Y+ K  R+QT+  + L    G G I++ TQF+ K   RA +VG
Sbjct  64   NSVGCFIQTTYICFYLFYAPKSARLQTLALVFLLNVVGMGLIVVLTQFVAKGYNRAAIVG  123

Query  470  WICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKDMNIAVP  649
            WICLVFSLCVF+APL ++RQV+RTKSVE MP LLS FLTLSAVMWFFYGL  KD NIA+P
Sbjct  124  WICLVFSLCVFIAPLCVVRQVVRTKSVEYMPFLLSFFLTLSAVMWFFYGLIRKDYNIAIP  183

Query  650  NVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTNDKRSSKL  829
            NVLGF+FG++Q+ LY+MYK+ KK  V E+KL E+         +ED++          K+
Sbjct  184  NVLGFIFGVIQMMLYVMYKNTKK--VVEEKLQEIQ--------MEDHH----------KI  223

Query  830  PELTEEQIIDIVKLGTLVCSEKIQK  904
            P    EQIID+ KL  +VCSE I  
Sbjct  224  P----EQIIDVEKLSAVVCSEIINN  244



>gb|EYU43031.1| hypothetical protein MIMGU_mgv1a011488mg [Erythranthe guttata]
Length=280

 Score =   284 bits (727),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 203/266 (76%), Gaps = 17/266 (6%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            +Q AF FG+LGN++SF+VFL+P+PTFYQ++KKKSTEG+QS+PY V LFSAMLWIYYAF+K
Sbjct  2    NQLAFVFGLLGNVVSFMVFLAPIPTFYQIFKKKSTEGFQSVPYAVGLFSAMLWIYYAFLK  61

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              +TTLLITINS G  I++ Y+ F++ ++TK  R+QT+K + L    GFG I++ T F  
Sbjct  62   P-ETTLLITINSVGCVIQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVLTHFWA  120

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R  VVGWICLVFSLCVFVAPL ++RQVIRTKSVE MP LLS FLTLSAVMWFFYGL
Sbjct  121  NDSNRDDVVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGL  180

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKD-GKKDVVKEQKLPEVTALPKPVIILEDNNG  796
              KD NIA+PNVLGF+FG++Q+ LY+MYK+  K    K+QKLPE+      +I++++N  
Sbjct  181  LRKDYNIAIPNVLGFMFGVIQMVLYVMYKNPKKVVQEKKQKLPEIET---QIIVIDEN--  235

Query  797  TNTNDKRSSKLPELTEEQIIDIVKLG  874
                     KLPEL +EQIID++KLG
Sbjct  236  ---------KLPEL-KEQIIDVMKLG  251



>gb|EYU43032.1| hypothetical protein MIMGU_mgv1a010677mg [Erythranthe guttata]
Length=305

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 202/266 (76%), Gaps = 17/266 (6%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            +Q AF FG+LGN+ISF+VFL+P+PTFY ++KKKSTEG+QS+PYVV LFSA LWIYYAF+K
Sbjct  31   NQLAFVFGLLGNVISFMVFLAPIPTFYTIFKKKSTEGFQSVPYVVGLFSAQLWIYYAFLK  90

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              +TTLLITIN+ G F+++ Y+ F++ ++TK  R+QT+K + L    GFG I++ T F  
Sbjct  91   P-ETTLLITINTVGCFVQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVLTHFWA  149

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R  +VGWICLVFSLCVFVAPL ++RQVIRTKSVE MP LLS FLTLSAVMWFFYGL
Sbjct  150  NDSNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGL  209

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKD-GKKDVVKEQKLPEVTALPKPVIILEDNNG  796
              KD NIA+PNVLGF+FG++Q+ LY+MYK+  K    K+QKLPE+      +I++++N  
Sbjct  210  LRKDYNIAIPNVLGFLFGVIQMVLYVMYKNPKKVVQEKKQKLPEIET---QIIVIDEN--  264

Query  797  TNTNDKRSSKLPELTEEQIIDIVKLG  874
                     KLPEL  EQIID+VKLG
Sbjct  265  ---------KLPEL-REQIIDVVKLG  280



>gb|EYU43030.1| hypothetical protein MIMGU_mgv1a011435mg [Erythranthe guttata]
Length=282

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 201/265 (76%), Gaps = 14/265 (5%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            +Q AF FG+LGN++SF+VFL+P+PTFY ++KKKST+G+QS+PYVV LFSAMLWIYYAF+K
Sbjct  2    NQLAFVFGLLGNVVSFMVFLAPIPTFYTIFKKKSTQGFQSVPYVVGLFSAMLWIYYAFLK  61

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              +TTLLITIN+ G F+++ Y+ F++ +++K  R+QT+K + L    GFG I++ T F  
Sbjct  62   P-ETTLLITINTVGCFVQSTYICFYLFFASKNARIQTVKLILLLNVVGFGLIIVLTHFWA  120

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R  +VGWICLVFSLCVFVAPL ++RQVIRTKSVE MP LLS FLTLSAVMWFFYGL
Sbjct  121  NDSNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGL  180

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
              KD NIA+PNVLGF+FG++Q+ LY+MYK+        ++  E++ +   +I+L++N   
Sbjct  181  LRKDYNIAIPNVLGFLFGVVQMVLYVMYKN-TNSKKVVKEKKEISEIETKIIVLDEN---  236

Query  800  NTNDKRSSKLPELTEEQIIDIVKLG  874
                    KLPEL +EQIID++KLG
Sbjct  237  --------KLPEL-KEQIIDVMKLG  252



>ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
 emb|CBI15714.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/271 (58%), Positives = 195/271 (72%), Gaps = 32/271 (12%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H   F FG+LGN+ISF+V+L+PLPTFYQ+YK+KSTEG+QS+PYVVALFSAMLWIYYAF+ 
Sbjct  8    HPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAFLN  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D +LLITINS G  IET Y+V F+ Y+ KK R+ T+K + L    GFG+ILL T  L 
Sbjct  68   -TDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLLA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            +   R  ++GW+CLVFSL VF+APL I+RQVIRTKSVE MP LLS FLTLSAVMWFFYGL
Sbjct  127  EGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             LKD  IA PN+LGFVFGI+Q+ LY++Y++ +K V++ +KLPE++               
Sbjct  187  MLKDFYIAGPNILGFVFGIVQMVLYLIYRN-RKKVLENEKLPELS---------------  230

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                           EQIID+VKL T+VCSE
Sbjct  231  ---------------EQIIDVVKLSTMVCSE  246



>emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera]
Length=273

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/271 (58%), Positives = 195/271 (72%), Gaps = 32/271 (12%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H   F FG+LGN+ISF+V+L+PLPTFYQ+YK+KSTEG+QS+PYVVALFSAMLWIYYAF+ 
Sbjct  8    HPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAFLN  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D +LLITINS G  IET Y+V F+ Y+ KK R+ T+K + L    GFG+ILL T  L 
Sbjct  68   -TDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLLA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            +   R  ++GW+CLVFSL VF+APL I+RQVIRTKSVE MP LLS FLTLSAVMWFFYGL
Sbjct  127  EGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             LKD  IA PN+LGFVFGI+Q+ LY++Y++ +K V++ +KLPE++               
Sbjct  187  MLKDFYIAGPNILGFVFGIVQMVLYLIYRN-RKKVLENEKLPELS---------------  230

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                           EQIID+VKL T+VCSE
Sbjct  231  ---------------EQIIDVVKLSTMVCSE  246



>ref|XP_004138032.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 ref|XP_004161361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 gb|KGN63458.1| hypothetical protein Csa_1G001300 [Cucumis sativus]
Length=292

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 195/278 (70%), Gaps = 26/278 (9%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    AF FG+LGNIISF+VFL+PLPTFY++YKKKS EGYQS+PYVVALFSAMLWIY
Sbjct  1    MAISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N  T LITINSFG  IE++Y++ FI Y+  K R QT K + L    GFG +L  
Sbjct  61   YALLKTN-ATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLAL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T  L K E R  V+GWICLVF+L VF APLFI+ +VI+TKSVE MP  LS FLTL+AVMW
Sbjct  120  TLVLAKGEKRLKVLGWICLVFNLSVFAAPLFIMGKVIKTKSVEYMPFALSFFLTLNAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD  IA+PNV+GFVFGI+Q+ LY++     K +  + ++P             
Sbjct  180  FFYGLLLKDYYIALPNVVGFVFGIIQMILYVIV----KHIGNKSRIP-------------  222

Query  785  DNNGTNTNDKRSSKLPELTE--EQIIDIVKLGTLVCSE  892
                    D++++  P+L E  EQIID VKLGT+VC+E
Sbjct  223  ------VKDEKAAAPPQLHELSEQIIDAVKLGTMVCTE  254



>emb|CDP21733.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/261 (59%), Positives = 194/261 (74%), Gaps = 18/261 (7%)
 Frame = +2

Query  110  GNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTTLLITI  289
            GNI+SF  +L+PLPTFY +YKKKSTEG+QS+PYVV LF AMLWIYYAF+K  DTTLLITI
Sbjct  7    GNIVSFTDYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFRAMLWIYYAFLKP-DTTLLITI  65

Query  290  NSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMRAHVVG  469
            NS G F +T+Y+ +++ Y+ ++ R+QT K L L V  GFG+I+L TQ L   + RA +VG
Sbjct  66   NSVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQLLSTGKTRARIVG  125

Query  470  WICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKDMNIAVP  649
            WI LV SLCVFVAPL I+RQVI TKSVE MP L S FLTLSA+MWFFYG   KD N+A+P
Sbjct  126  WIGLVLSLCVFVAPLAIVRQVILTKSVEYMPFLPSFFLTLSAIMWFFYGFLRKDYNVAIP  185

Query  650  NVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTNDKRSSKL  829
            N+LGF FGILQ+ LY++YK+ KK V  EQKLPE+      V++LE++           KL
Sbjct  186  NILGFFFGILQMVLYLIYKNAKKAV--EQKLPEIQ---NQVMVLEEH-----------KL  229

Query  830  PELTEEQIIDIVKLGTLVCSE  892
            PEL +EQ+I++VKL  LV  E
Sbjct  230  PEL-QEQVIEVVKLSALVRPE  249



>ref|XP_008464393.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
melo]
Length=296

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 197/278 (71%), Gaps = 22/278 (8%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    AF FG+LGNIISF+VFL+PLPTFY++YKKKS EGYQS+PYVVALFSAMLWIY
Sbjct  1    MAISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N  T LITINSFG  IE++Y++ FI Y+  K R QT K + L    GFG +L  
Sbjct  61   YALLKTN-ATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLAL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T  L K E R  V+GWICLVF+L VF APL I+ +VI+TKSVE MP  LS FLTL+AVMW
Sbjct  120  TLVLAKGEKRLKVLGWICLVFNLSVFAAPLLIMGKVIKTKSVEYMPFALSFFLTLNAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD  IA+PNV+GFVFGI+Q+ LY++     K++  + ++P           ++
Sbjct  180  FFYGLLLKDYYIALPNVVGFVFGIIQMILYVIV----KNIGNKSRIP-----------VK  224

Query  785  DNNGTNTNDKRSSKLPELTE--EQIIDIVKLGTLVCSE  892
            D  G      +++  P+L E  EQIID VKLGT+VC+E
Sbjct  225  DELGA----AKAAAPPQLHELSEQIIDAVKLGTMVCTE  258



>ref|XP_007038075.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22576.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
Length=280

 Score =   276 bits (707),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 202/298 (68%), Gaps = 34/298 (11%)
 Frame = +2

Query  83   QWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKA  262
             WAF FGVLGN++SF+V L+PLPTFYQ+YKK+++EG+QSIPYVV+LFSAMLWIYYA +K 
Sbjct  6    SWAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYYALLK-  64

Query  263  NDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFK  442
             D  LLITIN+F  FI+T Y+V +  Y+ KK +V T+K + LF   GFG I L+T FL  
Sbjct  65   KDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTFFLQN  124

Query  443  SEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLF  622
               R HV+G+IC+ F+L VF APL ILR+VI+TKSVE MP  LSVFLTL AVMWFFYGL 
Sbjct  125  PLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFFYGLL  184

Query  623  LKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTN  802
            LKDMNIAVPNV+GF+FGILQ+ LY +YK+  K +V++ KL +++                
Sbjct  185  LKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQLS----------------  228

Query  803  TNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQAVEA  976
                          E I+D+VKLGT+VCSE    +A A  P + N      + Q ++ 
Sbjct  229  --------------EHIVDVVKLGTMVCSE---VNAVAPQPNETNNNGGVVQAQNIKG  269



>ref|NP_001241307.1| uncharacterized protein LOC100810946 [Glycine max]
 gb|ACU19376.1| unknown [Glycine max]
 gb|KHN17481.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=257

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 192/284 (68%), Gaps = 29/284 (10%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M +    WAF FGV+GNIISF VFL+PLPTFYQ+YKKKSTEG+QS+PYVVALFSAMLWIY
Sbjct  1    MTMHRESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK     LLITIN+FGI +E+IY+  F+ Y+ +K R+ T+K L L    GFGA+LL+
Sbjct  61   YAFVKREAALLLITINTFGIVVESIYLAIFLLYAPRKPRLTTIKLLLLLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L K   R  ++GWICLVF++ VF APLFI+R+VI+T+SVE MP  LS+FLT++AVMW
Sbjct  121  TLYLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL L+D  +A+PN LGFVFGI+Q+G+Y+MY++               AL +PV   E
Sbjct  181  FFYGLLLRDYYVALPNTLGFVFGIIQMGMYLMYRNATP-----------VALEEPVKAQE  229

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAA  916
             N                    IID+ K+GT+  +      A  
Sbjct  230  LNG------------------HIIDVGKMGTMEPNHAATAGAVG  255



>emb|CDP21120.1| unnamed protein product, partial [Coffea canephora]
Length=264

 Score =   273 bits (699),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 191/256 (75%), Gaps = 17/256 (7%)
 Frame = +2

Query  131  VFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTTLLITINSFGIFI  310
            +FL+P+PTFYQ+YKKKSTEG+QSIPYV+ALFSAMLWIYYAF+K   TT LITINSFG FI
Sbjct  1    MFLAPVPTFYQIYKKKSTEGFQSIPYVIALFSAMLWIYYAFLKPK-TTFLITINSFGCFI  59

Query  311  ETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMRAHVVGWICLVFS  490
            ETIY+  F+ Y+TKK RV+T+K L L +A GFG  +L T FL K   R  +VGWICLVF+
Sbjct  60   ETIYICLFLFYTTKKARVETVKLLVLLLACGFGLNVLLTHFLAKDSTRVRIVGWICLVFA  119

Query  491  LCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKDMNIAVPNVLGFVF  670
            L VFVAPL I+ QVIRTKS E MP+ LS FLTL+AV WFFYGL LKD NIA+PNVLGFVF
Sbjct  120  LLVFVAPLRIVIQVIRTKSAEYMPLPLSAFLTLNAVAWFFYGLLLKDFNIAIPNVLGFVF  179

Query  671  GILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTNDKRSSKLPELTEEQ  850
            G+LQ+ LY +Y   +KD   E++  +V+ L   +II+E+N           KL ++T EQ
Sbjct  180  GVLQMVLYKIYSKSEKDNDLEKQ-RKVSQLADQIIIVEEN-----------KLSDIT-EQ  226

Query  851  IIDIVKLGTLVCSEKI  898
            IIDI KLG L   EKI
Sbjct  227  IIDIAKLGQL---EKI  239



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   274 bits (701),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 191/257 (74%), Gaps = 7/257 (3%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H W F FG+LGN+ISF+V+L+PLPTF+++YKKKSTEG+QS+PYVVALFSAMLWIYYAF+K
Sbjct  8    HPWTFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLWIYYAFLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D  LLITINSFG FIET+Y+V F+ Y++KK R++T+K L L   G F  ILL T FL 
Sbjct  68   P-DAHLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLNVGTFCLILLLTLFLA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                RA +VGW+C+ FS+ VF APL I+R VIRTKSVE MP  LS FLTLSAVMWF YG 
Sbjct  127  HGTKRAQIVGWLCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAVMWFSYGF  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
              KD+ +A+PN+LGF+FGILQ+ LY++YKD KK +++EQK+       + +I +   N T
Sbjct  187  LQKDLYVALPNILGFIFGILQMLLYVIYKDSKKVIIEEQKVNN-----EHIIDVRKLNST  241

Query  800  -NTNDKRSSKLPELTEE  847
             N  + RS  L  + +E
Sbjct  242  ENPAEVRSVDLTRIHDE  258



>ref|XP_007159993.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
 gb|ESW31987.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
Length=258

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 177/223 (79%), Gaps = 0/223 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+    WAF FG+LGNIISF VFL+PLPTFYQ+YKKKSTEG+QS+PYVVALFSAMLWIY
Sbjct  1    MAMHRESWAFVFGLLGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK     LLITIN+FGI +E+IY+  F+ Y+ +K R+ T+K L L    GFGA+LL+
Sbjct  61   YAFVKREAALLLITINTFGIVVESIYLTIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L K   R  ++GWICLVF++ VF APLFI+ +VI+T+SVE MP  LS+FLT++AVMW
Sbjct  121  TLYLTKGAKRLAIIGWICLVFNISVFAAPLFIISRVIKTRSVEYMPFTLSMFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE  733
            FFYGL L+D  +A+PN LGFVFGI+Q+G+Y+MY++     ++E
Sbjct  181  FFYGLLLRDYYVALPNTLGFVFGIIQMGMYLMYRNATPVALEE  223



>ref|XP_003532478.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN16865.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=254

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 190/272 (70%), Gaps = 29/272 (11%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M +    WAF FGV+GNIISF VFL+PLPTFYQ+YKKKSTEG+QS+PYVVALFSAMLWIY
Sbjct  1    MTMHRESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK     LLITIN+FGI +E+IY+  F+ Y+ +K R+ T+K L L    GFGA+LL+
Sbjct  61   YAFVKRETALLLITINTFGIVVESIYLSIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L K   R  ++GWICLVF++ VF APLFI+R+VI+T+SVE MP  LS+FLT++AVMW
Sbjct  121  TLYLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL L+D  +A+PN LGFVFGI+Q+ +Y+MY++               AL +PV   E
Sbjct  181  FFYGLLLRDYYVALPNTLGFVFGIIQMVMYLMYRNATP-----------VALEEPVKAQE  229

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTL  880
             N                    IID+VK+GT+
Sbjct  230  LNG------------------HIIDVVKIGTM  243



>ref|XP_004503778.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Cicer 
arietinum]
Length=255

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 191/271 (70%), Gaps = 28/271 (10%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+T   WAF FG+LGNIISF VFLSPLPTFY ++KKKSTEG+QS+PYVVALFSAMLWIY
Sbjct  1    MAMTRESWAFVFGLLGNIISFAVFLSPLPTFYLIFKKKSTEGFQSLPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK     LLITIN+FGI +E+ Y++ F+ Y+TKK+R+ T+K L L    GFGA+LL+
Sbjct  61   YAFVKREAALLLITINTFGIVVESCYLIVFLIYATKKSRLSTIKLLLLLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L K   R  ++GWICLVF++ VF APLFI+ +VIRT+SVE MP  LS FLT++AVMW
Sbjct  121  TLYLAKGAKRLAIIGWICLVFNITVFAAPLFIISRVIRTRSVEYMPFFLSFFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD  +A+PN LGFVFGI+Q+ +Y++Y++               A P P+    
Sbjct  181  FFYGLLLKDYYVALPNTLGFVFGIIQMVMYLIYRN---------------ATPVPL----  221

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGT  877
                         K  EL+   I+D+VK+G+
Sbjct  222  ---------DGPVKGQELSGGHIVDVVKIGS  243



>ref|XP_007038076.1| Nodulin MtN3 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22577.1| Nodulin MtN3 family protein, putative isoform 2 [Theobroma cacao]
Length=281

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 157/299 (53%), Positives = 202/299 (68%), Gaps = 35/299 (12%)
 Frame = +2

Query  83   QWAFAFGVL-GNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
             WAF FGVL GN++SF+V L+PLPTFYQ+YKK+++EG+QSIPYVV+LFSAMLWIYYA +K
Sbjct  6    SWAFVFGVLVGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYYALLK  65

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D  LLITIN+F  FI+T Y+V +  Y+ KK +V T+K + LF   GFG I L+T FL 
Sbjct  66   -KDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTFFLQ  124

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R HV+G+IC+ F+L VF APL ILR+VI+TKSVE MP  LSVFLTL AVMWFFYGL
Sbjct  125  NPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFFYGL  184

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             LKDMNIAVPNV+GF+FGILQ+ LY +YK+  K +V++ KL +++               
Sbjct  185  LLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQLS---------------  229

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQAVEA  976
                           E I+D+VKLGT+VCSE    +A A  P + N      + Q ++ 
Sbjct  230  ---------------EHIVDVVKLGTMVCSE---VNAVAPQPNETNNNGGVVQAQNIKG  270



>gb|AFK48645.1| unknown [Lotus japonicus]
Length=247

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 191/272 (70%), Gaps = 28/272 (10%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+T   WAF FG++GN+ISF+VFL+PLPTFYQ+YKKK+ EG+Q++PYVVALFSAMLWIY
Sbjct  1    MAMTRESWAFVFGLMGNVISFMVFLAPLPTFYQIYKKKTAEGFQALPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK     LLITIN+FGI +E+IY+ FF+ Y+ KK+R+ T+K L L    GFGA+LLA
Sbjct  61   YAFVKRESALLLITINTFGIVVESIYIAFFLFYAPKKSRLSTIKLLLLLNVFGFGAMLLA  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L K   R  ++GWICLVF++ VF APLFI+ +VIRT+SVE MP  LS  LT++AVMW
Sbjct  121  TLYLSKGAKRLQIIGWICLVFNISVFAAPLFIISKVIRTRSVEYMPFFLSFSLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYG+ L+D  +A+PN LGFVFGI+Q+ +Y++Y++                   PV+I E
Sbjct  181  FFYGMLLRDYYVALPNTLGFVFGIIQMVVYLIYRNA-----------------TPVVIEE  223

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTL  880
               G            E++ + IID+ K G +
Sbjct  224  KVKGQ-----------EMSGDHIIDVAKGGAV  244



>ref|XP_007137870.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
 gb|ESW09864.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
Length=264

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 195/285 (68%), Gaps = 31/285 (11%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+    WAF FG+LGN+ISF+VFL+PLPTFYQ+YKKK+ EG+QS+PYVVALFS+MLWIY
Sbjct  1    MAIHHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK + + LLITINSFG  IE+IY+  F+ Y+  KTR+ T+K L L    GFGA+LL+
Sbjct  61   YALVKKDASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +      R  V+GWICLVF++ VF APL I+++VI+TKSVE MP  LS FLT++AVMW
Sbjct  121  TLYFTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD  IA+PN LGF+FGI+Q+ LY++Y++ K   ++E                 
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMMLYLVYRNAKPKTLEEP----------------  224

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSE--KIQKSAA  913
                        +KL EL    I+D+VKLGT+  SE   + KS A
Sbjct  225  ------------TKLQEL-NGHIVDVVKLGTMAPSEPNHVTKSGA  256



>ref|XP_004297512.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 191/271 (70%), Gaps = 29/271 (11%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H    AFG+LGNIISF+VFL+P+PTFY++YKKK+TEG+Q++PY VALFS MLWIYYA +K
Sbjct  5    HPLTLAFGLLGNIISFMVFLAPMPTFYKIYKKKTTEGFQALPYAVALFSCMLWIYYALLK  64

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D T LITINS G  IET+Y+  F+ YS KK R+ T+KFL L    G+G +L+ T FL 
Sbjct  65   -QDATFLITINSVGCVIETVYLAIFLFYSPKKARISTVKFLLLLNVLGYGLMLVLTLFLA  123

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K E+R  VVGWICLVF+L VF APL IL++VIRTKSVE MP  LS FLTL AVMWFFYG 
Sbjct  124  KGEIRLKVVGWICLVFNLTVFAAPLCILKKVIRTKSVEFMPFPLSFFLTLGAVMWFFYGF  183

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             LKD NIA PN+LGF+FGI Q+ LY++YK+ KK                 V++LE+    
Sbjct  184  LLKDYNIAFPNILGFMFGIAQMVLYIVYKNAKK-----------------VVLLEE----  222

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                   SK+ EL+ + II+++K+ T+VC +
Sbjct  223  ------PSKVQELS-DHIIEVMKISTMVCPD  246



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 181/231 (78%), Gaps = 2/231 (1%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+    WAF FG+LGN+ISF+VFL+PLPTFYQ+YKKKS+EG+QS+PYVVALFS+MLWIY
Sbjct  1    MAIHHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK + + LLITINSFG  IETIY+  F+ Y+  KTR+ T+K L +    GFGA+LL+
Sbjct  61   YAFVKKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L     R  V+GWICLVF++ VF APL I+++VI+TKSVE MP  LS  LT++AVMW
Sbjct  121  TLYLTTGSKRLTVIGWICLVFNISVFAAPLCIMKRVIKTKSVEFMPFSLSFSLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTA  757
            FFYGL LKD  IA+PN LGF+FGI+Q+ LY++Y++ KKD  +  KL E+ +
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKKD--EPMKLEELNS  229



>gb|KHG27148.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=278

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 153/301 (51%), Positives = 204/301 (68%), Gaps = 35/301 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MAL    WAF FG+LGN++SF+V L+PLPTFYQ+YKK+++EGYQSIPYVV+LFSAMLWIY
Sbjct  1    MALHV-SWAFVFGILGNVVSFLVSLAPLPTFYQIYKKRTSEGYQSIPYVVSLFSAMLWIY  59

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  LLITIN+F +FI+T Y+V +  Y  KK ++ T+K + LF   GFG I  +
Sbjct  60   YALLK-KDAMLLITINTFCVFIQTFYIVVYFYYGPKKEKLVTLKLILLFNVFGFGVIFFS  118

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL    +R  ++G+IC+ F+LCVFVAPL ILR+VI+TKSVE MP  LSVFLTL AVMW
Sbjct  119  TFFLKNPLIRLQILGYICMGFALCVFVAPLGILRKVIKTKSVEYMPFTLSVFLTLGAVMW  178

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKDMNIAVPNVLGF+FGILQ+ LY +YK+  K +V++ KL              
Sbjct  179  FFYGLLLKDMNIAVPNVLGFIFGILQMILYAIYKNYPKKMVEDPKL--------------  224

Query  785  DNNGTNTNDKRSSKLPELTEEQ-IIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKL  961
                            +L+ +Q ++D+VKLG+   S  ++ +A   +P + +    A  +
Sbjct  225  ----------------QLSAQQVVVDVVKLGSTTVS--LEVNAVGPNPNNGDGTGEAQNI  266

Query  962  Q  964
            +
Sbjct  267  K  267



>ref|XP_006436900.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
 ref|XP_006493251.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Citrus 
sinensis]
 gb|ESR50140.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
Length=271

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/271 (52%), Positives = 191/271 (70%), Gaps = 31/271 (11%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WA AFG+LGNI SF+V L+P+PTFY++YKKKSTEG+QS+PYV++LFSAM+WIYYA +K
Sbjct  5    HSWATAFGLLGNITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYYALLK  64

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N    L+TIN+F   ++TIY+  ++ Y+ KK R+QT+K L L    GFGAI L T FL 
Sbjct  65   QN-AIFLMTINTFCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGAICLLTFFLS  123

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K  +R  ++G+IC+ F+L VF APLFI+R+VI+TKSVE MP  LS FLT+ AV WFFYGL
Sbjct  124  KGAIREKILGYICMTFALSVFAAPLFIVRKVIKTKSVEYMPFTLSFFLTIGAVAWFFYGL  183

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             +KD+N+A+PNVLGF+FG+LQ+ LY++YK+  K +V++ KL E++               
Sbjct  184  LIKDLNVAIPNVLGFIFGVLQMILYVIYKNPNKKIVEQTKLQELS---------------  228

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                           E ++D+VKL T+VCSE
Sbjct  229  ---------------EHVVDVVKLSTMVCSE  244



>ref|XP_010322967.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
lycopersicum]
Length=267

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 152/267 (57%), Positives = 194/267 (73%), Gaps = 15/267 (6%)
 Frame = +2

Query  119  ISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTTLLITINSF  298
            +SFIVFL+PLPTFY +YKKKSTEGYQSIPYVVAL SAM+ IYY  +      ++I IN+ 
Sbjct  3    VSFIVFLAPLPTFYNIYKKKSTEGYQSIPYVVALCSAMILIYYVILLGGLVEVII-INAI  61

Query  299  GIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMRAHVVGWIC  478
            G+FIETIY++F+I Y+ KK +VQT+K L LF+  GFG + L  QFL K  +R  +VG I 
Sbjct  62   GVFIETIYIIFYIFYAPKKAKVQTVKLLLLFLVVGFGGVFLIAQFLLKGAIRTKIVGRIS  121

Query  479  LVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKDMNIAVPNVL  658
              FS+C F APL IL++VI+TK+VECMP LLS FLT+SAV+WFFYG+  K+  I  PN+L
Sbjct  122  TAFSICTFAAPLCILKKVIKTKNVECMPFLLSFFLTISAVLWFFYGVIKKNYVIYAPNIL  181

Query  659  GFVFGILQIGLYMMYKDGKKD--VVKEQKLPEVTALPKPVIILEDNNGTNTNDKRSSKLP  832
            GF  G++Q+ LY++YK  KK+  V+KEQKL E+  L   VIIL+D            KLP
Sbjct  182  GFTLGVIQMVLYVVYKKYKKEDNVIKEQKLSEL--LQNHVIILDD----------GKKLP  229

Query  833  ELTEEQIIDIVKLGTLVCSEKIQKSAA  913
            +LT+EQIIDI KLGTL+ SEK+  SAA
Sbjct  230  QLTQEQIIDIWKLGTLIYSEKLNASAA  256



>ref|XP_002270131.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
Length=276

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 1/249 (0%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            LT    AFAFG+LGNI+SF+V+LSPLPTFY++YK+KSTEG+QSIPY VALFSAML +YYA
Sbjct  4    LTVPHMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLLYYA  63

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
            F+K ++  +LITINS G  IE  Y++ ++ Y+ +  ++ T K L LF  G +GAI+L+T 
Sbjct  64   FLKTDNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVLSTF  123

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL K   RA +VGW+C  FSLCVF APL I+R VIRTKSVE MP  LS FLT+ AVMWFF
Sbjct  124  FLSKGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVMWFF  183

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEV-TALPKPVIILED  787
            YGL ++D  IA PN+LGF FGI Q+ LY +YK+ KK V+ E KL E+   L  P +   +
Sbjct  184  YGLLIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKGVLAEFKLQELPNGLVFPTLKKAE  243

Query  788  NNGTNTNDK  814
            N  TN ND+
Sbjct  244  NTDTNPNDQ  252



>emb|CAC44123.1| N3 like protein [Medicago truncatula]
Length=255

 Score =   265 bits (678),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 188/271 (69%), Gaps = 29/271 (11%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+T   WAF FG++GNIISF VFLSPLPTFY ++KKKS EG+Q++PYVVALFSAMLWIY
Sbjct  1    MAMTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK     LLITIN+FGI +E+ Y++ F+ Y+ KK R+ T+K L L    GFGA+LL+
Sbjct  61   YAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L K   R  ++GWICLVF++ VF APLF++ +VIR++SVE MP  LS FLT++AVMW
Sbjct  121  TLYLSKGAKRLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL L+D  +A+PN LGFVFGI+Q+ +Y++Y++                   PV+   
Sbjct  181  FFYGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRNA-----------------TPVV---  220

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGT  877
                     +   K  EL+   IID+VK+GT
Sbjct  221  ---------EAPMKGQELSGGHIIDVVKIGT  242



>gb|KEH20983.1| bidirectional sugar transporter [Medicago truncatula]
Length=255

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 188/271 (69%), Gaps = 29/271 (11%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+T   WAF FG++GNIISF VFLSPLPTFY ++KKKS EG+Q++PYVVALFSAMLWIY
Sbjct  1    MAMTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK     LLITIN+FGI +E+ Y++ F+ Y+ KK R+ T+K L L    GFGA+LL+
Sbjct  61   YAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L K   R  ++GWICLVF++ VF APLF++ +VIR++SVE MP  LS FLT++AVMW
Sbjct  121  TLYLSKGAKRLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL L+D  +A+PN LGFVFGI+Q+ +Y++Y++                   PV+   
Sbjct  181  FFYGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRNA-----------------TPVV---  220

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGT  877
                     +   K  EL+   IID+VK+GT
Sbjct  221  ---------EAPMKGQELSGGHIIDVVKIGT  242



>emb|CBI32263.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 1/249 (0%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            LT    AFAFG+LGNI+SF+V+LSPLPTFY++YK+KSTEG+QSIPY VALFSAML +YYA
Sbjct  4    LTVPHMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLLYYA  63

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
            F+K ++  +LITINS G  IE  Y++ ++ Y+ +  ++ T K L LF  G +GAI+L+T 
Sbjct  64   FLKTDNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVLSTF  123

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL K   RA +VGW+C  FSLCVF APL I+R VIRTKSVE MP  LS FLT+ AVMWFF
Sbjct  124  FLSKGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVMWFF  183

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEV-TALPKPVIILED  787
            YGL ++D  IA PN+LGF FGI Q+ LY +YK+ KK V+ E KL E+   L  P +   +
Sbjct  184  YGLLIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKGVLAEFKLQELPNGLVFPTLKKAE  243

Query  788  NNGTNTNDK  814
            N  TN ND+
Sbjct  244  NTDTNPNDQ  252



>ref|XP_003531061.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=274

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 182/273 (67%), Gaps = 17/273 (6%)
 Frame = +2

Query  65   MALTAH-QWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            MAL +H   A AFG+LGN+ISF+V+L+PLPTFY++YKKKSTEG+QS+PY+VALFS+MLW+
Sbjct  1    MALNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWL  60

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K  D TLLITINS G  IE +Y+V F  Y+TK  R  T+K   +   G F  I L
Sbjct  61   YYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFL  120

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             T F     +R  VVGW+C+  ++ VF APL I+ QVIRTK+VE MP  LS+FLTLSAVM
Sbjct  121  VTYFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTLSAVM  180

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKD----VVKEQKLPEV------  751
            WFFYGL LKD+ IA+PN+LGF  G+LQ+ LY +Y++GK +      KE+K  E       
Sbjct  181  WFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALEAIMKNVV  240

Query  752  ------TALPKPVIILEDNNGTNTNDKRSSKLP  832
                  T    PVI  E+NNG      +  + P
Sbjct  241  VVNPLGTCEVYPVINKENNNGQGIEGAKEKECP  273



>gb|AFK35161.1| unknown [Medicago truncatula]
Length=255

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 187/271 (69%), Gaps = 29/271 (11%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+T   WAF FG++GNIISF VFLSPLPTFY ++KKKS EG+Q++PYVVALFSAMLWIY
Sbjct  1    MAMTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK     LLITIN+FGI +E+ Y++ F+ Y+ KK R+ T+K L L    GFGA+LL+
Sbjct  61   YAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L K   R  ++GWICLVF++ VF  PLF++ +VIR++SVE MP  LS FLT++AVMW
Sbjct  121  TLYLSKGAKRLAIIGWICLVFNISVFATPLFVISKVIRSRSVEYMPFFLSFFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL L+D  +A+PN LGFVFGI+Q+ +Y++Y++                   PV+   
Sbjct  181  FFYGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRNA-----------------TPVV---  220

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGT  877
                     +   K  EL+   IID+VK+GT
Sbjct  221  ---------EAPMKGQELSGGHIIDVVKIGT  242



>ref|XP_008239633.1| PREDICTED: bidirectional sugar transporter SWEET10 [Prunus mume]
Length=291

 Score =   264 bits (675),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/290 (51%), Positives = 192/290 (66%), Gaps = 36/290 (12%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H    AFG+LGNIISF+VFL+P+PTFY +YK+K+ EG+Q++PYV+AL S+ML+IYYA +K
Sbjct  5    HPLTLAFGLLGNIISFLVFLAPVPTFYTVYKRKTAEGFQALPYVIALLSSMLYIYYALLK  64

Query  260  AN---DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
                 D T LITINSFG  +ET+Y+  F+ Y+ KK R+ T+  + L    G+G +++ T 
Sbjct  65   EEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNVFGYGLMMMLTH  124

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL   E+R  +VGWICLVFSL VFVAPL +LRQVIRTKSVE MP  LS FLTL AV WFF
Sbjct  125  FLATGEIRLKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAVTWFF  184

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDN  790
            YGL +KD NIA PN+LGF+FGI Q+ LY++YK+ KK V++EQ  P+V  L          
Sbjct  185  YGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKK-VLEEQ--PKVQEL----------  231

Query  791  NGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSE---KIQKSAAAASPFD  931
                              E IID+VK+ +LVC E    +  SA   S +D
Sbjct  232  -----------------SEHIIDVVKISSLVCPELSPVVLGSAKGVSQYD  264



>ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
 ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
Length=295

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 172/223 (77%), Gaps = 1/223 (0%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FG+LGNIISF+V+L+PLPTFY++YKKKSTEG+QS+PYVVALFSAMLWIYYAF+K
Sbjct  8    HPWAFTFGILGNIISFMVYLAPLPTFYRVYKKKSTEGFQSVPYVVALFSAMLWIYYAFIK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            A D  LL+TINS G  IET+Y+V ++ Y+ KK R+ T + L L   G FG I+L T  + 
Sbjct  68   A-DAYLLVTINSIGCVIETMYIVMYLSYAPKKARIFTAQVLLLLNVGLFGLIVLVTLMVA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K   R HV+GW+C+ FS+ VFVAPL I+R VIRTKSVE MP  LS FLT+SA+ WF YGL
Sbjct  127  KGPERVHVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTMSAIAWFSYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
              KD+ +A+PN+LGF+FG++Q+G+Y+ YK  +K     QK+ E
Sbjct  187  LTKDIYVALPNILGFIFGVVQMGIYIAYKGTEKVAYDHQKVAE  229



>ref|XP_003523161.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31282.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=258

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 176/223 (79%), Gaps = 0/223 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++   WAF FG+LGN+ISF+VFL+PLPTFYQ+YKKKS+EG+QS+PYVVALFS+MLWIY
Sbjct  1    MAISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK + + LLITINSFG  IETIY+  F+ Y+  KTR+ T+K L +    GFG +LL+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L     R  V+GWICLVF++ VF APL I+++VI+T+SVE MP  LS+ LT++AVMW
Sbjct  121  TLYLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSLSLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE  733
            FFYGL LKD  IA+PN LGF+FGI+Q+ LY++Y++ K   ++E
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEE  223



>gb|KHN39181.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=274

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 181/273 (66%), Gaps = 17/273 (6%)
 Frame = +2

Query  65   MALTAH-QWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            MAL +H   A AFG+LGN+ISF+V+L+PLPTFY++YKKKSTEG+QS+PY+VALFS+MLW+
Sbjct  1    MALNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWL  60

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K  D TLLITINS G  IE +Y+V F  Y+TK  R  T+K   +   G F  I L
Sbjct  61   YYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFL  120

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             T F     +R  VVGW+C+  ++ VF APL I+ QVIRTK VE MP  LS+FLTLSAVM
Sbjct  121  VTYFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKDVEFMPFNLSLFLTLSAVM  180

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKD----VVKEQKLPEV------  751
            WFFYGL LKD+ IA+PN+LGF  G+LQ+ LY +Y++GK +      KE+K  E       
Sbjct  181  WFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALEAIMKNVV  240

Query  752  ------TALPKPVIILEDNNGTNTNDKRSSKLP  832
                  T    PVI  E+NNG      +  + P
Sbjct  241  VVNPLGTCEVYPVINKENNNGQGIEGAKEKECP  273



>ref|XP_007209422.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
 gb|EMJ10621.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
Length=293

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 186/274 (68%), Gaps = 33/274 (12%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H    +FG+LGNIISF+VFL+P+PTFY +YK+K+ EG+Q++PYV+AL S+ML+IYYA +K
Sbjct  5    HPLTLSFGLLGNIISFLVFLAPVPTFYTIYKRKTAEGFQALPYVIALLSSMLYIYYALLK  64

Query  260  AN---DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
                 D T LITINSFG  +ET+Y+  F+ Y+ KK R+ T+  + L    GFG ++L T 
Sbjct  65   EEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNLFGFGLMMLLTH  124

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL   EMR  +VGWICLVFSL VFVAPL +LR+VIRTKSVE MP  LS FLTL AV WFF
Sbjct  125  FLATGEMRLKIVGWICLVFSLSVFVAPLGVLRRVIRTKSVEFMPFPLSFFLTLGAVTWFF  184

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDN  790
            YGL +KD NIA PN+LGF+FGI Q+ LY++YK+ KK V++EQ  P+V  L          
Sbjct  185  YGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKK-VLEEQ--PKVQEL----------  231

Query  791  NGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                              E IID+VK+ +LVC E
Sbjct  232  -----------------SEHIIDVVKISSLVCPE  248



>ref|XP_007043874.1| Senescence-associated gene 29 [Theobroma cacao]
 gb|EOX99705.1| Senescence-associated gene 29 [Theobroma cacao]
Length=287

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 189/280 (68%), Gaps = 13/280 (5%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WA AFGV GNIIS +V+L+P+PTFY++Y+KKSTE +QS+PY VALFS+MLW+YYA +K
Sbjct  8    HSWAVAFGVFGNIISVLVYLAPVPTFYRIYRKKSTESFQSLPYQVALFSSMLWLYYALIK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D  LLITINSFG  +ET+Y+  +I Y++K +R+  MK       G F  IL+ T+FL 
Sbjct  68   -KDAFLLITINSFGCIVETMYISIYIAYASKNSRMSAMKLFVGMNVGLFSLILILTRFLV  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            KS +R  ++GWIC+  S+ VF APL I+ +VIRT SVE MP  LS FLTLSA+MWF YGL
Sbjct  127  KSSIRIQLLGWICVAISVSVFAAPLNIVARVIRTGSVEFMPFNLSFFLTLSAIMWFAYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE----VTALPK-------  766
            F+KD+ +A+PNVLGFV G+LQ+ LY +Y++ KK  ++E+K PE    V  L         
Sbjct  187  FIKDICVALPNVLGFVLGMLQMLLYAVYRNTKK-AIEEKKPPEQLKTVVVLSTIGASEVY  245

Query  767  PVIILEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVC  886
            PV I  D N   T +   +  P+ TE+ + D   L +  C
Sbjct  246  PVDIQPDANSNKTKENEQTGEPDKTEKSLEDSSDLQSNEC  285



>ref|XP_009337539.1| PREDICTED: bidirectional sugar transporter N3 [Pyrus x bretschneideri]
Length=298

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 198/299 (66%), Gaps = 25/299 (8%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            T + + H  AFAFG+LGNI+SFIVFL+PLPTF+++YK+KSTEG+QS+PYV ALFSAM+WI
Sbjct  2    TASTSHHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKRKSTEGFQSVPYVFALFSAMIWI  61

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYAF+K++   LLITINSFG  IETIY+  ++ Y+TK+ RV T++ L L   GGF  ILL
Sbjct  62   YYAFLKSH-VILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLLLVNFGGFCLILL  120

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             ++FL +   R  V+GW+C+ FS+ VF APL ++R VIRTKSVE MP  LS FLTLSAVM
Sbjct  121  LSRFLSQGPTRVEVLGWVCVTFSVGVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVM  180

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTA-LPKPVII  778
            W  YGL LKD+ +A PN++GF FG++Q+ LY  Y++ K   + E+KLPE  A + K + I
Sbjct  181  WLCYGLLLKDLYVATPNIIGFSFGVVQMALYTKYRNTK--TIGEEKLPEHKADVVKQITI  238

Query  779  L---------------EDNNGTNT------NDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
            L                D NGT+       N  +         E+II+    G LV  E
Sbjct  239  LTTTPEVEVQVQAPVTSDANGTDAHQNSELNTDQHVHAQTCRNEKIIEPSMPGQLVTCE  297



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 175/223 (78%), Gaps = 0/223 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+    WAF FG+LGN+ISF+VFL+PLPTFYQ+YKKKST+G+QS+PY+VALFS+MLWIY
Sbjct  1    MAINHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK + + LLITINSFG  IETIY+  F+ Y+  KTR+ T+K L +    GFGA+LL+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L     R  V+GWICLV ++ VF APL I+++VI+TKSVE MP  LS FLT++AVMW
Sbjct  121  TLYLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE  733
            FFYGL LKD  IA+PN LGF+FGI+Q+ LY++Y++ K   ++E
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEE  223



>ref|XP_002321731.1| N3 like family protein [Populus trichocarpa]
 gb|EEF05858.1| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 188/269 (70%), Gaps = 30/269 (11%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W  AFG+LGN+IS +V L+PLPTFYQ+YKKK++EG+QSIPYV+ALFSAMLW++YA + + 
Sbjct  7    WMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFYA-IFSE  65

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            D  LLITIN+F  F+E  Y+  ++ Y+TKK ++ T K L LF + GFG I + T FL + 
Sbjct  66   DAILLITINTFAFFMEFGYITVYLLYATKKDKILTFKLLLLFNSFGFGLICVLTLFLTQG  125

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
            + R  V+GWIC++FSLCVFVAPLFI+R+VI+TKSVE MP  LS FLTLSAVMWFFYG   
Sbjct  126  QKRVQVLGWICMIFSLCVFVAPLFIVREVIKTKSVEFMPFSLSFFLTLSAVMWFFYGYLK  185

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNT  805
            KD  +AVPN+LGF+FGI+Q+ LY++Y++  K +V E                        
Sbjct  186  KDQFVAVPNILGFLFGIIQMVLYVIYRNPMKILVVE------------------------  221

Query  806  NDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                  KL EL+ E I+DI KLGT +CSE
Sbjct  222  -----PKLQELSHEHIVDIRKLGTAICSE  245



>ref|XP_002511128.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51730.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 191/287 (67%), Gaps = 29/287 (10%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AFAFG+LGNIISF+V L+P+PTFYQ+ KKK++EG+QSIPYV+ALFSA LW++YA + AND
Sbjct  8    AFAFGLLGNIISFLVCLAPMPTFYQICKKKTSEGFQSIPYVIALFSATLWLFYA-IFAND  66

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
             TLLITINSF  F+ET Y+  ++ Y+ KK R+ T K +       FG+I +   FL   +
Sbjct  67   ATLLITINSFAFFMETAYIAIYLFYAVKKDRLFTTKLVLSLNIFAFGSICVIAMFLTHGQ  126

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             R  ++GWIC+VF+LCVFVAPL I+R+VI+TKSVE MP  LS FLTLSAVMWFFYG   K
Sbjct  127  KRVQLLGWICMVFALCVFVAPLAIVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYGFLKK  186

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTN  808
            D+ +AVPN+LGF+FG+LQ+ LY++Y++ KK                          T  +
Sbjct  187  DLYVAVPNILGFMFGVLQMILYLIYRNPKK--------------------------TGDD  220

Query  809  DKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAAT  949
            D+++++LP   +  IID+ KL T V   +   +  A S  D+    T
Sbjct  221  DQKANELPN--QHSIIDVAKLNTRVSCCEPNATTVAHSRNDREEQQT  265



>ref|XP_008392763.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=248

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 175/232 (75%), Gaps = 3/232 (1%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            T + + H  AFAFG+LGNI+SFIVFL+PLPTF+++YKKKSTEG+QS+PYV ALFSAM+WI
Sbjct  2    TASTSHHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWI  61

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYAF+K++   LLITINSFG  IETIY+  ++ Y+TK  RV T++ L L   GGF  ILL
Sbjct  62   YYAFLKSH-VILLITINSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILL  120

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             + FL +   R  V+GW+C+ FS+ VF APL ++R VIRTKSVE MP  LS FLTLSAVM
Sbjct  121  LSHFLSQGPTRVEVLGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVM  180

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTA  757
            W  YGL LKD+ +A PN+LGF FG++Q+ LY  Y++ K  V  E+KLPE  A
Sbjct  181  WLCYGLLLKDLYVATPNILGFSFGVVQMALYAKYRNTKTIV--EEKLPEHKA  230



>ref|XP_011023934.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=283

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 188/269 (70%), Gaps = 30/269 (11%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W  AFG+LGN+IS +V L+PLPTFYQ+YKKK++EG+QSIPYV+ALFSAMLW++YA + + 
Sbjct  7    WMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFYA-IFSE  65

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            D  LLITIN+F  F+E  Y+V ++ Y+TKK ++ T K L LF + GFG I L T FL + 
Sbjct  66   DAILLITINTFAFFMEFGYIVVYLLYATKKDKILTFKLLLLFNSFGFGLICLLTLFLTQG  125

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
            + R  V+GWIC++FSLCVFVAPLFI+R+VI+TKSVE MP  LS FLTLSAVMWFFYG   
Sbjct  126  QKRVQVLGWICMIFSLCVFVAPLFIVREVIKTKSVEFMPFSLSFFLTLSAVMWFFYGYLK  185

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNT  805
            KD  +AVPN+LGF+FGI+Q+ LY++Y+   K +V E                        
Sbjct  186  KDHFVAVPNILGFLFGIIQMVLYVIYRKPMKILVVE------------------------  221

Query  806  NDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                  KL +L+ E I+DI KLGT +CSE
Sbjct  222  -----PKLQDLSHEHIVDIRKLGTAICSE  245



>ref|XP_008440025.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=291

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 194/289 (67%), Gaps = 24/289 (8%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T H   FAFG+LGNIISFIVFL+P+PTF ++ KKKSTEG+QS+PYVVALFSAMLW
Sbjct  1    MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA   +N+T LLITINS G  IET+Y+  FI ++ K+ RV T++F+ L   GGF  IL
Sbjct  61   LYYASFNSNET-LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L T FL     +  VVGWIC+ FS+ VF APL I+R VIRTKSVE MP  LS FLTLSA+
Sbjct  120  LVTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAI  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPK----  766
             W  YG+FLKD+ +A+PNVLGF+FG+ Q+ LY++Y+  +  + KE KLPE T +      
Sbjct  180  TWLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPEQTKMDDIAMK  239

Query  767  ----------PVII------LEDNNGTN-TNDKRSSKLPELTEEQIIDI  862
                       VII      +E  NG N  +DK + K  E+   QI D+
Sbjct  240  QKQDSSVEAIEVIITTNIEEIELGNGNNDDDDKHNHKTLEVINHQITDL  288



>ref|XP_006347482.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=267

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 197/266 (74%), Gaps = 14/266 (5%)
 Frame = +2

Query  119  ISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTTLLITINSF  298
            +SFIVFL+PLPTFY +YKKKSTEGYQSIPYVVAL SAM+ IYY  +K  D   +I IN+ 
Sbjct  3    VSFIVFLAPLPTFYNIYKKKSTEGYQSIPYVVALCSAMILIYYVHLKG-DLVYVIIINAI  61

Query  299  GIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMRAHVVGWIC  478
            G+FIETIY+VF+I Y+ KK +VQT+K L LFV  G+G + L  QFL K  +R  +VGWI 
Sbjct  62   GVFIETIYIVFYIFYAPKKAKVQTIKLLLLFVVVGYGGVFLVAQFLLKGAIRTTIVGWIS  121

Query  479  LVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKDMNIAVPNVL  658
            + FS+C FVAPL I+R+VI+TK+VE MP LLS+FLTLSAV+WF YG   K++ I  PN+L
Sbjct  122  IAFSVCTFVAPLGIMRKVIKTKNVEYMPFLLSLFLTLSAVLWFIYGFTKKNVVIYAPNIL  181

Query  659  GFVFGILQIGLYMMYKDGKK-DVVKEQKLPEVTALPKPVIILEDNNGTNTNDKRSSKLPE  835
            GF FG++Q+ LY++YK+ K+ +V KEQKL EV  L   VIILED            KL +
Sbjct  182  GFTFGVVQMVLYVVYKNKKESNVTKEQKLSEV--LQNHVIILED----------GKKLTQ  229

Query  836  LTEEQIIDIVKLGTLVCSEKIQKSAA  913
            LT+EQIIDI KLGTL+ SEK+  SAA
Sbjct  230  LTQEQIIDIWKLGTLIYSEKLNASAA  255



>gb|ACU23483.1| unknown [Glycine max]
Length=258

 Score =   260 bits (665),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 186/250 (74%), Gaps = 3/250 (1%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++   WAF FG+LGN+ISF+VFL+PLPTFYQ+YKKKS+EG+QS+PYVVALFS+MLWIY
Sbjct  1    MAISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK + + LLITINSFG  IETI++  F+ Y+  KTR+ T+K L +    GFG +LL+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIHLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L     R  V+GWICLVF++ VF APL I+++VI+T+SVE MP  LS  LT++AVMW
Sbjct  121  TLYLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSSSLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVI-IL  781
            FFYGL LKD  IA+PN LGF+FGI+Q+ LY++Y++ K   ++E    +V  L   +I ++
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPT--KVQELNGHIIDVV  238

Query  782  EDNNGTNTND  811
            + N+ T    
Sbjct  239  KPNHATKNGH  248



>ref|XP_009779208.1| PREDICTED: bidirectional sugar transporter SWEET12-like, partial 
[Nicotiana sylvestris]
Length=264

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 171/225 (76%), Gaps = 1/225 (0%)
 Frame = +2

Query  92   FAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDT  271
            FAFG+LGNIISF VF+SP+PTFY + KKKS EG+QS+PYVVALFS+MLWIYYA  K N+T
Sbjct  2    FAFGILGNIISFTVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMTKTNET  61

Query  272  TLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEM  451
             L+ITINSFG   ETIY+  +  Y+TKKTR+QT++ + L   GGFG IL  TQ L K   
Sbjct  62   -LIITINSFGCIAETIYIAIYFAYATKKTRMQTLRLVLLLNFGGFGLILFLTQILCKGAK  120

Query  452  RAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKD  631
            RA V+GWIC+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LTLSAVMWF YGL L+D
Sbjct  121  RAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGLLLRD  180

Query  632  MNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPK  766
            + + VPN+ G V G+LQ+ LY +Y++ K +  +E+KLP V  L +
Sbjct  181  IYVTVPNIAGMVLGVLQMVLYGIYRNAKPNQAEEKKLPTVVKLEE  225



>ref|XP_009601079.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/273 (51%), Positives = 190/273 (70%), Gaps = 3/273 (1%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            +  H   FAFG+LGNI SF+VF+SP+PTFY + KKKS EG+QS+PYVVALFS+MLWIYYA
Sbjct  1    MANHPLIFAFGILGNIFSFMVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYA  60

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
             VK N+T L+ITINSFG   ETIYV  +  Y+TK  R+QT++ + L   GGFG IL  TQ
Sbjct  61   MVKTNET-LIITINSFGCIAETIYVAIYFAYATKNARMQTLRLVLLLNFGGFGLILFLTQ  119

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
             L K   RA VVGWIC+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LTLSAVMWF 
Sbjct  120  ILCKGPKRAEVVGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFL  179

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALP--KPVIILE  784
            YGL L+D+ + VPN+ G + G+LQ+ LY +Y++ K +  +E+KLP V  L   +P  +  
Sbjct  180  YGLLLRDIYVTVPNIAGIILGMLQMVLYGIYRNAKPNEAEEKKLPTVVKLEEQQPTTVNS  239

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLV  883
            + N  +     S++  +  + + +++ ++ + V
Sbjct  240  EVNPVSFPSTDSTENEDAKDGKNLEVAQINSPV  272



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 171/223 (77%), Gaps = 2/223 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H   FAFG+LGN+ISF+VFL+P+PTFY++Y+KKSTEG+ S+PYVVALFS MLWIYYAFVK
Sbjct  8    HPLPFAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLWIYYAFVK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N + LLITINSFG+FIETIY+  ++ Y+ KK R+  ++   L     F AI+L TQ +F
Sbjct  68   TN-SMLLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVLLTQLVF  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K   R  V+GWIC+ FS+ VF APL ++R VIRTKSVE MP  LS FLTLSA+ WF YGL
Sbjct  127  KGSNRVTVLGWICVGFSISVFAAPLSVIRLVIRTKSVEFMPFFLSFFLTLSAIAWFGYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
            F KD+ + +PNVLGFVFGI Q+ LY++YK  KK+VV E  +PE
Sbjct  187  FTKDIYVQLPNVLGFVFGIAQMLLYIIYKK-KKNVVVEPTVPE  228



>ref|XP_010093933.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
 gb|EXB54896.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
Length=295

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 192/292 (66%), Gaps = 36/292 (12%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            + H    AFG+LGNI+SF+VFL+P+PTF+++YKKKS EG+QS+PYV+AL S+MLWIYYA 
Sbjct  3    SHHYLTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYYAL  62

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
            +K  D  LLITINS G  IET+Y+  F+ Y+ KKTR++T+K L +    G+G +L+ T F
Sbjct  63   LKK-DALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTIF  121

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L + E R   VGWICL F+L VF APL I+RQVIRTKSVE MP  LS FLTL AVMWFFY
Sbjct  122  LAEGEKRLQAVGWICLAFNLSVFAAPLCIMRQVIRTKSVEFMPFPLSFFLTLGAVMWFFY  181

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNN  793
            GL LKD NIA PNVLGF FGI Q+ LY++YK+ KK ++ E KL E++             
Sbjct  182  GLLLKDYNIAFPNVLGFFFGIAQMALYIVYKNAKKTILLEPKLQELS-------------  228

Query  794  GTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEK-----IQKSAAAASPFDK  934
                             E +ID+VK+  LVC  +     IQ +   ++  DK
Sbjct  229  -----------------EHVIDVVKISALVCPTELNPVFIQTNDTGSTGNDK  263



>ref|XP_006436901.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
 gb|ESR50141.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
Length=285

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 197/257 (77%), Gaps = 6/257 (2%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            TM  T   W FAFG+LGNI+SFIVFL+P+PTFY++ KKKSTEG+QS+PYVVALFSAMLWI
Sbjct  2    TMFSTHDPWVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWI  61

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K  D  LLITIN+FG  IETIY+  +I ++ K+ R+ T++ L L   GGFG+ILL
Sbjct  62   YYAMMK-KDAFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILL  120

Query  422  aTQFLFK-SEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
             + FL K S  R  ++GWIC+VFS+ VF APL I+R V+RTKSVE MP  LS+FLTL+AV
Sbjct  121  LSHFLAKGSAARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAV  180

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE-QKLPEVTALPKPVI  775
            MWFFYGLFLKD+ +AVPNVLGF+FG++Q+ LY +Y++ ++ VV++  K+PE T     V+
Sbjct  181  MWFFYGLFLKDVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTV---DVV  237

Query  776  ILEDNNGTNTNDKRSSK  826
             L  NN T + ++ +S+
Sbjct  238  KLSTNNMTASEEQTNSR  254



>ref|XP_011084749.1| PREDICTED: bidirectional sugar transporter N3-like [Sesamum indicum]
Length=292

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 202/269 (75%), Gaps = 17/269 (6%)
 Frame = +2

Query  92   FAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDT  271
            F FG+LGN++SF V+L+P+PTFY+++KKKSTEG+QS+PYVVAL S+MLWIYYA +K+N+T
Sbjct  12   FTFGILGNLVSFAVYLAPMPTFYRIFKKKSTEGFQSVPYVVALLSSMLWIYYATLKSNET  71

Query  272  TLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEM  451
             LLITINS G FIE+IY+  +I Y+ KK R+  +K L L    GFG I++ T FL K   
Sbjct  72   -LLITINSAGCFIESIYIAIYIAYAPKKPRMGALKLLSLLNFVGFGLIVIFTHFLVKGPE  130

Query  452  RAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKD  631
            R  V+GWI +  S  V++APL I+RQVIRTKSV+ MP LLS+FLTLSAVMWFFYGL LKD
Sbjct  131  RVQVLGWISVTLSASVYIAPLSIMRQVIRTKSVQHMPFLLSLFLTLSAVMWFFYGLLLKD  190

Query  632  MNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTND  811
             NIA+PNVLGF FG+LQ+ LY+MY++ +K   KE+KLPE+  L K +IIL++        
Sbjct  191  FNIAIPNVLGFSFGVLQMVLYLMYRNAEK--TKEEKLPEI--LQKQIIILDEQ-------  239

Query  812  KRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
                K+PELT +QIIDI+KL     SEKI
Sbjct  240  ----KIPELT-QQIIDIIKLSACRSSEKI  263



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   258 bits (659),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 188/263 (71%), Gaps = 3/263 (1%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+    WAF FG+LGN+ISF+VFL+PLPTFYQ+YKKKSTE +QS+PYVVALFS+MLWIY
Sbjct  1    MAINHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK + + LLITINSFG  IETIY+  F+ Y+  KTR+ T+K L +    GFGA+LL+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L     R  V+GWICLVF++ VF APL I+++VI+TKSVE MP  LS FLT++AVMW
Sbjct  121  TLYLTTGSKRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD  +A+PN LGF+F I+Q+ LY++Y++ K   +   KL E+ +    V  L 
Sbjct  181  FFYGLLLKDYYVALPNTLGFLFSIIQMVLYLIYRNAKTPDL-PMKLQELNSHTIDVGKLS  239

Query  785  DNNGTNTNDKRSSKLPELTEEQI  853
                +  N    +K   LTE +I
Sbjct  240  RMEPSEPN--HVTKNGTLTEREI  260



>ref|XP_004297511.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Fragaria 
vesca subsp. vesca]
Length=310

 Score =   259 bits (663),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 173/239 (72%), Gaps = 13/239 (5%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AFAFG+LGNI+SFIVFL+P+PTFY++YKKKSTEG+QSIPY+ ALFSA +WIYYA +K+ D
Sbjct  9    AFAFGILGNIVSFIVFLAPVPTFYRVYKKKSTEGFQSIPYIFALFSATIWIYYASLKS-D  67

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
              LLITIN FG  IETIY+  +I Y+ KK RV T++ L L   GGF  IL  + FL +  
Sbjct  68   EMLLITINGFGCVIETIYIAMYITYAPKKARVNTLRLLLLVNFGGFCLILFLSHFLTQGP  127

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             R  V+GW+C+ FS+ VF APL I+R VIRTKSVE MP  LS FLTLSA+MW FYGL LK
Sbjct  128  TRVKVLGWVCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAIMWLFYGLLLK  187

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE------------VTALPKP  769
            D+ +A PN+LGF FG++Q+ LY  Y++ K  +V E+K+PE            +T LP P
Sbjct  188  DLYVAAPNILGFSFGVVQMILYAAYRNKKTVLVDEEKVPEHKTADDFVKQINITVLPSP  246



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 169/223 (76%), Gaps = 2/223 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FG+LGNIISF+V+LSPLPTF+++YKKKSTEG+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPWAFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D  LLITIN+ G  IE+IY+  +I Y+ KK ++ T K + L   G F  ILL T F  
Sbjct  68   -TDGYLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVFCMILLLTLFFV  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            +   R  V+GW+C+ FS+CVF APL I+R VI+TKSVE MP  LS  LTLSAVMWF YGL
Sbjct  127  QGPKRVRVLGWVCVTFSVCVFAAPLSIMRLVIQTKSVEFMPFSLSFSLTLSAVMWFSYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
              KD  IA+PNVLGF+FGI+Q+ LY++YK  KK  + ++KLPE
Sbjct  187  LTKDFYIALPNVLGFIFGIIQMVLYIIYKGTKKAFI-DKKLPE  228



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 176/234 (75%), Gaps = 3/234 (1%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T H   FAFG+LGNIISFIVFL+P+PTF ++YKKKSTEG+QS+PYVVALFSAMLW
Sbjct  1    MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA   +N+T LLITINS G  IET+Y+  FI ++ K+ RV T++F+ L   GGF  IL
Sbjct  61   LYYASFNSNET-LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L T FL     +  VVGWIC+ FS+ VF APL I+R VIRTKSVE MP  LS FLTLSA+
Sbjct  120  LVTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAI  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTAL  760
             W  YG+FLKD+ +A+PNVLGF+FG+ Q+ LY++Y+  +  + KE KLPE T +
Sbjct  180  TWLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPEQTTV  233



>ref|XP_006438820.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
 ref|XP_006483041.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Citrus 
sinensis]
 gb|ESR52060.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
Length=305

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 175/236 (74%), Gaps = 3/236 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            HQW  AFG+LGNIISF+V+L+P+PTFY++Y+KKSTE +QS+PY+VALFS+MLW YYA VK
Sbjct  8    HQWGVAFGILGNIISFLVYLAPVPTFYRIYRKKSTESFQSLPYLVALFSSMLWFYYALVK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N   LL+TIN FG  IETIY++ FI Y+ K +R  T+K       G F  ILL T FL 
Sbjct  68   QN-AFLLVTINCFGCVIETIYIILFITYAPKGSRNSTVKLFVSMNVGVFSLILLLTHFLA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R  ++GWIC+  S+ VF APL I+ QVIRTKSVE MP +LS FLTLSA+MWF YGL
Sbjct  127  TDSTRILILGWICVAVSVSVFAAPLSIVAQVIRTKSVEFMPFILSFFLTLSAIMWFAYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILED  787
            F KD+ +A+PN++GF+ G+ Q+ LY++YK+  K +++E+KLPE  A  K +++L +
Sbjct  187  FQKDICVALPNIVGFLLGLTQMLLYVIYKNANKVIIEEKKLPE--AQLKSIVVLSN  240



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 173/223 (78%), Gaps = 0/223 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+    WAF FG+LGN+ISF+VFL+ LPT YQ+YKKKST+G+QS+PY+VALFS+MLWIY
Sbjct  1    MAINHETWAFIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK + + LLITINSFG  IETIY+  F+ Y+  KTR+ T+K L +    GFGA+LL+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLS  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +L     R  V+GWICLV ++ VF APL I+++VI+TKSVE MP  LS FLT++AVMW
Sbjct  121  TLYLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE  733
            FFYGL LKD  IA+PN LGF+FGI+Q+ LY++Y++ K   ++E
Sbjct  181  FFYGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEE  223



>ref|XP_009609628.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=277

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 188/266 (71%), Gaps = 5/266 (2%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            TA Q AF FGVLGN +SF+V+LSP+PTFY++YK+KSTEG+QSIPY VALFSAML++YYA+
Sbjct  5    TASQLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAY  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
            +K  +  LL+TINSFG  IE IY+  F+ Y+T++ ++ T K + L   G +GAI+  T  
Sbjct  65   LKEKNGILLVTINSFGTAIELIYLTIFLIYATREAKIYTTKLVLLLNIGSYGAIVALTYI  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
              K E R  +VGWIC VFS+CVF APL I+R+VIRT+SVE MP  LS FLT+ AVMWFFY
Sbjct  125  FAKDETRVTIVGWICAVFSVCVFAAPLSIMRRVIRTRSVEFMPFPLSFFLTICAVMWFFY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVV-KEQKLPEVTA----LPKPVII  778
            GL +KDM IA PN+LGF FGI Q+ LY ++++ K+ +   +  L ++T     +   V+ 
Sbjct  185  GLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQVVIDMKAMVLE  244

Query  779  LEDNNGTNTNDKRSSKLPELTEEQII  856
            +++N+  N   +      + T+++++
Sbjct  245  MQENSDPNKEAEVDDTDEKKTKQEVV  270



>gb|KHG02402.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=273

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 182/243 (75%), Gaps = 3/243 (1%)
 Frame = +2

Query  83   QWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKA  262
             W F FG+LGN +SF+V L+PLPTFYQ++KKK++EG+QSIPYVV+LFSAMLWIYYA +K 
Sbjct  6    SWVFVFGILGNAVSFMVSLAPLPTFYQIFKKKTSEGFQSIPYVVSLFSAMLWIYYALLK-  64

Query  263  NDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFK  442
             D   LITIN+F +FI+T Y+V +  Y  KK ++ T+K + LF   GFG I LAT FL  
Sbjct  65   KDAIFLITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATYFLKN  124

Query  443  SEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLF  622
              +R  ++G+IC+ F+L VFVAPL I+R+VI+TKSVE MP  LSVFLTL AVMWFFYGL 
Sbjct  125  PSLRLLILGYICMAFALAVFVAPLAIVRKVIKTKSVEYMPFTLSVFLTLGAVMWFFYGLC  184

Query  623  LKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNN-GT  799
            LKDMN+AVPN+LGF+FG+LQ+ LY +YK+  K  V+E   P++     PV++++    G+
Sbjct  185  LKDMNVAVPNILGFIFGVLQMILYAVYKNHPKKTVEESD-PKLQLSDHPVVVVDVAKLGS  243

Query  800  NTN  808
            N N
Sbjct  244  NVN  246



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 180/254 (71%), Gaps = 5/254 (2%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T +  AF FG+LGNIISFIVFL+P+PTF ++YKKKSTEG+QSIPYVVALFSAMLW+YYA 
Sbjct  7    THNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYAS  66

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
               N+T LLITINS G  IETIY+  FI ++ K+ RV T++F+ L   GGF  ILL T F
Sbjct  67   FNPNET-LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L     R  VVGWIC+ FS+ VF APL I+R VIRTKSVE MP  LS FLTLSA  W  Y
Sbjct  126  LVHGSNRVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNN  793
            G+FLKD+ IAVPN+ GF+FGI Q+ LY++YK  K++   E +LP+ +     ++I+    
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYK--KRETAMEMQLPQHST--DNIVIVSAAT  241

Query  794  GTNTNDKRSSKLPE  835
             ++   + SS LP 
Sbjct  242  NSDKQKQHSSSLPS  255



>ref|XP_006493253.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X2 [Citrus sinensis]
Length=285

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 196/257 (76%), Gaps = 6/257 (2%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            TM  T     FAFG+LGNI+SFIVFL+P+PTFY++ KKKSTEG+QS+PYVVALFSAMLWI
Sbjct  2    TMFSTHDPSVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWI  61

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K  D  LLITIN+FG  IETIY+  +I ++ K+ R+ T++ L L   GGFG+ILL
Sbjct  62   YYAMMK-KDAFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILL  120

Query  422  aTQFLFK-SEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
             + FL K S  R  ++GWIC+VFS+ VF APL I+R V+RTKSVE MP  LS+FLTL+AV
Sbjct  121  LSHFLAKGSAARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAV  180

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE-QKLPEVTALPKPVI  775
            MWFFYGLFLKD+ +AVPNVLGF+FG++Q+ LY +Y++ ++ VV++  K+PE T     V+
Sbjct  181  MWFFYGLFLKDVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTV---DVV  237

Query  776  ILEDNNGTNTNDKRSSK  826
             L  NN T + ++ +S+
Sbjct  238  KLSTNNMTASEEQTNSR  254



>gb|KFK27668.1| hypothetical protein AALP_AA8G413300 [Arabis alpina]
Length=288

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 190/266 (71%), Gaps = 18/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG+LGN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSAMLW+YYA 
Sbjct  6    THNTWAFVFGMLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  FI ++ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFIAFANKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV+WF Y
Sbjct  125  LAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWFLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ----KLPEVT-------  754
            GL L+D+ +A PNVLGFV G LQ+ LY++YK  K   D+V+++    KLPEV+       
Sbjct  185  GLALRDIYVAFPNVLGFVLGALQMILYVVYKYCKTSSDLVEQELEAAKLPEVSIDMLKLG  244

Query  755  --ALPKP--VIILEDNNGTNTNDKRS  820
              A PKP  + ++   N    ND+++
Sbjct  245  THASPKPAEITVVRSLNTCLCNDRKA  270



>ref|XP_008374287.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=298

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 173/232 (75%), Gaps = 3/232 (1%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            + + + H  AFAFGVLGNI SFIVFL+PLPTF+++YKKKSTEG+QS+PYV ALF+A +WI
Sbjct  2    SASTSHHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWI  61

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYAF+K+N+  LLITINSFG  IETIY+  ++ Y+TK+ RV T+  L L   GGF  ILL
Sbjct  62   YYAFLKSNEI-LLITINSFGCVIETIYIAIYLTYATKQARVSTLTLLFLVNFGGFCLILL  120

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
               FL +   R  V+GW+C+ FS+ VF APL  ++ VIRTKSVE MP  LS FLTLSAVM
Sbjct  121  LAHFLSQGPTRVAVLGWVCVTFSVSVFAAPLSAMKMVIRTKSVEFMPFNLSFFLTLSAVM  180

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTA  757
            W  YGL LKD+ +A PN++GF FG++Q+ LY  Y++ K +V  E+KLPE  A
Sbjct  181  WLSYGLLLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNV--EEKLPEQKA  230



>ref|XP_007159040.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
 gb|ESW31034.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
Length=273

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 176/265 (66%), Gaps = 8/265 (3%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T +  A AFG+LGNIISF+V+L+PLPTFY++YKKKSTEG+QS+PY+VALFS+MLW+YYA 
Sbjct  6    THNHLALAFGLLGNIISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAV  65

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
            +K  D TLLITINS G  IET+Y+V F  Y+T   R  T+K   +   G F  I L T F
Sbjct  66   LKPADATLLITINSVGTVIETVYIVLFTVYATTDARKLTVKLFVVMNVGSFALIFLVTFF  125

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
                 +R  VVGW+C+  S+ VF APL I+ QVIRTK+VE MP  LS+FLTLSA+ WF Y
Sbjct  126  TMHGALRIQVVGWVCVAISVGVFAAPLSIVTQVIRTKNVEFMPFNLSLFLTLSAITWFSY  185

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKL--------PEVTALPKP  769
            G FLKD+ IA+PNVLGF  G++Q+ LY MY++GK  +V E++         P  T    P
Sbjct  186  GFFLKDICIAIPNVLGFTLGLVQMLLYAMYRNGKSKIVTEEEAMKNVVVVSPLGTCEGYP  245

Query  770  VIILEDNNGTNTNDKRSSKLPELTE  844
            V I+++        +   K  E  E
Sbjct  246  VQIMDEEKEKGIYGREKEKGVEAKE  270



>ref|XP_004310113.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/279 (50%), Positives = 185/279 (66%), Gaps = 17/279 (6%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
             +A   H WAF FG+LGN+ISF+V+L+P+PTFY+++KKKSTEG+QS+PY+VALFSA LW+
Sbjct  3    AVADAHHPWAFTFGILGNLISFMVYLAPVPTFYRIFKKKSTEGFQSVPYLVALFSATLWL  62

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K N   LLITIN+FG  IET+Y+  +I Y+TK +R  T+K LG    G F  IL+
Sbjct  63   YYAMLKQN-AVLLITINTFGSVIETLYIAMYIVYATKASRKFTIKLLGFMNLGLFSLILV  121

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
              Q+ F SE RA V+GWI +  S+CVF APL I+  VIRTKSVE MP  LS FLTLSAVM
Sbjct  122  ILQYAFHSEYRAPVLGWINVAISVCVFAAPLSIVAHVIRTKSVEFMPFSLSFFLTLSAVM  181

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK----------------KDVVKE  733
            WF YGLFLKD+ IA+PNVLGF+ G+LQ+ LY +Y++ K                K +V  
Sbjct  182  WFAYGLFLKDICIALPNVLGFILGLLQMLLYAIYRNRKPVIFDPEDKLRAPEQMKSIVIL  241

Query  734  QKLPEVTALPKPVIILEDNNGTNTNDKRSSKLPELTEEQ  850
              +P     P      + N+G + + K  +K  +  E +
Sbjct  242  STIPTSEVHPVDAKHCDGNDGEDVDGKDGNKEGDGDEHE  280



>ref|XP_004490502.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=270

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 162/216 (75%), Gaps = 1/216 (0%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AF FG+LGNIISF+VFL+PLPTFY+++KKKST+G+QS+PY+VALFS+MLW+YYA VK N 
Sbjct  8    AFVFGILGNIISFMVFLAPLPTFYRIWKKKSTQGFQSLPYLVALFSSMLWLYYAIVKTN-  66

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
              LLITINSFG  IETIY+V +  Y+TK  R+ T+K   +   G F  I   TQF     
Sbjct  67   ARLLITINSFGCVIETIYIVIYTIYATKDARILTVKLFMVMNVGSFALIFFTTQFGMHGS  126

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
            +R  V+GWIC+ F++CVF APL I+ +VIRTKSVE MP  LS FLTLSA+MWF YGL LK
Sbjct  127  LRVQVLGWICVSFAVCVFAAPLCIVAKVIRTKSVEFMPFNLSFFLTLSAIMWFAYGLLLK  186

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQ  736
            D+ IA+PNVLGF  G+LQ+ LY +Y  G K  +KE 
Sbjct  187  DICIALPNVLGFTLGLLQMLLYAIYNKGSKVSIKED  222



>ref|XP_008392727.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=295

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/279 (51%), Positives = 184/279 (66%), Gaps = 34/279 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MAL  H  + AFG+LGNIIS +VFL+P+PTFY +YKKK+TEG+Q++PYV+ L S+M+++Y
Sbjct  1    MAL-HHTLSLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYVY  59

Query  245  YAFVKAN---DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgai  415
            YA +K     D TL+ITINS G  IETIY+  F+ Y+ KK R+ T   L L     +G +
Sbjct  60   YALLKEELKEDATLVITINSVGCVIETIYIXLFLFYAPKKARISTATLLFLLNLFSYGMM  119

Query  416  llaTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSA  595
            ++ T+FL   E R  +VGWICLVFSL VFVAPL +LRQVIRTKSVE MP  LS FLTL A
Sbjct  120  VVLTRFLATGETRFKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGA  179

Query  596  VMWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVI  775
            V WFFYG  +KD  IA PN+LGF FG++Q+ +Y++YK+ KK                   
Sbjct  180  VAWFFYGFLIKDYYIAFPNILGFFFGVVQMAVYVVYKNAKK-------------------  220

Query  776  ILEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
             LED            K+ EL+E  IID++K+ TLVC E
Sbjct  221  FLEDQ----------PKVQELSE-HIIDVMKISTLVCPE  248



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 179/254 (70%), Gaps = 5/254 (2%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T +  AF FG+LGNIISFIVFL+P+PTF ++YKKKSTEG+QSIPYVVALFSAMLW+YYA 
Sbjct  7    THNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYAS  66

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
               N+T LLITINS G  IETIY+  FI ++ K+ RV T++F+ L   GGF  ILL T F
Sbjct  67   FNPNET-LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L     R  VVGWIC+ FS+ VF APL I+R VIRTKSVE MP  LS FLTLSA  W  Y
Sbjct  126  LVHGSNRVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNN  793
            G+FLKD+ IAVPN+ GF+FGI Q+ LY++YK  K++   E +LP+ +      +I+    
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYK--KRETAMEMQLPQHST--DNTVIVSAAT  241

Query  794  GTNTNDKRSSKLPE  835
             ++   + SS LP 
Sbjct  242  NSDKQKQHSSSLPS  255



>ref|XP_009132693.1| PREDICTED: bidirectional sugar transporter SWEET10 [Brassica 
rapa]
Length=289

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 187/279 (67%), Gaps = 29/279 (10%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++       FG+LGNIISF+V L+P+PTF ++YK+KS+EGYQSIPYV+ALFSAMLWIY
Sbjct  1    MAVSIVVLRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N   ++ITIN+  + I+  Y+ F++ Y+ KK +  T+KF+       FG I   
Sbjct  61   YAMIKTN-VVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL   + R  ++G+IC+VFSLCVFVAPL I+R+VI+T+S E MP  LS FLTLSAVMW
Sbjct  120  TYFLLHGQKRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKDMNIA+PNVLGF+FG+LQ+ LYM+YK            P    L  PVI L+
Sbjct  180  FFYGLLLKDMNIALPNVLGFIFGVLQMILYMIYKK-----------PGTKVLEPPVINLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQ  901
            +                   + ++D+V+L ++VCS +++
Sbjct  229  E-----------------ISDHVVDVVRLSSMVCSSQMR  250



>ref|XP_008222221.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=282

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 176/240 (73%), Gaps = 3/240 (1%)
 Frame = +2

Query  59   NTMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
              +A + H WAF FG+LGN+ISF+V+L+P+PTFY +YKKKST+G+QS+PY+VALFS MLW
Sbjct  2    GALADSHHPWAFTFGILGNVISFLVYLAPMPTFYGIYKKKSTQGFQSVPYLVALFSGMLW  61

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
             YYA +K N   LLITINSFG  IETIY+V FI Y+ K  R  T+K  G    G F +IL
Sbjct  62   FYYALLKKN-AMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSIL  120

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            + + F  +SE R  V+GWI +  S+ VF APL I+ QVIRT+SVE MP  LS FLTLSAV
Sbjct  121  VLSHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAV  180

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVK--EQKLPEVTALPKPV  772
            MWF YGLFLKD+ IA+PNVLGF+ G+LQ+ LY +Y++ ++ +++  E+K+P   A  + V
Sbjct  181  MWFSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNREQVIIEDDEKKIPAAAAADQHV  240



>ref|NP_197755.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
 sp|O82587.1|SWT12_ARATH RecName: Full=Bidirectional sugar transporter SWEET12; Short=AtSWEET12; 
AltName: Full=MtN3-like protein [Arabidopsis thaliana]
 gb|AAC64192.1| MTN3 homolog [Arabidopsis thaliana]
 dbj|BAA97235.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL09814.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAL15214.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAM47150.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AED93195.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
Length=285

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 191/271 (70%), Gaps = 20/271 (7%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T + WAF FG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QSIPYVVALFSAMLW
Sbjct  1    MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA  +  D  LL+TINSFG FIETIY+  F+ +++KK R+ T+K L L   GGF  IL
Sbjct  61   LYYA-TQKKDVFLLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L  QFL K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV
Sbjct  120  LLCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAV  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ----KLPEVT--  754
            +W  YGL LKD+ +A PNV+GFV G LQ+ LY++YK  K   D+V+++    KLPEV+  
Sbjct  180  IWLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPEVSID  239

Query  755  -------ALPKPVII--LEDNNGTNTNDKRS  820
                     P+PV I  +   N  N ND+ +
Sbjct  240  MVKLGTLTSPEPVAITVVRSVNTCNCNDRNA  270



>ref|XP_004161953.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64434.1| hypothetical protein Csa_1G051720 [Cucumis sativus]
Length=291

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 175/234 (75%), Gaps = 3/234 (1%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T H   FAFG+LGNIISFIVFL+P+PTF ++ KKKSTEG+QS+PYVVALFSAMLW
Sbjct  1    MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA   +N+T LLITINS G  IET+Y+  FI ++ K+ RV T++F+ L   GGF  IL
Sbjct  61   LYYASFNSNET-LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L T FL     +  VVGWIC+ FS+ VF APL I+R VIRTKSVE MP  LS FLTLSA+
Sbjct  120  LVTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAI  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTAL  760
             W  YG+FLKD+ +A+PNVLGF+FG+ Q+ LY++Y+  +  + KE KLPE T +
Sbjct  180  TWLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPEQTTV  233



>ref|XP_002865823.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42082.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/294 (49%), Positives = 192/294 (65%), Gaps = 34/294 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    A  FG+LGNIISF V L+P+PTF ++YK+KS+EGYQSIPYV++LFSAMLW+Y
Sbjct  1    MAISQAVLATVFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  +LITINSF   I+ +Y+  +  Y+ KK +  T+KF+      GFGAI + 
Sbjct  61   YAMIK-KDAMMLITINSFAFVIQIVYISLYFFYAPKKEKTLTVKFVLFVDVFGFGAIFVL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL  +  R HV+G+IC+VF+L VF+APL I+R+VI+TKS E MP  LS FLTLSAVMW
Sbjct  120  TYFLIHANKRVHVLGYICMVFALSVFLAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKDMNIA+PNVLGF+FG+LQ+ L+++YK            P    L  P I L+
Sbjct  180  FFYGLLLKDMNIALPNVLGFIFGVLQMILFLIYKK-----------PGTKVLEPPGIKLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI-----QKSAAAASPFD  931
            D                   E ++D+V+L T+VC+ ++     Q SA   +  D
Sbjct  229  D-----------------ISEHVVDVVRLSTMVCNSQMRTLVPQDSADMEATID  265



>ref|XP_007222479.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
 gb|EMJ23678.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
Length=277

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 173/241 (72%), Gaps = 1/241 (0%)
 Frame = +2

Query  59   NTMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
              +A + H WAF FG+LGN+ISF+V+L+P+PTFY +YKKKST+G+QS+PY+VALFS MLW
Sbjct  2    GALADSHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGMLW  61

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
             YYA +K N   LLITINSFG  IETIY+V FI Y+ K  R  T+K  G    G F +IL
Sbjct  62   FYYALLKKN-AMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSIL  120

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            + + F  +SE R  V+GWI +  S+ VF APL I+ QVIRT+SVE MP  LS FLTLSAV
Sbjct  121  VLSHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAV  180

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVII  778
            MWF YGLFLKD+ IA+PNVLGF+ G+LQ+ LY +Y++ K     E+K+P      K V+ 
Sbjct  181  MWFSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNRKPIEDDEKKIPAADQHVKNVVG  240

Query  779  L  781
            L
Sbjct  241  L  241



>ref|XP_002322281.2| N3 like family protein [Populus trichocarpa]
 gb|EEF06408.2| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 181/269 (67%), Gaps = 30/269 (11%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W F FG+LGN IS +V L+PLPTFY++ KKK+++G+ SIPYV+ALFSAMLW++YA  K  
Sbjct  7    WVFGFGLLGNFISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFYALFK-E  65

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            D  LLITINSF  F+E  Y+  ++ Y+TKK ++ T K L LF   GFG I + T+FL + 
Sbjct  66   DALLLITINSFTFFMEIGYIFMYLLYATKKDKILTFKLLLLFNVFGFGLICVLTRFLTQR  125

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
            + R  V+GWIC+ FSLCVFVAPLFI+R+VIRTKSVE MP  LS FLTLSAVMWFFYG   
Sbjct  126  QKRVQVLGWICMTFSLCVFVAPLFIVRKVIRTKSVEFMPFSLSFFLTLSAVMWFFYGFLK  185

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNT  805
            KD  +AVPN+LG +FGILQ+ LYM+Y++ KK VV E KL                     
Sbjct  186  KDQFVAVPNILGLLFGILQMVLYMIYRNSKKVVVVEPKL---------------------  224

Query  806  NDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
                  KL     E ++D+ KLG  +CSE
Sbjct  225  ------KLD--ISEHVVDLEKLGAAICSE  245



>ref|XP_011020821.1| PREDICTED: bidirectional sugar transporter N3-like [Populus euphratica]
Length=285

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 197/288 (68%), Gaps = 17/288 (6%)
 Frame = +2

Query  65   MALTA-HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            MA+T+    AF FG+LGNIIS +VFL+P+PTF +++KKKSTE +QS+PY++ALFS+MLW+
Sbjct  1    MAVTSILHLAFTFGILGNIISTMVFLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWL  60

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K  DT LL+TINSFG  IET Y+  +I Y+T+++RV T+K L     G F  ILL
Sbjct  61   YYAMLK-KDTILLVTINSFGCLIETTYIAIYIVYATRESRVSTIKLLISMNMGLFSLILL  119

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
               FL    +R  V+GW+C+  S+CVF APL IL+QVIRTKSVE MP  LS FLTLSAVM
Sbjct  120  LAHFLVSGSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVM  179

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE------VTALP  763
            WF YGL LKD+ +A+PN+LGF+ G+LQ+ LY +Y++ +K V +++KLP       ++A+ 
Sbjct  180  WFAYGLLLKDLCVALPNILGFILGLLQMVLYGIYRNAQK-VEEKKKLPALKSIVILSAVG  238

Query  764  KPVIILED-----NNGTNTNDK-RSSKLPELTEEQIIDIVKLGTLVCS  889
             P I   D     N G   +D+   SK  E + E   D  KL +  C+
Sbjct  239  GPGIYPVDAEPDVNGGAEEHDQTEESKEDEKSMEASQD--KLQSNECA  284



>ref|XP_010093935.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
 gb|EXB54898.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
Length=304

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 179/253 (71%), Gaps = 12/253 (5%)
 Frame = +2

Query  92   FAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDT  271
            F FG+LGN+ S IVFL+P+PTFY++YKKKSTEG+QS+PYVVALFSAM+W+YYA +K+ D 
Sbjct  12   FIFGLLGNVTSLIVFLAPVPTFYRVYKKKSTEGFQSVPYVVALFSAMMWLYYATLKS-DL  70

Query  272  TLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEM  451
             LLITINS G  IETIY+  +I Y+TK+ R+ T++ + L   GGF  ILL + FL K  +
Sbjct  71   ILLITINSVGCVIETIYIALYIAYATKQARIFTLRLILLLNFGGFCLILLLSHFLAKGSL  130

Query  452  RAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKD  631
            RA V+GW+C  F++ VF APL I+R VIRTKSVE MP+ LS FLTLSA MW  YGL LKD
Sbjct  131  RATVLGWVCTSFAVSVFAAPLSIIRVVIRTKSVEFMPLPLSFFLTLSATMWLMYGLMLKD  190

Query  632  MNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE-----------VTALPKPVII  778
            + +A+PNV+G +FG+LQ+ LY++Y+  K  +V+EQK+ E           +      VI 
Sbjct  191  LCVAIPNVMGLIFGVLQMVLYVIYRKNKTVLVEEQKVQEQIKADIEKAETIIMAEVQVIS  250

Query  779  LEDNNGTNTNDKR  817
             E NN   + +K 
Sbjct  251  TESNNNNESKEKE  263



>ref|XP_010242697.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=276

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 174/230 (76%), Gaps = 2/230 (1%)
 Frame = +2

Query  65   MALT-AHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            MA+T +H   FAFG+LGNI+S  V+L+P+PTFY++YKKKSTEG+QSIPYVVALFSAMLWI
Sbjct  1    MAITNSHTLVFAFGILGNIVSCAVYLAPVPTFYRIYKKKSTEGFQSIPYVVALFSAMLWI  60

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K N  T+LITIN  G  IETIY+  ++ Y+ K T++ T+K L L   G +G ILL
Sbjct  61   YYALLKTN-VTMLITINGIGCTIETIYITLYLVYAPKGTKIFTVKLLLLLNMGAYGLILL  119

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             +   FK   R  VVGW+C  FS+ VF APL I+R+VIRTKSVE MP+ LS FLTL AV 
Sbjct  120  LSFLFFKGFGRVTVVGWVCAGFSVIVFAAPLSIMRRVIRTKSVEFMPISLSFFLTLCAVF  179

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEV  751
            WFFYG+ +KD+ IA+PNVLGF  G+ Q+ LY++Y+D KK ++ E KLPE+
Sbjct  180  WFFYGILMKDLYIAIPNVLGFALGVAQMILYIIYRDSKKHLIVELKLPEL  229



>ref|XP_004145147.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=295

 Score =   254 bits (648),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 180/254 (71%), Gaps = 5/254 (2%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T +  AF FG+LGNIISFIVFL+P+PTF ++YKKKSTEG+QSIPYVVALFSAMLW+YYA 
Sbjct  7    THNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYAS  66

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
               N+T LLITINS G  IETIY+  FI ++ K+ RV T++F+ L   GGF  ILL T F
Sbjct  67   FNPNET-LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L     +  VVGWIC+ FS+ VF APL I+R VIRTKSVE MP  LS FLTLSA  W  Y
Sbjct  126  LVHGSNQVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNN  793
            G+FLKD+ IAVPN+ GF+FGI Q+ LY++YK  K++   E +LP+ +     ++I+    
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYK--KRETAMEMQLPQHST--DNIVIVSAAT  241

Query  794  GTNTNDKRSSKLPE  835
             ++   + SS LP 
Sbjct  242  NSDKQKQHSSSLPS  255



>ref|NP_001239695.1| uncharacterized protein LOC100777741 [Glycine max]
 gb|ACU24541.1| unknown [Glycine max]
 gb|KHN03191.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=268

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 180/264 (68%), Gaps = 6/264 (2%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    AFAFG+LGN+ISF+VFL+P+ TFY+++KKKSTEG+QS+PY+VALFS+MLW+Y
Sbjct  1    MAISHSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  LL+TINSFG  IE IY++ +I Y+T+  R  T+K       G F  ILL 
Sbjct  61   YALLK-KDAMLLLTINSFGCVIEVIYIILYITYATRDARNLTLKLFFAMNVGAFALILLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T F     +R  V+GWIC+  S+ VF APL I+ QV+RTKSVE MP  LS  LTLSA+MW
Sbjct  120  THFAVHGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKK--DVVKEQKLPEVTALPKPVII  778
            F YGLFLKD+ IA+PNVLGF  G+LQ+ LY +Y++G K  D + E+K P     P   ++
Sbjct  180  FGYGLFLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKIMEKKAP---LEPLKTVV  236

Query  779  LEDNNGTNTNDKRSSKLPELTEEQ  850
            +E         K+S +  E  E+ 
Sbjct  237  IETGLEEKQQGKKSKENSEEKEKS  260



>gb|KHN24976.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=272

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 163/225 (72%), Gaps = 1/225 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+T H  AF FG+LGN+ISF+VFL+P+PTFY++YKKKSTE +QS+PY+VALFS+MLW+Y
Sbjct  1    MAITHHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  LLITINSFG  IE IY+V +I Y+T+  R  T+K         F  ILL 
Sbjct  61   YALLK-RDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T F     +R  V+GWIC+  S+ VF APL I+ QV+RTKSVE MP  LS  LTLSA+MW
Sbjct  120  THFGVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQK  739
            F YGLFLKD+ IA+PNVLGFV G+LQ+ LY +Y+ G K     +K
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTNTNEK  224



>ref|XP_009347840.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=327

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 174/232 (75%), Gaps = 3/232 (1%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            + + + H  AFAFGVLGNI SFIVFL+PLPTF+++YKKKSTEG+QS+PYV ALF+A +WI
Sbjct  2    SASTSHHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWI  61

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYAF+K+N+  LLITINSFG  IETIY+  ++ Y+TK+ RV T++ L L   GGF  ILL
Sbjct  62   YYAFLKSNEI-LLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLFLVNFGGFCFILL  120

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
               FL +   R  V+GW+C+ FS+ VF APL +++ VI TKSVE MP  LS FLTLSAVM
Sbjct  121  LAHFLSQGPTRVAVLGWVCVTFSVSVFAAPLSVMKMVIHTKSVEFMPFNLSFFLTLSAVM  180

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTA  757
            W  YGL LKD+ +A PN++GF FG++Q+ LY  Y++ K +V  E+KLPE  A
Sbjct  181  WLSYGLLLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNV--EKKLPEQKA  230



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 184/267 (69%), Gaps = 15/267 (6%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W F FG+LGN +SF+VFL+P+PTF ++ +KKSTEG+QS+PYVVALFSAM+W+YYA +K+ 
Sbjct  10   WIFTFGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIWLYYASLKS-  68

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            D  LLITINS G FIE IY+  ++ Y+ K+ R+ T++ L L   GGF A+LL + F  K 
Sbjct  69   DALLLITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLLLSHFFVKG  128

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
              R  V+GW+C++FS+ VF APL I+R VIRT+SVE MP  LS FLTLSA+MW FYG+ L
Sbjct  129  SNRVKVLGWVCVIFSVSVFAAPLSIMRIVIRTRSVEFMPFTLSFFLTLSAIMWLFYGVLL  188

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE----------VTALPKPVI  775
            KD  IA+PN+LGF+FG+LQ+ LY++YK+ K  V  E  LP+          ++   KP +
Sbjct  189  KDFYIAIPNILGFIFGVLQMVLYVIYKNSKTAVPMEPTLPQNSNDIAKLSSISCEMKPAV  248

Query  776  IL----EDNNGTNTNDKRSSKLPELTE  844
                  ED++  N+ D  + + P   E
Sbjct  249  CPQSNEEDDHTENSKDPSNQEKPNQCE  275



>ref|XP_010678288.1| PREDICTED: bidirectional sugar transporter N3 [Beta vulgaris 
subsp. vulgaris]
Length=324

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 185/268 (69%), Gaps = 5/268 (2%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H W FAFG+LGN+ISF+VFL+PLPTF ++YKKKSTEG+QS+PYVVA+FSAMLWIYYA +K
Sbjct  6    HPWVFAFGLLGNVISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYALLK  65

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N + LLITIN  G+ IETIYV  +I Y+ ++ R+ T+K L      GF  I+L   +L 
Sbjct  66   GN-SVLLITINVAGVIIETIYVAIYITYAPRQARISTLKLLLFMNFCGFCTIVLFCHYLV  124

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K+E R  V GWIC+ FS+ VF APL ++R VI TKSVE MP+ LS+ LTL+A +WF YG 
Sbjct  125  KAENRLQVFGWICVAFSISVFAAPLSVMRTVISTKSVEYMPINLSISLTLTATIWFLYGF  184

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDV-VKEQKLPEVTALPKPVIILEDNNG  796
              KD+ I +PNV+GF+FG+ Q+GLY +Y+  K D+  K++KLPEV +  K   +  D   
Sbjct  185  VQKDLYITLPNVVGFMFGVAQMGLYSIYR--KYDIKAKKEKLPEVASPVKQETVEIDTIN  242

Query  797  TNTNDKRSSK-LPELTEEQIIDIVKLGT  877
            ++ N   S   +P   +   I++V  G 
Sbjct  243  SSPNKTESEDYIPPHEKTPEIEVVVTGN  270



>ref|XP_002877629.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53888.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 188/266 (71%), Gaps = 19/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG+LGN+ISF VFLSP+PTFY+++KKK+TEG+QSIPYVVALFSA LW+YYA 
Sbjct  6    TENTWAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TIN+FG FIETIY+  F+ Y+TK  R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINAFGCFIETIYIAMFLAYATKPARMLTVKTLLLMNFGGFCVILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LVKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLPEVT------  754
            GL LKD+ +A PNV+GF  G LQ+ LY++YK        G+K+ V+  KLPEV+      
Sbjct  185  GLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTSPHLGEKE-VEAAKLPEVSLDMLKL  243

Query  755  ---ALPKPV-IILEDNNGTNTNDKRS  820
               + P+P+ ++ + N  T  ND+R+
Sbjct  244  GTVSSPEPISVVRQANKCTCGNDRRA  269



>gb|EYU42078.1| hypothetical protein MIMGU_mgv1a010705mg [Erythranthe guttata]
Length=304

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 184/265 (69%), Gaps = 6/265 (2%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FGVLGNIIS  V+L+PLPTF +++K+KST G+ S+PY VALFSAMLW+YYAF+K
Sbjct  8    HPWAFTFGVLGNIISIFVYLAPLPTFRRIFKEKSTMGFDSLPYAVALFSAMLWLYYAFLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N   LLI+IN+FG  +ETIY+  F+ Y++KK R +T K LG+   G    I + T F+F
Sbjct  68   TN-AVLLISINTFGCIVETIYISMFLFYASKKARGRTAKLLGVVNVGVLSLIFVVTFFIF  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K + R HVVGWIC+  S+CVF APL I+ QV+RT+SVE MP  LS FLTLSAVMWF YGL
Sbjct  127  KGQNRVHVVGWICVAVSVCVFAAPLSIVFQVVRTRSVEFMPFPLSFFLTLSAVMWFGYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK----KDVVKEQKLPEVTALPKPVIILED  787
            F KD+ +AVPNVLGF+ G+LQ+ LY ++++ K     DV  E+K+  +T     VI +  
Sbjct  187  FEKDLCVAVPNVLGFILGVLQMVLYGIFRNVKAEAINDVDDEKKMGVITTDHDHVINIMV  246

Query  788  NNGTNTNDKRSSKLPELT-EEQIID  859
                +     +S+  ++T + Q+ D
Sbjct  247  LGTPHKKSSSTSQYDDVTIKAQVSD  271



>ref|XP_009405955.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 170/221 (77%), Gaps = 5/221 (2%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            WAF FG+LGNIISF+V+L+PLPTFY++YK+KSTEG+QS+PYVVALFSAMLWI YAF+K  
Sbjct  11   WAFTFGILGNIISFMVYLAPLPTFYRVYKRKSTEGFQSVPYVVALFSAMLWISYAFLK-T  69

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            D  LLITINS G  IET+Y+V    Y+ K T++ T K + L +   FG ILL T  L + 
Sbjct  70   DACLLITINSVGCAIETVYIV----YAPKATKIFTAKLVLLVIVAMFGLILLLTLLLSEG  125

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
              R  ++GWIC+ FS+ VFVAPL ++R VIRTKSVE MP  LS FLTLSAV+WF YGL +
Sbjct  126  AKRVEILGWICVSFSVSVFVAPLSVIRLVIRTKSVEFMPFSLSFFLTLSAVVWFAYGLLI  185

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
            +D+ +++PNVLGF+FGILQ+ LY+ YKD KK  V EQ+ PE
Sbjct  186  RDLYVSLPNVLGFIFGILQMALYVAYKDRKKAAVVEQEPPE  226



>ref|NP_001067955.1| Os11g0508600 [Oryza sativa Japonica Group]
 sp|Q2R3P9.1|SWT14_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Japonica Group]
 gb|ABA93969.1| nodulin MtN3 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28318.1| Os11g0508600 [Oryza sativa Japonica Group]
 gb|EAZ18482.1| hypothetical protein OsJ_34008 [Oryza sativa Japonica Group]
 dbj|BAG95290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=303

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 192/293 (66%), Gaps = 23/293 (8%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAFAFG+LGNIISF+ +L+PLPTFY++YK KST+G+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             +D  LLITINS G  IETIY+  ++ Y+ KK ++ T K L L   G FG ILL T  L 
Sbjct  68   -SDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              + R  V+GW+C+ FS+ VFVAPL I+R V+RTKSVE MP  LS  LT+SAV+WF YGL
Sbjct  127  AGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             +KD  +A+PNVLGF FG++Q+GLY MY++               + PK V+  E    T
Sbjct  187  LIKDKYVALPNVLGFSFGVIQMGLYAMYRN---------------STPKAVLTKEVEAAT  231

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFD-KNPAATAP  955
             T D   S      +E +++I KL   V   K ++      P D ++P A AP
Sbjct  232  ATGDDDHSAAG--VKEHVVNIAKLSAAVDVVKTRE----VHPVDVESPPAEAP  278



>sp|B8BKP4.1|SWT14_ORYSI RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Indica Group]
 gb|EEC68230.1| hypothetical protein OsI_36230 [Oryza sativa Indica Group]
Length=303

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 192/293 (66%), Gaps = 23/293 (8%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAFAFG+LGNIISF+ +L+PLPTFY++YK KST+G+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             +D  LLITINS G  IETIY+  ++ Y+ KK ++ T K L L   G FG ILL T  L 
Sbjct  68   -SDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              + R  V+GW+C+ FS+ VFVAPL I+R V+RTKSVE MP  LS  LT+SAV+WF YGL
Sbjct  127  AGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             +KD  +A+PNVLGF FG++Q+GLY MY++               + PK V+  E    T
Sbjct  187  LIKDKYVALPNVLGFSFGVIQMGLYAMYRN---------------STPKAVLTKEVEAAT  231

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFD-KNPAATAP  955
             T D   S      +E +++I KL   V   K ++      P D ++P A AP
Sbjct  232  ATGDDDHSAAG--VKEHVVNIAKLSAAVDVVKTRE----VHPVDVESPPAEAP  278



>ref|XP_002877428.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53687.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 191/271 (70%), Gaps = 20/271 (7%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T + WAF FG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QSIPYVVALFSAMLW
Sbjct  1    MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA  +  D  LL+TINSFG FIE IY+  F+ +++KK R+ T+K L L   GGF  IL
Sbjct  61   LYYA-TQKKDVFLLVTINSFGCFIEIIYISIFVAFASKKARMLTVKLLLLMNFGGFCLIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L  QFL K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV
Sbjct  120  LLCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAV  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ----KLPEVT--  754
            +W  YGL LKD+ +A PNV+GFV G LQ+ LY++YK  K   D+V+++    KLPEV+  
Sbjct  180  IWLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPEVSID  239

Query  755  -------ALPKP--VIILEDNNGTNTNDKRS  820
                     P+P  + ++   N  N ND+++
Sbjct  240  MLKLGTLTSPEPAAITVVRSVNTCNCNDRKA  270



>ref|XP_006394628.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
 gb|ESQ31914.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
Length=288

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 190/266 (71%), Gaps = 18/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSAMLW+YYA 
Sbjct  6    TQNTWAFAFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ ++ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYIAIFVAFAPKKARMFTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LSV LTLSAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSVSLTLSAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ----KLPEVT-------  754
            GL LKD+ +A PNV+GFV G LQ+ LY+++K  K   D+++++    KLPEV+       
Sbjct  185  GLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLMEKELEAAKLPEVSIDMLKLG  244

Query  755  --ALPKP--VIILEDNNGTNTNDKRS  820
              A P+P  + ++   N    ND+++
Sbjct  245  TLASPEPAAITVVRSVNTCVCNDRKA  270



>ref|XP_008389921.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 188/292 (64%), Gaps = 31/292 (11%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            T+A + H  AF FGVLGN++S +V+L+P+PTFY++Y+KKSTEG+ S+PY+VA+FS+MLW+
Sbjct  3    TVADSHHPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWL  62

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K N   LLITINSFG F E IY+V F+ Y+ K  R  T+K  G+   G F  IL+
Sbjct  63   YYASLKKN-AMLLITINSFGSFAEMIYIVIFVVYAPKDARKLTVKLFGIMNVGLFTLILV  121

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             + FL     R  V+GWI +  S  VF APL I+ QVIRT+SVE MP  LS FLTLSA+M
Sbjct  122  VSHFLVSRAYRVPVLGWINVAISTSVFAAPLSIVSQVIRTRSVEFMPFRLSFFLTLSAIM  181

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIIL  781
            WF YGLFLKD+ +A+PNVLGFV G+LQ+ LY MY++ K+                  +I+
Sbjct  182  WFAYGLFLKDICVAIPNVLGFVLGLLQMLLYAMYRNRKQ------------------VII  223

Query  782  EDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKN  937
            ED+           KLP  T + + +IV + TL  SE      A A P ++N
Sbjct  224  EDH---------EKKLPAATPDHVKNIVIIATLAASE---VHPADAQPNNRN  263



>ref|XP_003551863.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=271

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 163/227 (72%), Gaps = 1/227 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M ++ H  AF FG+LGN+ISF+VFL+P+PTFY++YKKKSTE +QS+PY+VALFS+MLW+Y
Sbjct  1    MVISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  LLITINSFG  IE IY+V +I Y+T+  R  T+K         F  ILL 
Sbjct  61   YAMLK-RDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T F     +R  V+GWIC+  S+ VF APL I+ QV+RTKSVE MP  LS  LTLSA+MW
Sbjct  120  THFAVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLP  745
            F YGLFLKD+ IA+PNVLGFV G+LQ+ LY +Y+ G K     +K P
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNEKSP  226



>ref|XP_010678287.1| PREDICTED: bidirectional sugar transporter SWEET12 [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 178/255 (70%), Gaps = 19/255 (7%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W   FG+LGN ISF+VFLSP+PTFY++YKKKSTE +QSIPYVVA FSAMLW+ YA+VK  
Sbjct  12   WITIFGLLGNTISFMVFLSPIPTFYRIYKKKSTEEFQSIPYVVAFFSAMLWLLYAYVKT-  70

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            D   L+TIN FG+FIETIY+V F+ Y+ K+ R+  +K L LF   GFG I+  T  + K+
Sbjct  71   DVIFLVTINCFGLFIETIYLVIFLVYANKEARISAIKQLLLFNVFGFGVIVFFTAVIAKT  130

Query  446  -EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLF  622
              +R  ++GW+CLVFS CVFVAPL ++R+VIRTKSVE MP  LS FLTLSAV+WFFYGL 
Sbjct  131  TRVRLLILGWVCLVFSFCVFVAPLGVMRKVIRTKSVEYMPFFLSFFLTLSAVVWFFYGLL  190

Query  623  LKDMNIAVPNVLGFVFGILQIGLYMMYKDGK-----------KDVVKEQKLPEVTALPKP  769
             +D+ +AVPNVLGF FGI+Q+ LYMMY++ K           KD   +Q   E    P+P
Sbjct  191  KRDVYVAVPNVLGFTFGIVQMILYMMYRNAKPVEKDIEVGKTKDSSTDQIFVEEPVKPQP  250

Query  770  VIILEDNNGTNTNDK  814
                   N T TND 
Sbjct  251  ------KNTTPTNDN  259



>ref|XP_009765830.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=278

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 187/263 (71%), Gaps = 12/263 (5%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            TA   AF FGVLGN +SF+V+LSP+PTFY++YK+KSTEG+QSIPY VALFSAML++YYA+
Sbjct  5    TASHLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAY  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
            +K  +  LLITINSFG  IE IY+  F+ Y+T++ ++ T K + L   G FGAI+  T  
Sbjct  65   LKEKNGILLITINSFGTAIEFIYLTIFLMYATREAKIYTTKLVLLLNIGSFGAIVALTYI  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
              K + R  +VGWIC VFS+CVF APL I+R+VI+T+SVE MP  LS FLT+ AVMWFFY
Sbjct  125  FAKDKTRVTIVGWICAVFSVCVFAAPLSIMRRVIKTRSVEFMPFPLSFFLTICAVMWFFY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVV-KEQKLPEVTA----LPKPVII  778
            GL +KDM IA PN+LGF FGI Q+ LY ++++ K+ +   +  L ++T     +   V+ 
Sbjct  185  GLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQVVIDMKAMVLE  244

Query  779  LEDNNGTN-------TNDKRSSK  826
            +++N+  N       T++K+++K
Sbjct  245  MQENSDPNKEAEVDDTDEKKTNK  267



>ref|NP_199892.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
 sp|Q9LUE3.1|SWT10_ARATH RecName: Full=Bidirectional sugar transporter SWEET10; Short=AtSWEET10 
[Arabidopsis thaliana]
 dbj|BAA96992.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAK96739.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL47380.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAM61234.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AED95992.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
Length=289

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 191/294 (65%), Gaps = 34/294 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    A  FG+LGNIISF V L+P+PTF ++YK+KS+EGYQSIPYV++LFSAMLW+Y
Sbjct  1    MAISQAVLATVFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  +LITINSF   ++ +Y+  F  Y+ KK +  T+KF+      GFGAI + 
Sbjct  61   YAMIK-KDAMMLITINSFAFVVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFVL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T F+  +  R  V+G+IC+VF+L VFVAPL I+R+VI+TKS E MP  LS FLTLSAVMW
Sbjct  120  TYFIIHANKRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKDMNIA+PNVLGF+FG+LQ+ L+++YK            P    L  P I L+
Sbjct  180  FFYGLLLKDMNIALPNVLGFIFGVLQMILFLIYKK-----------PGTKVLEPPGIKLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI-----QKSAAAASPFD  931
            D                   E ++D+V+L T+VC+ ++     Q SA   +  D
Sbjct  229  D-----------------ISEHVVDVVRLSTMVCNSQMRTLVPQDSADMEATID  265



>ref|XP_006288378.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
 gb|EOA21276.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
Length=287

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 189/269 (70%), Gaps = 19/269 (7%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T + WAF FG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QSIPYVVALFSAMLW
Sbjct  1    MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA  +  D  LL+TINSFG FIETIY+  F+ ++TK  R+ T+K L L   GGF AIL
Sbjct  61   LYYA-TQKKDVFLLVTINSFGCFIETIYISIFLAFATKNARMLTVKLLLLMNVGGFCAIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L  QFL K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV
Sbjct  120  LLCQFLAKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAV  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ----KLPEVT--  754
            +W  YGL LKD+ +A PNV+GF  G LQ+ LY++YK  K   D+V+++    KLPEV+  
Sbjct  180  IWLLYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTSSDLVEKELENAKLPEVSID  239

Query  755  -----ALPKP---VIILEDNNGTNTNDKR  817
                    +P   + ++   N  N ND+R
Sbjct  240  MLKLGGAAEPACGITVVRSVNMCNCNDRR  268



>ref|XP_003530901.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=272

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 162/225 (72%), Gaps = 1/225 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M +T H  AF FG+LGN+ISF+VFL+P+PTFY++YKKKSTE +QS+PY+VALFS+MLW+Y
Sbjct  1    MVITHHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  LLITINSFG  IE IY+V +I Y+T+  R  T+K         F  ILL 
Sbjct  61   YALLK-RDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T F     +R  V+GWIC+  S+ VF APL I+ QV+RTKSVE MP  LS  LTLSA+MW
Sbjct  120  THFGVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQK  739
            F YGLFLKD+ IA+PNVLGFV G+LQ+ LY +Y+ G K     +K
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTNTNEK  224



>ref|XP_011023931.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
 ref|XP_011023932.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=258

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 183/253 (72%), Gaps = 4/253 (2%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W F FG+LGNIIS +V L+PLPTFY++ KKK+++G+ SIPYV+ALFSAMLW++YA  K  
Sbjct  7    WVFGFGLLGNIISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFYALYK-E  65

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            D  LLITINSF  F+E  Y+  ++ Y+TKK ++ T K L LF   GFG I + T+FL + 
Sbjct  66   DALLLITINSFTFFMEIGYIFMYLFYATKKDKILTFKLLLLFNVFGFGLICVLTRFLTQR  125

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
            + R  V+GWIC+ FSLCVFVAPLFI+R+VI+TKSVE MP  LS FLTLSAVMWFFYG   
Sbjct  126  QKRVQVLGWICMTFSLCVFVAPLFIVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYGFLK  185

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNT  805
            KD  +AVPN+LG +FGILQ+ LYM+Y++ KK VV E KL     + + V+ LE   G   
Sbjct  186  KDQFVAVPNILGLLFGILQMVLYMIYRNSKKVVVVEPKLQ--LDISEHVVDLE-KFGATI  242

Query  806  NDKRSSKLPELTE  844
              + ++ +P+L +
Sbjct  243  CSEIATGIPKLND  255



>gb|KHN03192.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=271

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 162/227 (71%), Gaps = 1/227 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M ++ H  AF FG+LGN+ISF+VFL+P+PTFY++YKKKSTE +QS+PY+VALFS+MLW+Y
Sbjct  1    MVISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  LLITINSFG  IE IY+V +I Y+T+  R  T+K         F  ILL 
Sbjct  61   YAMLK-RDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T F     +R  V+GWIC+  S+ VF APL I+ QV+RTKSVE MP  LS  LTLSA+MW
Sbjct  120  THFAVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLP  745
            F YGLFLKD+ IA+PNVLGFV G+LQ+ LY +Y+ G K      K P
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNDKSP  226



>ref|XP_002303766.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
 gb|EEE78745.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
Length=287

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 144/290 (50%), Positives = 197/290 (68%), Gaps = 19/290 (7%)
 Frame = +2

Query  65   MALTA-HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            MA+T+    AF FG+LGNIIS +V+L+P+PTF +++KKKSTE +QS+PY++ALFS+MLW+
Sbjct  1    MAVTSILHLAFTFGILGNIISTMVYLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWL  60

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K  DT LL+TINSFG  IET Y+  +I Y+T+++RV T+K L     G F  ILL
Sbjct  61   YYAMLK-KDTILLVTINSFGCVIETTYIAIYIVYATRESRVSTIKLLISMNLGLFSLILL  119

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
               FL    +R  V+GW+C+  S+CVF APL IL+QVIRTKSVE MP  LS FLTLSAVM
Sbjct  120  LAHFLVSGSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVM  179

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE--------VTA  757
            WF YGL LKD+ IA+PN+LGF+ G+LQ+ LY +Y++ +K V +++KLP         ++A
Sbjct  180  WFAYGLLLKDLCIALPNILGFILGLLQMLLYGIYRNAQK-VEEKKKLPAENLKSIVILSA  238

Query  758  LPKPVIILED-----NNGTNTNDK-RSSKLPELTEEQIIDIVKLGTLVCS  889
            +  P +   D     N G   +D+   SK  E + E   D  KL +  C+
Sbjct  239  VGGPEVYPVDAKPDVNGGAEEHDQTEESKEDEKSMEASQD--KLQSNECA  286



>ref|NP_190443.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
 sp|Q9SMM5.1|SWT11_ARATH RecName: Full=Bidirectional sugar transporter SWEET11; Short=AtSWEET11 
[Arabidopsis thaliana]
 gb|AAK32837.1|AF361825_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAL31891.1|AF419559_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 emb|CAB62363.1| MTN3-like protein [Arabidopsis thaliana]
 gb|AAL49908.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AAL77742.1| AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAM20244.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AEE78451.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
Length=289

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 188/266 (71%), Gaps = 19/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG+LGN+ISF VFLSP+PTFY+++KKK+TEG+QSIPYVVALFSA LW+YYA 
Sbjct  6    TENTWAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TIN+FG FIETIY+  F+ Y+ K  R+ T+K L L   GGF AILL  QF
Sbjct  65   TQKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKMLLLMNFGGFCAILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LVKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLPEVT------  754
            GL LKD+ +A PNVLGF  G LQ+ LY++YK        G+K+ V+  KLPEV+      
Sbjct  185  GLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTSPHLGEKE-VEAAKLPEVSLDMLKL  243

Query  755  ---ALPKPV-IILEDNNGTNTNDKRS  820
               + P+P+ ++ + N  T  ND+R+
Sbjct  244  GTVSSPEPISVVRQANKCTCGNDRRA  269



>gb|KHG20984.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=289

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 168/229 (73%), Gaps = 3/229 (1%)
 Frame = +2

Query  65   MALTA--HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MA+ A  H  A  FG+LGNIIS +VFL+P+PTF ++YKKKSTE +QS+PY VALFS MLW
Sbjct  1    MAVMADHHSLAVVFGILGNIISVLVFLAPVPTFCRIYKKKSTESFQSLPYQVALFSCMLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA +K     LLITINSFG  +ETIY+  F+ Y++K +R+  MK       G F  IL
Sbjct  61   LYYALIK-KGAFLLITINSFGCVVETIYISMFLAYASKNSRMSAMKLFISMNLGLFSFIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            + T FL KS +R  V+GWIC+  S+ VF APL I+ +VIRTKSVE MP  LS FLTLSAV
Sbjct  120  ILTHFLLKSSIRIQVLGWICVAISVSVFAAPLNIMARVIRTKSVEFMPFTLSFFLTLSAV  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLP  745
            MWF YGLF+KD+ +A+PNVLGF+ G+LQ+ LY +Y+  +K  ++E+KLP
Sbjct  180  MWFAYGLFIKDLCVALPNVLGFILGMLQMLLYAIYRHSEKVNIEEKKLP  228



>ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 147/292 (50%), Positives = 188/292 (64%), Gaps = 28/292 (10%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FG+LGNIISF+V+L+PLPTFY++ ++KSTEG+ S+PYVVALFSA LWI+YAF+K
Sbjct  8    HPWAFTFGILGNIISFMVYLAPLPTFYRVCRRKSTEGFHSVPYVVALFSATLWIFYAFLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N   LLITIN+ G  IET YVV +  Y+ K  ++ T K + L   G FG IL+ T    
Sbjct  68   TN-AGLLITINAVGCVIETAYVVVYFTYAPKAAKMFTAKLVLLVNVGMFGLILVLTLLFA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            +   R  V+GWIC+ FS+ VFVAPL I+R VIRTKSVE MP  LS FLT SAV+WF YGL
Sbjct  127  RGAKRVEVLGWICMSFSVSVFVAPLSIIRLVIRTKSVEFMPFSLSFFLTWSAVVWFGYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
              KD+ +A+PNVLGF+FG+LQ+ LY+ Y++  K +V EQKLPE  A              
Sbjct  187  LTKDLYVALPNVLGFIFGVLQMVLYVAYRNKDKAMV-EQKLPEHIA--------------  231

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAP  955
                   SKL   T E++++I  +G     EK+   A      DK   A AP
Sbjct  232  -------SKLG--TAEKVLEIYAIGV---EEKVPNRAQEEQEEDKQGVAAAP  271



>ref|XP_009385515.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 182/269 (68%), Gaps = 13/269 (5%)
 Frame = +2

Query  92   FAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDT  271
            F FG+LGNIISF+VFLSPLPTFY++Y+KKSTEG+QS+PYVVAL S ML IYYA VK N  
Sbjct  12   FIFGILGNIISFMVFLSPLPTFYRIYRKKSTEGFQSVPYVVALSSCMLLIYYALVKTN-A  70

Query  272  TLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEM  451
             LLITINSFG FIET Y+  ++ Y+TKK R+  ++   L     F AI+L T+  F    
Sbjct  71   VLLITINSFGCFIETAYITIYLIYATKKARIFCIQIFVLLNVVAFAAIVLLTRLAFTGPD  130

Query  452  RAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKD  631
            R  VVGWIC+ FSLCVF APL I+R VIRTKSVE MP  LS FLTL+A+ WF YG F KD
Sbjct  131  RVTVVGWICVGFSLCVFAAPLSIIRLVIRTKSVEFMPFYLSFFLTLNAIAWFGYGFFTKD  190

Query  632  MNIAVPNVLGFVFGILQIGLYMMYK--DGKKD----VVKEQ--KLPEVTALPKPVIIL--  781
            + + +PNVLGFVFG++Q+ +YM+YK  + KKD     V E   K+ E+++ P   + +  
Sbjct  191  LYVELPNVLGFVFGVVQMVVYMLYKNNNNKKDAAVAAVPEHRVKIAELSSAPASELQVSL  250

Query  782  --EDNNGTNTNDKRSSKLPELTEEQIIDI  862
              +D N  +  D + +   E   E+  DI
Sbjct  251  EEKDQNKRSMEDSQDTDKNETAYEEGHDI  279



>gb|KFK26707.1| hypothetical protein AALP_AA8G282900 [Arabis alpina]
Length=281

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/294 (49%), Positives = 192/294 (65%), Gaps = 34/294 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++       FG+LG+IISF V L+P+PTF ++YK+KS+EGYQSIPYV+ALFSAMLWIY
Sbjct  1    MAISPAVLVTVFGLLGDIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVIALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA V+ +   LLITIN+F   I+  Y+ F++ Y+ KK +  T+KF+       FG I L 
Sbjct  61   YALVRKH-AVLLITINTFCCVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGLIFLL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL     R  V+G+IC+VF+LCVFVAPL I+R+VI+TKS E MP  LS FLTLSAVMW
Sbjct  120  TYFLTHGIKRVQVLGYICMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKDMN+A+PNVLGF+FG+LQ+ LYM+YK                   KP     
Sbjct  180  FFYGLLLKDMNVALPNVLGFIFGVLQMILYMIYK-------------------KP-----  215

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI-----QKSAAAASPFD  931
               GT   +    KL +++ E ++D+V+L ++VCS ++     Q SA   +  D
Sbjct  216  ---GTKVLEPSGIKLQDIS-EHVVDVVRLSSMVCSSQMRALVPQDSADMEATID  265



>ref|XP_008356571.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Malus 
domestica]
Length=295

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 181/279 (65%), Gaps = 34/279 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MAL  H  + AFG+LGNIIS +VFL+P+PTFY +YKKK+TEG+Q++PYV+ L S+ML+IY
Sbjct  1    MALQ-HTLSLAFGLLGNIISLLVFLAPVPTFYTIYKKKTTEGFQALPYVIGLLSSMLYIY  59

Query  245  YAFVKAN---DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgai  415
            YA +K     D TLLITINS G  IET+Y+  F+ Y+ KK R+     L L     +  +
Sbjct  60   YALLKEEIKYDATLLITINSVGSVIETLYISLFLFYAPKKARISNATLLFLLNGFSYAVM  119

Query  416  llaTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSA  595
            ++ T+FL   EMR  +VGWICLVFS+ VFVAPL +LRQV RTKSVE MP  LS FLTL A
Sbjct  120  VVLTRFLATGEMRIKIVGWICLVFSISVFVAPLGVLRQVXRTKSVEFMPFPLSFFLTLGA  179

Query  596  VMWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVI  775
            V WFFYG  +KD  IA+PN+LGF  G++Q+ +Y++YK+ K+                   
Sbjct  180  VAWFFYGFLIKDFYIALPNILGFFLGVVQMVVYIVYKNAKE-------------------  220

Query  776  ILEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
            +LED            K  EL+E  IID+ K+ TLVC E
Sbjct  221  VLEDQ----------PKGQELSE-HIIDVRKISTLVCPE  248



>ref|XP_009150896.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Brassica 
rapa]
Length=288

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 189/266 (71%), Gaps = 18/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGNIISF VFLSP+PTFY+++KKK+TE +QS+PYVVALFSAMLW+YYA 
Sbjct  6    TQNTWAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ ++TKK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ----KLPEVT-------  754
            GL L+D+ +A PNV+GF  G LQ+ LY+++K  K   D+V+++    KLPEV+       
Sbjct  185  GLALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSIDMLKLG  244

Query  755  --ALPKP--VIILEDNNGTNTNDKRS  820
              A P+P  + ++   N    ND+++
Sbjct  245  TLASPEPAEITVVPTANKCICNDRKA  270



>ref|XP_007050795.1| Medicago truncatula MTN3 [Theobroma cacao]
 gb|EOX94952.1| Medicago truncatula MTN3 [Theobroma cacao]
Length=306

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 168/226 (74%), Gaps = 4/226 (2%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H ++  FG+LGNI+SF+V+L+PLPTFY+++KKKSTEG+QSIPY VALFSAML +YYAF+K
Sbjct  35   HGFSVVFGLLGNILSFLVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLLLYYAFLK  94

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             +D  +LITINS G FIE+IY++ ++ Y+TK  RV T K L  F  G  G+I+L T    
Sbjct  95   KHDAFMLITINSIGCFIESIYLLLYMVYATKSARVYTTKLLIFFNLGALGSIILLTFIFS  154

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K   R  VVGWIC VFS+CVF APL I+R VI+TK+VE MP  LS FLTL AV WF YG 
Sbjct  155  KGSSRISVVGWICAVFSVCVFAAPLSIIRLVIKTKTVEYMPFPLSFFLTLCAVTWFLYGF  214

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTA  757
             L+D  IA PN+LGF+FGI Q+ LY++Y+ G+    KEQ LPE+ A
Sbjct  215  SLRDYYIATPNILGFIFGITQMILYLLYRGGR----KEQILPEIKA  256



>ref|XP_003524088.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
 gb|KHN22921.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=283

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/273 (51%), Positives = 180/273 (66%), Gaps = 17/273 (6%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            +  A  FG+LGN+ISF+V+L+PLPTFY++YKKKSTEG+QS+PY+VALFS+MLW+YYA +K
Sbjct  8    NHLALGFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYASLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D TLLITINS G  IE +Y++ F  Y+TK  R  T+K   +   G F  I L T F  
Sbjct  68   PADATLLITINSLGCVIEIVYIIMFTIYATKDARNLTVKLFMVMNVGSFALIFLVTYFAM  127

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
               +R  VVGW+C+  ++ VF APL I+ QVIRTK+VE MP  LS+FLT+SAVMWFFYGL
Sbjct  128  HGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTISAVMWFFYGL  187

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKD----VVKEQKLPEV-----------T  754
             LKD+ IA+PN+LGF  G+LQ+ LY +Y++GK +    V KE+   E            T
Sbjct  188  LLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVVTKEEHALEAMKNVVVVNPLGT  247

Query  755  ALPKPVIILE-DNNGTNTND-KRSSKLPELTEE  847
                PVI  E +NNG      +   K  EL +E
Sbjct  248  CEVYPVIGKEINNNGQGIEGAEEKEKGVELGKE  280



>ref|XP_010482380.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Camelina 
sativa]
Length=288

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 198/317 (62%), Gaps = 36/317 (11%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    A  FG+LGNIISF V L+P+PTF ++YK+KS+EGYQS+PYV++LFSAMLW+Y
Sbjct  1    MAISQAVLATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  +LITINSF   ++ +Y+  +  Y+ KK ++ T+KF+       FG I L 
Sbjct  61   YAMIK-KDAMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL     R  V+G+IC+VF+L VFVAPL I+R+VI+TKS E MP  LS FLTLSA+MW
Sbjct  120  TYFLTHGNKRGQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKDMNIA+PN+LGF+FG+LQ+ L+++YK            P    L   VI L+
Sbjct  180  FFYGLLLKDMNIALPNILGFIFGVLQMILFVIYKK-----------PGTKVLEPSVIKLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI-----QKSAAAAS--PFDKNPA  943
            D                   E ++D+V+L ++VC+ ++     Q SA  A     D+   
Sbjct  229  D-----------------ISEHVVDVVRLSSMVCNSQMRTLVPQDSADMADTIDLDEKIK  271

Query  944  ATAPKLQAVEA*LLNRR  994
                K+   EA L+++ 
Sbjct  272  GDIEKINNKEAFLISKN  288



>emb|CDX68492.1| BnaC01g25700D [Brassica napus]
Length=286

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 188/266 (71%), Gaps = 19/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG++GN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+YYA 
Sbjct  6    THNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ ++ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGITRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLPEVT------  754
            GL LKDM +A PNVLGF  G LQ+ LY++Y+        G+K+ V+  KLPEV+      
Sbjct  185  GLALKDMYVAFPNVLGFALGALQMILYVVYRYCKTPPQLGEKE-VEAAKLPEVSLDMLKL  243

Query  755  ---ALPKPV-IILEDNNGTNTNDKRS  820
               + P+P+ ++ + N  T  ND+RS
Sbjct  244  GTVSSPEPIAVVRQTNKCTCGNDQRS  269



>ref|XP_006664549.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Oryza 
brachyantha]
Length=256

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 182/250 (73%), Gaps = 3/250 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAFAFG+LGN+ISF  +L+P+PTFY++YK KSTEG+QS+PYVVALFSAMLWI+YA +K
Sbjct  8    HPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALIK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            +N+  LLITIN+ G  IETIY+V ++ Y++KK +V T K L     G FG ILL T  L 
Sbjct  68   SNEA-LLITINAAGCVIETIYIVIYLAYASKKAKVFTTKILLGLNVGVFGVILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K E R   +GW+C+ FS+ VFVAPL I+R+V++T+SVE MP  LS+ LTLSA++WF YGL
Sbjct  127  KGENRVVSLGWVCVAFSVSVFVAPLSIIRRVVQTRSVEYMPFSLSLTLTLSAIVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             +KD  +A+PNVLGF FG++Q+GLY+ Y +    V  E K  ++ A  +P +++     T
Sbjct  187  LIKDKYVALPNVLGFTFGVVQMGLYVFYMNA-TPVAGEGKEGKLAA-EEPQVVVNVGKLT  244

Query  800  NTNDKRSSKL  829
             T D+ S ++
Sbjct  245  ATPDRSSGEI  254



>gb|AHL43546.1| nodule-specific sucrose transporter [Medicago truncatula]
Length=270

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = +2

Query  77   AHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFV  256
            +  WAF FGV+GN+IS + FL+PLPTFY++YKKKSTEG+QS+PYV ALFSAMLWIYYA V
Sbjct  6    SEYWAFVFGVIGNVISCMTFLAPLPTFYRIYKKKSTEGFQSVPYVTALFSAMLWIYYAHV  65

Query  257  KANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFL  436
            K   T LL+TIN +G  IE IY++ F+ Y++ K R+ T+K L      G+G +++ T +L
Sbjct  66   KNKATLLLLTINIYGFGIEAIYIIIFLLYASNKARLSTIK-LLFLTVCGYGTMVILTTYL  124

Query  437  FKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYG  616
             K   R  ++GWIC+VF++CVF +PLFIL+QVI+TKSV  MP+ LS FLTL+A++WFFYG
Sbjct  125  TKGSKRLSIIGWICMVFNICVFASPLFILKQVIKTKSVAFMPLNLSFFLTLNAIVWFFYG  184

Query  617  LFLKDMNIAVPNVLGFVFGILQIGLYMMYKDG  712
            L + D  IA+PN LGFVFGI+Q+ +Y++YKD 
Sbjct  185  LLIDDFYIAIPNTLGFVFGIVQMVIYLIYKDA  216



>ref|XP_010503515.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Camelina 
sativa]
Length=294

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 151/305 (50%), Positives = 202/305 (66%), Gaps = 30/305 (10%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            T+  T + WAF FG+LGN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+
Sbjct  2    TLLNTENTWAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWL  61

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA  +  D  LL+TIN+FG FIETIY+  F+ Y+ K  R+ T+K L L   GGF  ILL
Sbjct  62   YYA-TQKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCIILL  120

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
              QFL K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+
Sbjct  121  ICQFLVKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI  180

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYK-------DGKKDVVKEQKLP-EVT-  754
            W  YGL LKD+ +A PNV+GF  G LQ+ LY++YK        G+K+ V+  KLP EVT 
Sbjct  181  WLLYGLALKDIYVAFPNVIGFGLGALQMILYIVYKYCKTSPHIGEKE-VEAAKLPAEVTL  239

Query  755  --------ALPKPV-IILEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKS  907
                    + P+P  ++L+ N  T  ND+R+  + +  +  I  I K          Q S
Sbjct  240  DMLKLGTISSPEPAPLVLQANKCTCGNDRRAEMIEDGRQTPINGIGK----------QPS  289

Query  908  AAAAS  922
            +AAA+
Sbjct  290  SAAAT  294



>ref|XP_004235470.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=276

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 185/270 (69%), Gaps = 16/270 (6%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H   + FG+LGN++SF+VF++P+PTFY++ KKKS+EG+ S+PYVV LFSAMLWIYYA VK
Sbjct  8    HPLVYTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N  TLLITINSFG   ETIYV  +  Y+TKK R++T+  + L   G FG IL  TQ L 
Sbjct  68   TN-VTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILC  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            +   RA V+GWIC+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LT+SAVMWF YGL
Sbjct  127  QGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK-KDVVKEQKLPEVTALPK----------  766
             LKD+ +AVPN+ G + G+LQ+ LY +Y++ K  +V  E++LP V  + +          
Sbjct  187  LLKDVYVAVPNIPGMILGVLQMILYGIYRNSKSNNVATEKELPIVVKVDQEQPTKVNSEV  246

Query  767  -PVII--LEDNNGTNTNDKRSSKLPELTEE  847
             PV I  L+  NG    D ++ + P++  +
Sbjct  247  YPVNISSLDSENG-EAKDGKNLQDPQMNSQ  275



>emb|CDX80379.1| BnaC07g30650D [Brassica napus]
Length=288

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 189/266 (71%), Gaps = 18/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG++GNIISF VFLSP+PTFY+++KKK+TE +QS+PYVVALFSAMLW+YYA 
Sbjct  6    TQNTWAFAFGLVGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ ++TKK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ----KLPEVT-------  754
            GL L+D+ +A PNV+GF  G LQ+ LY+++K  K   D+V+++    KLPEV+       
Sbjct  185  GLALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSIDMLKLG  244

Query  755  --ALPKP--VIILEDNNGTNTNDKRS  820
              A P+P  + ++   N    ND+++
Sbjct  245  TLASPEPAEITVVPTANKCICNDRKA  270



>emb|CDX83046.1| BnaA01g20460D [Brassica napus]
Length=286

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 188/266 (71%), Gaps = 19/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG++GN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+YYA 
Sbjct  6    THNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ ++ KK R+ T+K L L   GGF  ILL +QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLSQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLPEVT------  754
            GL LKD+ +A PNVLGF  G LQ+ LY++Y+        G+K+ V+  KLPEV+      
Sbjct  185  GLALKDIYVAFPNVLGFALGALQMILYVVYRYCKTPPQLGEKE-VEAAKLPEVSLDMLKL  243

Query  755  ---ALPKPV-IILEDNNGTNTNDKRS  820
               + P+P+  + + N  T  ND+RS
Sbjct  244  GTVSSPEPIAFVRQTNKCTCGNDQRS  269



>gb|AHB08882.1| bidirectional sugar transporter SWEET14-like protein [Suaeda 
glauca]
Length=323

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 169/229 (74%), Gaps = 2/229 (1%)
 Frame = +2

Query  74   TAHQ-WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            T H  W FAFG+LGNIISF+VFL+PLPTF ++YKKKSTEG+QS+PYVVA+FSAMLWIYYA
Sbjct  3    TIHNPWVFAFGILGNIISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYA  62

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
             +K N + LLITIN  G+ IETIYV  FI Y+ ++ R+ T+K L L   GGF  I+L   
Sbjct  63   MLKGN-SVLLITINIAGVIIETIYVAIFITYAPRQARISTLKLLMLLNFGGFCGIILLCH  121

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            +L K + R  + GWIC+ FS+ VFVAPL ++R VIRTKSVE MP  LS  LTL+A +WFF
Sbjct  122  YLAKGQARLQLYGWICVAFSISVFVAPLSVIRTVIRTKSVEYMPFNLSCCLTLTATVWFF  181

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTA  757
            YG   KD+ + +PNV+GF+FGI Q+ LY++Y        ++QKLPEV +
Sbjct  182  YGFVQKDLYVTLPNVVGFIFGIAQMTLYLVYSRKYGKEAEKQKLPEVAS  230



>ref|XP_010249453.1| PREDICTED: bidirectional sugar transporter SWEET12 [Nelumbo nucifera]
Length=292

 Score =   248 bits (634),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H W FAFG+LGNIIS +V+L+P+PTF ++YKKKSTEG+QS+PYVVALFSAMLWIYY  +K
Sbjct  8    HPWTFAFGLLGNIISLMVYLAPVPTFIRIYKKKSTEGFQSVPYVVALFSAMLWIYYGLLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D  LLITINS G  IET Y+  F+ Y+ KK RV  +K L L   G F +ILL T FL 
Sbjct  68   P-DAHLLITINSVGCVIETSYITMFMVYAPKKARVLAIKLLLLLNVGTFCSILLFTLFLA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K   R  V+G IC+ FS+ VF APL I+R VIR+KSVE MP  LS FLTLSAVMWF YG 
Sbjct  127  KGSNRVRVLGSICVAFSVSVFAAPLSIMRLVIRSKSVEFMPFSLSFFLTLSAVMWFSYGF  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQK  739
             LKD  IA+PN+LGF+FG+ Q+ LY +YKD  +  ++EQ+
Sbjct  187  LLKDFYIALPNILGFIFGVAQMVLYAIYKDANRSNIEEQQ  226



>ref|XP_009336454.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 141/293 (48%), Positives = 183/293 (62%), Gaps = 36/293 (12%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            T+A + H  AF FGVLGN++S +V+L+P+PTFY++Y+KKSTEG+ S+PY+VA+FS+MLW 
Sbjct  3    TVADSHHPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWF  62

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K N   LLITINSFG F E  Y+V F+ Y+ +  R  T+K  G+   G F  IL+
Sbjct  63   YYASLKKN-AMLLITINSFGSFAEMTYIVIFVVYAPRDARKLTVKLFGIMNVGLFTLILV  121

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             + FL     R  V+GWI +  S  VF APL I+ QVIRT+SVE MP  LS FLTLSAVM
Sbjct  122  VSHFLVSRAYRVPVLGWINVAISTSVFAAPLSIVAQVIRTRSVEFMPFRLSFFLTLSAVM  181

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIIL  781
            WF YGLFLKD+ IA+PNVLGFV G+LQ+ LY MY++ K++                  IL
Sbjct  182  WFAYGLFLKDICIAIPNVLGFVLGLLQMLLYAMYRNRKQE------------------IL  223

Query  782  EDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNP  940
            ED+           KLP  T + + +IV + TL  SE          P D  P
Sbjct  224  EDH---------EKKLPAATPDHVNNIVIIATLAASE--------VHPVDAQP  259



>emb|CDX84877.1| BnaA03g13530D [Brassica napus]
Length=272

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 185/280 (66%), Gaps = 29/280 (10%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++       FG+LGNIISF+V L+P+PTF ++YK+KS+EGYQSIPYV+ALFSAMLWIY
Sbjct  1    MAVSIVVLRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N   ++ITIN+  + I+  Y+ F++ Y+ KK +  T+KF+       FG I   
Sbjct  61   YAMIKTN-VVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL   + R  ++G+IC+VFSLCVFVAPL I+R+VI+T+S E MP  LS FLTLSAVMW
Sbjct  120  TYFLLHGQKRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKDMNIA+PNVLGF+FG+LQ+ LYM+YK            P    L  PVI L+
Sbjct  180  FFYGLLLKDMNIALPNVLGFIFGVLQMILYMIYKK-----------PGTKVLEPPVINLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQK  904
            +                   + ++D+V+L ++V +  I +
Sbjct  229  E-----------------ISDHVVDVVRLSSMVYTITIDE  251



>ref|XP_006347653.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 179/259 (69%), Gaps = 15/259 (6%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H   F FG+LGN++SF+VF++P+PTFY++ KKKS+EG+ S+PYVV LFSAMLWIYYA VK
Sbjct  8    HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N  TLLITINSFG   ETIYV  +  Y+TKK R++T+  + L   G FG IL  TQ L 
Sbjct  68   TN-VTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILC  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            +   RA V+GWIC+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LT+SAVMWF YGL
Sbjct  127  QGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK-KDVVKEQKLPEVTALPK----------  766
             LKD+ +AVPN+ G + G+LQ+ LY +Y++ K  +V  +++LP V  + +          
Sbjct  187  LLKDVYVAVPNISGMILGVLQMILYGIYRNSKSNNVATKKELPTVVKVDQEQPTKVNCEV  246

Query  767  -PVII--LEDNNGTNTNDK  814
             PV I  L+  NG   + K
Sbjct  247  YPVNISSLDSENGEGKDGK  265



>dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/282 (48%), Positives = 189/282 (67%), Gaps = 23/282 (8%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FG+LGN+ISF+ +L+PLPTFY++YK KST+G+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             +D  LLITIN+ G  IETIY+V ++ Y+ K+ R+ T K L L   G FG ILL T  L 
Sbjct  68   -SDEYLLITINTAGCVIETIYIVLYLAYAPKQARLFTAKILLLLNVGVFGLILLLTLLLT  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              E R  ++GW+C+ FS+CVFVAPL ++R V+RT+SVE MP  LS+ LT SAV+WF YGL
Sbjct  127  AGERRVVMLGWVCVGFSVCVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             +KD  +A+PN+LGF FG++Q+GLY +Y++              T +P P    ++ +  
Sbjct  187  LIKDKYVALPNILGFAFGVIQMGLYALYRNA-------------TPIPAP----KEMDAP  229

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASP  925
             + D  + K P    E +++I KLGT   + ++  +     P
Sbjct  230  ESEDG-AVKAP----EHVVNIAKLGTAAAAIELNTNHPVEPP  266



>emb|CDX77928.1| BnaC03g52910D [Brassica napus]
Length=285

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 189/273 (69%), Gaps = 21/273 (8%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG++GN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+YYA 
Sbjct  6    THNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ Y+ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R+VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRKVIKTRSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLPEVT------  754
            GL LKD+ +A PNVLGF  G LQ+ LY++YK        G+K+ V+  KLPEV+      
Sbjct  185  GLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTPPHLGEKE-VEAAKLPEVSLDILKL  243

Query  755  -ALPKPVIILEDNNGTNTNDKRSSKLPELTEEQ  850
              +  P  + + N  T  ND+R    PE+ + Q
Sbjct  244  GTVSSPE-VRQANKCTCGNDRR----PEVEDGQ  271



>ref|XP_002514863.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47417.1| conserved hypothetical protein [Ricinus communis]
Length=272

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AFAFG+LGNIIS +V+L+P+PTFY++Y+KKSTEG+QS+PY+VALFS+MLW+YYA +K  D
Sbjct  11   AFAFGILGNIISILVYLAPVPTFYRIYRKKSTEGFQSLPYLVALFSSMLWLYYAMLK-KD  69

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
              LL+TIN+FG  IETIY++ +I Y+TKK RV T K L     G F  I+L + FL KS 
Sbjct  70   VFLLVTINAFGCVIETIYIIMYIIYATKKNRVSTFKVLTSMNLGLFAFIILFSHFLVKSS  129

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
            +RA V+GWIC+  S+CVF APL I+ QVI+T+SVE MP  LS FLTLSA+MWF YGL  K
Sbjct  130  VRAQVLGWICVAVSVCVFAAPLSIVAQVIKTRSVEFMPFNLSFFLTLSAIMWFAYGLSTK  189

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
            D  +A+PNVLGF+ G+LQ+ LY++Y+  KK V+ E+KLPE
Sbjct  190  DTCVALPNVLGFILGLLQMVLYVIYRKAKK-VILEEKLPE  228



>emb|CDX88041.1| BnaA06g26320D [Brassica napus]
Length=288

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/278 (52%), Positives = 191/278 (69%), Gaps = 32/278 (12%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGNIISF VFLSP+PTFY+++KKK+TE +QS+PYVVALFSAMLW+YYA 
Sbjct  6    TQNTWAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ ++TKK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQKLPEVTALPKPVIILED  787
            GL L+D+ +A PNV+GF  G LQ+ LY+++K  K   D+V+++              LE 
Sbjct  185  GLALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKE--------------LE-  229

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQ  901
                      ++KLPE++    ID++KLGTL   E  +
Sbjct  230  ----------AAKLPEVS----IDMLKLGTLASPEPAE  253



>ref|XP_009150178.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Brassica 
rapa]
Length=285

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 197/298 (66%), Gaps = 33/298 (11%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG++GN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+YYA 
Sbjct  6    THNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ Y+ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLPEVT------  754
            GL LKD+ +A PNVLGF  G LQ+ LY++YK        G+K+ V+  KLPEV+      
Sbjct  185  GLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTPPHLGEKE-VEAAKLPEVSLDILKL  243

Query  755  -ALPKPVIILEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASP  925
              +  P  + + N  T  ND+R    PE+ + Q            + K  K +++ASP
Sbjct  244  GTVSSPE-VRQANKCTCGNDRR----PEVEDGQ------------NAKNGKQSSSASP  284



>ref|XP_002511125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51727.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 184/278 (66%), Gaps = 17/278 (6%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            TMA   H   F FGVLGNIIS ++FLSP+ TF ++YKKKSTEG+QSIPYVVALFS MLWI
Sbjct  2    TMA-EHHPLIFTFGVLGNIISILMFLSPMFTFIRVYKKKSTEGFQSIPYVVALFSCMLWI  60

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA +K+ D  LL++INSFG  ++TIY+V FI Y+ KK ++ T++ L L    GF AI+ 
Sbjct  61   YYAMLKSGDY-LLLSINSFGCLVQTIYIVLFIFYAEKKAKILTLQLLFLMNFAGFLAIVA  119

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
             T+F  K   R H+VGW C+  S  +F APL ++R V+RTKSVE MP  LS+FLTLSA+M
Sbjct  120  LTRFFAKGSSRLHIVGWFCVAVSAVLFAAPLSVIRLVVRTKSVEFMPFTLSLFLTLSAIM  179

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKL------------P  745
            W  YG+ LKD+ IA+PN+ G VFG +Q+ LY++Y+DGKK +   +K+             
Sbjct  180  WLLYGVLLKDLYIALPNIFGLVFGAIQMVLYVIYRDGKKVIELPEKIDMDSPIKTFEVHA  239

Query  746  EVTALPKPVIILEDNNGTNTNDKR---SSKLPELTEEQ  850
             V +LP P    + N   N N++R   +     L +EQ
Sbjct  240  AVVSLPIPDDNYQVNKEDNPNEQRKPNADSTESLNQEQ  277



>ref|XP_006366912.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H   F FG+LGN++SF+VF++P+PTFY++ KKKS+EG+ S+PYVV LFSAMLWIYYA VK
Sbjct  8    HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N  TLLITINSFG   ETIYV  +  Y+TKK R++T+  + L   G FG IL  TQ L 
Sbjct  68   TN-VTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILC  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            +   RA V+GWIC+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LT+SAVMWF YGL
Sbjct  127  QGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK-KDVVKEQKLPEV  751
             LKD+ +AVPN+ G + G+LQ+ LY +Y++ K  +V  E++LP V
Sbjct  187  LLKDIYVAVPNIPGMILGVLQMILYGIYRNFKSNNVATEKELPTV  231



>ref|XP_003615405.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES98363.1| bidirectional sugar transporter [Medicago truncatula]
Length=269

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/260 (50%), Positives = 176/260 (68%), Gaps = 6/260 (2%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AF FG+LGNIIS +V+L+PLPTFY+++KKKSTEG+QS+PY+VALFS+MLW+YY FVK + 
Sbjct  10   AFIFGILGNIISSMVYLAPLPTFYRIWKKKSTEGFQSLPYLVALFSSMLWLYYGFVKKH-  68

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
              LLITINS G  IETIY+V ++ Y+TK  R+ T+K            I+L TQ     +
Sbjct  69   AFLLITINSAGCVIETIYIVTYLIYATKDARILTIKLFMAMNVACSVLIVLTTQLAMHGK  128

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
            +R HV+GWIC  F++CVF APL I+ +VIRTKSVE MP+ LS FLTLSA++WFFYGL L 
Sbjct  129  LRVHVLGWICTSFAICVFAAPLTIMAKVIRTKSVEFMPINLSFFLTLSAIVWFFYGLLLH  188

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVT-----ALPKPVIILEDNN  793
            D+ IA+PNVLGF+ G+LQ+ LY +Y    K+    + +  +       +P  V  L   +
Sbjct  189  DICIAIPNVLGFILGLLQMLLYAIYNKSVKEEYALEPMTNIVIVNPLGIPCEVFSLPVID  248

Query  794  GTNTNDKRSSKLPELTEEQI  853
              N  +K  ++  E + E +
Sbjct  249  NVNKIEKEGAEEMEKSVENL  268



>ref|XP_009411801.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 178/257 (69%), Gaps = 3/257 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H   F FG+LGN+ISF+VFL+P+PTFY++Y+KKSTEG+ S+PYVVA+FS MLWIYYA+VK
Sbjct  8    HPLPFTFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSLPYVVAVFSCMLWIYYAYVK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D+ LLITINSFG+FIET Y+  ++ Y+ KKTR+ +M+   L     F AI+L TQ LF
Sbjct  68   -TDSILLITINSFGVFIETAYITIYLIYAPKKTRIMSMRIFVLLNVVVFAAIILLTQLLF  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
               +R  V+GWIC+ FS+ VF APL ++R VIRTKSVE +P  LS FLTLSA+ WF YGL
Sbjct  127  TGSIRLKVLGWICVGFSVSVFAAPLSVIRLVIRTKSVEFLPFYLSFFLTLSAIAWFGYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVI--ILEDNN  793
            F KD+ + +PNVLGF+FG+ Q+ LY++YK  K  VV+   +  +  + +  I    E   
Sbjct  187  FTKDIYVQLPNVLGFLFGVAQMVLYIVYKKKKNVVVEPAGIEHIVRIAELAIAPASELQA  246

Query  794  GTNTNDKRSSKLPELTE  844
            G   ND R       TE
Sbjct  247  GVEENDHRKKASEGSTE  263



>ref|XP_006404221.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
 gb|ESQ45674.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
Length=291

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 192/278 (69%), Gaps = 25/278 (9%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG++GN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+YYA 
Sbjct  6    THNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TIN+FG FIETIY+  ++ Y+ K  ++ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINAFGCFIETIYISMYLAYAPKTAKMLTVKLLLLMNFGGFCLILLICQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            LFK   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LFKGPTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLPEVT------  754
            GL LKD  +A PNV+GFV G LQ+ LY++YK        G+K+ V+  KLPEV+      
Sbjct  185  GLALKDFYVAFPNVIGFVLGALQMILYVVYKYCKTPPHLGEKE-VEAAKLPEVSLDMLKL  243

Query  755  ---ALPKP---VIILEDNNGTNTNDKRSSKLPELTEEQ  850
               + P+P    ++ + N  T  ND+R+    E+ +EQ
Sbjct  244  GTISSPEPAPIAVVRQANKCTCGNDRRA----EVEDEQ  277



>ref|XP_011071246.1| PREDICTED: bidirectional sugar transporter N3 [Sesamum indicum]
Length=297

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/280 (50%), Positives = 187/280 (67%), Gaps = 10/280 (4%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FGVLGNIIS  V+L+PLPTF+++YK++ST G+ S+PYVVALFSAMLW+YYAF+K
Sbjct  8    HPWAFTFGVLGNIISVFVYLAPLPTFFRIYKERSTMGFDSLPYVVALFSAMLWMYYAFLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N   LLI+IN FG  IE IY+  ++ Y++KK R  T K L L   G    I L T F+F
Sbjct  68   TN-AILLISINLFGCVIEAIYIFIYLFYASKKARTHTAKLLSLINVGLLALIFLLTFFIF  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K  +R HVVGWIC+  S+ VF APL I+ QV+RT+SVE MP  LS FLTLSAVMWF YGL
Sbjct  127  KGPIRVHVVGWICVAVSVSVFAAPLTIVFQVVRTRSVEFMPFPLSFFLTLSAVMWFAYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE----VTALPKPVIILED  787
            F KD+ +A+PNVLGF  G+LQ+ LY ++++ K +  +++KLPE    +  L  P +   D
Sbjct  187  FQKDLCVALPNVLGFFLGLLQMLLYGIFRNVKPE-NEDKKLPEHVINIMVLGTPEVHPVD  245

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKS  907
            +   N  DK      E  +E+  D  +   + C+  ++ S
Sbjct  246  SQ--NCPDKIGVSQEENKDEE--DEAQENCVPCAISLEPS  281



>ref|XP_008370771.1| PREDICTED: bidirectional sugar transporter NEC1-like [Malus domestica]
Length=267

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 183/265 (69%), Gaps = 5/265 (2%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            L   Q AF FG+LGNI+SF+VFL+P+PTFY +YKKKS++G+QSIPYVVAL SA L +YY 
Sbjct  4    LNTEQLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLLYYG  63

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
             +K N   L+++IN  GI IE  Y++ +I Y++KK ++ T+  + L     FG +L  T 
Sbjct  64   VLKTN-AYLIVSINVIGIXIEVTYLILYIVYASKKDKITTLSLILLVNVAAFGLVLAVTV  122

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL     R   VGWIC VF++ VF APL I+RQVIRTKSVE MP  LS+FLTL A MWFF
Sbjct  123  FLLGGTARVCAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFF  182

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDV-VKEQ--KLPEVTALPKPVIIL  781
            YGLF KD  IA+PNVLGF+FGI Q+ LYM YK+  KDV VK+   ++ ++++  +P +  
Sbjct  183  YGLFTKDYYIALPNVLGFLFGIAQMILYMTYKNSGKDVEVKKSTMEMKKLSSTNRPNLTG  242

Query  782  EDNNGTNTND-KRSSKLPELTEEQI  853
              N  + +++ K+++ + E  +E +
Sbjct  243  SVNKNSRSDELKQTTDVYESNDEHV  267



>ref|XP_010442345.1| PREDICTED: bidirectional sugar transporter SWEET10 [Camelina 
sativa]
Length=289

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 189/296 (64%), Gaps = 34/296 (11%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    A  FG+LGNIISF V L+P+PTF ++YK+KS+EGYQS+PYV++LFSAMLW+Y
Sbjct  1    MAISQAVLATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  +LITINSF   ++ +Y+  +  Y+ KK ++ T+KF+       FG I L 
Sbjct  61   YAMIK-KDAMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL     R  V+G+IC+VF+L VFVAPL I+R+VI+TKS E MP  LS FLTLSA+MW
Sbjct  120  TYFLTHGNKRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD NIA+PNVLGF+FG+LQ+ L+++YK            P    L   VI L+
Sbjct  180  FFYGLLLKDKNIALPNVLGFIFGVLQMILFVIYKK-----------PGTKVLEPSVIKLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI-----QKSAAAASPFDKN  937
            D                   E ++D+V+L ++VC+ ++     Q SA      D++
Sbjct  229  D-----------------ISEHVVDVVRLSSMVCNSQMRTLVPQDSADMEDTIDRD  267



>ref|XP_003602780.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=270

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = +2

Query  77   AHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFV  256
            +  WAF FGV+GN+IS + FL+PLPTFY++YKKKSTEG+QS+PYV AL SAMLWIYYA V
Sbjct  6    SEYWAFVFGVIGNVISCMTFLAPLPTFYRIYKKKSTEGFQSVPYVTALLSAMLWIYYAHV  65

Query  257  KANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFL  436
            K   T LL+TIN +G  IE IY++ F+ Y++ K R+ T+K L      G+G +++ T +L
Sbjct  66   KNKATLLLLTINIYGFGIEAIYIIIFLLYASNKARLSTIK-LLFLTVCGYGTMVILTTYL  124

Query  437  FKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYG  616
             K   R  ++GWIC+VF++CVF +PLFIL+QVI+TKSV  MP+ LS FLTL+A++WFFYG
Sbjct  125  TKGSKRLSIIGWICMVFNICVFASPLFILKQVIKTKSVAFMPLNLSFFLTLNAIVWFFYG  184

Query  617  LFLKDMNIAVPNVLGFVFGILQIGLYMMYKDG  712
            L + D  IA+PN LGFVFGI+Q+ +Y++YKD 
Sbjct  185  LLIDDFYIAIPNTLGFVFGIVQMVIYLIYKDA  216



>ref|XP_006402062.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
 gb|ESQ43515.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
Length=289

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/294 (47%), Positives = 185/294 (63%), Gaps = 34/294 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA+     A  FG+LGNIISF+V L+P+PTF ++YK+KS+EGYQSIPYV+ LFSAMLWIY
Sbjct  1    MAIPLAVLATVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIGLFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N   +LITIN+    I+  Y+  ++ Y+ KK +  T+K +       FG I + 
Sbjct  61   YAMIKKN-VMILITINAVSFVIQIFYIAVYLFYAPKKEKTLTVKLVLFVNVFAFGLIFVL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL     R  V+G++C+VF+LCVFVAPL I+R+VI+TKS E MP  LS FLTLSAVMW
Sbjct  120  TYFLLHGNKRVTVLGYVCMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL  KDMN+A+PNVLGFVFG+LQ+ LY++YK            P    L  P I L+
Sbjct  180  FFYGLLNKDMNVALPNVLGFVFGVLQMVLYLIYKK-----------PGTKVLEPPGIKLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI-----QKSAAAASPFD  931
            D                   + ++D+V+L ++VCS ++     Q SA   +  D
Sbjct  229  D-----------------ISDHVVDVVRLSSMVCSSQMRTLVPQDSADMEATID  265



>ref|XP_010243612.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=270

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 168/228 (74%), Gaps = 1/228 (0%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            +T H  AFAFG+LGNI+SF+V+L+P+PTFY++YKKKSTEG+QSIPYVVAL SAMLWIYYA
Sbjct  5    ITIHTLAFAFGLLGNIVSFMVYLAPVPTFYRIYKKKSTEGFQSIPYVVALLSAMLWIYYA  64

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
             +K N+  +L TIN  G  IE IY+  ++ Y+ K+ RV T+K L L   G +G ILL T 
Sbjct  65   MLK-NEGAMLETINGIGCSIEAIYITIYLVYAPKEARVFTLKLLLLLNVGAYGLILLLTF  123

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
             L     +  VVGWIC  FS+ VF +PL I+RQVIRTKSVE MP LLS FLTL AV+WF 
Sbjct  124  LLTNGSRQVMVVGWICAGFSISVFASPLSIMRQVIRTKSVEFMPFLLSFFLTLCAVLWFC  183

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVT  754
            YGL   D+ IA+PNVLGF FGI Q+ LYM+YKD KKD   E KLP++ 
Sbjct  184  YGLLKNDLYIAIPNVLGFAFGITQMILYMVYKDTKKDFKCEVKLPQLN  231



>ref|XP_009141677.1| PREDICTED: bidirectional sugar transporter SWEET12 [Brassica 
rapa]
Length=277

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 192/276 (70%), Gaps = 32/276 (12%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QS+PYVVALFSAMLW+YYA 
Sbjct  6    THNTWAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG  IETIY+  F+ ++TK+ R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCVIETIYIAIFVAFATKEARMFTVKLLLLMNFGGFFLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQKLPEVTALPKPVIILED  787
            GL LKD+ +A PNV+GFV G LQ+ LY+++K  K   D+V+++              LE 
Sbjct  185  GLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKE--------------LE-  229

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEK  895
                      ++KLPE++    ID++KLGTLV S +
Sbjct  230  ----------AAKLPEVS----IDMLKLGTLVASPE  251



>ref|XP_008392764.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=283

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 180/261 (69%), Gaps = 14/261 (5%)
 Frame = +2

Query  110  GNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTTLLITI  289
            GNI+SFIVFL+PLPTF+++YKKKSTEG+QS+PYV ALFSAM+WIYYAF+K++   LLITI
Sbjct  3    GNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSH-VILLITI  61

Query  290  NSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMRAHVVG  469
            NSFG  IETIY+  ++ Y+TK  RV T++ L L   GGF  ILL + FL +   R  V+G
Sbjct  62   NSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFLSQGPTRVEVLG  121

Query  470  WICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKDMNIAVP  649
            W+C+ FS+ VF APL ++R VIRTKSVE MP  LS FLTLSAVMW  YGL LKD+ +A P
Sbjct  122  WVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLLKDLYVATP  181

Query  650  NVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE-----------VTALPKPVIILEDNNG  796
            N+LGF FG++Q+ LY  Y++ K  V  E+KLPE           +T  P+  + ++    
Sbjct  182  NILGFSFGVVQMALYAKYRNTKTIV--EEKLPEHKADVVKQIKILTTTPEVEVQVQAPVT  239

Query  797  TNTNDKRSSKLPELTEEQIID  859
            ++TN   + +  E   +Q + 
Sbjct  240  SDTNSTDAHQNSERGTDQYVH  260



>sp|A2X5B4.1|SWT15_ORYSI RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Indica Group]
 gb|EAY86024.1| hypothetical protein OsI_07385 [Oryza sativa Indica Group]
Length=319

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 157/217 (72%), Gaps = 1/217 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M++    WAF FG+LGN+IS +VFLSPLPTFY++Y+KKSTEG+QS PYVV LFS MLW+Y
Sbjct  4    MSMERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMY  63

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK+    LL+TIN  G  IET+Y+  ++ Y+ K  R+ T K L     G FG I L 
Sbjct  64   YAFVKSG-AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALV  122

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T  L + E+R HV+GWIC+  SL VF APL I+R VIRTKSVE MP  LS FL LSAV+W
Sbjct  123  TLLLSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIW  182

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK  715
            F YGL  KD+ +A+PNVLGFVFG+ Q+ LYM Y+  K
Sbjct  183  FLYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKK  219



>ref|XP_002321730.2| N3 like family protein [Populus trichocarpa]
 gb|EEF05857.2| N3 like family protein [Populus trichocarpa]
Length=269

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 178/256 (70%), Gaps = 15/256 (6%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W F FG+LGNIIS +V L+PLPTFYQ+ KKK+++G+QSIPYV+ALFSAMLW++YA    N
Sbjct  7    WVFGFGLLGNIISCLVCLAPLPTFYQICKKKTSQGFQSIPYVIALFSAMLWLFYASFSEN  66

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
               LLITINSF  F+E  Y+  ++ Y+TKK ++ T K L LF   GFG I   +  L + 
Sbjct  67   -AMLLITINSFAFFMEIGYIAVYLFYATKKDKILTFKLLLLFNIFGFGLICALSLLLTEG  125

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
              R HV+GWIC+VF+LCVFVAPL ++R+VIRTKSVE MP  LS FLTLSAVMWFFYG   
Sbjct  126  TKRVHVLGWICMVFALCVFVAPLGVVRKVIRTKSVEFMPFALSFFLTLSAVMWFFYGYLK  185

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVT---------ALPKPVII  778
            KD  +A+PN+LGF+FGILQ+ LY++Y++ KK+ V E +  E++         A+PK    
Sbjct  186  KDKFVAIPNILGFIFGILQMVLYLIYRNPKKNEVAEPRTQELSEQYCSDINIAMPK----  241

Query  779  LEDNNGTNTNDKRSSK  826
              +  G    +  S+K
Sbjct  242  -LNEGGNEVFEAHSAK  256



>ref|XP_002511126.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51728.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 173/225 (77%), Gaps = 2/225 (1%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T +   F FG+LGNI+SF+VFL+P+PTF ++ KKKSTEG+QS PYVV+LFSAMLW+YYA 
Sbjct  6    THNPSVFVFGLLGNIVSFVVFLAPVPTFLRVCKKKSTEGFQSFPYVVSLFSAMLWLYYAS  65

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
            +K+ D  LLITINS G  IETIY+  FI Y+ K+ R+ T+K L L   GGF  ILL + F
Sbjct  66   LKS-DAFLLITINSVGCLIETIYITLFITYAPKQARITTLKILLLLNFGGFCLILLLSHF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++GW+C++FS+ VF APL ++R VIRTKSVE MP  LS FLTLSA+MW FY
Sbjct  125  LAKGSERATILGWVCVIFSVSVFAAPLSVMRIVIRTKSVEFMPFYLSFFLTLSAIMWLFY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
            GL LKD+ IAVPN+LG VFG+LQ+ LY++YK+  K VV+E KLPE
Sbjct  185  GLLLKDLYIAVPNILGLVFGVLQMILYVIYKN-VKTVVEEPKLPE  228



>ref|XP_010442555.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X1 [Camelina sativa]
 ref|XP_010442556.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X2 [Camelina sativa]
Length=288

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 195/317 (62%), Gaps = 36/317 (11%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    A  FG+LGNIISF V L+P+PTF ++YK+KS+EGYQS+PYV++LFSAMLW+Y
Sbjct  1    MAISQAVLATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  +LITINSF   ++ +Y+  +  Y+ KK ++ T+K +       FG I L 
Sbjct  61   YAMIK-KDAMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKCVLFVDVFAFGLIFLL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL     R  V+G+IC+VFSL VFVAPL I+R+VI+TKS E MP  LS FLTLSA+MW
Sbjct  120  TYFLTHGNKRVQVLGYICMVFSLSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD NIA+PNVLGF+FG+LQ+ L+++YK            P    L   VI L+
Sbjct  180  FFYGLLLKDKNIALPNVLGFIFGVLQMILFVIYKK-----------PGTKVLEPSVIKLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI-----QKSAAAAS--PFDKNPA  943
            D                   E ++D+V+L ++VC+ ++     Q SA        D+   
Sbjct  229  D-----------------ISEHVVDVVRLSSMVCNSQMRTLVPQDSADMEDTIDLDEKIK  271

Query  944  ATAPKLQAVEA*LLNRR  994
                K+   EA L+++ 
Sbjct  272  GDIEKINNKEAFLISKN  288



>ref|NP_001046944.1| Os02g0513100 [Oryza sativa Japonica Group]
 sp|Q6K602.1|SWT15_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Japonica Group]
 dbj|BAD23245.1| putative nodulin 3 [Oryza sativa Japonica Group]
 dbj|BAF08858.1| Os02g0513100 [Oryza sativa Japonica Group]
 dbj|BAG95984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57067.1| hypothetical protein OsJ_06889 [Oryza sativa Japonica Group]
Length=319

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 157/217 (72%), Gaps = 1/217 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M++    WAF FG+LGN+IS +VFLSPLPTFY++Y+KKSTEG+QS PYVV LFS MLW+Y
Sbjct  4    MSMERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMY  63

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK+    LL+TIN  G  IET+Y+  ++ Y+ K  R+ T K L     G FG I L 
Sbjct  64   YAFVKSG-AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALV  122

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T  L + E+R HV+GWIC+  SL VF APL I+R VIRTKSVE MP  LS FL LSAV+W
Sbjct  123  TLLLSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIW  182

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK  715
            F YGL  KD+ +A+PNVLGFVFG+ Q+ LYM Y+  K
Sbjct  183  FLYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKK  219



>emb|CDY05867.1| BnaC08g20440D [Brassica napus]
Length=289

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 186/266 (70%), Gaps = 19/266 (7%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG++GN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+YYA 
Sbjct  6    THNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ Y+ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLPEVT------  754
            GL LKD+ +A PNV+GF  G LQ+ LY++YK        G+K+ V+  KLPEVT      
Sbjct  185  GLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTPPHLGEKE-VEAAKLPEVTLDMLKL  243

Query  755  ---ALPKPVI-ILEDNNGTNTNDKRS  820
               + P+ +  + + N  T  ND+R+
Sbjct  244  GTVSSPETITAVRQANKCTCGNDRRA  269



>ref|XP_006366913.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=357

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H   F FG+LGN++SF+VF++P+PTFY++ KKKS+EG+ S+PYVV LFSAMLWIYYA VK
Sbjct  8    HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N  TLLITINSFG   ETIYV  +  Y+TKK R++T+  + L   G FG IL  TQ L 
Sbjct  68   TN-VTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILC  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            +   RA V+GWIC+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LT+SAVMWF YGL
Sbjct  127  QGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK-KDVVKEQKLPEV  751
             LKD  +AVPN+ G + G+LQ+ LY +Y++ K  +V  E++LP V
Sbjct  187  LLKDFYVAVPNISGMILGVLQMILYGIYRNSKSNNVATEKELPTV  231



>ref|XP_010454652.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 191/274 (70%), Gaps = 22/274 (8%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T + WAF FG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QS+PYVVALFSA LW
Sbjct  1    MALFDTHNTWAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA  +  D  LL+TIN FG FIETIY+  F+ ++TKK R+ T+K L L   GGF AIL
Sbjct  61   LYYA-TQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L  QFL K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV
Sbjct  120  LLCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAV  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ----KLPE----  748
            +W  YGL LKD+ +A PNV+GFV G LQ+ LY++YK  K   ++V+++    KLP+    
Sbjct  180  IWLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELETAKLPDEVSI  239

Query  749  -------VTALPKP--VIILEDNNGTNTNDKRSS  823
                   + A P+P  + ++   N  N ND+++ 
Sbjct  240  DMLKLGTLIASPEPAAITVVRPVNMCNCNDRKAD  273



>ref|XP_009337947.1| PREDICTED: bidirectional sugar transporter NEC1-like [Pyrus x 
bretschneideri]
Length=267

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/261 (51%), Positives = 176/261 (67%), Gaps = 9/261 (3%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            L   Q AF FG+LGNI+SF+VFL+P+PTFY +YKKKS++G+QSIPYVVAL SA L +YY 
Sbjct  4    LNTEQLAFIFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLLYYG  63

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
             +K N   L+++IN  GI IE  Y++ +I Y++KK ++ T+  + L     FG +L  T 
Sbjct  64   VLKTN-AYLIVSINGIGIVIEVTYLILYIVYASKKDKITTLSLILLVNVATFGLVLAVTV  122

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL     R   VGWIC VF++ VF APL I+RQVIRTKSVE MP  LS+FLTL A MWFF
Sbjct  123  FLLGGTARICAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFF  182

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALP---KPVIIL  781
            YGLF KD  IA+PNVLGF+FG+ Q+ LYM YK+  KDV  ++   E+  L    +P    
Sbjct  183  YGLFTKDYYIALPNVLGFLFGVAQMILYMTYKNSGKDVEAKKSTMEMKKLSFTNRP----  238

Query  782  EDNNGTNTNDKRSSKLPELTE  844
             +  G+ + + RS +L + T+
Sbjct  239  -NLTGSVSKNPRSDELKQTTD  258



>ref|XP_009149800.1| PREDICTED: bidirectional sugar transporter SWEET11 [Brassica 
rapa]
Length=289

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 140/265 (53%), Positives = 184/265 (69%), Gaps = 17/265 (6%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG++GN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+YYA 
Sbjct  6    THNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ Y+ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK------KDVVKEQKLPEVT-------  754
            GL LKD+ +A PNV+GF  G LQ+ LY++YK  K      +  V+  KLPEVT       
Sbjct  185  GLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTPPHLEEKEVEAAKLPEVTLDMLKLG  244

Query  755  --ALPKPVI-ILEDNNGTNTNDKRS  820
              + P+ +  + + N  T  ND+R+
Sbjct  245  TVSSPETITAVRQANKCTCGNDRRA  269



>ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix 
dactylifera]
Length=296

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FG+LGNIISF+V+++PLPTFY++Y KKSTEG+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPWAFTFGILGNIISFMVYVAPLPTFYRVYIKKSTEGFQSVPYVVALFSAMLWIYYALIK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D+ LL+TINS G  IET+Y++ ++ Y+ KK R+ T + L L   G FG I+L T  L 
Sbjct  68   -TDSYLLVTINSIGCIIETMYIIMYLSYAPKKARIFTAQILLLLNVGLFGLIVLLTLLLA  126

Query  440  KS-EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYG  616
            K    +  V+GW+C+ FS+ VFVAPL I+R VIRTKSVE MP  LS FLTLSA+ WF YG
Sbjct  127  KGPREQVRVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTLSAIAWFSYG  186

Query  617  LFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
            L  KD+ +A+PN+LGF+FG++Q+G+Y+ YK  K+    + K+ E
Sbjct  187  LLTKDIYVALPNILGFIFGVVQMGIYIAYKGAKRAAYDQNKVAE  230



>ref|XP_006493252.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X1 [Citrus sinensis]
Length=290

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 190/247 (77%), Gaps = 6/247 (2%)
 Frame = +2

Query  92   FAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDT  271
            F   ++GNI+SFIVFL+P+PTFY++ KKKSTEG+QS+PYVVALFSAMLWIYYA +K  D 
Sbjct  17   FHVTIIGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMK-KDA  75

Query  272  TLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFK-SE  448
             LLITIN+FG  IETIY+  +I ++ K+ R+ T++ L L   GGFG+ILL + FL K S 
Sbjct  76   FLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSA  135

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             R  ++GWIC+VFS+ VF APL I+R V+RTKSVE MP  LS+FLTL+AVMWFFYGLFLK
Sbjct  136  ARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLK  195

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE-QKLPEVTALPKPVIILEDNNGTNT  805
            D+ +AVPNVLGF+FG++Q+ LY +Y++ ++ VV++  K+PE T     V+ L  NN T +
Sbjct  196  DVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTV---DVVKLSTNNMTAS  252

Query  806  NDKRSSK  826
             ++ +S+
Sbjct  253  EEQTNSR  259



>emb|CDY08093.1| BnaA06g16330D [Brassica napus]
Length=289

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 140/265 (53%), Positives = 184/265 (69%), Gaps = 17/265 (6%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG++GN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+YYA 
Sbjct  6    THNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG FIETIY+  F+ Y+ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK------KDVVKEQKLPEVT-------  754
            GL LKD+ +A PNV+GF  G LQ+ LY++YK  K      +  V+  KLPEVT       
Sbjct  185  GLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTPPHLEEKEVEAAKLPEVTLDMLKLG  244

Query  755  --ALPKPVI-ILEDNNGTNTNDKRS  820
              + P+ +  + + N  T  ND+R+
Sbjct  245  TVSSPETITAVRQANKCTCGNDRRA  269



>ref|XP_006647263.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Oryza 
brachyantha]
Length=319

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 172/261 (66%), Gaps = 12/261 (5%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            +++  + WAF FG+LGNIIS +VFLSPLPTFY++Y+KKSTEG+QS PYVV LFS MLW+Y
Sbjct  4    LSMERNTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMY  63

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YAFVK+    LL+TIN  G  IET+Y+  ++ Y+ K TR+ T + L     G FG I L 
Sbjct  64   YAFVKSG-AELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIALV  122

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T  L +  +R HV+GW+C+  SL VF APL I+R VIRTKSVE MP  LS FL LSAV+W
Sbjct  123  TLLLPQGALRVHVLGWVCVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIW  182

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVV--------KEQKLPEVTAL  760
            F YGL  KD+ +A+PNVLGFVFG+ Q+ LYM Y+  K            +E KLPE    
Sbjct  183  FGYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRTKKPPASSSSSAAAGQEIKLPEHV--  240

Query  761  PKPVIILEDNNGTNTNDKRSS  823
             K V  +    G    + R+S
Sbjct  241  -KEVTTIVAKAGAAPPEGRAS  260



>emb|CDY16863.1| BnaA09g05190D [Brassica napus]
Length=277

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 193/277 (70%), Gaps = 32/277 (12%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QS+PYVVALFSAMLW+YYA 
Sbjct  6    THNTWAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG  IETIY+  F+ ++TK+ R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+TKSV+ MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVKYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQKLPEVTALPKPVIILED  787
            GL LKD+ +A PNV+GFV G LQ+ LY+++K  K   D+V+++              LE 
Sbjct  185  GLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKE--------------LE-  229

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
                      ++KLPE++    ID++KLGTLV S ++
Sbjct  230  ----------AAKLPEVS----IDMLKLGTLVGSPEL  252



>ref|XP_006281748.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
 gb|EOA14646.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
Length=290

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 183/279 (66%), Gaps = 29/279 (10%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    A  FG+LGN+ISF V L+P+PTF ++YK+KS+EGYQS+PYV++LFSAMLW+Y
Sbjct  1    MAISQAVLATVFGILGNVISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K  D  +LITINSF   I+ +Y+  F  Y+ KK ++ T+KF+       FG I  +
Sbjct  61   YAMIK-KDAVMLITINSFAFVIQIVYISLFFFYAPKKDKILTVKFVLFVDVFAFGLIFFS  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T F      R  V+G+IC+VF+L VFVAPL I+R+VI+TKS E MP  LS FLTLSAVMW
Sbjct  120  TYFPIHGNKRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            FFYGL LKD NIA+PNVLGF+FG+LQ+ L+++YK            P    L   VI L+
Sbjct  180  FFYGLLLKDKNIALPNVLGFIFGVLQMVLFVIYKK-----------PGTKVLEPSVIKLQ  228

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQ  901
            D                   E ++D+V+L ++VC+ +++
Sbjct  229  D-----------------ISEHVVDVVRLSSMVCNSQMR  250



>emb|CDX87161.1| BnaC09g04760D [Brassica napus]
Length=277

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 193/277 (70%), Gaps = 32/277 (12%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QS+PYVVALFSAMLW+YYA 
Sbjct  6    THNTWAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TINSFG  IETIY+  F+ ++TK+ R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKKDVFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQKLPEVTALPKPVIILED  787
            GL LKD+ +A PNV+GFV G LQ+ LY+++K  K   D+V+++              LE 
Sbjct  185  GLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKE--------------LE-  229

Query  788  NNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKI  898
                      ++KLPE++    I+++KLGTLV S ++
Sbjct  230  ----------AAKLPEVS----INMLKLGTLVGSPEL  252



>ref|XP_010493487.1| PREDICTED: bidirectional sugar transporter SWEET12 [Camelina 
sativa]
Length=289

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 147/279 (53%), Positives = 190/279 (68%), Gaps = 29/279 (10%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T + WAF FG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QS+PYVVALFSA LW
Sbjct  1    MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA  +  D  LL+TIN FG FIETIY+  F+ ++TKK R+ T+K L L   GGF AIL
Sbjct  61   LYYA-TQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L  QFL K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV
Sbjct  120  LLCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAV  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVII  778
            +W  YGL LKD+ +A PNV+GFV G LQ+ LY++YK  K                 P  +
Sbjct  180  IWLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCK----------------TPSEL  223

Query  779  LEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEK  895
            +E        +  ++KLP   +E  ID++KLGTL+ S +
Sbjct  224  VE-------KELETAKLP---DEVSIDMLKLGTLIASPE  252



>ref|XP_010421173.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 189/273 (69%), Gaps = 22/273 (8%)
 Frame = +2

Query  65   MAL--TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL  T + WAF FG+LGN+ISF VFLSP+PTFY++ KKK+TEG+QS+PYVVALFSA LW
Sbjct  1    MALFDTHNTWAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA  +  D  LL+TIN FG FIETIY+  F+ ++TKK R+ T+K L L   GGF AIL
Sbjct  61   LYYA-TQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAIL  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L  QFL K   RA ++G IC+ FS+CVF APL I+R VI+TKSVE MP  LS+ LT+SAV
Sbjct  120  LLCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAV  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK--KDVVKEQ------------  736
            +W  YGL LKD+ +A PNV+GFV G LQ+ LY++YK  K   ++V+++            
Sbjct  180  IWLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELETAKLHDEVSI  239

Query  737  ---KLPEVTALPKP--VIILEDNNGTNTNDKRS  820
               KL  + A P+P  + ++   N  N ND+++
Sbjct  240  DMLKLGTLIASPEPAAITVVRPVNMCNCNDRKA  272



>ref|XP_007038078.1| Medicago truncatula MTN3, putative [Theobroma cacao]
 gb|EOY22579.1| Medicago truncatula MTN3, putative [Theobroma cacao]
Length=285

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 187/282 (66%), Gaps = 5/282 (2%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H W    G+LGNI+SF+V+L+PLPTF ++Y+KKSTEG+QSIPYVVAL SA LWIYYA +K
Sbjct  4    HPWIIVSGILGNILSFMVYLAPLPTFLRVYRKKSTEGFQSIPYVVALVSAALWIYYATLK  63

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            +N   LL+TINSFG F+ETIY V FI Y+ KK R+ TMK L LF  GG   ILL T F  
Sbjct  64   SN-AFLLMTINSFGCFVETIYTVVFIIYAPKKARILTMKLLLLFNFGGLLLILLLTHFFS  122

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            K   R H+VGW C+V S  VF APL I+R V+RTKSVE MP  LS FLTLSA+MW  YG+
Sbjct  123  KGPSRIHIVGWFCVVSSAGVFAAPLSIMRLVVRTKSVEFMPFALSFFLTLSAIMWLIYGV  182

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             LKD  I++PN++G V G++Q+ L+++YK  K    ++++LP   A  K +  ++ +N T
Sbjct  183  LLKDFYISLPNIIGVVLGMIQMVLFVVYKKYKNIENEQKQLPVQVANGKNLAPIKASNNT  242

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASP  925
            +++ + S  +    +E   D      L  S K  +S   A P
Sbjct  243  DSSLQVSGDVGVGRDENPHD----HPLQHSHKSMESTNQAEP  280



>ref|XP_008239523.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=296

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 167/217 (77%), Gaps = 4/217 (2%)
 Frame = +2

Query  95   AFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTT  274
            AFG+LGN++SF+VFL+P+PTF+++YKKKSTEG+QS+PYV ALFSAM+WIYYAF+K+ D  
Sbjct  13   AFGILGNVVSFVVFLAPVPTFWRIYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKS-DEF  71

Query  275  LLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMR  454
            LLITIN+FG  IETIY+  +I Y+ K+ RV  ++ L L   GGF  ILL + FL +   R
Sbjct  72   LLITINAFGCIIETIYISMYITYAPKQARVFALRLLLLVNFGGFCLILLLSHFLAQGPTR  131

Query  455  AHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKDM  634
              V+GW+C+ FS+ VF APL I+R VIRTKS   MP  LS FLTLSAVMW FYGL LKD+
Sbjct  132  VEVLGWVCVAFSVSVFAAPLSIMRVVIRTKS---MPFSLSFFLTLSAVMWLFYGLLLKDL  188

Query  635  NIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLP  745
             +A PN+LGF FG+ Q+ LY +Y++ K  +V++QKLP
Sbjct  189  YVACPNILGFTFGVAQMILYAIYRNKKTVLVEDQKLP  225



>emb|CDY69440.1| BnaCnng63490D, partial [Brassica napus]
Length=214

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++       FG+LGNIISF+V L+P+PTF ++YK+KS+EGYQSIPYV+ALFSAMLWIY
Sbjct  1    MAVSIDVLRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA +K N   ++ITIN+  + I+  Y+ F++ Y+ KK +  T+KF+       FG I   
Sbjct  61   YAMIKTN-VVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFL  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T FL   + R  ++G+IC+VFSLCVFVAPL I+R+VI+T+S E MP  LS FLTLSAVMW
Sbjct  120  TYFLLHGQKRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD  709
            FFYGL LKDMNIA+PNVLGF+FG+LQ+ LYM+YK 
Sbjct  180  FFYGLLLKDMNIALPNVLGFIFGVLQMILYMIYKK  214



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 179/291 (62%), Gaps = 13/291 (4%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FG+LGNIIS +VFLSPLPTFY++Y+KKSTEG+QS PYVV LFS +LW+YYAF+K
Sbjct  9    HTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLLWMYYAFLK  68

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            +    LL+TIN  G  IET+Y+  ++ Y+ K  R+ T K       G FG I L T  + 
Sbjct  69   SG-AELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIALVTMLVS  127

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
               +R  +VGWIC+  +L VF APL I+R VIRTKSVE MP+ LS FL LSAV+WF YGL
Sbjct  128  AGTLRVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAVIWFAYGL  187

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVV---KEQKLPEVTALPKPVIILEDN  790
              KD+ +AVPNVLGFVFG+ Q+ LYM Y++    +    +E KLPE     K V      
Sbjct  188  LKKDVFVAVPNVLGFVFGVAQMALYMAYRNKSPAITVVHQEMKLPEHV---KEVTTNTKL  244

Query  791  NGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEK--IQKSAAAASPFDKN  937
             G  T  + S       E   ID++       +++  I    AAA   D N
Sbjct  245  GGAPTEGRISCG----AEVHPIDVMPTSAAAGADEQAINVEEAAAGRDDHN  291



>ref|XP_004302124.1| PREDICTED: bidirectional sugar transporter NEC1-like [Fragaria 
vesca subsp. vesca]
Length=257

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 158/216 (73%), Gaps = 2/216 (1%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T  Q AF+FG+LGNI+SF+VFL+P+PTFY++YKKKS+EG+QSIPYVVAL SAML +YY  
Sbjct  5    TTEQLAFSFGLLGNIVSFMVFLAPMPTFYRIYKKKSSEGFQSIPYVVALLSAMLLLYYGV  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
            +K N   L+I+IN+FGI IE  Y++F++ Y+ KK R+ T+  + L        +   T F
Sbjct  65   IKTN-AILIISINAFGIVIEVAYLIFYLTYAPKKQRIFTLNLILLVNVAFGLTLAA-TIF  122

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L     R   VGWIC VF++ VF APL I+R+VIRTKSVE MP  LS+FLTL A  WFFY
Sbjct  123  LLSGTKRVAAVGWICAVFNIAVFAAPLSIMREVIRTKSVEFMPFGLSLFLTLCATTWFFY  182

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKD  721
            GLF KD  IA+PNVLGF+FGI Q+ LYM+Y++  KD
Sbjct  183  GLFTKDYYIALPNVLGFLFGIAQMILYMVYRNSGKD  218



>ref|XP_006663471.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Oryza 
brachyantha]
Length=310

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 162/210 (77%), Gaps = 1/210 (0%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAFAFG+LGNIISF+ +L+PLPTFY++YK KST+G+QSIPYVVALFSAMLWIYYA +K
Sbjct  8    HPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             +D  LLITINS G  IET+Y+  ++ Y+ KK RV T + L L   G FG ILL T  L 
Sbjct  68   -SDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLLLLVNVGVFGLILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R  V+GW+C+ FS+ VFVAPL I+R V+RTKSVE MP  LS+ LT+SAV+WF YGL
Sbjct  127  AGPRRVVVLGWVCVGFSVSVFVAPLSIMRLVVRTKSVEFMPFSLSLSLTVSAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKD  709
             +KD  +A+PNVLGF FG++Q+GLY MY++
Sbjct  187  LIKDKYVALPNVLGFTFGVIQMGLYAMYRN  216



>ref|XP_003576036.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Brachypodium 
distachyon]
Length=300

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 195/295 (66%), Gaps = 25/295 (8%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAFAFG+LGN+ISF+ +L+PL TFY++YK KST+G+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPWAFAFGLLGNVISFMTYLAPLSTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             +D  LLITIN+ G  IETIY+V ++ Y+ K+ ++ T K L L   G FG ILL T  L 
Sbjct  68   -SDGCLLITINTAGCVIETIYIVVYLAYAPKQAKLFTAKILLLLNVGVFGMILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
            + E R  ++GW+C+ FS+ VFVAPL ++R V+RT+SVE MP  LS+ LTLSAV+WF YGL
Sbjct  127  EGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFNLSLSLTLSAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             +KD  +A+PN+LGF FG++Q+GLY +Y++               + P+PV    D    
Sbjct  187  LIKDKYVALPNILGFAFGVIQMGLYALYRN---------------STPRPVTKEVD---A  228

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGT--LVCSEKIQKSAAAASPFDKNPAATAPK  958
             ++D  + K+P    E +++I KLG   L  +E     A  + P  +N  A   +
Sbjct  229  ESHDGAAPKVP----EHVVNIGKLGAVELKTTEVFIHPAIESPPTKENGVAHGAE  279



>ref|XP_010426372.1| PREDICTED: bidirectional sugar transporter SWEET11 [Camelina 
sativa]
Length=292

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 192/282 (68%), Gaps = 20/282 (7%)
 Frame = +2

Query  62   TMALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWI  241
            T+  T + WAF FG+LGN+ISF VFLSP+PTFY+++KKK+TEG+QS+PYVVALFSA LW+
Sbjct  2    TLLNTENTWAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWL  61

Query  242  YYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaill  421
            YYA  +  D  LL+TIN+FG FIETIY+  F+ Y+ K  R+ T+K L L   GGF  ILL
Sbjct  62   YYA-TQKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCIILL  120

Query  422  aTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
              QFL K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SAV+
Sbjct  121  ICQFLVKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI  180

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD-------GKKDVVKEQKLP-EVT-  754
            W  YGL LKD+ +A PNV+GF  G LQ+ LY++YK        G+K+ V+  KLP EVT 
Sbjct  181  WLLYGLALKDIYVAFPNVIGFGLGALQMILYIVYKYCKTSPHLGEKE-VEAAKLPAEVTL  239

Query  755  --------ALPKPV-IILEDNNGTNTNDKRSSKLPELTEEQI  853
                    + P+P  ++ + N  T  ND+R+  + +  +  I
Sbjct  240  DMLKLGTISSPEPAPLVRQANKCTCGNDRRAEMIEDGRQTPI  281



>gb|EAY83053.1| hypothetical protein OsI_38270 [Oryza sativa Indica Group]
 gb|AGS56391.1| disease susceptible protein Xa25 [Oryza sativa Indica Group]
Length=293

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 179/260 (69%), Gaps = 20/260 (8%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAFAFG+LGN+ISF  +L+P+PTFY++YK KSTEG+QS+PYVVALFSAMLWI+YA +K
Sbjct  8    HPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALIK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            +N+  LLITIN+ G  IETIY+V ++ Y+ KK +V T K L L   G FG ILL T  L 
Sbjct  68   SNEA-LLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              E R   +GW+C+ FS+ VFVAPL I+++VI+++SVE MP  LS+ LTLSAV+WF YGL
Sbjct  127  HGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMY----------KDGKKDVVKEQKLPEVTALPKP  769
             +KD  +A+PN+LGF FG++Q+GLY+ Y          K+GK  +   ++LP        
Sbjct  187  LIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEELP--------  238

Query  770  VIILEDNNGTNTNDKRSSKL  829
             +IL       T D+ S  +
Sbjct  239  -VILNVGKLAGTPDRSSGAV  257



>ref|XP_004501816.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cicer 
arietinum]
Length=262

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/284 (47%), Positives = 186/284 (65%), Gaps = 34/284 (12%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AF FG+LGN ISF+VFL+P+PTFYQ+YKKKSTEG+QSIPYVVAL SAMLWIYYA  K   
Sbjct  9    AFIFGILGNAISFMVFLAPVPTFYQIYKKKSTEGFQSIPYVVALLSAMLWIYYALAKREH  68

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
            + LL+TIN+FG+ +E++Y+  F+  ++ K R+ T+K L L    GFG ++++T +L K+ 
Sbjct  69   SFLLLTINTFGVGVESLYIAIFLVCASHKARLSTIKLLVLCNVFGFGGMVVSTLYLTKAS  128

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             R  ++GW+CLVF++ VF +PL I+++VI T+SV  MP+ LS FL+L+A+MWFFYG  L 
Sbjct  129  ERISIIGWVCLVFNIGVFASPLGIIKKVIETRSVAFMPLSLSFFLSLNAIMWFFYGFLLN  188

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTN  808
            D  IA+PN LGF+FGI+Q+ +Y++YK                               N+N
Sbjct  189  DYYIALPNTLGFLFGIVQMVIYLIYK-------------------------------NSN  217

Query  809  DKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNP  940
            +    KL EL    IIDIVK+GT   +  I      A+  D+NP
Sbjct  218  EVDPKKLQEL-NGHIIDIVKMGT--NTMVISGPNQVANSGDENP  258



>gb|KDP22573.1| hypothetical protein JCGZ_26404 [Jatropha curcas]
Length=285

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 180/267 (67%), Gaps = 31/267 (12%)
 Frame = +2

Query  92   FAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDT  271
            F FGVL NIIS +V L+PLPTFYQ+ KKK++EG+QSIPYV+ALFSAMLW++YA +  N+ 
Sbjct  9    FIFGVLANIISAMVCLAPLPTFYQICKKKTSEGFQSIPYVIALFSAMLWLFYA-IFDNNA  67

Query  272  TLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEM  451
            TLLITIN+F  F+E  Y++ ++ Y+TK  R+ T+K +  F   GFG I + T FL     
Sbjct  68   TLLITINTFTFFMEICYIIVYLIYATKNDRMFTIKLVLFFNVFGFGTICILTLFLTHGRK  127

Query  452  RAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLKD  631
            R  V+GWIC+VF+LCVFVAPL I+R+VI+TKSVE MP  LS FLTL+AVMWFFYG   KD
Sbjct  128  RVDVLGWICMVFALCVFVAPLGIMRKVIKTKSVEFMPFSLSFFLTLTAVMWFFYGFLKKD  187

Query  632  MNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTND  811
            + +AVPN LGF+FGI+Q+ +Y++Y+  +K  V+E KL E++                   
Sbjct  188  IYVAVPNTLGFLFGIIQMVIYLIYRKPQKLTVEEPKLRELS-------------------  228

Query  812  KRSSKLPELTEEQIIDIVKLGTLVCSE  892
                       + I+D+ KL   +CSE
Sbjct  229  -----------DHIVDVAKLSATLCSE  244



>ref|XP_008441812.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
melo]
Length=262

 Score =   243 bits (619),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 177/259 (68%), Gaps = 7/259 (3%)
 Frame = +2

Query  68   ALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYY  247
             L+AHQ  F FG+LGNIISF+VFL+P+PTF+ +YKKK++EG+QSIPYVVAL SAML +YY
Sbjct  3    GLSAHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLLYY  62

Query  248  AFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaT  427
            A +K  D  LLI+INSFG  IE IY+  ++ Y+ KK ++ T+K   +F  G  G ++  T
Sbjct  63   AALK-TDAYLLISINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGCSGVMVGGT  121

Query  428  QFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWF  607
                    R + VGWIC  F+L VF +PL I+++VIRTKSVE MP  LS FLTLSA MWF
Sbjct  122  MVFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVIRTKSVEYMPFFLSFFLTLSATMWF  181

Query  608  FYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILED  787
            FYG F+KD+ IA+PNV+GF+ G++Q+ +YM+YKD K  V  E+KL E     +     +D
Sbjct  182  FYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDRKGKV--EEKLDEGAKFWEE----DD  235

Query  788  NNGTNTNDKRSSKLPELTE  844
             N +    +R +K   + E
Sbjct  236  QNLSIVKTQRETKEINMAE  254



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 158/227 (70%), Gaps = 5/227 (2%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
              WAF FG+LGNIIS +VFLSPLPTFY++Y+KKSTEG+QS PYVV LFS MLWI+YA +K
Sbjct  9    QTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYALLK  68

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
                 LL+TIN  G  IET+Y+  ++ Y+ +  RV T K L     G FG + L T  L 
Sbjct  69   -TGAVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVSLVTMVLS  127

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
               +R HV+GWIC+  +L VF APL I+RQVIRTKSVE MP  LS FL LSAV+WF YG 
Sbjct  128  NGNLRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAVIWFAYGA  187

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKD----VVKEQKLPE  748
              KD+ +A PNVLGFVFG+ Q+ LYM Y++ K      +V+E KLPE
Sbjct  188  LKKDVFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVKLPE  234



>ref|XP_009403777.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 167/223 (75%), Gaps = 2/223 (1%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FG+LGNIISF+V+L+PLPTFY++Y+ KSTEG+QS+PYVVALFSAMLW+ YAF+K
Sbjct  8    HPWAFTFGILGNIISFMVYLAPLPTFYRVYRGKSTEGFQSVPYVVALFSAMLWVLYAFLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              D  LLITINSFG  IE++YVV +  Y+ K  ++ T K + +   G FG+ILL T  L 
Sbjct  68   -TDAFLLITINSFGCVIESVYVVLYFTYAPKLAKILTAKLVLVLNVGMFGSILLLTLLLP  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R  V+GWIC+ FS+ VFVAPL I+R VIRTKSVE MP +LS FLTLS+++WF YG 
Sbjct  127  DGLKRVRVLGWICMCFSVSVFVAPLSIIRLVIRTKSVEFMPFMLSFFLTLSSIVWFAYGC  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
              KD  +A+PNVLGF FG+LQ+GLY+ +K  K   V E +LPE
Sbjct  187  LTKDKFVALPNVLGFAFGLLQMGLYLAFKCMKPTAV-EPRLPE  228



>ref|XP_004491680.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=257

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 175/260 (67%), Gaps = 8/260 (3%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MA++    AF FG+LGN+ISF+VFL+P+ TFY++YKKKSTE +QS+PY+VALFS+MLW+Y
Sbjct  1    MAISHATLAFGFGMLGNVISFMVFLAPMTTFYRIYKKKSTEQFQSLPYLVALFSSMLWLY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK N+  LLITINSFG  +E IY++ +I Y+ K  R  T+K L     G FG IL  
Sbjct  61   YALVKTNEF-LLITINSFGCLVEIIYILLYITYAPKDARKLTLKLLLAMNMGSFGLILSV  119

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            T +     +R  V+GWIC+  S+ VF APL I+ QV+RTKSVE MP  LS  LTLSA+MW
Sbjct  120  THYAMHGALRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE---QKLPEVTALPKPVI  775
            F YGLFLKD+ IA+PNVLGFV G++Q+ LY +Y++G K    +     L      P    
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLVQMILYGIYRNGNKKATLKTVVSSLENGEVFP----  235

Query  776  ILEDNNGTNTNDKRSSKLPE  835
            + ED+   N N +  +K  E
Sbjct  236  VQEDHEIGNKNKEEKNKSME  255



>sp|Q2QR07.1|SWT13_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET13; Short=OsSWEET13 
[Oryza sativa Japonica Group]
 gb|ABA98216.1| N3 like protein, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ20456.1| hypothetical protein OsJ_36063 [Oryza sativa Japonica Group]
 dbj|BAH01364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGS56390.1| major disease resistance protein xa25 [Oryza sativa Indica Group]
Length=296

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 176/248 (71%), Gaps = 11/248 (4%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAFAFG+LGN+ISF  +L+P+PTFY++YK KSTEG+QS+PYVVALFSAMLWI+YA +K
Sbjct  8    HPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYALIK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            +N+  LLITIN+ G  IETIY+V ++ Y+ KK +V T K L L   G FG ILL T  L 
Sbjct  68   SNEA-LLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              E R   +GW+C+ FS+ VFVAPL I+++VI+++SVE MP  LS+ LTLSAV+WF YGL
Sbjct  127  HGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMY----------KDGKKDVVKEQKLPEVTALPKP  769
             +KD  +A+PN+LGF FG++Q+GLY+ Y          K+GK  +   ++LP V  + K 
Sbjct  187  LIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEELPVVVNVGKL  246

Query  770  VIILEDNN  793
                 D +
Sbjct  247  AAATPDRS  254



>ref|XP_008464392.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=297

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 192/289 (66%), Gaps = 16/289 (6%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            +  + W FAFG+LGNI SFIVFL+P+PTF ++ +KKSTEG+QSIPYVVALFSA+L IYY+
Sbjct  6    MNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALLLIYYS  65

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
             + A D   L+TINS G FIET+Y+  +I Y+ KK R+ T++F+ L    GF +IL+ TQ
Sbjct  66   TLNA-DEFFLMTINSVGCFIETVYIALYIAYAPKKARIFTVRFVLLLDVVGFCSILVVTQ  124

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL K   RA V+G+IC   S+ VF APL I+++VIRT+SVE MP  LS FLTLSAVMW  
Sbjct  125  FLVKRAYRARVIGFICGGLSVSVFAAPLSIMKKVIRTRSVEYMPFSLSFFLTLSAVMWLC  184

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDN  790
            YGLFLKD+ +A+PN LGF FG+ Q+ LY +Y++ K  +  E+KLP+  A  +  I++   
Sbjct  185  YGLFLKDLYVALPNTLGFTFGMAQMILYAIYRNAKP-LPNEEKLPQHKADIETQIVITTT  243

Query  791  NGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKN  937
               +  D+  +      ++Q+I++            Q +A  ASP   N
Sbjct  244  TNPDQGDEHQN------QDQVINV--------PPPPQSNANHASPVCNN  278



>ref|XP_009349481.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/292 (49%), Positives = 182/292 (62%), Gaps = 36/292 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            +A + H  AF FG+LGN+IS +V+LSP+PTFY++Y+KKSTEG+ S+PY+VALFS+MLW Y
Sbjct  4    VADSHHPLAFTFGILGNLISAMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSMLWFY  63

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK N   +LITINSFG F+E IY+V F+ Y+ K+ R  T+K  G+   G F  IL+ 
Sbjct  64   YALVKTN-AMMLITINSFGSFVEIIYIVMFVVYAPKEARKLTVKLFGIMNVGLFTMILIV  122

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            + FL  S  R  ++GWI +  S  VFVAPL I+ QVIRT+SVE MP  LS FLTLSAVMW
Sbjct  123  SHFLVGSAYRVPILGWINVAISTGVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSAVMW  182

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            F YGL LKD+ + +PNVLGFV G+LQI LY + ++      +EQ           VII  
Sbjct  183  FAYGLLLKDICVVIPNVLGFVLGLLQILLYGICRN------REQ-----------VII--  223

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNP  940
                    D    KLP  T E + +IV +  L  SE          P D  P
Sbjct  224  --------DDHEKKLPAATHENVKNIVIIAILAASE--------VHPVDDQP  259



>ref|XP_004138250.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=302

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 187/264 (71%), Gaps = 5/264 (2%)
 Frame = +2

Query  71   LTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYA  250
            +  + W FAFG+LGNI SFIVFL+P+PTF ++ +KKSTEG+QSIPYVVALFSA+L IYY+
Sbjct  6    MNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALLLIYYS  65

Query  251  FVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
             + A D   L+TINS G FIETIY+  +I Y+ KK R+ T++F+ L    GF +IL+ TQ
Sbjct  66   TLNA-DEFFLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSILVVTQ  124

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL K   RA V+G+IC   S+ VF APL I+++VIRT+SVE MP  LS FLTLSAVMW  
Sbjct  125  FLVKRAYRARVIGFICGGLSVSVFAAPLSIMKRVIRTRSVEYMPFSLSFFLTLSAVMWLC  184

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDN  790
            YGLFLKD+ +A+PN LGF FG+ Q+ LY +Y++ K  +  E+KLP+  A  +  I++   
Sbjct  185  YGLFLKDLYVALPNTLGFTFGMAQMILYAIYRNAKP-LPSEEKLPQHKADIETQIVITA-  242

Query  791  NGTNTNDKRSSKLPELTEEQIIDI  862
              TN +D +  +     ++Q+I++
Sbjct  243  TPTNPDDHQGDE--HQNQDQVINV  264



>ref|XP_011023933.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=269

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 167/223 (75%), Gaps = 1/223 (0%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W F FG+LGNIIS +V L+PLPTFYQ+ +KK+++G+QSIPYV+ALFSAMLW++YA    N
Sbjct  7    WVFGFGLLGNIISCLVCLAPLPTFYQICRKKTSQGFQSIPYVIALFSAMLWLFYAIFSEN  66

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
               LLITINSF  F+E  Y+  ++ YSTKK ++ T K L LF   GFG I   T  L + 
Sbjct  67   -AMLLITINSFTFFMEIGYIAVYLFYSTKKDKILTFKLLLLFNIFGFGLICALTLLLTEG  125

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
              R  V+GWIC+VF+LCVFVAPL ++R+VI+TKSVE MP  LS FLTLSAVMWFFYG   
Sbjct  126  IKRVQVLGWICMVFALCVFVAPLGVVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYGYLK  185

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVT  754
            KD  +A+PN+LGF+FG+LQ+ LY++Y++ KK+ V E K  E++
Sbjct  186  KDKFVAIPNILGFIFGMLQMALYLIYRNPKKNEVAEPKTQELS  228



>ref|XP_006291603.1| hypothetical protein CARUB_v10017757mg [Capsella rubella]
 gb|EOA24501.1| hypothetical protein CARUB_v10017757mg [Capsella rubella]
Length=291

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/274 (52%), Positives = 187/274 (68%), Gaps = 22/274 (8%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAF FG+LGN+ISF VFLSP+PTFY+++KKK+TEG+QSIPYVVALFSA LW+YYA 
Sbjct  6    TENTWAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             +  D  LL+TIN+FG FIETIY+  F+ Y+ K  R+ T+K L L   GGF  ILL  Q 
Sbjct  65   TQKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCLILLLCQL  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+CVF APL I+R VI+T+SVE MP  LS+ LT+SA++WF Y
Sbjct  125  LLKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAIIWFLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKD---------GKKDVVKEQKLPEVTAL--  760
            GL LKD+ +A PNVLGF  G LQ+ LY++YK          G+K+ V+  KLPEV  L  
Sbjct  185  GLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTSPHPHLGEKE-VEAAKLPEVVTLDM  243

Query  761  --------PKP-VIILEDNNGTNTNDKRSSKLPE  835
                    P P  ++ + N  T  ND+R +++ +
Sbjct  244  LKLGAVASPDPGHVVRQCNKCTCGNDRRVAEIED  277



>ref|XP_004979336.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=296

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 187/269 (70%), Gaps = 20/269 (7%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H  AFAFG+LGNIISF+ +L+PLPTFY++YK KST+G+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPLAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            +N+  LLITIN+ G  IET+Y+  ++ Y+ KK ++ T K L L   G FG ILL T  L 
Sbjct  68   SNEC-LLITINAAGCVIETLYIAMYLTYAPKKAKLFTAKILLLLNVGVFGLILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              + R  ++GW+C+ FS+ VFVAPL I+RQV+RT+SVE MP  LS+ LT+SAV+WF YGL
Sbjct  127  AGQNRLVILGWVCVGFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYK------------DGKKDVVK-EQKLPEVTAL  760
             +KD  +A+PNVLGF FG++Q+GLY +Y+            D K+D++K  + +  +  L
Sbjct  187  LIKDKYVALPNVLGFSFGVIQMGLYALYRNATPRVPAKEVADDKEDIIKVPEHVVTIAKL  246

Query  761  PKPVIILEDNNGTNTNDKRSSKLPELTEE  847
              P + L+      T++ R  + P + EE
Sbjct  247  GAPAVELK------THEVRPVESPPMEEE  269



>gb|KHG03157.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=286

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 172/230 (75%), Gaps = 4/230 (2%)
 Frame = +2

Query  65   MALTA--HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MAL A  H  A AFGVLGNIIS +V+L+PLPTFY++YKKKSTE +QS+PY VALFS+MLW
Sbjct  1    MALMADHHSLAVAFGVLGNIISVLVYLAPLPTFYRIYKKKSTESFQSLPYQVALFSSMLW  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYA +K     LLITINSFG  +ETIY+  +I Y+TK +RV  +K         F  I+
Sbjct  61   LYYALMK-KGAFLLITINSFGCVVETIYIAIYIAYATKNSRVSAIKLFVAMNVALFSFII  119

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            + T FL K  +R  V+GWIC+  S+ VF APL ++ +VIRTKSVE MP  LS FLTLSAV
Sbjct  120  ILTHFLVKGSIRVQVLGWICVAISVSVFAAPLNVVARVIRTKSVEFMPFNLSFFLTLSAV  179

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
            MWF YGLF+KD+ +A+PNV+GFV G+LQ+ LY +Y++ +K V++E+K+PE
Sbjct  180  MWFAYGLFMKDLCVALPNVIGFVLGMLQMLLYAIYRNSEK-VIEEKKIPE  228



>ref|XP_011042931.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
SWEET10 [Populus euphratica]
Length=273

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 185/267 (69%), Gaps = 8/267 (3%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W F FG+LGNI S  V LSPLPTFYQ+ KKK++EG+QSIPYV+ALF+AMLW++YA  K  
Sbjct  7    WVFGFGLLGNITSCSVCLSPLPTFYQICKKKTSEGFQSIPYVIALFNAMLWLFYAIFK-K  65

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            DT LL+ INSF  F+   Y+V  + ++TKK ++ T K L LF   GFG + L T FL + 
Sbjct  66   DTILLLAINSFAFFMAIGYIVVXLFFATKKDKILTFKLLLLFNVFGFGLVCLLTLFLTQG  125

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
              R  V+GWIC++FSLCVFVAPLFI+R+VI+TKSVE MP  LS FLTLSA+MWF YG   
Sbjct  126  HKRVQVLGWICMIFSLCVFVAPLFIVRKVIKTKSVEFMPFXLSFFLTLSALMWFSYGYLK  185

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKK----DVVKEQKLPEVTALPKPVIILEDNN  793
            KD  +A+PN+LGF+FG+LQ+ LYM+Y++ +K     V+  +KL         ++I + N+
Sbjct  186  KDQFVAIPNILGFIFGLLQMPLYMIYRNPEKVISEHVLDXEKLGPTICSEITIVIPKLND  245

Query  794  GTN--TNDKRSSKLPELTEEQIIDIVK  868
            G N   ND +++K   +   + ID+V 
Sbjct  246  GGNGFVND-QNAKGQAMKIMKAIDVVN  271



>ref|XP_007137872.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
 gb|ESW09866.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
Length=291

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 3/220 (1%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            +F FGVLGN+ SF+ FL+PLPTFY++ KKKSTEG+QS+PYV ALFSAMLWI+YA+VK  +
Sbjct  7    SFLFGVLGNVASFVCFLAPLPTFYRVCKKKSTEGFQSVPYVAALFSAMLWIFYAYVKTGE  66

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
            T LLITINSFG  IETIY+  F+ Y  KK R+ T++ + LF  GGF  I+L T  L K  
Sbjct  67   T-LLITINSFGCVIETIYLAIFLTYCPKKARMSTLRMIVLFNFGGFCTIVLLTHLLAKGA  125

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             R  ++GWIC+VF+  VF APL I+R VIRTKSVE +P  LS+ L LSA+MW  YG+ LK
Sbjct  126  GRVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSMLLLLSAIMWLLYGISLK  185

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
            D+ + +PNV+G  FG++QI LYMMY++ K   +K +KLPE
Sbjct  186  DIYVTLPNVVGLTFGVIQIVLYMMYRNNK--TLKNEKLPE  223



>gb|EMT22394.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=296

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/288 (47%), Positives = 186/288 (65%), Gaps = 27/288 (9%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAF FG+LGN+ISF+ +L+PLPTFY++YK KST+G+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             +D  LLITINS G  IETIY+V ++ Y+ K+ R+ T K L L   G FG ILL T  L 
Sbjct  68   -SDEYLLITINSAGCVIETIYIVLYLAYAHKQARIFTAKILLLLNVGVFGLILLLTLLLT  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              E R  ++GW+C+ FS+ VFVAPL ++R V+RT+SVE MP  LS+ LT SAV+WF YGL
Sbjct  127  AGERRIVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             +KD  +A+PN+LGF FG++Q+GLY +Y++               A P+P     D   +
Sbjct  187  LIKDKYVALPNILGFAFGVIQMGLYALYRN---------------ATPRPAPKEVDAPVS  231

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPA  943
            +    + S       E +++I KLG    + ++        P D  P+
Sbjct  232  DDGAVKPS-------EHVVNIAKLGPAATAIELNTH----YPVDPPPS  268



>dbj|BAJ85621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 188/299 (63%), Gaps = 36/299 (12%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H WAFAFG+LGNIISF   L+P+PTFY+++K KSTEG+QS+PYVVALFSAMLWI+YA VK
Sbjct  8    HPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALVK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
              +  LLITIN+ G  IET+Y++ ++ Y+ +K ++ T K + L    GFG I L T F F
Sbjct  68   TGEG-LLITINAAGCVIETVYIIMYLVYAPRKAKIFTAKIVLLLNVAGFGLIFLLTLFAF  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              E R   +GWIC+ FS+CVFVAPL I+ +VI+TKSVE MP  LS+ LTLSAV+WF YGL
Sbjct  127  HGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             +KD  +A+PN+LGF FG++Q+ LYM Y +    V  + K                    
Sbjct  187  LIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVASDAK--------------------  226

Query  800  NTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNPAATAPKLQAVEA  976
                K + K+P   E+ ++ ++ +G      K  KS+ A    +  P A  P+  A EA
Sbjct  227  --EGKEAWKVP--AEDHVV-VINVG------KADKSSCA----EVRPVADVPRRCAAEA  270



>ref|XP_011036129.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Populus 
euphratica]
Length=282

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 180/267 (67%), Gaps = 8/267 (3%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H  AF FG+LGNIISF+V+L+P+PTF ++ +KKSTE +QS+PY+VALFS+MLW+YYA +K
Sbjct  8    HPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLWLYYAMLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             ND  LL+TINSFG  IE+IY+  +I Y+T+++RV T+K L     G F  ILL T FL 
Sbjct  68   -NDAILLVTINSFGCVIESIYIAIYIAYATRESRVSTIKLLVSMNMGLFSLILLLTHFLA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R   +GW+C+ FS+CVF APL I++Q+IRTKSVE MP  LS FLTLSAVMWF YGL
Sbjct  127  SGSTRVKALGWLCVAFSVCVFAAPLSIVKQIIRTKSVEFMPFTLSFFLTLSAVMWFAYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPK-------PVII  778
            F+KD+ +A+PN+LGFV G+LQ+ LY +Y++ KK  +  + L     L         PV  
Sbjct  187  FIKDLCVALPNILGFVLGLLQMLLYGIYRNAKKKKIPAEILKSSVILSTLGASEVYPVDA  246

Query  779  LEDNNGTNTNDKRSSKLPELTEEQIID  859
              D +    +    SK  E + +   D
Sbjct  247  QPDVSAAEHDQTEESKENEKSTDASHD  273



>ref|XP_002322282.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
 gb|EEF06409.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
Length=276

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 177/254 (70%), Gaps = 10/254 (4%)
 Frame = +2

Query  86   WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAN  265
            W F FG+LGN +SF+VFL+P+PTF ++ +KK+TEG+QS+PYVVALFSAM+W+YYA +K+ 
Sbjct  10   WIFTFGLLGNFVSFVVFLAPIPTFLRICRKKTTEGFQSLPYVVALFSAMIWLYYASLKS-  68

Query  266  DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKS  445
            D  LLITINS G FIE IY+  ++ Y+ K+ R+ T++ L LF  GGF +ILL + F  K 
Sbjct  69   DVLLLITINSVGCFIEMIYIALYVAYAPKQARIATLRILILFNFGGFCSILLLSHFFVKG  128

Query  446  EMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFL  625
              R  V+GW C++FS+ VF APL I+R VIRTKSVE MP  LS FLTLSA+ W  YG+ +
Sbjct  129  SNRVKVLGWACVIFSVSVFAAPLNIMRIVIRTKSVEFMPFTLSFFLTLSAITWLVYGVLV  188

Query  626  KDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLP---------EVTALPKPVII  778
            KD  IA+PN++GF+FG+LQ+ LY++YK+ K  V  E KLP          V+   KP + 
Sbjct  189  KDYYIAIPNIVGFIFGVLQMVLYVIYKNFKTAVPMEPKLPYSIDIAKLSPVSCEMKPAVC  248

Query  779  LEDNNGTNTNDKRS  820
             + N   +  D+ S
Sbjct  249  PQSNEEDDHTDQNS  262



>gb|KDP26857.1| hypothetical protein JCGZ_18015 [Jatropha curcas]
Length=293

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 136/291 (47%), Positives = 196/291 (67%), Gaps = 12/291 (4%)
 Frame = +2

Query  71   LTAHQ-WAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYY  247
            L+ HQ  AFAFG+LGNIIS +V+L+P+PTF ++Y+KKSTEG+ S+PY+VALFS+MLW++Y
Sbjct  4    LSTHQPLAFAFGLLGNIISVLVYLAPVPTFLRIYRKKSTEGFHSLPYLVALFSSMLWLHY  63

Query  248  AFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaT  427
            A +K  D  LL+TIN FG  IETIY+  ++ Y++K+ RV T + L       F +I+L T
Sbjct  64   AMLK-KDVFLLVTINVFGCAIETIYIFLYMFYASKEIRVSTFRLLVSMNIALFSSIVLFT  122

Query  428  QFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWF  607
             FL K  +R  V+GWIC+  S+ VF +PL I+ QV+RT+SVE MP  LS FLTLSAVMWF
Sbjct  123  HFLMKGSIRVQVLGWICVAVSVSVFASPLSIVAQVVRTRSVEFMPFTLSFFLTLSAVMWF  182

Query  608  FYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE-  784
             YG   K+M +A+PN+LGF+ G+LQ+ LY +Y+  K  VV E+KLPE     K ++IL  
Sbjct  183  AYGFTTKNMCVALPNILGFILGLLQMLLYAIYRKAKV-VVIEEKLPEKNL--KSIVILST  239

Query  785  -DNNGTNTNDKRSSKLPE---LTEEQIIDIVKLGTLVCSEKIQKSAAAASP  925
              N+     D R    P+   + +EQ  + ++ G+   +E+  +++   +P
Sbjct  240  LGNSEVYPVDVRPESEPDENKVAKEQ--EQIEEGSKKSNERSLETSNDLNP  288



>gb|KHG13555.1| Bidirectional sugar transporter SWEET15 [Gossypium arboreum]
Length=275

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 161/223 (72%), Gaps = 2/223 (1%)
 Frame = +2

Query  65   MALTAHQWAFA--FGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLW  238
            MA   H  +F+  FG+LGNI+SF V+L+PLPTFY+++KKKSTEG+QSIPY VALFSAML 
Sbjct  1    MAANIHDQSFSIVFGLLGNILSFFVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLL  60

Query  239  IYYAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgail  418
            +YYAF+K +D  +LITINS G  IE+IY++F+  Y+TK  R+ T K +  F     G I+
Sbjct  61   LYYAFLKQHDAVMLITINSIGSCIESIYLIFYQIYATKTARIYTTKLVIFFNIVALGFII  120

Query  419  laTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAV  598
            L T   FK  +R  +VGWIC +FS+CVF APL I+R VI+TKSVE MP  LS FLTL A+
Sbjct  121  LVTLVFFKGHLRVSIVGWICAIFSVCVFAAPLSIIRLVIKTKSVEYMPFPLSFFLTLCAI  180

Query  599  MWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVV  727
             WF YG  L+D  IA PN+LGF FGI Q+ LY++Y+   K +V
Sbjct  181  TWFLYGFSLRDFYIATPNILGFSFGITQMILYLVYRGETKALV  223



>ref|XP_002299333.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
 gb|EEE84138.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
Length=282

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 185/270 (69%), Gaps = 14/270 (5%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H  AF FG+LGNIISF+V+L+P+PTF ++ +KKSTE +QS+PY+VALFS+MLW+YYA +K
Sbjct  8    HPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLWLYYAMLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             ND  LL+TINSFG  IETIY+  +I Y+T++++V T+K L     G F  I+L T FL 
Sbjct  68   -NDEILLVTINSFGCVIETIYIAIYIAYATRESKVSTIKLLLSMNMGLFSLIILLTHFLA  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
                R   +GW+C+ FS+CVF APL I++Q+IRTKSVE MP  LS FLTLSAV+WF YGL
Sbjct  127  SGSTRVKALGWLCVAFSVCVFAAPLNIVKQIIRTKSVEFMPFTLSFFLTLSAVIWFAYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTAL------------P  763
            F+KDM +A+PN+LGFV G+LQ+ LY +Y++ +K  +  + L  +  L            P
Sbjct  187  FIKDMCVALPNILGFVLGLLQMLLYGIYRNAEKKKIPAENLKSIVILGTLGASEVYPVDP  246

Query  764  KPVIILEDNNGTNTNDKRSSKLPELTEEQI  853
            +P +   +++ T    K + K  E + + +
Sbjct  247  QPDVSAAEHDQTE-ESKENEKSMEASHDDL  275



>ref|XP_010045482.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Eucalyptus 
grandis]
 gb|KCW83109.1| hypothetical protein EUGRSUZ_B00063 [Eucalyptus grandis]
Length=279

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 134/269 (50%), Positives = 172/269 (64%), Gaps = 31/269 (12%)
 Frame = +2

Query  89   AFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKAND  268
            AFAFG+LGNI+SF+ FL+PLPTFY +YK K T+G+QSIPYVV+L SAML +YY  VK + 
Sbjct  10   AFAFGLLGNIVSFMTFLAPLPTFYGIYKTKKTQGFQSIPYVVSLLSAMLLLYYGLVKKD-  68

Query  269  TTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSE  448
             TLLITIN  G  IET YV  ++ Y++K  RV T+K   +    G+G +L  T FL K  
Sbjct  69   -TLLITINGIGCVIETAYVAAYLIYASKNDRVLTLKLFLIMNVLGYGVVLSTTFFLSKGA  127

Query  449  MRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGLFLK  628
             RA ++GWIC+ FSL VFVAPL IL++VI+T+SVE MP+ LS+FLTL A++WFFYG  LK
Sbjct  128  KRAWIIGWICMTFSLGVFVAPLCILKKVIKTRSVEFMPITLSIFLTLGAIVWFFYGFLLK  187

Query  629  DMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTN  808
            D  IAVPNVLGFV G++Q+ LY  YK                            N     
Sbjct  188  DFFIAVPNVLGFVLGVIQMVLYATYK----------------------------NANTVE  219

Query  809  DKRSSKLPELTEEQIIDIVKLGTLVCSEK  895
             +R+S+  E   E+IID++KL    C E 
Sbjct  220  VERNSQQQE-PREEIIDVMKLSAAACPEN  247



>ref|XP_010536596.1| PREDICTED: bidirectional sugar transporter SWEET10 [Tarenaya 
hassleriana]
Length=311

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 186/270 (69%), Gaps = 31/270 (11%)
 Frame = +2

Query  98   FGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVKANDTTL  277
            FG+LG+ ISF+V L+PLPTFY++YK+KS EGYQSIPYV+AL SAMLWIYYA ++ +  TL
Sbjct  12   FGILGDAISFLVCLAPLPTFYRIYKRKSAEGYQSIPYVIALLSAMLWIYYAMIRKH-ATL  70

Query  278  LITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLFKSEMRA  457
            LITIN+F I I+T Y+V ++ Y+ KK ++ T KF+ LF   GFGA+LL T F+   + R 
Sbjct  71   LITINTFCIVIQTFYIVVYMYYAPKKDKILTTKFIFLFNVLGFGAVLLLTLFVTHGDKRV  130

Query  458  HVVGWICLVFSLCVFVAPLFILRQVIRT--KSVECMPVLLSVFLTLSAVMWFFYGLFLKD  631
             VVG++C+VF+LCVFVAPL I+    +T  KSVE MP  LS FLTL AVMWFFYGL LKD
Sbjct  131  SVVGYVCMVFALCVFVAPLGIIVTSKQTNIKSVEFMPFPLSFFLTLGAVMWFFYGLLLKD  190

Query  632  MNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGTNTND  811
            +NIA+PNVLGF FG+ Q+ LY++YK   K+V           L +P I L+D        
Sbjct  191  LNIALPNVLGFAFGVAQMLLYVIYKKPTKNV-----------LEQPAIKLQD--------  231

Query  812  KRSSKLPELTEEQIIDIVKLGTLVCSEKIQ  901
                       E ++D+V+L T+VCS +++
Sbjct  232  ---------ISEHVVDVVRLSTMVCSSEMR  252



>gb|AAM65058.1| MtN3-like protein [Arabidopsis thaliana]
Length=294

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 165/223 (74%), Gaps = 0/223 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MALT + WAF FG+LGNIISF+VFL+P+PTF ++ KKKSTEG+QS+PYV ALFSAMLWIY
Sbjct  1    MALTNNLWAFVFGILGNIISFVVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA  K     LLITIN+FG  IETIY+V F+ Y+ KKTR+ T+K LGL    GF AI+L 
Sbjct  61   YAMQKDGTAFLLITINAFGCVIETIYIVLFVSYANKKTRISTLKVLGLLNFLGFAAIVLV  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
             + L K   R  V+G IC+ FS+ VF APL I+R V+RT+SVE MP  LS+FLT+SAV W
Sbjct  121  CZLLTKGSTREKVLGGICVGFSVSVFAAPLSIMRVVVRTRSVEFMPFSLSLFLTISAVTW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE  733
             FYGL +KD  +A+PNVLG   G +Q+ LY+++K  K  V ++
Sbjct  181  LFYGLAIKDFYVALPNVLGAFLGAVQMILYIIFKYYKTPVAQK  223



>ref|NP_001131289.1| mtN3-like protein [Zea mays]
 gb|ACF79630.1| unknown [Zea mays]
 gb|ACG31892.1| mtN3-like protein [Zea mays]
 gb|AFW60846.1| mtN3-like protein [Zea mays]
Length=293

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 168/223 (75%), Gaps = 6/223 (3%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H  AFAFG+LGNIISF+ +L+PLPTFY++YK KSTEG+QS+PYVVALFSAMLWIYYA +K
Sbjct  8    HPMAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTEGFQSVPYVVALFSAMLWIYYALLK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
            +N+  LLITINS G  IET+Y+  ++ Y+ KK ++ T K L L   G FG ILL T  L 
Sbjct  68   SNEL-LLITINSAGCVIETLYIAMYLLYAPKKAKLFTAKILLLLNVGVFGLILLLTLLLS  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
              + R  V+GW+C+ FS+ VFVAPL I+RQV+RT+SVE MP  LS+ LT+SAV+WF YGL
Sbjct  127  AGQRRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWFLYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDG-----KKDVVKE  733
             +KD  +A+PNV+GF FG++Q+GLY +Y++       KDV  +
Sbjct  187  LIKDKYVALPNVIGFSFGVVQMGLYALYRNATPRVPAKDVADD  229



>ref|XP_004239304.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=295

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 185/278 (67%), Gaps = 6/278 (2%)
 Frame = +2

Query  80   HQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAFVK  259
            H W F FGVLGN+IS +VFL+P+P F ++ K+KST GYQS+PYVVALFS+MLW+YYAF+K
Sbjct  8    HPWLFVFGVLGNVISILVFLAPVPAFRRICKEKSTMGYQSVPYVVALFSSMLWMYYAFIK  67

Query  260  ANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQFLF  439
             N   LL++INSFG  +ETIY+  FI Y++K+ R QT++ L L + G +  I L T F  
Sbjct  68   KN-AILLVSINSFGCIVETIYITIFILYASKEARRQTVQLLVLLIGGLYTLIFLITLFPL  126

Query  440  KSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFYGL  619
               +R  VVGWIC+  ++ VF APL I+ QV+RT++VE MP  LS FLTLSA+MWF YGL
Sbjct  127  NGVLRVQVVGWICVTVAVGVFAAPLSIVFQVVRTRTVEFMPFTLSFFLTLSAIMWFGYGL  186

Query  620  FLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDNNGT  799
             LKD+ IA+PNVLGF  G++Q+ LY +Y++ K  +  E+K+ E  A+    I   D+   
Sbjct  187  LLKDLCIALPNVLGFFLGMIQMLLYGIYRNAKPAIDLEKKVCE-HAVNSEQIYPVDSEDV  245

Query  800  NTNDKR----SSKLPELTEEQIIDIVKLGTLVCSEKIQ  901
            N ND      ++ +P +      +  +LG  V   K+Q
Sbjct  246  NFNDTEEINMAAIVPVVVANNNENEERLGDDVAQVKLQ  283



>ref|XP_008340254.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
 ref|XP_008353052.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 140/292 (48%), Positives = 182/292 (62%), Gaps = 36/292 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            +A + H  AF FG+LGN+IS +V+LSP+PTFY++Y+KKSTEG+ S+PY+VALFS+MLW+Y
Sbjct  4    VADSHHPLAFTFGILGNLISTMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSMLWLY  63

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA VK N   +LITINSFG F+E IY+V F  Y+ K+ R  T+K  G+   G F  IL+ 
Sbjct  64   YALVKKN-AMMLITINSFGSFVEIIYIVMFXVYAPKEARKLTVKLFGIMNVGLFTMILVV  122

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
            + FL  S  R  ++GWI +  S  VFVAPL I+ QVIRT+SVE MP  LS FLTLSAV+W
Sbjct  123  SHFLVGSAYRVPILGWINVAISTSVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSAVIW  182

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILE  784
            F YG  LKD+ +A+PN LGFV G+LQ+ LY +Y++      +EQ           VII  
Sbjct  183  FAYGYLLKDICVAIPNFLGFVLGLLQMLLYGIYRN------REQ-----------VII--  223

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSEKIQKSAAAASPFDKNP  940
                    D    KLP    E + +IV + TL  SE          P D  P
Sbjct  224  --------DDHEKKLPGAIHEDVKNIVIIATLAASE--------VHPVDDQP  259



>ref|XP_004247459.1| PREDICTED: bidirectional sugar transporter NEC1 [Solanum lycopersicum]
Length=286

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 191/266 (72%), Gaps = 7/266 (3%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T  Q AFAFG+LGN +SF+V+LSPLPTFY+++K+KSTEG+QSIPY V+LFSAML++YYA+
Sbjct  5    TTLQLAFAFGILGNGVSFLVYLSPLPTFYRIFKRKSTEGFQSIPYSVSLFSAMLYLYYAY  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ-  430
            +K N+  LLITINSFG  I+ IY+  F+ Y+TK  ++   K L  F    FGAI+  T  
Sbjct  65   LKKNEI-LLITINSFGTGIQLIYLTIFMIYATKSAKIFATKLLIGFNLVAFGAIVGLTYV  123

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            F  ++++R  +VGWIC VFS+ VF APL I+R+VI+TKSVE MP  LS FLT+ AVMWFF
Sbjct  124  FANENDLRISIVGWICAVFSVSVFAAPLSIMRRVIQTKSVEFMPFPLSFFLTICAVMWFF  183

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVT--ALPKPVIILE  784
            YGL  KDM IA+PN+LGF FGI Q+ LY +Y++ K+ V+ +  L ++   A+    +++E
Sbjct  184  YGLLKKDMYIAMPNILGFSFGIAQMILYAIYRNRKQQVLPDLSLMDLKEIAIDMKAVVVE  243

Query  785  DNNGTNTNDKRSSKLPELTEEQIIDI  862
                 N +D+  +K+ +  +E+++ +
Sbjct  244  IIQ-ENVDDENKNKINK--QEEVVSV  266



>ref|XP_010039121.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
 gb|KCW49070.1| hypothetical protein EUGRSUZ_K02670 [Eucalyptus grandis]
Length=284

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 183/260 (70%), Gaps = 6/260 (2%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGN+ISF+VFL+P+PTFY + K+KSTEG+QS+PYVV+L SAMLW+YYA 
Sbjct  6    TDNPWAFAFGLLGNLISFMVFLAPVPTFYGVCKRKSTEGFQSVPYVVSLLSAMLWLYYAS  65

Query  254  VKANDTT-LLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQ  430
            + +     LL+T+NS G  IETIYV  ++ Y+ KK ++ T K + +   G    ILL ++
Sbjct  66   INSESNDFLLVTVNSVGCVIETIYVALYLAYAPKKAKIFTAKLMVMGFGGFCSFILL-SR  124

Query  431  FLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFF  610
            FL +   R  ++GW+C+ FS+ VF APL ++R VIRTKSVE MP  LS FLTLSAV W  
Sbjct  125  FLTEGSTRVQLLGWLCVGFSVIVFAAPLSVMRMVIRTKSVEFMPFSLSFFLTLSAVTWLL  184

Query  611  YGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVIILEDN  790
            YG+FLKD++IAVPNVLGF+ G+LQ+GLY++Y+  K++++  +K P+     KP+   +  
Sbjct  185  YGIFLKDIHIAVPNVLGFILGVLQMGLYLIYR--KRNIMVLEK-PDYLGGAKPIANTQSC  241

Query  791  N-GTNTNDKRSSKLPELTEE  847
            +  +N N     ++ E  E+
Sbjct  242  SIASNDNVIHVDEVKERKED  261



>ref|XP_003602778.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES73029.1| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=311

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 167/229 (73%), Gaps = 4/229 (2%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            M+      +FAFGVLGNI SF+ FL+PLPTFY++ KKKSTEG+QSIPYV ALFSAMLW++
Sbjct  1    MSSHHSHLSFAFGVLGNISSFVCFLAPLPTFYRICKKKSTEGFQSIPYVAALFSAMLWMF  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA+ K  +T LLITIN+FG  IETIY+  F+ Y  KK R+ T++ + L    GFG I+L 
Sbjct  61   YAYTKKGET-LLITINAFGCVIETIYLAVFVTYCPKKVRMSTLRMIVLMNFVGFGTIVLL  119

Query  425  TQFLFKSEM-RAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVM  601
            T FL K E  R  ++GWIC+VF+  VF APL I+R VIRTKSVE +P  LSV L +SAVM
Sbjct  120  THFLAKQEEGRIKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSVLLLISAVM  179

Query  602  WFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPE  748
            W  YGL L+D+ + +PNV+G  FGI+QI LY MY++ K   V ++KLPE
Sbjct  180  WLLYGLSLRDIYVTLPNVVGLTFGIVQITLYAMYRNSKP--VIDEKLPE  226



>ref|XP_010545940.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Tarenaya 
hassleriana]
Length=285

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 189/265 (71%), Gaps = 17/265 (6%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGNIISF VFLSP+ TFY+++KKKSTEG+ S+PYVVALFSAMLW+YYA 
Sbjct  6    THNPWAFAFGLLGNIISFCVFLSPMTTFYRIWKKKSTEGFHSLPYVVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             + +D  LL+TINSFG FIETIY+  FI ++ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKSDVFLLVTINSFGCFIETIYISLFIAFANKKARMFTLKLLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+ VF APL I+R VI+TKSVE MP  LS+ LTLSAV+WF Y
Sbjct  125  LAKGSTRAKIIGGICVGFSVSVFAAPLSIIRVVIKTKSVEFMPFSLSLSLTLSAVVWFLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKK--DVVKEQ----KLPEVT-------  754
            GL LKD  +A PNV+GF+ G LQ+ LY++YK  K+  D+++++    KLPEV+       
Sbjct  185  GLSLKDFYVAFPNVIGFLLGALQMILYVVYKYCKRTPDLIEKEVEAAKLPEVSIDMMKLG  244

Query  755  --ALPKPVI-ILEDNNGTNTNDKRS  820
              A P+P I ++   N  N N++ +
Sbjct  245  TVASPEPAISVVRPGNTCNCNNRTA  269



>ref|XP_010550745.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Tarenaya 
hassleriana]
Length=287

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 185/269 (69%), Gaps = 16/269 (6%)
 Frame = +2

Query  74   TAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIYYAF  253
            T + WAFAFG+LGNIISF VFLSP+ TFY+++KKKSTEG+ S+PY+VALFSAMLW+YYA 
Sbjct  6    THNTWAFAFGLLGNIISFCVFLSPVLTFYRIWKKKSTEGFHSLPYLVALFSAMLWLYYA-  64

Query  254  VKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgaillaTQF  433
             + +D  LL+TINSFG FIETIY+  FI ++ KK R+ T+K L L   GGF  ILL  QF
Sbjct  65   TQKSDVFLLVTINSFGCFIETIYISLFIAFANKKARMFTLKVLLLMNFGGFCLILLLCQF  124

Query  434  LFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMWFFY  613
            L K   RA ++G IC+ FS+ VF APL I R VI+T+SVE MP  LS+ LT+SAV+W  Y
Sbjct  125  LVKGSTRAKIIGGICVGFSVSVFAAPLNIYRVVIKTRSVEFMPFSLSLTLTISAVVWLLY  184

Query  614  GLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGK------KDVVKEQKLPEVT-------  754
            GL LKD  +A PNV+GF+ G +Q+ LY++YK  K      +  V+  KLPEV+       
Sbjct  185  GLSLKDFYVAFPNVIGFLLGAIQMILYVVYKYCKTTPNLAEKEVEAAKLPEVSIDMLKLA  244

Query  755  --ALPKPVIILEDNNGTNTNDKRSSKLPE  835
                P+P I +  +  T T + R++++ +
Sbjct  245  TVLSPEPAIAVVRSANTCTCNNRTAEIDD  273



>ref|NP_199893.1| bidirectional sugar transporter SWEET13 [Arabidopsis thaliana]
 sp|Q9FGQ2.1|SWT13_ARATH RecName: Full=Bidirectional sugar transporter SWEET13; Short=AtSWEET13 
[Arabidopsis thaliana]
 dbj|BAB08903.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AED95993.1| bidirectional sugar transporter SWEET13 [Arabidopsis thaliana]
Length=294

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 165/223 (74%), Gaps = 0/223 (0%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MALT + WAF FG+LGNIISF+VFL+P+PTF ++ KKKSTEG+QS+PYV ALFSAMLWIY
Sbjct  1    MALTNNLWAFVFGILGNIISFVVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIY  60

Query  245  YAFVKANDTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgailla  424
            YA  K     LLITIN+FG  IETIY+V F+ Y+ KKTR+ T+K LGL    GF AI+L 
Sbjct  61   YAMQKDGTAFLLITINAFGCVIETIYIVLFVSYANKKTRISTLKVLGLLNFLGFAAIVLV  120

Query  425  TQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSAVMW  604
             + L K   R  V+G IC+ FS+ VF APL I+R V+RT+SVE MP  LS+FLT+SAV W
Sbjct  121  CELLTKGSTREKVLGGICVGFSVSVFAAPLSIMRVVVRTRSVEFMPFSLSLFLTISAVTW  180

Query  605  FFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKE  733
             FYGL +KD  +A+PNVLG   G +Q+ LY+++K  K  V ++
Sbjct  181  LFYGLAIKDFYVALPNVLGAFLGAVQMILYIIFKYYKTPVAQK  223



>ref|XP_009337540.1| PREDICTED: bidirectional sugar transporter NEC1 [Pyrus x bretschneideri]
Length=295

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/279 (51%), Positives = 184/279 (66%), Gaps = 34/279 (12%)
 Frame = +2

Query  65   MALTAHQWAFAFGVLGNIISFIVFLSPLPTFYQMYKKKSTEGYQSIPYVVALFSAMLWIY  244
            MAL  H    AFG+LGNIIS +VFL+P+PTFY +YKKK+TEG+Q++PYV+ L S+M++IY
Sbjct  1    MAL-HHTLTLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYIY  59

Query  245  YAFVKAN---DTTLLITINSFGIFIETIYVVFFICYSTKKTRVQTMKflglfvaggfgai  415
            YA +K     D TL+ITINS G  IETIY+  F+ Y+ KK R+ T   L L     +G +
Sbjct  60   YALLKEELKEDATLVITINSVGCVIETIYISLFLFYAPKKARISTAMLLFLLNLFSYGMM  119

Query  416  llaTQFLFKSEMRAHVVGWICLVFSLCVFVAPLFILRQVIRTKSVECMPVLLSVFLTLSA  595
            ++ T+FL   E R  +V WICLVFSL VFVAPL +LRQVIRTKSVE MP  LS FLTL A
Sbjct  120  VVLTRFLATGETRFKIVAWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGA  179

Query  596  VMWFFYGLFLKDMNIAVPNVLGFVFGILQIGLYMMYKDGKKDVVKEQKLPEVTALPKPVI  775
            V WFFYG  +KD  IA PN+LGF+FG++Q+ +Y++YK+ KK                   
Sbjct  180  VAWFFYGFLIKDYYIAFPNMLGFLFGVVQMVVYVVYKNAKK-------------------  220

Query  776  ILEDNNGTNTNDKRSSKLPELTEEQIIDIVKLGTLVCSE  892
            +LED            K+ EL+ E IID++K+ TLVC E
Sbjct  221  LLEDQ----------PKVQELS-EHIIDVMKINTLVCPE  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2985744528603