BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14207_g1_i1 len=1373 path=[2635:0-279 230:280-303 254:304-759
710:760-1372]

Length=1373
                                                                      Score     E

ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    409   1e-137   
ref|XP_009597195.1|  PREDICTED: bidirectional sugar transporter S...    407   1e-136   
ref|XP_009796436.1|  PREDICTED: bidirectional sugar transporter S...    406   3e-136   
ref|XP_009605549.1|  PREDICTED: bidirectional sugar transporter S...    404   1e-135   
ref|XP_009587580.1|  PREDICTED: bidirectional sugar transporter S...    403   4e-135   
ref|XP_009794695.1|  PREDICTED: bidirectional sugar transporter N...    403   6e-135   
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    401   2e-134   
ref|XP_009787633.1|  PREDICTED: bidirectional sugar transporter N...    401   3e-134   
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    400   7e-134   
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    399   2e-133   
ref|XP_009762335.1|  PREDICTED: bidirectional sugar transporter S...    398   4e-133   
ref|XP_009758166.1|  PREDICTED: bidirectional sugar transporter S...    397   1e-132   
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    394   6e-132   
ref|XP_009599477.1|  PREDICTED: bidirectional sugar transporter S...    394   1e-131   
ref|XP_004235339.1|  PREDICTED: bidirectional sugar transporter S...    391   1e-130   
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    391   2e-130   
ref|XP_006347633.1|  PREDICTED: bidirectional sugar transporter S...    390   3e-130   
ref|XP_004241452.1|  PREDICTED: bidirectional sugar transporter S...    389   6e-130   
ref|XP_006347346.1|  PREDICTED: bidirectional sugar transporter S...    388   2e-129   
ref|XP_006347634.1|  PREDICTED: bidirectional sugar transporter S...    389   2e-129   
ref|XP_009802608.1|  PREDICTED: bidirectional sugar transporter S...    388   3e-129   
ref|XP_004235342.2|  PREDICTED: uncharacterized protein LOC101265905    396   3e-128   
ref|XP_009614915.1|  PREDICTED: bidirectional sugar transporter S...    385   4e-128   
ref|XP_004235334.1|  PREDICTED: bidirectional sugar transporter S...    385   4e-128   
ref|XP_006363981.1|  PREDICTED: bidirectional sugar transporter S...    384   1e-127   
gb|ACV71016.1|  UPA16                                                   384   1e-127   Capsicum annuum
ref|XP_004235326.1|  PREDICTED: bidirectional sugar transporter N3      382   7e-127   
ref|XP_006347347.1|  PREDICTED: bidirectional sugar transporter S...    380   4e-126   
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    386   1e-125   
ref|XP_004235333.1|  PREDICTED: bidirectional sugar transporter S...    379   2e-125   
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    377   8e-125   
ref|XP_009794853.1|  PREDICTED: bidirectional sugar transporter S...    361   7e-119   
ref|XP_004242139.1|  PREDICTED: bidirectional sugar transporter S...    358   1e-117   
ref|XP_009802195.1|  PREDICTED: bidirectional sugar transporter S...    356   9e-117   
ref|XP_009614917.1|  PREDICTED: bidirectional sugar transporter S...    353   8e-116   
ref|XP_009803865.1|  PREDICTED: bidirectional sugar transporter S...    345   1e-112   
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    328   7e-106   
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    328   7e-106   
ref|XP_011073577.1|  PREDICTED: bidirectional sugar transporter S...    324   2e-104   
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    320   4e-103   
ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    320   7e-103   
ref|XP_009605548.1|  PREDICTED: bidirectional sugar transporter S...    320   2e-102   
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                317   9e-102   
ref|XP_009801964.1|  PREDICTED: bidirectional sugar transporter S...    316   3e-101   
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    310   6e-99    Vitis vinifera
emb|CDP21121.1|  unnamed protein product                                310   7e-99    
emb|CAN71371.1|  hypothetical protein VITISV_023352                     309   8e-99    Vitis vinifera
gb|EYU43031.1|  hypothetical protein MIMGU_mgv1a011488mg                309   1e-98    
gb|EPS64389.1|  hypothetical protein M569_10392                         308   2e-98    
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                309   2e-98    
gb|EYU43030.1|  hypothetical protein MIMGU_mgv1a011435mg                306   1e-97    
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    303   2e-96    
ref|XP_006436900.1|  hypothetical protein CICLE_v10033645mg             302   6e-96    
emb|CDP21733.1|  unnamed protein product                                300   1e-95    
ref|XP_004297512.1|  PREDICTED: bidirectional sugar transporter S...    300   4e-95    
ref|XP_007038076.1|  Nodulin MtN3 family protein, putative isoform 2    299   1e-94    
ref|XP_009601079.1|  PREDICTED: bidirectional sugar transporter S...    298   2e-94    
emb|CDP21120.1|  unnamed protein product                                297   3e-94    
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    297   8e-94    
gb|KHG27148.1|  Bidirectional sugar transporter SWEET10 -like pro...    296   2e-93    
ref|XP_009779208.1|  PREDICTED: bidirectional sugar transporter S...    295   2e-93    
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             293   1e-92    
ref|XP_007209422.1|  hypothetical protein PRUPE_ppa009422mg             294   2e-92    
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    293   5e-92    
ref|XP_008239633.1|  PREDICTED: bidirectional sugar transporter S...    291   2e-91    
ref|XP_011084749.1|  PREDICTED: bidirectional sugar transporter N...    290   6e-91    
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    289   7e-91    
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          288   2e-90    
ref|NP_001237418.1|  N3 protein                                         285   1e-89    
gb|AFK48645.1|  unknown                                                 285   2e-89    
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            286   2e-89    
ref|XP_006347482.1|  PREDICTED: bidirectional sugar transporter S...    285   2e-89    
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    285   2e-89    
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    284   2e-89    
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 284   4e-89    
ref|XP_006436901.1|  hypothetical protein CICLE_v10032313mg             284   7e-89    
gb|KHG02402.1|  Bidirectional sugar transporter SWEET10 -like pro...    283   1e-88    
gb|ACU23483.1|  unknown                                                 282   2e-88    Glycine max [soybeans]
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter S...    283   3e-88    
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      282   6e-88    
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    281   7e-88    
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    280   1e-87    
ref|XP_006493253.1|  PREDICTED: bidirectional sugar transporter S...    281   2e-87    
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    280   3e-87    
ref|NP_001242732.1|  uncharacterized protein LOC100810962               278   7e-87    
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    279   8e-87    
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    279   1e-86    
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    277   2e-86    
ref|XP_002321731.1|  N3 like family protein                             278   2e-86    Populus trichocarpa [western balsam poplar]
gb|KFK26707.1|  hypothetical protein AALP_AA8G282900                    278   2e-86    
ref|NP_001241307.1|  uncharacterized protein LOC100810946               276   2e-86    
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    277   3e-86    
ref|XP_009347840.1|  PREDICTED: bidirectional sugar transporter N...    279   3e-86    
ref|XP_006366912.1|  PREDICTED: bidirectional sugar transporter S...    277   3e-86    
ref|XP_004235470.1|  PREDICTED: bidirectional sugar transporter S...    277   3e-86    
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    277   4e-86    
ref|XP_006347653.1|  PREDICTED: bidirectional sugar transporter S...    276   4e-86    
ref|XP_011023934.1|  PREDICTED: bidirectional sugar transporter S...    277   5e-86    
ref|XP_009132693.1|  PREDICTED: bidirectional sugar transporter S...    277   6e-86    
ref|XP_002322281.2|  N3 like family protein                             276   7e-86    Populus trichocarpa [western balsam poplar]
ref|XP_002511128.1|  conserved hypothetical protein                     276   8e-86    Ricinus communis
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    276   1e-85    
gb|KFK27668.1|  hypothetical protein AALP_AA8G413300                    275   2e-85    
ref|XP_011023931.1|  PREDICTED: bidirectional sugar transporter S...    274   3e-85    
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    275   4e-85    
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             274   4e-85    
ref|XP_006663471.1|  PREDICTED: bidirectional sugar transporter S...    275   4e-85    
ref|NP_001239695.1|  uncharacterized protein LOC100777741               274   4e-85    
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             274   6e-85    Populus trichocarpa [western balsam poplar]
ref|XP_008222221.1|  PREDICTED: bidirectional sugar transporter N3      274   6e-85    
ref|XP_006366913.1|  PREDICTED: bidirectional sugar transporter S...    276   6e-85    
ref|XP_004503778.1|  PREDICTED: bidirectional sugar transporter S...    273   6e-85    
ref|XP_008239523.1|  PREDICTED: bidirectional sugar transporter N3      274   8e-85    
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             272   1e-84    
ref|XP_008392764.1|  PREDICTED: bidirectional sugar transporter S...    273   1e-84    
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    273   1e-84    
ref|XP_010482380.1|  PREDICTED: bidirectional sugar transporter S...    273   2e-84    
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    273   2e-84    
ref|XP_011071246.1|  PREDICTED: bidirectional sugar transporter N3      273   2e-84    
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    273   2e-84    
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               272   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602778.1|  Protein RUPTURED POLLEN GRAIN                      273   3e-84    
ref|XP_010322967.1|  PREDICTED: bidirectional sugar transporter S...    271   4e-84    
ref|XP_010678287.1|  PREDICTED: bidirectional sugar transporter S...    273   4e-84    
ref|XP_010442555.1|  PREDICTED: bidirectional sugar transporter S...    271   6e-84    
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    271   6e-84    
ref|XP_010442345.1|  PREDICTED: bidirectional sugar transporter S...    271   7e-84    
emb|CDX84877.1|  BnaA03g13530D                                          271   7e-84    
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               271   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006493252.1|  PREDICTED: bidirectional sugar transporter S...    271   1e-83    
ref|XP_002321730.2|  N3 like family protein                             270   2e-83    Populus trichocarpa [western balsam poplar]
ref|XP_007043874.1|  Senescence-associated gene 29                      270   3e-83    
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    270   3e-83    
gb|KEH20983.1|  bidirectional sugar transporter                         269   3e-83    
emb|CAC44123.1|  N3 like protein                                        268   3e-83    Medicago truncatula
gb|KHN24976.1|  Bidirectional sugar transporter N3                      269   3e-83    
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            270   4e-83    
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             270   4e-83    
ref|XP_004310113.1|  PREDICTED: bidirectional sugar transporter S...    270   6e-83    
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    270   6e-83    
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 269   7e-83    
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    269   7e-83    
ref|XP_002865823.1|  nodulin MtN3 family protein                        269   7e-83    
ref|XP_008392727.1|  PREDICTED: bidirectional sugar transporter S...    269   8e-83    
ref|XP_009141677.1|  PREDICTED: bidirectional sugar transporter S...    268   1e-82    
ref|XP_006394628.1|  hypothetical protein EUTSA_v10004719mg             268   1e-82    
ref|XP_003531061.1|  PREDICTED: bidirectional sugar transporter N...    268   1e-82    
ref|XP_010045482.1|  PREDICTED: bidirectional sugar transporter S...    268   1e-82    
gb|AFK35161.1|  unknown                                                 267   1e-82    
emb|CDY16863.1|  BnaA09g05190D                                          267   2e-82    
gb|KHN39181.1|  Bidirectional sugar transporter N3                      267   2e-82    
ref|XP_003530901.1|  PREDICTED: bidirectional sugar transporter N...    267   2e-82    
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    268   2e-82    
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             267   2e-82    
emb|CDX87161.1|  BnaC09g04760D                                          267   2e-82    
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    267   3e-82    Vitis vinifera
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                268   3e-82    
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    267   4e-82    
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    267   5e-82    
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    268   6e-82    
emb|CBI32263.3|  unnamed protein product                                268   6e-82    
ref|XP_003551863.1|  PREDICTED: bidirectional sugar transporter N...    266   6e-82    
ref|XP_002511126.1|  conserved hypothetical protein                     266   7e-82    Ricinus communis
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               266   7e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          268   7e-82    Sorghum bicolor [broomcorn]
gb|KHN03192.1|  Bidirectional sugar transporter N3                      266   7e-82    
emb|CDX88041.1|  BnaA06g26320D                                          266   8e-82    
ref|XP_009150896.1|  PREDICTED: bidirectional sugar transporter S...    266   9e-82    
ref|XP_003524088.1|  PREDICTED: bidirectional sugar transporter N...    265   1e-81    
ref|XP_008389921.1|  PREDICTED: bidirectional sugar transporter N...    266   2e-81    
gb|KDO64482.1|  hypothetical protein CISIN_1g047365mg                   264   2e-81    
ref|XP_006281748.1|  hypothetical protein CARUB_v10027907mg             265   2e-81    
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    265   2e-81    
emb|CDX80379.1|  BnaC07g30650D                                          265   3e-81    
ref|XP_002511127.1|  conserved hypothetical protein                     264   3e-81    Ricinus communis
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    265   3e-81    
ref|XP_010536596.1|  PREDICTED: bidirectional sugar transporter S...    265   3e-81    
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    265   3e-81    
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    265   4e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_009612477.1|  PREDICTED: bidirectional sugar transporter N...    265   4e-81    
ref|XP_007038077.1|  Medicago truncatula MTN3, putative                 264   4e-81    
ref|NP_001046944.1|  Os02g0513100                                       265   4e-81    Oryza sativa Japonica Group [Japonica rice]
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         264   5e-81    
gb|KDO64483.1|  hypothetical protein CISIN_1g020739mg                   264   6e-81    
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    265   7e-81    
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    263   9e-81    
ref|XP_008791098.1|  PREDICTED: bidirectional sugar transporter S...    264   9e-81    
ref|XP_002514863.1|  conserved hypothetical protein                     263   9e-81    Ricinus communis
ref|XP_006402062.1|  hypothetical protein EUTSA_v10014273mg             263   1e-80    
ref|XP_009336454.1|  PREDICTED: bidirectional sugar transporter N...    263   1e-80    
gb|KDP26857.1|  hypothetical protein JCGZ_18015                         263   2e-80    
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    263   2e-80    
ref|XP_011023933.1|  PREDICTED: bidirectional sugar transporter S...    261   2e-80    
ref|XP_002877629.1|  nodulin MtN3 family protein                        262   4e-80    
emb|CDY69440.1|  BnaCnng63490D                                          259   4e-80    
ref|NP_196821.1|  senescence-associated protein 29                      262   4e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65389.1|  senescence-associated protein (SAG29)                   262   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    263   4e-80    
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             261   5e-80    
ref|XP_010678288.1|  PREDICTED: bidirectional sugar transporter N3      263   5e-80    
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             261   6e-80    
ref|NP_001131289.1|  mtN3-like protein                                  261   6e-80    Zea mays [maize]
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    261   6e-80    
ref|XP_007159040.1|  hypothetical protein PHAVU_002G203600g             260   7e-80    
ref|XP_002264875.1|  PREDICTED: bidirectional sugar transporter N3      261   7e-80    Vitis vinifera
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    261   8e-80    
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    261   9e-80    
emb|CDX77928.1|  BnaC03g52910D                                          261   9e-80    
ref|XP_011015361.1|  PREDICTED: bidirectional sugar transporter S...    260   1e-79    
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    261   1e-79    
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    259   1e-79    
ref|XP_004239304.1|  PREDICTED: bidirectional sugar transporter N3      261   1e-79    
ref|XP_010426372.1|  PREDICTED: bidirectional sugar transporter S...    261   1e-79    
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       259   1e-79    
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    260   1e-79    
ref|XP_010503515.1|  PREDICTED: bidirectional sugar transporter S...    260   1e-79    
emb|CDY08093.1|  BnaA06g16330D                                          260   1e-79    
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    259   2e-79    
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      259   2e-79    
dbj|BAJ94651.1|  predicted protein                                      260   2e-79    
ref|XP_009777590.1|  PREDICTED: bidirectional sugar transporter N...    261   2e-79    
ref|XP_008356571.1|  PREDICTED: bidirectional sugar transporter S...    260   2e-79    
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             259   2e-79    Populus trichocarpa [western balsam poplar]
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             260   2e-79    
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 262   2e-79    
ref|NP_001067955.1|  Os11g0508600                                       260   2e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    259   2e-79    
emb|CDP13388.1|  unnamed protein product                                260   2e-79    
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    260   3e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    259   3e-79    
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    259   3e-79    
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         260   3e-79    
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          259   3e-79    Sorghum bicolor [broomcorn]
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    258   4e-79    
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    259   4e-79    
emb|CDX83046.1|  BnaA01g20460D                                          259   4e-79    
ref|XP_006399805.1|  hypothetical protein EUTSA_v10014234mg             259   4e-79    
ref|XP_002873602.1|  nodulin MtN3 family protein                        259   5e-79    
emb|CDY05867.1|  BnaC08g20440D                                          259   5e-79    
ref|XP_007050795.1|  Medicago truncatula MTN3                           259   5e-79    
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             259   6e-79    
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         258   7e-79    
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         258   8e-79    
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    257   1e-78    
gb|KHN23961.1|  Bidirectional sugar transporter SWEET12                 259   1e-78    
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    257   1e-78    
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             258   2e-78    
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         258   2e-78    
ref|XP_010027258.1|  PREDICTED: bidirectional sugar transporter N...    258   2e-78    
ref|XP_008340254.1|  PREDICTED: bidirectional sugar transporter N...    258   2e-78    
ref|XP_004247459.1|  PREDICTED: bidirectional sugar transporter NEC1    257   2e-78    
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 261   2e-78    
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             256   2e-78    
ref|XP_010534707.1|  PREDICTED: bidirectional sugar transporter S...    258   2e-78    
ref|XP_011036129.1|  PREDICTED: bidirectional sugar transporter S...    256   3e-78    
emb|CDX91144.1|  BnaC02g04530D                                          257   3e-78    
ref|XP_003620983.1|  Protein RUPTURED POLLEN GRAIN                      256   3e-78    
emb|CDP03543.1|  unnamed protein product                                256   3e-78    
ref|XP_006291603.1|  hypothetical protein CARUB_v10017757mg             256   4e-78    
gb|KHG03157.1|  Bidirectional sugar transporter SWEET15 -like pro...    256   4e-78    
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 256   4e-78    
ref|XP_009349481.1|  PREDICTED: bidirectional sugar transporter N...    257   5e-78    
ref|XP_009403777.1|  PREDICTED: bidirectional sugar transporter S...    256   6e-78    
gb|KEH21447.1|  sugar efflux transporter for intercellular exchan...    256   6e-78    
ref|XP_004501816.1|  PREDICTED: bidirectional sugar transporter S...    255   6e-78    
gb|EMT20480.1|  Protein RUPTURED POLLEN GRAIN 1                         256   7e-78    
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    256   8e-78    
emb|CDP14988.1|  unnamed protein product                                255   8e-78    
emb|CDX68492.1|  BnaC01g25700D                                          256   8e-78    
ref|NP_001149028.1|  LOC100282648                                       256   1e-77    Zea mays [maize]
ref|XP_010545940.1|  PREDICTED: bidirectional sugar transporter S...    255   1e-77    
ref|XP_009125890.1|  PREDICTED: bidirectional sugar transporter S...    256   1e-77    
ref|XP_003526939.1|  PREDICTED: bidirectional sugar transporter S...    256   1e-77    
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 256   1e-77    
gb|EMT22394.1|  Protein RUPTURED POLLEN GRAIN 1                         256   1e-77    
ref|XP_009337540.1|  PREDICTED: bidirectional sugar transporter NEC1    255   1e-77    
ref|XP_004501726.1|  PREDICTED: bidirectional sugar transporter S...    255   1e-77    
ref|XP_010438942.1|  PREDICTED: bidirectional sugar transporter S...    255   1e-77    
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    255   2e-77    
ref|NP_001141106.1|  uncharacterized protein LOC100273190               255   2e-77    
ref|XP_004980522.1|  PREDICTED: bidirectional sugar transporter S...    255   2e-77    
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    254   2e-77    
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          255   2e-77    
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    254   3e-77    
ref|XP_002511125.1|  conserved hypothetical protein                     254   3e-77    
dbj|BAJ85621.1|  predicted protein                                      254   4e-77    
ref|XP_011042931.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    253   5e-77    
emb|CDX85668.1|  BnaA02g01450D                                          254   5e-77    
ref|XP_010550745.1|  PREDICTED: bidirectional sugar transporter S...    254   5e-77    
gb|ACG28570.1|  MTN3                                                    254   5e-77    
ref|NP_001141654.1|  hypothetical protein                               254   6e-77    
ref|XP_002450786.1|  hypothetical protein SORBIDRAFT_05g018110          253   6e-77    
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    255   7e-77    
emb|CDX97233.1|  BnaC09g43920D                                          253   7e-77    
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             253   8e-77    
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    252   8e-77    
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    253   8e-77    
ref|XP_003576036.1|  PREDICTED: bidirectional sugar transporter S...    253   9e-77    
gb|AAM65058.1|  MtN3-like protein                                       253   1e-76    
ref|XP_010943754.1|  PREDICTED: bidirectional sugar transporter S...    252   1e-76    
ref|XP_010045483.1|  PREDICTED: bidirectional sugar transporter S...    252   1e-76    
ref|XP_004491681.1|  PREDICTED: bidirectional sugar transporter N...    251   1e-76    
emb|CDX69663.1|  BnaA10g20120D                                          253   2e-76    
ref|XP_007200238.1|  hypothetical protein PRUPE_ppa015264mg             252   2e-76    
emb|CDY53626.1|  BnaC03g71480D                                          253   2e-76    
ref|XP_006444236.1|  hypothetical protein CICLE_v10023774mg             252   2e-76    
gb|AHL43546.1|  nodule-specific sucrose transporter                     251   2e-76    
ref|XP_010025273.1|  PREDICTED: bidirectional sugar transporter N...    252   2e-76    
gb|KDO87388.1|  hypothetical protein CISIN_1g036251mg                   252   2e-76    
gb|KDO64484.1|  hypothetical protein CISIN_1g020739mg                   253   2e-76    
ref|XP_006664549.1|  PREDICTED: bidirectional sugar transporter S...    251   2e-76    
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    251   3e-76    
emb|CDX78511.1|  BnaA03g04230D                                          252   3e-76    
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    252   3e-76    
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               252   3e-76    
ref|XP_010025272.1|  PREDICTED: bidirectional sugar transporter N...    251   3e-76    
ref|NP_001149087.1|  MTN3                                               252   3e-76    
ref|XP_002443163.1|  hypothetical protein SORBIDRAFT_08g013620          252   4e-76    
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    251   5e-76    
ref|NP_001132836.1|  hypothetical protein                               253   6e-76    
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    250   6e-76    
gb|EMT20481.1|  Protein RUPTURED POLLEN GRAIN 1                         251   7e-76    
ref|XP_003602780.1|  Protein RUPTURED POLLEN GRAIN                      250   9e-76    
gb|EAY83053.1|  hypothetical protein OsI_38270                          250   1e-75    
emb|CDY34333.1|  BnaA01g14360D                                          249   1e-75    
gb|EYU43028.1|  hypothetical protein MIMGU_mgv1a019383mg                246   1e-75    
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                248   1e-75    
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               249   1e-75    
emb|CDY24854.1|  BnaA08g14560D                                          249   2e-75    
emb|CDY03395.1|  BnaC01g16870D                                          249   2e-75    
gb|KHN31280.1|  Bidirectional sugar transporter SWEET14-like protein    251   2e-75    
ref|XP_008235079.1|  PREDICTED: bidirectional sugar transporter S...    249   2e-75    
emb|CDX92666.1|  BnaC07g39240D                                          249   2e-75    
dbj|BAK04274.1|  predicted protein                                      250   2e-75    
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                249   2e-75    
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             249   3e-75    
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    248   3e-75    
ref|XP_010027260.1|  PREDICTED: bidirectional sugar transporter N...    249   3e-75    
ref|XP_002867630.1|  nodulin MtN3 family protein                        248   5e-75    
ref|XP_002299333.2|  hypothetical protein POPTR_0001s13410g             248   6e-75    
ref|XP_007139099.1|  hypothetical protein PHAVU_008G001100g             248   7e-75    
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    248   8e-75    
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    247   8e-75    
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             248   9e-75    
gb|EYU24137.1|  hypothetical protein MIMGU_mgv1a022637mg                243   1e-74    
ref|XP_009601078.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-74    
ref|XP_009121791.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    248   1e-74    
gb|KHN24975.1|  Bidirectional sugar transporter N3                      247   1e-74    
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    248   1e-74    
ref|XP_002520679.1|  conserved hypothetical protein                     247   1e-74    
ref|XP_006480106.1|  PREDICTED: bidirectional sugar transporter S...    247   1e-74    
gb|KEH21448.1|  bidirectional sugar transporter                         246   2e-74    
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    247   2e-74    
sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    246   3e-74    
ref|XP_010039121.1|  PREDICTED: bidirectional sugar transporter S...    246   3e-74    
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    246   3e-74    
emb|CDX71659.1|  BnaC09g27000D                                          246   4e-74    
gb|KDP22572.1|  hypothetical protein JCGZ_26403                         246   4e-74    
ref|XP_004157602.1|  PREDICTED: bidirectional sugar transporter S...    245   5e-74    
ref|XP_004140547.1|  PREDICTED: bidirectional sugar transporter S...    245   5e-74    
ref|XP_003532319.1|  PREDICTED: bidirectional sugar transporter N...    245   5e-74    
ref|XP_007038078.1|  Medicago truncatula MTN3, putative                 246   5e-74    
ref|XP_008459891.1|  PREDICTED: bidirectional sugar transporter N3      245   6e-74    
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    246   7e-74    
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    244   1e-73    
ref|XP_002862913.1|  nodulin MtN3 family protein                        245   1e-73    
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14                 252   1e-73    
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    244   1e-73    
ref|XP_002280599.1|  PREDICTED: bidirectional sugar transporter S...    244   1e-73    
ref|XP_010027259.1|  PREDICTED: bidirectional sugar transporter N...    244   1e-73    
emb|CDP09549.1|  unnamed protein product                                244   1e-73    
gb|KHG13555.1|  Bidirectional sugar transporter SWEET15                 244   1e-73    
gb|KDP28088.1|  hypothetical protein JCGZ_13859                         244   2e-73    
ref|XP_010926783.1|  PREDICTED: bidirectional sugar transporter S...    244   2e-73    
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    244   2e-73    
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    243   2e-73    
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    244   2e-73    
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    244   2e-73    
ref|XP_010036837.1|  PREDICTED: bidirectional sugar transporter N...    243   3e-73    
ref|XP_003576225.1|  PREDICTED: bidirectional sugar transporter S...    244   3e-73    
gb|AFK47472.1|  unknown                                                 243   3e-73    
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    244   3e-73    
ref|XP_010519500.1|  PREDICTED: bidirectional sugar transporter S...    243   3e-73    
gb|KCW61896.1|  hypothetical protein EUGRSUZ_H04589                     243   4e-73    
ref|XP_007159991.1|  hypothetical protein PHAVU_002G283800g             244   4e-73    
gb|KCW61894.1|  hypothetical protein EUGRSUZ_H04587                     242   4e-73    
ref|XP_010027262.1|  PREDICTED: bidirectional sugar transporter N...    243   5e-73    
ref|XP_002865824.1|  nodulin MtN3 family protein                        243   6e-73    
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    243   6e-73    
gb|EMT20483.1|  Protein RUPTURED POLLEN GRAIN 1                         244   7e-73    
gb|KCW49071.1|  hypothetical protein EUGRSUZ_K02671                     242   8e-73    
ref|XP_009783143.1|  PREDICTED: bidirectional sugar transporter N...    242   9e-73    
ref|XP_008386620.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-72    
gb|EMS51423.1|  Bidirectional sugar transporter SWEET13                 243   1e-72    
ref|XP_010037362.1|  PREDICTED: bidirectional sugar transporter S...    242   2e-72    
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 242   2e-72    
ref|XP_010037373.1|  PREDICTED: bidirectional sugar transporter S...    241   2e-72    
gb|AGL98401.1|  sucrose transporter SWEET9                              241   2e-72    
gb|AGV54262.1|  bidirectional sugar transporter SWEET12                 243   2e-72    
ref|XP_007137871.1|  hypothetical protein PHAVU_009G162800g             238   2e-72    
gb|KCW61897.1|  hypothetical protein EUGRSUZ_H04592                     241   3e-72    
ref|XP_007139174.1|  hypothetical protein PHAVU_008G007600g             240   3e-72    
sp|P93332.1|NOD3_MEDTR  RecName: Full=Bidirectional sugar transpo...    239   6e-72    
ref|XP_010039124.1|  PREDICTED: bidirectional sugar transporter S...    238   6e-72    
gb|AFK39311.1|  unknown                                                 239   8e-72    
ref|XP_010042796.1|  PREDICTED: bidirectional sugar transporter N...    240   9e-72    
gb|EMS49335.1|  Bidirectional sugar transporter SWEET14                 242   1e-71    
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    239   1e-71    
ref|XP_007030240.1|  Nodulin MtN3 family protein isoform 1              240   1e-71    
ref|XP_010037364.1|  PREDICTED: bidirectional sugar transporter S...    239   2e-71    
gb|EMT23597.1|  Protein RUPTURED POLLEN GRAIN 1                         239   2e-71    
ref|XP_004957300.1|  PREDICTED: bidirectional sugar transporter S...    239   2e-71    
ref|XP_010112742.1|  Bidirectional sugar transporter NEC1               238   2e-71    
dbj|BAK07340.1|  predicted protein                                      239   3e-71    
emb|CBI15715.3|  unnamed protein product                                239   3e-71    
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    238   3e-71    
gb|KFK26708.1|  hypothetical protein AALP_AA8G283000                    238   8e-71    
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-70    
ref|XP_003552719.1|  PREDICTED: bidirectional sugar transporter N...    236   1e-70    
ref|XP_003593107.1|  Protein RUPTURED POLLEN GRAIN                      236   2e-70    
ref|XP_003578398.1|  PREDICTED: bidirectional sugar transporter S...    236   2e-70    
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    234   2e-70    
ref|XP_009586714.1|  PREDICTED: bidirectional sugar transporter N...    235   3e-70    
ref|XP_006376915.1|  hypothetical protein POPTR_0012s10500g             235   3e-70    
gb|KEH21559.1|  bidirectional sugar transporter                         235   3e-70    
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    235   4e-70    
ref|XP_006296061.1|  hypothetical protein CARUB_v10025211mg             235   4e-70    
gb|KGN63457.1|  hypothetical protein Csa_1G001290                       235   4e-70    
gb|KHN17298.1|  Bidirectional sugar transporter NEC1                    234   5e-70    
gb|KFK36797.1|  hypothetical protein AALP_AA4G172400                    234   9e-70    
ref|XP_010696414.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-69    
ref|XP_011069470.1|  PREDICTED: bidirectional sugar transporter S...    229   2e-69    
ref|XP_010517242.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-69    
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    233   2e-69    
ref|XP_004301046.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    233   5e-69    
ref|XP_007139100.1|  hypothetical protein PHAVU_008G001200g             232   6e-69    
ref|XP_010037379.1|  PREDICTED: bidirectional sugar transporter S...    232   6e-69    
ref|XP_007030241.1|  Nodulin MtN3 family protein isoform 2              232   1e-68    
gb|AFW71562.1|  hypothetical protein ZEAMMB73_472818                    232   1e-68    
gb|AFK36312.1|  unknown                                                 231   1e-68    
ref|XP_006411131.1|  hypothetical protein EUTSA_v10017080mg             231   2e-68    
gb|EPS72542.1|  hypothetical protein M569_02215                         229   2e-68    
ref|XP_002881628.1|  nodulin MtN3 family protein                        230   2e-68    
ref|NP_181439.1|  bidirectional sugar transporter SWEET9                230   2e-68    
gb|AAM63257.1|  similar to MtN3 protein                                 230   2e-68    
emb|CDY70861.1|  BnaCnng70080D                                          228   2e-68    
ref|XP_010528779.1|  PREDICTED: bidirectional sugar transporter S...    230   2e-68    
gb|KCW49087.1|  hypothetical protein EUGRSUZ_K02694                     231   3e-68    
ref|XP_010039128.1|  PREDICTED: bidirectional sugar transporter S...    231   3e-68    
ref|XP_011069431.1|  PREDICTED: bidirectional sugar transporter N...    229   3e-68    
ref|XP_010999465.1|  PREDICTED: bidirectional sugar transporter S...    229   4e-68    
ref|XP_009417933.1|  PREDICTED: bidirectional sugar transporter S...    229   5e-68    
ref|XP_010505570.1|  PREDICTED: bidirectional sugar transporter S...    229   6e-68    
ref|XP_010509074.1|  PREDICTED: bidirectional sugar transporter S...    228   8e-68    
ref|XP_010037381.1|  PREDICTED: bidirectional sugar transporter S...    229   9e-68    
ref|XP_010926782.1|  PREDICTED: bidirectional sugar transporter S...    229   1e-67    
ref|XP_003617528.1|  Protein RUPTURED POLLEN GRAIN                      228   1e-67    
gb|ACJ84828.1|  unknown                                                 229   1e-67    
ref|XP_009383909.1|  PREDICTED: bidirectional sugar transporter N...    230   3e-67    
ref|XP_010039123.1|  PREDICTED: bidirectional sugar transporter S...    226   3e-67    
ref|XP_003518628.1|  PREDICTED: bidirectional sugar transporter NEC1    227   3e-67    
ref|XP_010045484.1|  PREDICTED: bidirectional sugar transporter S...    226   4e-67    
ref|XP_010041902.1|  PREDICTED: bidirectional sugar transporter S...    227   4e-67    
gb|EYU43027.1|  hypothetical protein MIMGU_mgv1a022177mg                226   6e-67    
ref|XP_010674202.1|  PREDICTED: bidirectional sugar transporter N...    226   8e-67    
dbj|BAJ99068.1|  predicted protein                                      228   9e-67    
ref|XP_004174114.1|  PREDICTED: bidirectional sugar transporter S...    223   1e-66    
ref|XP_009103141.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-66    
ref|XP_009391576.1|  PREDICTED: bidirectional sugar transporter S...    224   4e-66    
ref|NP_001149496.1|  MTN3                                               224   7e-66    
gb|KCW83110.1|  hypothetical protein EUGRSUZ_B00066                     223   9e-66    
ref|XP_006661417.1|  PREDICTED: bidirectional sugar transporter S...    222   9e-66    
gb|KDO64485.1|  hypothetical protein CISIN_1g020739mg                   221   2e-65    
ref|XP_008389034.1|  PREDICTED: bidirectional sugar transporter N...    223   2e-65    
gb|EMT31030.1|  Protein RUPTURED POLLEN GRAIN 1                         221   3e-65    
gb|KHN17480.1|  Bidirectional sugar transporter SWEET15                 222   4e-65    
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    219   7e-65    
ref|XP_002462642.1|  hypothetical protein SORBIDRAFT_02g029430          221   8e-65    
ref|NP_001288941.1|  bidirectional sugar transporter SWEET9             221   8e-65    
gb|KCW61900.1|  hypothetical protein EUGRSUZ_H04596                     221   1e-64    
gb|EAZ45313.1|  hypothetical protein OsJ_29956                          221   1e-64    
gb|EAZ09693.1|  hypothetical protein OsI_31976                          221   1e-64    
ref|XP_007148462.1|  hypothetical protein PHAVU_006G210800g             221   2e-64    
gb|EMS67211.1|  Bidirectional sugar transporter SWEET12                 222   2e-64    
ref|NP_001240121.1|  uncharacterized protein LOC100800347               220   2e-64    
gb|EMT20482.1|  Protein RUPTURED POLLEN GRAIN 1                         222   2e-64    
ref|NP_001050099.1|  Os03g0347500                                       221   2e-64    
sp|A2XGM7.1|SWT12_ORYSI  RecName: Full=Bidirectional sugar transp...    221   3e-64    
gb|AES73031.2|  sugar efflux transporter for intercellular exchan...    218   3e-64    
gb|KDP22571.1|  hypothetical protein JCGZ_26402                         219   6e-64    
ref|XP_010037372.1|  PREDICTED: bidirectional sugar transporter S...    218   1e-63    
gb|KCW61425.1|  hypothetical protein EUGRSUZ_H04154                     217   2e-63    
ref|XP_004984398.1|  PREDICTED: bidirectional sugar transporter S...    218   3e-63    
ref|XP_003524473.1|  PREDICTED: bidirectional sugar transporter S...    217   4e-63    
ref|NP_001136928.1|  hypothetical protein                               218   4e-63    
ref|XP_008218389.1|  PREDICTED: bidirectional sugar transporter N...    214   6e-63    
ref|XP_010682692.1|  PREDICTED: bidirectional sugar transporter S...    216   8e-63    
gb|KHN33482.1|  Bidirectional sugar transporter SWEET15                 216   8e-63    
emb|CDX73521.1|  BnaC08g24820D                                          216   1e-62    
ref|XP_002465280.1|  hypothetical protein SORBIDRAFT_01g035490          217   1e-62    



>ref|XP_009591687.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   409 bits (1052),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/272 (75%), Positives = 240/272 (88%), Gaps = 6/272 (2%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNIISFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIISFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
             LK+N TLLITINSFG  +ETIY+GFY++YA KKA+VQT+KML+L V+ GFGA+ LV+QF
Sbjct  63   LLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A VR QVVGW+CLVFSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEEK--  832
            YGLLLKDINIA PNVLGFIFGILQ+VLYA+Y  K++    E++LP++  P V+ ++E   
Sbjct  182  YGLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQKPEVIVVDENMN  241

Query  833  -QKLPKELTEEQIVDIVKLGSLICSDKINVAA  925
             +KLP ELT+EQI+DIVKLG L+CSDK+NVA+
Sbjct  242  SKKLP-ELTQEQIIDIVKLGLLVCSDKVNVAS  272



>ref|XP_009597195.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=291

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/271 (74%), Positives = 241/271 (89%), Gaps = 6/271 (2%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
            +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYAF
Sbjct  1    MSGHWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAF  60

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            LK+N TLLITINSFG  +ETIY+GFY++YA KKARVQT+KML+L V+ GFGA+ LV+QFL
Sbjct  61   LKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTMKMLLLSVVGGFGAIVLVTQFL  120

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            FK A VR QVVGW+CLVFSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFFY
Sbjct  121  FKGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFY  179

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE---K  832
            GLLLKDINIA PNVLGFIFGI+Q+VLY +Y  K++ +  E +LP++  P V+ ++E   K
Sbjct  180  GLLLKDINIAAPNVLGFIFGIVQIVLYVIYSKKEKANLKEPKLPEIQKPAVIVVDENMNK  239

Query  833  QKLPKELTEEQIVDIVKLGSLICSDKINVAA  925
            +K+P ELT+EQI+DIVKLG L+C+DK++VA+
Sbjct  240  KKIP-ELTQEQIIDIVKLGLLVCADKVHVAS  269



>ref|XP_009796436.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=297

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/272 (74%), Positives = 239/272 (88%), Gaps = 6/272 (2%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY I+KKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYSIFKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
             LK+N TLLITINSFG  +ETIY+GFY++YA KKA+VQT+KML+L V+ GFGA+ LV+QF
Sbjct  63   LLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A VR Q+VGW+CLVFSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-VRGQIVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEEK--  832
            YGLLLKDINIA PNVLGFIFGILQ+VLYA+Y  K++    E++LP++  P V+ ++E   
Sbjct  182  YGLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQKPAVIVVDENMN  241

Query  833  -QKLPKELTEEQIVDIVKLGSLICSDKINVAA  925
             +KLP ELT+EQI+DIVKLG L+CSDK+NVA+
Sbjct  242  SKKLP-ELTQEQIIDIVKLGLLVCSDKVNVAS  272



>ref|XP_009605549.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/281 (72%), Positives = 241/281 (86%), Gaps = 8/281 (3%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
            A+SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    AISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TL+ITINSFGC +ETIY+GFY++YA KKARVQT+KML+L V+ GFG + LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A  R Q VGW+CLVFSLCVFVAPL IV+QVI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEEK--  832
            YGLL+KDINIA+PNVLGFI GI QMVLY +Y  K++ +  E++LP+ +   V+ ++E   
Sbjct  182  YGLLVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKANLKEQKLPEKIQNHVIIVDENNS  241

Query  833  QKLPKELTEEQIVDIVKLGSLICSDKINVAAA---ACCSIQ  946
            QKLP ELTEE+I+DIVKLGSLI S KI+VA+    + C ++
Sbjct  242  QKLP-ELTEERIIDIVKLGSLISSGKIHVASCLHNSTCGVE  281



>ref|XP_009587580.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   403 bits (1036),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 199/270 (74%), Positives = 239/270 (89%), Gaps = 6/270 (2%)
 Frame = +2

Query  128  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  307
            + HW FAFGVLGNI+SFIVFLSP+PTFY+IYKKKSAEGYQSIPYV+ALFSSMLWIYYAFL
Sbjct  6    TDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYYAFL  65

Query  308  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  487
            K+N TLLITINSFG  +ETIY+GFY++YA KKARVQT+KML+L V+ GFGA+ LV+QFLF
Sbjct  66   KTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLF  125

Query  488  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYG  667
            K A VR QVVGW+CLVFSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFFYG
Sbjct  126  KGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  184

Query  668  LLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE---KQ  835
            LLLKDINIA PNVLGFIFGILQ+VLY +Y  K++    E++LP++  P+V+ L+E    +
Sbjct  185  LLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQKLPEIQKPSVILLDENMNNK  244

Query  836  KLPKELTEEQIVDIVKLGSLICSDKINVAA  925
            KLP ELT+EQI+DIVKL  L+CSDK++VA+
Sbjct  245  KLP-ELTQEQIIDIVKLSLLVCSDKVHVAS  273



>ref|XP_009794695.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   403 bits (1035),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 202/273 (74%), Positives = 240/273 (88%), Gaps = 7/273 (3%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TLLITINSFG  +ETIY+G Y++YA KKARVQT+KML+L V+ GFGA+ LV+QF
Sbjct  63   FLKTNTTLLITINSFGVFIETIYVGVYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A VR QVVGW+CLVFSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE---  829
            YGLLLKDINIA PNVLGFIFGILQ+VLY +Y  K++    E++LP++  P V+ ++E   
Sbjct  182  YGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQKLPEIQKPAVIVVDENMN  241

Query  830  KQKLPKELTEEQIVDIVKL-GSLICSDKINVAA  925
            K+KLP ELT+EQI+DIVKL G L+CSDK++VA+
Sbjct  242  KKKLP-ELTQEQIIDIVKLAGLLVCSDKVHVAS  273



>ref|XP_009605550.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/281 (72%), Positives = 239/281 (85%), Gaps = 8/281 (3%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TL+ITINSFGC +ETIY+ FY++YA KKARVQT+KMLVL V+ GFGA+ LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVSFYLFYAPKKARVQTVKMLVLSVVGGFGAIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A  R Q VGW+CLVFSLCVFVAPL IV+QVI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE--K  832
            YGLL+KDINIA+PNVLGFI GILQ+VLY +Y  K++    E++LP  +   V+ ++E   
Sbjct  182  YGLLVKDINIAIPNVLGFILGILQIVLYVIYNKKEKAILKEQKLPAKIQNHVIIVDENNN  241

Query  833  QKLPKELTEEQIVDIVKLGSLICSDKINVAAA---ACCSIQ  946
            QKLP ELTEEQI+DIVKLGSLI S KI+VA+    + C ++
Sbjct  242  QKLP-ELTEEQIIDIVKLGSLISSGKIHVASCLHNSTCGVE  281



>ref|XP_009787633.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/273 (74%), Positives = 240/273 (88%), Gaps = 7/273 (3%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TLLITINSFG  +ETIY+GFY++YA KKA+VQT+KML+L V+ GFGA+ LV+QF
Sbjct  63   FLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A VR QVVGW+CLVFSLCVF+APL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-VRGQVVGWICLVFSLCVFIAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE---  829
            YGLLLKDINIA PNVLGFIFGILQ+VLY +Y  K++    E++LP++  P V+ + E   
Sbjct  182  YGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQKLPEIQKPAVIVVGENMN  241

Query  830  KQKLPKELTEEQIVDIVKL-GSLICSDKINVAA  925
            K+KLP ELT+EQI+DIVKL G L+CSDK++VA+
Sbjct  242  KKKLP-ELTQEQIIDIVKLAGLLVCSDKVHVAS  273



>ref|XP_009758167.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   400 bits (1027),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/271 (73%), Positives = 237/271 (87%), Gaps = 5/271 (2%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
            A+SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLW+YYA
Sbjct  3    AISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWVYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TL+ITINSFGC +ETIY+GFY++YA KKAR+QT+KMLVL V+ GFG + LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARIQTVKMLVLSVVGGFGVIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A  R Q VGW+CLVFSLCVFVAPL IV+QVI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE--K  832
            YGLL+KDINIA+PNVLGF+ GILQ+VLY +Y  K++    E+++P+ +   V+ +++   
Sbjct  182  YGLLVKDINIAIPNVLGFVLGILQIVLYVIYNKKEKAILKEEKVPEKIQNHVIIVDDYNN  241

Query  833  QKLPKELTEEQIVDIVKLGSLICSDKINVAA  925
            QKLP ELTEEQI+DIVKLGSLI S KI+VA+
Sbjct  242  QKLP-ELTEEQIIDIVKLGSLISSGKIHVAS  271



>ref|XP_009758165.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/281 (71%), Positives = 239/281 (85%), Gaps = 8/281 (3%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNIISFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIISFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TL+ITINSFGC +ETIY+GFY++YA KKARVQT+KML+L V+ GFG + LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTLKMLLLSVVGGFGVIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A  R Q VGW+CLVFSLCVFVAPL IV+QVI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE--K  832
            YGLL+KDINIA+PN+LGFI GILQ+VLY +Y  K++    E++LP+ +   V+ ++E   
Sbjct  182  YGLLVKDINIAIPNILGFILGILQIVLYIIYNKKEKAILKEQKLPEKIQNHVIIVDENNN  241

Query  833  QKLPKELTEEQIVDIVKLGSLICSDKINVAAA---ACCSIQ  946
            QKLP ELTEE I+DIVKLGSLI S KI+VA+    + C ++
Sbjct  242  QKLP-ELTEEHIIDIVKLGSLISSGKIHVASCLHNSTCGVE  281



>ref|XP_009762335.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
sylvestris]
Length=299

 Score =   398 bits (1023),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 198/271 (73%), Positives = 236/271 (87%), Gaps = 7/271 (3%)
 Frame = +2

Query  128  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  307
            + HW FAFGVLGNI+SFIVFLSP+PTFY+IYKKKSAEGYQSIPYV+ALFSSMLWIYYAFL
Sbjct  6    TDHWAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYYAFL  65

Query  308  KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLF  487
            K+N TLLITINSFG  +ETIY+GFY++YA KKARVQT+KML+L V+ GFGA+ LV+QFLF
Sbjct  66   KTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLF  125

Query  488  KSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYG  667
            K A VR QVVGW+CLVFSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFFYG
Sbjct  126  KGA-VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  184

Query  668  LLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE----K  832
            LLLKDINIA PNVLGFIFGILQ+VLY +Y  K+     E++LP++    V+ L+E     
Sbjct  185  LLLKDINIAAPNVLGFIFGILQIVLYVIYSKKENAILKEQKLPEIQKQAVILLDENMNNN  244

Query  833  QKLPKELTEEQIVDIVKLGSLICSDKINVAA  925
            +KLP ELT+EQI+DIVKLG ++CSDK +VA+
Sbjct  245  KKLP-ELTQEQIIDIVKLGLMVCSDKAHVAS  274



>ref|XP_009758166.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 198/271 (73%), Positives = 234/271 (86%), Gaps = 5/271 (2%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TL+ITINSFGC +ETIY+GFY++YA KKARVQT+KML+L V+ GFG + LV+QF
Sbjct  63   FLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A  R Q VGW+CLVFSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-ARGQAVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE--K  832
            YGLL+KDINIA+PNVLGFI GI QMVLY +Y  K++    E++L + +   V+ ++E   
Sbjct  182  YGLLVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKAILKEQKLSEKIQNHVIIVDENNN  241

Query  833  QKLPKELTEEQIVDIVKLGSLICSDKINVAA  925
            QKLP ELTEEQI+DIVKLGSLI S KI+VA+
Sbjct  242  QKLP-ELTEEQIIDIVKLGSLISSGKIHVAS  271



>ref|XP_006347635.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=286

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 195/273 (71%), Positives = 232/273 (85%), Gaps = 9/273 (3%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA+SGHW F FGVLGNIISFIVFLSP+PTF +IYKKKS EGYQSIPYV+ALFS MLWIYY
Sbjct  1    MAISGHWAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            AFLK+N TLLITINSFG L+ETIY+G ++YYA KKARV T+KML+L V+ GFGA+ +V+Q
Sbjct  61   AFLKTNTTLLITINSFGMLIETIYVGLFLYYAPKKARVNTVKMLLLTVVGGFGAIIVVTQ  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            F+FK   VR Q+VGW+CL+FSLCVFVAPL IV+QVI+TKSVE+MPILLSVFLT+SAVMWF
Sbjct  121  FVFKGV-VRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQV---VLPTVVALEE  829
            FYGLLLKD+NIA PN+LGFIFGILQM+LYAMY+ K    D K +  V   V   V+ L++
Sbjct  180  FYGLLLKDVNIAAPNILGFIFGILQMILYAMYRKK----DNKPIVNVNVEVQNPVIILDD  235

Query  830  KQKLPKELTEEQIVDIVKLGSLICSDKINVAAA  928
             +K+P ELTEEQI+DIVKLG L+CS KI +A+ 
Sbjct  236  NKKIP-ELTEEQIIDIVKLGKLVCSGKIQMAST  267



>ref|XP_009599477.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=282

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/272 (72%), Positives = 231/272 (85%), Gaps = 4/272 (1%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA+SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYV+ALFSSMLWIYY
Sbjct  1    MAISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            AFLK+N TLLITINSFG  +ETIY+GFY++YA KKARVQT+KML+L V+ GFGA+ L++Q
Sbjct  61   AFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLTVVAGFGAIILIAQ  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FLFK    R QVVGWVCLVFSLCVFVAPLCIV++VI+TKSVE MP+LLSVFLT+SAVMWF
Sbjct  121  FLFKGV-ARGQVVGWVCLVFSLCVFVAPLCIVRKVIKTKSVEFMPLLLSVFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEEKQ  835
            FYGLLLKDINIA PN+LG IFGILQ+VLY +Y  K++    E+ LP++    V+ L++ +
Sbjct  180  FYGLLLKDINIAAPNILGLIFGILQIVLYVIYNKKEKHILKEQNLPELQ-NHVIILDDNK  238

Query  836  KLPKELTEEQIVDIVKLGSLICSDKINVAAAA  931
            KLP ELTEE  +DI+KLG L+ S   N  AAA
Sbjct  239  KLP-ELTEEHKIDILKLGKLVSSLHENACAAA  269



>ref|XP_004235339.1| PREDICTED: bidirectional sugar transporter SWEET10 [Solanum lycopersicum]
Length=282

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/274 (70%), Positives = 231/274 (84%), Gaps = 12/274 (4%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA++GHW F FGVLGNIISFIVFLSP+PTF +IYKKKS EGYQSIPYV+ALFS MLWIYY
Sbjct  1    MAIAGHWAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            AFLK+N TLLITINSFG L+ETIY+  ++YYA KKARV T+KML+L V+ GFGA+ LV+Q
Sbjct  61   AFLKTNTTLLITINSFGMLIETIYVSLFLYYAPKKARVNTVKMLLLTVVGGFGAIILVTQ  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FLFK   VR Q+VGW+CL+FSLCVFVAPL IV+QVI+TKSVE+MPILLSVFLT+SAVMWF
Sbjct  121  FLFKGV-VRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE----DDEKRLPQVVLPTVVALE  826
            FYGLLLKD+NIA PN+LGFIFGILQM+LYAMY+ K +     + E + P      V+ L+
Sbjct  180  FYGLLLKDVNIAAPNILGFIFGILQMILYAMYRKKHKPIVNVNVEVQNP------VIILD  233

Query  827  EKQKLPKELTEEQIVDIVKLGSLICSDKINVAAA  928
            + +K+P ELTEEQI+DIVKLG L+CS KI +A+ 
Sbjct  234  DNKKIP-ELTEEQIIDIVKLGKLVCSGKIQMAST  266



>ref|XP_009614916.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X2 [Nicotiana tomentosiformis]
Length=298

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/270 (73%), Positives = 227/270 (84%), Gaps = 7/270 (3%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
             SGHW F FGVLGNI+SF VFLSPLPTFY+IY+KKS EGYQSIPYVVALFS+MLWIYYAF
Sbjct  4    FSGHWAFTFGVLGNIVSFFVFLSPLPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIYYAF  63

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            LKSN TLLITINSFGC VETIY+GFY++YA KKARVQT+K+L+L V  GFGA+ LV+QFL
Sbjct  64   LKSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLVTQFL  123

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            FK   VR QVVGW+CLVFSLCVFV+PLCI++QVI+TKS E+MP  LSVFLT+SAVMWFFY
Sbjct  124  FKGV-VRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVMWFFY  182

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE--DDEKRLPQVVLPTVVALEEKQK  838
            GLLLKD NIA+PNVLGFI GILQMVLY MY  KK+E    E + P+ +   V+ L   + 
Sbjct  183  GLLLKDFNIAIPNVLGFILGILQMVLYVMY-NKKEEVIVKEHKFPE-LQNHVIILHNDKN  240

Query  839  LPKELTEEQIVDIVKLGSLI-CSDKINVAA  925
            LP ELTEEQI+DIVKL SLI C++K NVA+
Sbjct  241  LP-ELTEEQIIDIVKLASLISCTEKFNVAS  269



>ref|XP_006347633.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 237/288 (82%), Gaps = 10/288 (3%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +S HW FAFGVLGNI+SFIVFLSP+PTFY IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISNHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
             LK+N  LLITINSFG  +ETIY+G Y++YA KKARVQT+KML+L V+ GFGA+ LV++ 
Sbjct  63   LLKTNMPLLITINSFGMFIETIYVGLYLFYAPKKARVQTVKMLMLSVVGGFGAIILVTEL  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A +R QVVGW+CL+FSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-IRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE---  829
            YGLLLKDINIA PNVLGFIFGILQ+VLYA+Y  K++    E++LP++  P V+  +E   
Sbjct  182  YGLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQKLPEIQTPGVIVKDENMH  241

Query  830  -KQKLPKELTEEQIVDIVKLGSLICSDKINVAAA---ACCSIQDKLLH  961
              +KLP ELT+EQI+DIVKLG L+CSDK  VA       C I + +++
Sbjct  242  TNKKLP-ELTQEQIIDIVKLGLLVCSDKTQVATCPNDTNCGINNNVVN  288



>ref|XP_004241452.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
lycopersicum]
Length=287

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/264 (73%), Positives = 232/264 (88%), Gaps = 3/264 (1%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
              S HW FAFGVLGNIISF VFLSPLPTFY IYKKKS EGYQSIPYVVALFS+MLWIYYA
Sbjct  3    GFSDHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TLL+TIN+FGC +ET+Y+GFY++YA KKARVQTIK+L+LLV+ GFGA+ L++QF
Sbjct  63   FLKTNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIILITQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A +RAQ+VGW+CLVFSLCVFVAPLCIV+QVI+TKSVE+MP LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-IRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMY-KGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            YGLLLKD NIA+PNVLGFIFGILQM+LY MY K +K    E+ LP++    ++  ++K+K
Sbjct  182  YGLLLKDFNIAIPNVLGFIFGILQMILYVMYNKKEKVVIKEQNLPELKDHVIIIEDDKKK  241

Query  839  LPKELTEEQIVDIVKLGSLICSDK  910
            LP EL+EEQI++I+KLGSL+ SDK
Sbjct  242  LP-ELSEEQIINIIKLGSLVYSDK  264



>ref|XP_006347346.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=287

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/283 (70%), Positives = 240/283 (85%), Gaps = 6/283 (2%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
              S HW FAFGVLGNIISF VFLSPLPTFY IYKKKS EGYQSIPYVVALFS+MLWIYYA
Sbjct  3    GFSDHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TLL+TIN+FGC +ET+Y+GFY++YA KKARVQTIK+L+LLV+ GFGA+ LV+QF
Sbjct  63   FLKTNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A +RAQ+VGW+CLVFSLCVFVAPLCIV+QVI+TKSVE+MP LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-IRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE--DDEKRLPQVVLPTVVALEEKQ  835
            YGLLLKD NIA+PNVLGFIFGILQM+LY MY  KK+E    E+ LP++    ++  ++K+
Sbjct  182  YGLLLKDFNIAIPNVLGFIFGILQMILYVMY-NKKEEVVIKEQNLPELKDHVIILEDDKK  240

Query  836  KLPKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQDKLLHQ  964
            KLP EL+EEQI++I+KLGSL+ S+K N       +  DK++ +
Sbjct  241  KLP-ELSEEQIINIMKLGSLVYSEK-NYGNLNEVAKNDKVVSK  281



>ref|XP_006347634.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/275 (70%), Positives = 233/275 (85%), Gaps = 8/275 (3%)
 Frame = +2

Query  119  MALSG-HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MA S  HW F FGVLGNI+SFIVFLSPLPTFY IYKKK+AEGYQSIPYVVALFSSMLWIY
Sbjct  1    MAFSADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YAFLK+N TLLITIN+FG  +ETIY+GFY++YA KK+RVQTIKML L V+ GFGA+ LV+
Sbjct  61   YAFLKTNTTLLITINTFGVFIETIYVGFYLFYAPKKSRVQTIKMLSLFVVGGFGAIILVT  120

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
            +FLFK A +R QVVGW+CL+FSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMW
Sbjct  121  EFLFKGA-IRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE-  829
            FFYGLLLKDINIA PN+LGFIFGILQM+LY +Y  K++    E++LP++    V+  +E 
Sbjct  180  FFYGLLLKDINIAAPNILGFIFGILQMILYVIYSKKEKAILKEQKLPEIQKAEVIVKDEN  239

Query  830  ---KQKLPKELTEEQIVDIVKLGSLICSDKINVAA  925
                +K P ELT+EQI+DIV+LG ++C DK++VA 
Sbjct  240  MNTNKKFP-ELTQEQIIDIVRLGLMVCKDKVHVAT  273



>ref|XP_009802608.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
 ref|XP_009792803.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=293

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/283 (69%), Positives = 233/283 (82%), Gaps = 15/283 (5%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA+SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYV+ALFSSMLWIYY
Sbjct  1    MAISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            AFLK+N TLLITINSFG  +ETIY+GFY++YA KKAR+QT+KML L V+ GFGA+ L++Q
Sbjct  61   AFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQ  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIV-----------KQVIRTKSVEHMPILLS  625
            FLFK    R QVVGWVCLVFSLCVFVAPLCIV           ++VI+TKSVE+MP+LLS
Sbjct  121  FLFKGV-ARGQVVGWVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLLS  179

Query  626  VFLTVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVV  802
            VFLT+SAVMWFFYGLLLKDINIA PN+LGFIFGILQ+VLY +Y  K++    E+ LP++ 
Sbjct  180  VFLTLSAVMWFFYGLLLKDINIAAPNILGFIFGILQIVLYVIYNKKEKHILKEQNLPELQ  239

Query  803  LPTVVALEEKQKLPKELTEEQIVDIVKLGSLICSDKINVAAAA  931
               V+ L++ +KLP ELTEEQ +DI+KL  L+ S   N +AAA
Sbjct  240  -NHVIILDDNKKLP-ELTEEQKIDIMKLSKLVSSLHENASAAA  280



>ref|XP_004235342.2| PREDICTED: uncharacterized protein LOC101265905 [Solanum lycopersicum]
Length=599

 Score =   396 bits (1018),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 241/284 (85%), Gaps = 8/284 (3%)
 Frame = +2

Query  110  DRSMA-LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSML  286
            + SMA +SGHW FAFGVLGNI+SFIVFLSPLPTFY+IYKKKS +GYQSIPYVVALFSSML
Sbjct  300  EASMAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTDGYQSIPYVVALFSSML  359

Query  287  WIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  466
            WIYYAFLK+N TLLITINSFG  +ETIY+GFY++YA KK RVQTIKML+L V+ GFGA+ 
Sbjct  360  WIYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIV  419

Query  467  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSA  646
            L+++FLFK   VR Q+VGW+CL+FSLCVFVAPL IVKQVI+TKSVE+MP+LLS+FLT+SA
Sbjct  420  LITEFLFKGV-VRGQIVGWICLIFSLCVFVAPLGIVKQVIKTKSVEYMPLLLSIFLTLSA  478

Query  647  VMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLP-TVVA  820
            V+WFFYGLLLKDINIA+PNVLGFI GILQMVLY +Y  K++    E++LP+ +    +++
Sbjct  479  VVWFFYGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEKAILKEQKLPEKLQNHMIIS  538

Query  821  LEEKQKLPKELTEEQIVDIVKLGSLICSDKINVAA----AACCS  940
            ++EK K    LTEEQI+DIVKLGSLI S KI++A+    A C S
Sbjct  539  MDEKNKNSPGLTEEQIIDIVKLGSLISSGKIHIASCLHDAMCAS  582


 Score =   380 bits (977),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 192/285 (67%), Positives = 235/285 (82%), Gaps = 12/285 (4%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFG+LGNIISFIVFLSP+PTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGILGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
             LK+N TLLITINSFG  +ETIY+GFY++YA KK RVQTIKML+L V+ GFGA+ LV++F
Sbjct  63   LLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLVTEF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK   VR QVVGW+CL+FSLCVFVAPL IV+QVI+TKSVE+MP+LLS+FLT+SAV+WFF
Sbjct  123  LFKGV-VRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSIFLTLSAVVWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE---  829
            YGLLLKDINIA PNVLGFIFGILQ+VLY +Y  K++    E++LP++    V+  ++   
Sbjct  182  YGLLLKDINIAAPNVLGFIFGILQIVLYVIYNKKEKVILKEQKLPEIQKAAVIVSDDNTN  241

Query  830  -KQKLPKELTEEQIVDIVKLGSLIC-SDKINVAAA----ACCSIQ  946
              +KLP ELT+EQI+DIV+L  L+  +DK+ VA      A C ++
Sbjct  242  VNKKLP-ELTQEQIIDIVRLAGLLANTDKVQVATCPHDHANCGVK  285



>ref|XP_009614915.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana tomentosiformis]
Length=302

 Score =   385 bits (990),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/274 (72%), Positives = 227/274 (83%), Gaps = 11/274 (4%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPL----PTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  292
             SGHW F FGVLGNI+SF VFLSPL    PTFY+IY+KKS EGYQSIPYVVALFS+MLWI
Sbjct  4    FSGHWAFTFGVLGNIVSFFVFLSPLYVRRPTFYKIYRKKSTEGYQSIPYVVALFSAMLWI  63

Query  293  YYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  472
            YYAFLKSN TLLITINSFGC VETIY+GFY++YA KKARVQT+K+L+L V  GFGA+ LV
Sbjct  64   YYAFLKSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLV  123

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            +QFLFK   VR QVVGW+CLVFSLCVFV+PLCI++QVI+TKS E+MP  LSVFLT+SAVM
Sbjct  124  TQFLFKGV-VRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVM  182

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE--DDEKRLPQVVLPTVVALE  826
            WFFYGLLLKD NIA+PNVLGFI GILQMVLY MY  KK+E    E + P+ +   V+ L 
Sbjct  183  WFFYGLLLKDFNIAIPNVLGFILGILQMVLYVMY-NKKEEVIVKEHKFPE-LQNHVIILH  240

Query  827  EKQKLPKELTEEQIVDIVKLGSLI-CSDKINVAA  925
              + LP ELTEEQI+DIVKL SLI C++K NVA+
Sbjct  241  NDKNLP-ELTEEQIIDIVKLASLISCTEKFNVAS  273



>ref|XP_004235334.1| PREDICTED: bidirectional sugar transporter SWEET12 [Solanum lycopersicum]
Length=298

 Score =   385 bits (989),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/282 (69%), Positives = 229/282 (81%), Gaps = 11/282 (4%)
 Frame = +2

Query  131  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  310
             HW FAFGVLGNI+SFIVFLSP+PTFY IYKKKS EGYQSIPYVVALFSSMLWIYYA LK
Sbjct  4    NHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  63

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
            SN  LLITINSFG  +ETIY+G Y+ YA  KARV TIKML+L V+ GFGA+ L+++FLFK
Sbjct  64   SNMPLLITINSFGMFIETIYVGLYLLYAPNKARVHTIKMLMLSVVGGFGAIVLITEFLFK  123

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
               VR Q+VGW+CL+FSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMWFFYGL
Sbjct  124  GV-VRGQIVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  182

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEEK-----  832
            LLKDINIA PNVLGFIFGILQ+VLYA+Y  K++    E++LP++  P V+   E      
Sbjct  183  LLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQKLPEIQTPAVIVKNENMMNTT  242

Query  833  QKLPKELTEEQIVDIVKLGSLICSDKINVAAA---ACCSIQD  949
            +KLP ELT+EQI+DIVKLG L+CSDK  VA       C ++D
Sbjct  243  KKLP-ELTQEQIIDIVKLGLLVCSDKTQVATCPNDTNCGVKD  283



>ref|XP_006363981.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=300

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/271 (72%), Positives = 230/271 (85%), Gaps = 8/271 (3%)
 Frame = +2

Query  131  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  310
            GH+ FAFGVLGNI+SFIVFLSP+PTFY IYKKKS EGYQSIPYVVALFSSMLWIYYA LK
Sbjct  6    GHYAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  65

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
            SN  LLITINSFG  +ETIY+GFY++YA KKARV TIKML+L V+ GFGA+ LV++FLFK
Sbjct  66   SNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFK  125

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
               VR Q+VGWVCL+FSLCVFVAPL IV+QVI+TKSVE+MP+LLSVFLT+SAVMWFFYGL
Sbjct  126  GV-VRGQIVGWVCLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE-DDEKRLPQVVLPTVVALEE----KQ  835
            LLKDINIA PNVLGFIFGILQ++LYA+Y  K++    E++LP++  P V+  +E     +
Sbjct  185  LLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEMQKPEVIVKDENMNANK  244

Query  836  KLPKELTEEQIVDIVKL-GSLICSDKINVAA  925
            KLP ELT+EQI+DIVKL G L+ +DK NVA 
Sbjct  245  KLP-ELTQEQIIDIVKLAGLLVVTDKANVAT  274



>gb|ACV71016.1| UPA16 [Capsicum annuum]
Length=301

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/274 (70%), Positives = 232/274 (85%), Gaps = 8/274 (3%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNIISFIVFLSP+PTFY IYKKK+AEGYQSIPYV+ALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIISFIVFLSPIPTFYTIYKKKTAEGYQSIPYVIALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TLLITINSFG  +ETIY+G Y++YA KKARV T+KML+L V+ GFGA+ LV+QF
Sbjct  63   FLKTNVTLLITINSFGIFIETIYVGLYLFYAPKKARVHTVKMLLLTVVGGFGAIVLVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK   VR Q+VGW+CL+F+L VFVAPL IV+QVI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGV-VRGQIVGWICLIFALSVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE---  829
            YGLLLKDINIA PNVLGFIFG+LQ+VLYA+Y  K++    E++LP++  P V+  ++   
Sbjct  182  YGLLLKDINIAAPNVLGFIFGVLQIVLYAIYSKKEKVILKEQKLPEIQKPAVIVADDNTN  241

Query  830  -KQKLPKELTEEQIVDIVKL-GSLICSDKINVAA  925
              +KLP ELT EQI+DIVKL G L C++K +VA 
Sbjct  242  ANKKLP-ELTHEQIIDIVKLAGLLTCTEKSHVAT  274



>ref|XP_004235326.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=300

 Score =   382 bits (981),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 194/271 (72%), Positives = 229/271 (85%), Gaps = 8/271 (3%)
 Frame = +2

Query  131  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  310
            GH+ FAFGVLGNIISFIVFLSP+PTFY IYKKKS EGYQSIPYVVALFSSMLWIYYA LK
Sbjct  6    GHYAFAFGVLGNIISFIVFLSPIPTFYSIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  65

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
            SN  LLITINSFG  +ETIY+GFY++YA KKARV TIKML+L V+ GFGA+ LV++FLFK
Sbjct  66   SNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFK  125

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
               VR Q+VGW+CL+FSLCVFVAPL IV+QVI+TKSVE+MP+LLSVFLT+SAVMWFFYGL
Sbjct  126  GV-VRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGL  184

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE-DDEKRLPQVVLPTVVALEE----KQ  835
            LLKDINIA PNVLGFIFGILQ++LYA+Y  K++    E++LP++    V+  +E     +
Sbjct  185  LLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEIQKTEVIVKDENMNANK  244

Query  836  KLPKELTEEQIVDIVKL-GSLICSDKINVAA  925
            KLP ELT+EQI+DIVKL G L+ +DK NVA 
Sbjct  245  KLP-ELTQEQIIDIVKLAGLLVVTDKTNVAT  274



>ref|XP_006347347.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
tuberosum]
Length=289

 Score =   380 bits (975),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 198/269 (74%), Positives = 232/269 (86%), Gaps = 6/269 (2%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
             S HWVFAFGVLGNI+SF VFLSPLPTF ++YKK S EGYQSIPYVVALFS+MLWIYYAF
Sbjct  4    FSVHWVFAFGVLGNIVSFFVFLSPLPTFCKMYKKNSTEGYQSIPYVVALFSAMLWIYYAF  63

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            LK+N TLLITIN+FGC VE IY+GFY++YA+K+ARVQTIK+L+LLV+ GFGA+ LVSQFL
Sbjct  64   LKTNTTLLITINTFGCFVEIIYVGFYLFYASKEARVQTIKLLLLLVVGGFGAIVLVSQFL  123

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            F+ A VR QVVGW+CLV SLCVFVAPLCIVKQVI+TKSVE+MP LLSVFLT+SAVMWFFY
Sbjct  124  FEGA-VRVQVVGWICLVCSLCVFVAPLCIVKQVIKTKSVEYMPFLLSVFLTLSAVMWFFY  182

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED--DEKRLPQVVLPTVVALEEKQK  838
            GLLLKD NIA+PNVLGFIFGILQMVLY MY  KK+E+   E+ LP++    V+ L   +K
Sbjct  183  GLLLKDFNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEQNLPELK-NHVIILHNDKK  241

Query  839  LPKELTEEQIVDIVKLGSLI-CSDKINVA  922
             P EL+EEQI++IVKLGSLI C+ K ++A
Sbjct  242  FP-ELSEEQIIEIVKLGSLISCTQKFDLA  269



>ref|XP_006347652.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=482

 Score =   386 bits (991),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/289 (68%), Positives = 237/289 (82%), Gaps = 13/289 (4%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
             +SGHW FAFGVLGNIISFIVFLSP+PTFY+IYKKKS EGYQSIPYVVALFSSMLWIYYA
Sbjct  3    GISGHWAFAFGVLGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLK+N TLLITIN+FG  +ETIY+GFY++YA KKARVQTIKML L V+ GFGA+ +V+QF
Sbjct  63   FLKTNTTLLITINTFGVFIETIYVGFYLFYAPKKARVQTIKMLSLFVVGGFGAIIVVTQF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            LFK A +R QVVGW+CL+FSLCVFVAPL IV+QVI+TKSVE+MP+LLSVFLT+SAVMWFF
Sbjct  123  LFKGA-IRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEE---  829
            YGLLLKDINIA PNVLGF FGILQ+VLY +Y  K++    E++LP++    V+  ++   
Sbjct  182  YGLLLKDINIAAPNVLGFFFGILQIVLYVIYSKKEKAILKEQKLPEIQKAAVIVSDDNTN  241

Query  830  --KQKLPKELTEEQIVDIVKLGSLIC-SDKINVAAA----ACCSIQDKL  955
               +KLP ELT+EQI+DIV+L  L+  +DK+ VA      A C I+  L
Sbjct  242  VANKKLP-ELTQEQIIDIVRLAGLLANTDKVQVATCPHDHANCGIKKCL  289


 Score =   196 bits (498),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 132/162 (81%), Gaps = 8/162 (5%)
 Frame = +2

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            ++FLFK A VR QVVGW+CL+FSLCVFVAPL I +QVI+TKSVE+MP+LLS+FLT+SAV+
Sbjct  306  TEFLFKGA-VRGQVVGWICLIFSLCVFVAPLGI-RQVIKTKSVEYMPLLLSIFLTLSAVV  363

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLP-TVVALE  826
            WFFYGLLLKDINIA+PNVLGFI GILQMVLY +Y  K++    E++LP+ +    +++++
Sbjct  364  WFFYGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEKAILKEQKLPEKLQNHMIISID  423

Query  827  EKQKLPKELTEEQIVDIVKLGSLICSDKINVAA----AACCS  940
            EK K   ELTEEQI+DIVKLGSLI S KI++A+    A C S
Sbjct  424  EKNKNFPELTEEQIIDIVKLGSLISSGKIHIASCLHDAVCAS  465



>ref|XP_004235333.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
lycopersicum]
Length=296

 Score =   379 bits (972),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/275 (69%), Positives = 229/275 (83%), Gaps = 8/275 (3%)
 Frame = +2

Query  119  MALSG-HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MA S  HW F FGVLGNI+SFIVFLSPLPTFY IYKKK+AEGYQSIPYVVALFSSMLWIY
Sbjct  1    MAFSADHWAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YAFLK+N TLLITIN+FG  VETIY+ FY+ YA KK+RVQTIKML L V+ GFGA+ LV+
Sbjct  61   YAFLKTNTTLLITINTFGVFVETIYVVFYLIYAPKKSRVQTIKMLSLFVVGGFGAIILVT  120

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
            QFLFK   +R QVVGW+CL+FSLCVFVAPL IV++VI+TKSVE+MP+LLSVFLT+SAVMW
Sbjct  121  QFLFKGV-IRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEEK  832
            FFYGLLLKDINIA PN+LGFIFG+LQM+LY +Y  K++    E++LP++    V+  +E 
Sbjct  180  FFYGLLLKDINIAAPNILGFIFGVLQMILYVIYSKKEKAILKEQKLPEIQKGEVIVKDEN  239

Query  833  ----QKLPKELTEEQIVDIVKLGSLICSDKINVAA  925
                +K P ELT+EQI+DIV+LG ++C  K++VA 
Sbjct  240  MNADKKFP-ELTQEQIIDIVRLGLMVCKGKVHVAT  273



>ref|XP_009802194.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana sylvestris]
Length=298

 Score =   377 bits (968),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 191/270 (71%), Positives = 223/270 (83%), Gaps = 7/270 (3%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
             SGHW F FGVLGNI+SF VFLSPLPTFY+IYKKKS E YQSIPYVVALFS+M WIYYAF
Sbjct  4    FSGHWAFTFGVLGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAF  63

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            LKSN TLLITINSFGC +ETIY+GFY++YA KKARVQT+K+L+L V  GFGA+ LV+Q L
Sbjct  64   LKSNTTLLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLL  123

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            FK   VR QVVGW+CLVFSLCVFV+PLCI++QVI+TKSVE+MP  +SVFLT+SAV WFFY
Sbjct  124  FKGV-VRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFY  182

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE--DDEKRLPQVVLPTVVALEEKQK  838
            GLLLKD NIA+PNVLGFI GILQMV Y +Y  KK+E    E + P+ +   V+ L   + 
Sbjct  183  GLLLKDFNIAIPNVLGFIVGILQMVFYVIYY-KKEEVIVKEHKFPE-IQNHVIILHNDKN  240

Query  839  LPKELTEEQIVDIVKLGSLI-CSDKINVAA  925
            LP ELTEEQI+DIVKLGSLI C++  NVA+
Sbjct  241  LP-ELTEEQIIDIVKLGSLISCTEIFNVAS  269



>ref|XP_009794853.1| PREDICTED: bidirectional sugar transporter SWEET9-like, partial 
[Nicotiana sylvestris]
Length=282

 Score =   361 bits (926),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 184/269 (68%), Positives = 220/269 (82%), Gaps = 15/269 (6%)
 Frame = +2

Query  161  GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITIN  340
            GNI+SFIVFLSPLPTFY+IYKKKS EGYQSIPYV+ALFSSMLWIYYAFLK+N TLLITIN
Sbjct  4    GNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTNTTLLITIN  63

Query  341  SFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVG  520
            SFG  +ETIY+GFY++YA KKAR+QT+KML L V+ GFGA+ L++QFLFK    R QVVG
Sbjct  64   SFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQFLFKGV-ARGQVVG  122

Query  521  WVCLVFSLCVFVAPLCIV-----------KQVIRTKSVEHMPILLSVFLTVSAVMWFFYG  667
            WVCLVFSLCVFVAPLCIV           ++VI+TKSVE+MP+LLSVFLT+SAVMWFFYG
Sbjct  123  WVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  182

Query  668  LLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLPTVVALEEKQKLP  844
            LLLKDINIA PN+LGFIFGILQ+VLY +Y  K++    E+ LP++    V+ L++ +KLP
Sbjct  183  LLLKDINIAAPNILGFIFGILQIVLYVIYNKKEKHILKEQNLPELQ-NHVIILDDNKKLP  241

Query  845  KELTEEQIVDIVKLGSLICSDKINVAAAA  931
             ELTEEQ +DI+KL  L+ S   N +AAA
Sbjct  242  -ELTEEQKIDIMKLSKLVSSLHENASAAA  269



>ref|XP_004242139.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Solanum 
lycopersicum]
Length=289

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 229/268 (85%), Gaps = 6/268 (2%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
             S HWVFAFGVLGNIISF VFLSPLPTFY++YKKKS EGYQSIPY+VALFS+MLWIYYAF
Sbjct  4    FSVHWVFAFGVLGNIISFFVFLSPLPTFYKMYKKKSTEGYQSIPYIVALFSAMLWIYYAF  63

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            LK+N TLLITIN+FGC VE +YIGFY++YA+K+ARVQT+K+L+LLV+ GFGA+ LVSQFL
Sbjct  64   LKTNTTLLITINTFGCFVEIMYIGFYLFYASKEARVQTVKLLLLLVVGGFGAIVLVSQFL  123

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            F+ A VR QVVG +CL+ SLCVFVAPLCIV+QVI+TKSVE+MP LLSVFLT+SAVMWFFY
Sbjct  124  FEGA-VRVQVVGCICLICSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFFY  182

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKG--KKQEDDEKRLPQVVLPTVVALEEKQK  838
            G+LL+D NIA+PNVLGFIFGILQMVLY MY    +++   EK LP +    V+ L   +K
Sbjct  183  GILLEDFNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEKNLPDLK-NHVIILHNDKK  241

Query  839  LPKELTEEQIVDIVKLGSLI-CSDKINV  919
             P EL+EEQI++IVKLGSLI C+ K ++
Sbjct  242  FP-ELSEEQIIEIVKLGSLISCTQKFDL  268



>ref|XP_009802195.1| PREDICTED: bidirectional sugar transporter SWEET9-like isoform 
X2 [Nicotiana sylvestris]
Length=297

 Score =   356 bits (914),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 183/263 (70%), Positives = 215/263 (82%), Gaps = 7/263 (3%)
 Frame = +2

Query  146  AFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATL  325
             F   GNI+SF VFLSPLPTFY+IYKKKS E YQSIPYVVALFS+M WIYYAFLKSN TL
Sbjct  10   GFPFAGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLKSNTTL  69

Query  326  LITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVR  505
            LITINSFGC +ETIY+GFY++YA KKARVQT+K+L+L V  GFGA+ LV+Q LFK   VR
Sbjct  70   LITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFKGV-VR  128

Query  506  AQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDI  685
             QVVGW+CLVFSLCVFV+PLCI++QVI+TKSVE+MP  +SVFLT+SAV WFFYGLLLKD 
Sbjct  129  VQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFYGLLLKDF  188

Query  686  NIAVPNVLGFIFGILQMVLYAMYKGKKQE--DDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            NIA+PNVLGFI GILQMV Y +Y  KK+E    E + P+ +   V+ L   + LP ELTE
Sbjct  189  NIAIPNVLGFIVGILQMVFYVIYY-KKEEVIVKEHKFPE-IQNHVIILHNDKNLP-ELTE  245

Query  860  EQIVDIVKLGSLI-CSDKINVAA  925
            EQI+DIVKLGSLI C++  NVA+
Sbjct  246  EQIIDIVKLGSLISCTEIFNVAS  268



>ref|XP_009614917.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=286

 Score =   353 bits (906),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 181/277 (65%), Positives = 226/277 (82%), Gaps = 3/277 (1%)
 Frame = +2

Query  122  ALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
             +S H W  AFGVLG+I+SFIVFLSPLPTFY IYKKKS EGYQSIPYVVALFS +LWIYY
Sbjct  3    GISVHVWASAFGVLGDIVSFIVFLSPLPTFYTIYKKKSTEGYQSIPYVVALFSCILWIYY  62

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A L SN   +ITIN+FGC +ETIY+GFY++YA KKARVQT+KML+LLV+ GFGA+ LV+Q
Sbjct  63   ALLMSNMIFIITINTFGCFIETIYVGFYLFYAPKKARVQTVKMLLLLVLGGFGAIVLVTQ  122

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FLFK A VR Q+VGW+CLVFSLC F APLCIV++VI+TKSVE+MP LLS FLT+SAVMWF
Sbjct  123  FLFKGA-VRGQIVGWICLVFSLCTFAAPLCIVRKVIKTKSVEYMPFLLSFFLTLSAVMWF  181

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYGLL+KD N+A+PN+LGFIFGILQM+LY +Y  K++   +++  + +   VV  EE++ 
Sbjct  182  FYGLLIKDKNVAIPNILGFIFGILQMILYVIYNKKEKNIIKEQKLRELQNHVVISEEQKN  241

Query  839  LPKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQD  949
            LP +LTEEQI+DIVKLG+L+ S+K N        +++
Sbjct  242  LP-QLTEEQIIDIVKLGALVYSEKFNARGPEAAKVEN  277



>ref|XP_009803865.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=288

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 220/275 (80%), Gaps = 4/275 (1%)
 Frame = +2

Query  131  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL-  307
            G W  AFGVLGNI+SF+VFLSPLPTFY IYKKKS EGYQSIPYVVALFS +LWIYYA L 
Sbjct  7    GIWTSAFGVLGNIVSFMVFLSPLPTFYSIYKKKSTEGYQSIPYVVALFSCVLWIYYALLM  66

Query  308  -KSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
             +SN   +ITIN+ GC +ET Y+G Y++YA KKARVQT+KML+LLV+ GFGA+ LV QFL
Sbjct  67   PQSNLIFIITINTIGCFIETFYVGIYLFYAPKKARVQTVKMLLLLVVGGFGAMVLVIQFL  126

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            FK A VR Q+VGW+CLVFS+C F APLCI+++VI+TKSVE+MP LLS+FLT++AVMWFFY
Sbjct  127  FKGA-VRGQIVGWICLVFSVCTFAAPLCILRKVIKTKSVEYMPFLLSLFLTLNAVMWFFY  185

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLP  844
            GLL ++  +A+PN+LGF FGILQM+LY +Y  K++   +++  + +   V+  +E++KLP
Sbjct  186  GLLKRNKIVAIPNILGFTFGILQMILYVVYNKKEKNVIKEQKLRELQNHVIISDEQKKLP  245

Query  845  KELTEEQIVDIVKLGSLICSDKINVAAAACCSIQD  949
             +LTEEQI+DIVKLG+++ S+K N        +++
Sbjct  246  -QLTEEQIIDIVKLGAIVYSEKFNARGTEAAKVEN  279



>ref|XP_011073105.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=290

 Score =   328 bits (841),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 215/268 (80%), Gaps = 11/268 (4%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
            +S +  F FG+LGNIISF+VFL+P+PTFYQIYK+KS EG+QS+PYVV LFS+ML IYYAF
Sbjct  1    MSANLAFVFGLLGNIISFMVFLAPIPTFYQIYKRKSTEGFQSLPYVVGLFSAMLLIYYAF  60

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            L  ++TLLITINSFGC +ET+YI FY++YA K AR+QT  +L+LL +VG G + +++ FL
Sbjct  61   LLPDSTLLITINSFGCFIETLYICFYLFYAPKTARLQTATLLLLLNVVGMGLIVVLTHFL  120

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
             K +  RA +VGW+CLVFS+ VFVAPLC+V+QVIRTKSVE+MP LLS FLT+SAVMWFFY
Sbjct  121  AKDS-TRAHIVGWICLVFSVSVFVAPLCVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFY  179

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK--  838
            GLL KD NIA+PN+LGFIFG+LQM LY +YK  K+   EK      LP ++ +EE+++  
Sbjct  180  GLLRKDYNIAIPNILGFIFGVLQMALYLVYKNAKKAIQEK------LPEIIEMEEEKQNN  233

Query  839  -LPKELTEEQIVDIVKLGSLICSDKINV  919
             +P EL +EQI+D++KL +++CS+ I V
Sbjct  234  TIPAEL-KEQIIDVMKLSAIVCSEIIPV  260



>ref|XP_006347632.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=294

 Score =   328 bits (841),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 207/265 (78%), Gaps = 5/265 (2%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  F FG+LGNI+SF+V+L+P+PTFY+IYKKKS EG+QS+PYVV LFS+MLWIYYAFLK 
Sbjct  4    HLAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  63

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            + TLLITINS GC ++T YI F+++YA KKA++ T+K+L+ + +VG G + L++QF F  
Sbjct  64   DTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTVKLLLSMNVVGLGLIILLTQF-FSK  122

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
               RAQ+VGW+CL+FS CVFVAPL +++QVIR+KSVE+MP  LS FLT+SAVMWFFYGLL
Sbjct  123  GSNRAQIVGWICLIFSFCVFVAPLGVLRQVIRSKSVEYMPFQLSFFLTLSAVMWFFYGLL  182

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
             KD NIA+PNVLGF  G++QM LY +YK  K+   E RL      T   ++E+ KL +E+
Sbjct  183  RKDYNIAIPNVLGFSLGVIQMTLYLIYKNAKKVTKEVRLEN----TETVVDEELKLSEEM  238

Query  854  TEEQIVDIVKLGSLICSDKINVAAA  928
             +EQI+D+VKL +++CS+ I +  A
Sbjct  239  LKEQIIDVVKLSAMVCSEIIPMVTA  263



>ref|XP_011073577.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
 ref|XP_011073579.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=270

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 210/265 (79%), Gaps = 19/265 (7%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
              SGHW FAFG+LGNI+SF+VFLSP+PTFYQIYKKK++EG+QS+PYVVALFS+MLWIYYA
Sbjct  3    GFSGHWAFAFGLLGNIVSFMVFLSPIPTFYQIYKKKTSEGFQSVPYVVALFSAMLWIYYA  62

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            FLKSN TL+ITINS GC ++TIYI FY++YA KK RVQT+K+L LL++ GFG + + + F
Sbjct  63   FLKSNTTLIITINSVGCFIQTIYICFYLFYAPKKQRVQTLKLLFLLIVCGFGFILVSTHF  122

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            L K A ++A VVGW+CLVFSLCVF+APLCIV++VIRTKSVE+MP LLS+FLT+SAVMWFF
Sbjct  123  LVK-ASLQANVVGWICLVFSLCVFIAPLCIVRKVIRTKSVEYMPFLLSLFLTLSAVMWFF  181

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKL  841
            YG L+KD NIA+PNVLGF FG+LQM LY  YK   +               + LE+ +  
Sbjct  182  YGFLIKDYNIAIPNVLGFSFGVLQMALYVKYKNAAK---------------MILEDGK--  224

Query  842  PKELTEEQIV-DIVKLGSLICSDKI  913
              ELT EQI+ DIVK+ +L  SDK+
Sbjct  225  ISELTAEQIMDDIVKISALSRSDKV  249



>ref|XP_011083538.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=278

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 204/249 (82%), Gaps = 8/249 (3%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN++SF+VFL+P+PTFYQIYKKKS EG+QS+PYVV LFS+MLWIYYAFLK + T
Sbjct  6    FVFGLLGNVVSFMVFLAPIPTFYQIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTT  65

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINS GC +++ YI FY+++A + ARVQT+K+L+LL  VGFG + +++ FL K +  
Sbjct  66   LLITINSVGCFIQSAYICFYLFFAPRNARVQTVKLLLLLNTVGFGLIMVLTYFLAKGSN-  124

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            RA  VGW+CLVFSLCVFVAPLC+V+QV+RTKS E+MP LLS FLT+SA++WFFYG L KD
Sbjct  125  RANFVGWICLVFSLCVFVAPLCVVRQVLRTKSAEYMPFLLSFFLTISAIVWFFYGFLRKD  184

Query  683  INIAVPNVLGFIFGILQMVLYAMYK-GKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
             NIA+PNVLGFIFG+LQMVLY +Y+ GK    + ++LP      ++A+E++++LP+    
Sbjct  185  YNIAIPNVLGFIFGVLQMVLYLIYRNGKTLVQENQQLPA----GIIAVEDEKQLPE--LR  238

Query  860  EQIVDIVKL  886
            +QI+D+VKL
Sbjct  239  DQIIDVVKL  247



>ref|XP_004235340.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=295

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 207/263 (79%), Gaps = 4/263 (2%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
            ++ H  F FG+LGNI+SF+V+L+P+PTFY+IYKKKS EG+QS+PYVV LFS+MLWIYYAF
Sbjct  1    MTTHLAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAF  60

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            LK + TLLITINS GC ++T YI F+++YA KKA++ T+K+L+ + +VG G +  ++QF 
Sbjct  61   LKPDTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTMKLLLSMNVVGLGLIIFLTQF-  119

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            F     RAQ+VGW+CL+FS CVFVAPL +++QVIRTKSVE+MP  LS FLT+SAVMWF Y
Sbjct  120  FAKGSNRAQIVGWICLIFSFCVFVAPLGVLRQVIRTKSVEYMPFQLSFFLTLSAVMWFLY  179

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLP  844
            GLL KD NIA+PNVLGF  G++QM LY +YK  K+   E +L    +  +VA +++ KL 
Sbjct  180  GLLRKDYNIAIPNVLGFSLGVIQMTLYLIYKNAKKVTKEVKLE---VTEIVADDKELKLS  236

Query  845  KELTEEQIVDIVKLGSLICSDKI  913
            +E+ ++QI+D+VKL +++CS+ I
Sbjct  237  EEILKDQIIDVVKLSAIVCSEII  259



>ref|XP_009605548.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
tomentosiformis]
Length=294

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/260 (61%), Positives = 209/260 (80%), Gaps = 3/260 (1%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  F FG+LGNI+SF+V+L+P PTFY+IYKKKS EG+QS+PYVV LFS+MLWIYYAFLK 
Sbjct  3    HLAFTFGLLGNIVSFMVYLAPAPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  62

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            + TLLITINS GC +++ YI F+++YA KKA++ T+K+L+LL   G G + L++QFL KS
Sbjct  63   DTTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKS  122

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
            +  RAQ+VGW+CL+FSLCVFVAPL IV+QVI+T+SVE+MP LLS FLT+SAVMWFFYGLL
Sbjct  123  SN-RAQIVGWICLIFSLCVFVAPLGIVRQVIKTQSVEYMPFLLSFFLTLSAVMWFFYGLL  181

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
             KD NIA+PNVLGF  G+LQMVLY +YK  K+   E ++ +      V + E+ KL ++L
Sbjct  182  RKDYNIAIPNVLGFTLGVLQMVLYVIYKNAKKVTKEIKIAEK--ENTVTIVEEHKLSEDL  239

Query  854  TEEQIVDIVKLGSLICSDKI  913
             +EQI+D+VKL +++CS+ I
Sbjct  240  LKEQIIDVVKLSAMVCSEII  259



>gb|EYU23059.1| hypothetical protein MIMGU_mgv1a019104mg [Erythranthe guttata]
Length=278

 Score =   317 bits (812),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 200/252 (79%), Gaps = 13/252 (5%)
 Frame = +2

Query  161  GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITIN  340
            GNI+SF+VFL+PLPTF+QIYK+KS+EG+QS+PYVV LFS+MLWIYYA LK + TLLITIN
Sbjct  5    GNIVSFMVFLAPLPTFHQIYKRKSSEGFQSVPYVVGLFSAMLWIYYALLKPDTTLLITIN  64

Query  341  SFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVG  520
            S GC ++T YI FY++YA K AR+QT+ ++ LL +VG G + +++QF+ K    RA +VG
Sbjct  65   SVGCFIQTTYICFYLFYAPKSARLQTLALVFLLNVVGMGLIVVLTQFVAKGYN-RAAIVG  123

Query  521  WVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDINIAVP  700
            W+CLVFSLCVF+APLC+V+QV+RTKSVE+MP LLS FLT+SAVMWFFYGL+ KD NIA+P
Sbjct  124  WICLVFSLCVFIAPLCVVRQVVRTKSVEYMPFLLSFFLTLSAVMWFFYGLIRKDYNIAIP  183

Query  701  NVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQIVDIV  880
            NVLGFIFG++QM+LY MYK  K+  +EK          + +E+  K+P     EQI+D+ 
Sbjct  184  NVLGFIFGVIQMMLYVMYKNTKKVVEEKL-------QEIQMEDHHKIP-----EQIIDVE  231

Query  881  KLGSLICSDKIN  916
            KL +++CS+ IN
Sbjct  232  KLSAVVCSEIIN  243



>ref|XP_009801964.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=294

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/260 (60%), Positives = 209/260 (80%), Gaps = 3/260 (1%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  F FG+LGNI+SF+V+L+P+PTFY+I+KKKS EG+QS+PYVV LFS+MLWIYYAFLK 
Sbjct  3    HLAFTFGLLGNIVSFMVYLAPVPTFYKIHKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  62

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            + TLLITINS GC +++ YI F+++YA KKA++ T+K+L+LL   G G + L++QFL KS
Sbjct  63   DTTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKS  122

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
            +  RAQ+VGW+CL+FSLCVFVAPL IV+QVI+T+SVE+MP LLS FLT+SAVMWFFYGLL
Sbjct  123  SN-RAQIVGWICLIFSLCVFVAPLGIVRQVIKTRSVEYMPFLLSFFLTLSAVMWFFYGLL  181

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
             KD NIA+PNVLGF  G+LQMVLY +YK  K+   E ++ +      V + E+ KL ++ 
Sbjct  182  RKDYNIAIPNVLGFTLGVLQMVLYVIYKNAKKVTKEVKIAEK--ENTVTIVEEHKLSEDK  239

Query  854  TEEQIVDIVKLGSLICSDKI  913
             +EQI+D+VKL +++CS+ I
Sbjct  240  LKEQIIDVVKLSAMVCSEII  259



>ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
 emb|CBI15714.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 203/256 (79%), Gaps = 20/256 (8%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VF FG+LGN+ISF+V+L+PLPTFYQIYK+KS EG+QS+PYVVALFS+MLWIYYAFL ++A
Sbjct  11   VFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAFLNTDA  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            +LLITINS GC++ET YI  ++ YA KKAR+ T+K++ L+ I GFG++ L++  L + A 
Sbjct  71   SLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLLAEGAN  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             R +++GWVCLVFSL VF+APLCI++QVIRTKSVE+MP LLS FLT+SAVMWFFYGL+LK
Sbjct  131  -RVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLMLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            D  IA PN+LGF+FGI+QMVLY +Y+ +K+  + ++LP++                    
Sbjct  190  DFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPEL-------------------S  230

Query  860  EQIVDIVKLGSLICSD  907
            EQI+D+VKL +++CS+
Sbjct  231  EQIIDVVKLSTMVCSE  246



>emb|CDP21121.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 208/262 (79%), Gaps = 6/262 (2%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGNI+SF+V+L+PLPTFY IYKKKS EG+QS+PYVV LFS+ML IYYAFLK + T
Sbjct  6    FIFGLLGNIVSFMVYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFSAMLRIYYAFLKPDTT  65

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            L ITINS GC  +T+Y+ +Y++YA ++AR+QT K+L LLV++GFG++ L++Q L  +   
Sbjct  66   LRITINSVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQ-LLSTGKT  124

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            RA++VGW+ LV SLCVFVAPL IV+QVI TKSVE+MP L S FLT+SA+MWFFYG L +D
Sbjct  125  RARIVGWIGLVLSLCVFVAPLAIVRQVILTKSVEYMPFLPSFFLTLSAIMWFFYGFLRQD  184

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEE  862
             NIA+PN+LGF FGILQMVLY +YK  K+  ++K LP++    V+ LEE  KLP+   +E
Sbjct  185  YNIAIPNILGFFFGILQMVLYLIYKNAKKAVEQK-LPEIQ-NQVIVLEE-HKLPE--LQE  239

Query  863  QIVDIVKLGSLICSDKINVAAA  928
            Q++++VKL +L+  + ++V +A
Sbjct  240  QVIEVVKLSALVRPEIVSVISA  261



>emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera]
Length=273

 Score =   309 bits (792),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 203/256 (79%), Gaps = 20/256 (8%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VF FG+LGN+ISF+V+L+PLPTFYQIYK+KS EG+QS+PYVVALFS+MLWIYYAFL ++A
Sbjct  11   VFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAFLNTDA  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            +LLITINS GC++ET YI  ++ YA KKAR+ T+K++ L+ I GFG++ L++  L + A 
Sbjct  71   SLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLLAEGAN  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             R +++GWVCLVFSL VF+APLCI++QVIRTKSVE+MP LLS FLT+SAVMWFFYGL+LK
Sbjct  131  -RVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLMLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            D  IA PN+LGF+FGI+QMVLY +Y+ +K+  + ++LP++                    
Sbjct  190  DFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPEL-------------------S  230

Query  860  EQIVDIVKLGSLICSD  907
            EQI+D+VKL +++CS+
Sbjct  231  EQIIDVVKLSTMVCSE  246



>gb|EYU43031.1| hypothetical protein MIMGU_mgv1a011488mg [Erythranthe guttata]
Length=280

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/250 (61%), Positives = 202/250 (81%), Gaps = 3/250 (1%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN++SF+VFL+P+PTFYQI+KKKS EG+QS+PY V LFS+MLWIYYAFLK   T
Sbjct  6    FVFGLLGNVVSFMVFLAPIPTFYQIFKKKSTEGFQSVPYAVGLFSAMLWIYYAFLKPETT  65

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINS GC++++ YI FY+++A K AR+QT+K+++LL +VGFG + +++ F + +   
Sbjct  66   LLITINSVGCVIQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVLTHF-WANDSN  124

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R  VVGW+CLVFSLCVFVAPL +V+QVIRTKSVE+MP LLS FLT+SAVMWFFYGLL KD
Sbjct  125  RDDVVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  184

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEE  862
             NIA+PNVLGF+FG++QMVLY MYK  K+   EK+     + T + + ++ KLP+   +E
Sbjct  185  YNIAIPNVLGFMFGVIQMVLYVMYKNPKKVVQEKKQKLPEIETQIIVIDENKLPE--LKE  242

Query  863  QIVDIVKLGS  892
            QI+D++KLG 
Sbjct  243  QIIDVMKLGG  252



>gb|EPS64389.1| hypothetical protein M569_10392, partial [Genlisea aurea]
Length=248

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/257 (61%), Positives = 193/257 (75%), Gaps = 18/257 (7%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN ISF+VFL+P+PTFY+IYKKKS EG+Q +PY+V LFS+MLWIYYAFLK + T
Sbjct  5    FVFGLLGNAISFMVFLAPIPTFYKIYKKKSTEGFQCVPYIVGLFSAMLWIYYAFLKPDTT  64

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LL+TINS GC  ++IYIGFY+Y+++KK RV T K L +L +  FG +  V++F+  S   
Sbjct  65   LLVTINSVGCFFQSIYIGFYLYFSSKKTRVVTTKQLFVLNVASFGVIIAVTRFVV-SPSQ  123

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            +A VVGW+CLVFSLCVFVAPLC+V+QVIRTKSVE MP LLS FLT+SAVMWFFYGLL KD
Sbjct  124  QASVVGWICLVFSLCVFVAPLCVVRQVIRTKSVECMPFLLSFFLTLSAVMWFFYGLLRKD  183

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEE  862
             NIA+PNVLGFIFG+LQM+LY MY+ K  ED  K+                KLP    ++
Sbjct  184  YNIALPNVLGFIFGVLQMLLYMMYR-KVDEDSAKK----------------KLPLPELQD  226

Query  863  QIVDIVKLGSLICSDKI  913
            QI+D VKL S I  + I
Sbjct  227  QILDAVKLNSAIAVEII  243



>gb|EYU43032.1| hypothetical protein MIMGU_mgv1a010677mg [Erythranthe guttata]
Length=305

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/286 (56%), Positives = 209/286 (73%), Gaps = 12/286 (4%)
 Frame = +2

Query  101  RHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSS  280
            R+  R M       F FG+LGN+ISF+VFL+P+PTFY I+KKKS EG+QS+PYVV LFS+
Sbjct  24   RNQLREM---NQLAFVFGLLGNVISFMVFLAPIPTFYTIFKKKSTEGFQSVPYVVGLFSA  80

Query  281  MLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGA  460
             LWIYYAFLK   TLLITIN+ GC V++ YI FY+++A K AR+QT+K+++LL +VGFG 
Sbjct  81   QLWIYYAFLKPETTLLITINTVGCFVQSAYICFYLFFATKNARIQTVKLILLLNVVGFGL  140

Query  461  VALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTV  640
            + +++ F + +   R  +VGW+CLVFSLCVFVAPL +V+QVIRTKSVE+MP LLS FLT+
Sbjct  141  IIVLTHF-WANDSNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTL  199

Query  641  SAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVA  820
            SAVMWFFYGLL KD NIA+PNVLGF+FG++QMVLY MYK  K+   EK+     + T + 
Sbjct  200  SAVMWFFYGLLRKDYNIAIPNVLGFLFGVIQMVLYVMYKNPKKVVQEKKQKLPEIETQII  259

Query  821  LEEKQKLPKELTEEQIVDIVKLGSLICS------DKINVAAAACCS  940
            + ++ KLP+    EQI+D+VKLG           D + + A   CS
Sbjct  260  VIDENKLPE--LREQIIDVVKLGGAAVGIIPVRIDNVILGAEKTCS  303



>gb|EYU43030.1| hypothetical protein MIMGU_mgv1a011435mg [Erythranthe guttata]
Length=282

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/251 (59%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN++SF+VFL+P+PTFY I+KKKS +G+QS+PYVV LFS+MLWIYYAFLK   T
Sbjct  6    FVFGLLGNVVSFMVFLAPIPTFYTIFKKKSTQGFQSVPYVVGLFSAMLWIYYAFLKPETT  65

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITIN+ GC V++ YI FY+++A+K AR+QT+K+++LL +VGFG + +++ F + +   
Sbjct  66   LLITINTVGCFVQSTYICFYLFFASKNARIQTVKLILLLNVVGFGLIIVLTHF-WANDSN  124

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R  +VGW+CLVFSLCVFVAPL +V+QVIRTKSVE+MP LLS FLT+SAVMWFFYGLL KD
Sbjct  125  RDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  184

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVV-LPTVVALEEKQKLPKELTE  859
             NIA+PNVLGF+FG++QMVLY MYK    +   K   ++  + T + + ++ KLP+   +
Sbjct  185  YNIAIPNVLGFLFGVVQMVLYVMYKNTNSKKVVKEKKEISEIETKIIVLDENKLPE--LK  242

Query  860  EQIVDIVKLGS  892
            EQI+D++KLG 
Sbjct  243  EQIIDVMKLGG  253



>ref|XP_007038075.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22576.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
Length=280

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 198/265 (75%), Gaps = 23/265 (9%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   W F FGVLGN++SF+V L+PLPTFYQIYKK+++EG+QSIPYVV+LFS+MLWIYY
Sbjct  1    MALHLSWAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK +A LLITIN+F C ++T YI  Y YYA KK +V T+K+++L  I GFG + L S 
Sbjct  61   ALLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFL-ST  119

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            F  ++   R  V+G++C+ F+L VF APLCI+++VI+TKSVE+MP  LSVFLT+ AVMWF
Sbjct  120  FFLQNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKG--KKQEDDEKRLPQVVLPTVVALEEK  832
            FYGLLLKD+NIAVPNV+GFIFGILQM+LYA+YK   KK  +D K L Q+           
Sbjct  180  FYGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPK-LHQL-----------  227

Query  833  QKLPKELTEEQIVDIVKLGSLICSD  907
                     E IVD+VKLG+++CS+
Sbjct  228  --------SEHIVDVVKLGTMVCSE  244



>ref|XP_006436900.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
 ref|XP_006493251.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Citrus 
sinensis]
 gb|ESR50140.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
Length=271

 Score =   302 bits (773),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 210/278 (76%), Gaps = 20/278 (7%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA+   W  AFG+LGNI SF+V L+P+PTFY+IYKKKS EG+QS+PYV++LFS+M+WIYY
Sbjct  1    MAIHHSWATAFGLLGNITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK NA  L+TIN+F C+++TIYI  Y++YA KK R+QT+K+L+LL I GFGA+ L++ 
Sbjct  61   ALLKQNAIFLMTINTFCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGAICLLTF  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL K A +R +++G++C+ F+L VF APL IV++VI+TKSVE+MP  LS FLT+ AV WF
Sbjct  121  FLSKGA-IREKILGYICMTFALSVFAAPLFIVRKVIKTKSVEYMPFTLSFFLTIGAVAWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYGLL+KD+N+A+PNVLGFIFG+LQM+LY +YK   ++                + E+ K
Sbjct  180  FYGLLIKDLNVAIPNVLGFIFGVLQMILYVIYKNPNKK----------------IVEQTK  223

Query  839  LPKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQDK  952
            L +EL+ E +VD+VKL +++CS+ +N       +IQ++
Sbjct  224  L-QELS-EHVVDVVKLSTMVCSE-LNSVVPQLSAIQNE  258



>emb|CDP21733.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 196/249 (79%), Gaps = 6/249 (2%)
 Frame = +2

Query  161  GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITIN  340
            GNI+SF  +L+PLPTFY IYKKKS EG+QS+PYVV LF +MLWIYYAFLK + TLLITIN
Sbjct  7    GNIVSFTDYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFRAMLWIYYAFLKPDTTLLITIN  66

Query  341  SFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVG  520
            S GC  +T+Y+ +Y++YA ++AR+QT K+L LLV++GFG++ L++Q L  +   RA++VG
Sbjct  67   SVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQ-LLSTGKTRARIVG  125

Query  521  WVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDINIAVP  700
            W+ LV SLCVFVAPL IV+QVI TKSVE+MP L S FLT+SA+MWFFYG L KD N+A+P
Sbjct  126  WIGLVLSLCVFVAPLAIVRQVILTKSVEYMPFLPSFFLTLSAIMWFFYGFLRKDYNVAIP  185

Query  701  NVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQIVDIV  880
            N+LGF FGILQMVLY +YK  K+  ++K LP++     V + E+ KLP+   +EQ++++V
Sbjct  186  NILGFFFGILQMVLYLIYKNAKKAVEQK-LPEI--QNQVMVLEEHKLPE--LQEQVIEVV  240

Query  881  KLGSLICSD  907
            KL +L+  +
Sbjct  241  KLSALVRPE  249



>ref|XP_004297512.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 200/263 (76%), Gaps = 17/263 (6%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA+      AFG+LGNIISF+VFL+P+PTFY+IYKKK+ EG+Q++PY VALFS MLWIYY
Sbjct  1    MAIHHPLTLAFGLLGNIISFMVFLAPMPTFYKIYKKKTTEGFQALPYAVALFSCMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK +AT LITINS GC++ET+Y+  +++Y+ KKAR+ T+K L+LL ++G+G + +++ 
Sbjct  61   ALLKQDATFLITINSVGCVIETVYLAIFLFYSPKKARISTVKFLLLLNVLGYGLMLVLTL  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL K   +R +VVGW+CLVF+L VF APLCI+K+VIRTKSVE MP  LS FLT+ AVMWF
Sbjct  121  FLAKGE-IRLKVVGWICLVFNLTVFAAPLCILKKVIRTKSVEFMPFPLSFFLTLGAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG LLKD NIA PN+LGF+FGI QMVLY +YK  K+              VV LEE  K
Sbjct  180  FYGFLLKDYNIAFPNILGFMFGIAQMVLYIVYKNAKK--------------VVLLEEPSK  225

Query  839  LPKELTEEQIVDIVKLGSLICSD  907
            + +EL+ + I++++K+ +++C D
Sbjct  226  V-QELS-DHIIEVMKISTMVCPD  246



>ref|XP_007038076.1| Nodulin MtN3 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22577.1| Nodulin MtN3 family protein, putative isoform 2 [Theobroma cacao]
Length=281

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 198/266 (74%), Gaps = 24/266 (9%)
 Frame = +2

Query  119  MALSGHWVFAFGVL-GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MAL   W F FGVL GN++SF+V L+PLPTFYQIYKK+++EG+QSIPYVV+LFS+MLWIY
Sbjct  1    MALHLSWAFVFGVLVGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LK +A LLITIN+F C ++T YI  Y YYA KK +V T+K+++L  I GFG + L S
Sbjct  61   YALLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFL-S  119

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
             F  ++   R  V+G++C+ F+L VF APLCI+++VI+TKSVE+MP  LSVFLT+ AVMW
Sbjct  120  TFFLQNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKG--KKQEDDEKRLPQVVLPTVVALEE  829
            FFYGLLLKD+NIAVPNV+GFIFGILQM+LYA+YK   KK  +D K L Q+          
Sbjct  180  FFYGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPK-LHQL----------  228

Query  830  KQKLPKELTEEQIVDIVKLGSLICSD  907
                      E IVD+VKLG+++CS+
Sbjct  229  ---------SEHIVDVVKLGTMVCSE  245



>ref|XP_009601079.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/242 (61%), Positives = 187/242 (77%), Gaps = 9/242 (4%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            +FAFG+LGNI SF+VF+SP+PTFY I KKKSAEG+QS+PYVVALFSSMLWIYYA +K+N 
Sbjct  7    IFAFGILGNIFSFMVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMVKTNE  66

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            TL+ITINSFGC+ ETIY+  Y  YA K AR+QT+++++LL   GFG +  ++Q L K  P
Sbjct  67   TLIITINSFGCIAETIYVAIYFAYATKNARMQTLRLVLLLNFGGFGLILFLTQILCK-GP  125

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             RA+VVGW+C+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LT+SAVMWF YGLLL+
Sbjct  126  KRAEVVGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGLLLR  185

Query  680  DINIAVPNVLGFIFGILQMVLYAMYK-GKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            DI + VPN+ G I G+LQMVLY +Y+  K  E +EK+     LPTVV LEE+Q  P  + 
Sbjct  186  DIYVTVPNIAGIILGMLQMVLYGIYRNAKPNEAEEKK-----LPTVVKLEEQQ--PTTVN  238

Query  857  EE  862
             E
Sbjct  239  SE  240



>emb|CDP21120.1| unnamed protein product, partial [Coffea canephora]
Length=264

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 203/284 (71%), Gaps = 22/284 (8%)
 Frame = +2

Query  182   VFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVE  361
             +FL+P+PTFYQIYKKKS EG+QSIPYV+ALFS+MLWIYYAFLK   T LITINSFGC +E
Sbjct  1     MFLAPVPTFYQIYKKKSTEGFQSIPYVIALFSAMLWIYYAFLKPKTTFLITINSFGCFIE  60

Query  362   TIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFS  541
             TIYI  +++Y  KKARV+T+K+LVLL+  GFG   L++ FL K +  R ++VGW+CLVF+
Sbjct  61    TIYICLFLFYTTKKARVETVKLLVLLLACGFGLNVLLTHFLAKDS-TRVRIVGWICLVFA  119

Query  542   LCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDINIAVPNVLGFIF  721
             L VFVAPL IV QVIRTKS E+MP+ LS FLT++AV WFFYGLLLKD NIA+PNVLGF+F
Sbjct  120   LLVFVAPLRIVIQVIRTKSAEYMPLPLSAFLTLNAVAWFFYGLLLKDFNIAIPNVLGFVF  179

Query  722   GILQMVLYAMY-KGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQIVDIVKLGSLI  898
             G+LQMVLY +Y K +K  D EK+     L   + + E+ KL  ++T EQI+DI KLG L 
Sbjct  180   GVLQMVLYKIYSKSEKDNDLEKQRKVSQLADQIIIVEENKL-SDIT-EQIIDIAKLGQL-  236

Query  899   CSDKINVAAAACCSIQDKLLHQgggggggTATADHNINIPTKPL  1030
               +KI V   A     D L             AD  +N+  +P+
Sbjct  237   --EKIPVVLRAN---NDGL------------EADKGLNVQMEPI  263



>ref|XP_004138032.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 ref|XP_004161361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 gb|KGN63458.1| hypothetical protein Csa_1G001300 [Cucumis sativus]
Length=292

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 202/266 (76%), Gaps = 15/266 (6%)
 Frame = +2

Query  119  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MA+S   + F FG+LGNIISF+VFL+PLPTFY+IYKKKSAEGYQS+PYVVALFS+MLWIY
Sbjct  1    MAISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LK+NAT LITINSFGC++E++YI  +I YA  K R QT K++ LL ++GFG +  ++
Sbjct  61   YALLKTNATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALT  120

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              L K    R +V+GW+CLVF+L VF APL I+ +VI+TKSVE+MP  LS FLT++AVMW
Sbjct  121  LVLAKGEK-RLKVLGWICLVFNLSVFAAPLFIMGKVIKTKSVEYMPFALSFFLTLNAVMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
            FFYGLLLKD  IA+PNV+GF+FGI+QM+LY +    K   ++ R+P          +EK 
Sbjct  180  FFYGLLLKDYYIALPNVVGFVFGIIQMILYVIV---KHIGNKSRIP--------VKDEKA  228

Query  836  KLPKELTE--EQIVDIVKLGSLICSD  907
              P +L E  EQI+D VKLG+++C++
Sbjct  229  AAPPQLHELSEQIIDAVKLGTMVCTE  254



>gb|KHG27148.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=278

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 198/269 (74%), Gaps = 24/269 (9%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   W F FG+LGN++SF+V L+PLPTFYQIYKK+++EGYQSIPYVV+LFS+MLWIYY
Sbjct  1    MALHVSWAFVFGILGNVVSFLVSLAPLPTFYQIYKKRTSEGYQSIPYVVSLFSAMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK +A LLITIN+F   ++T YI  Y YY  KK ++ T+K+++L  + GFG V   S 
Sbjct  61   ALLKKDAMLLITINTFCVFIQTFYIVVYFYYGPKKEKLVTLKLILLFNVFGFG-VIFFST  119

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            F  K+  +R Q++G++C+ F+LCVFVAPL I+++VI+TKSVE+MP  LSVFLT+ AVMWF
Sbjct  120  FFLKNPLIRLQILGYICMGFALCVFVAPLGILRKVIKTKSVEYMPFTLSVFLTLGAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKG--KKQEDDEKRLPQVVLPTVVALEEK  832
            FYGLLLKD+NIAVPNVLGFIFGILQM+LYA+YK   KK  +D K                
Sbjct  180  FYGLLLKDMNIAVPNVLGFIFGILQMILYAIYKNYPKKMVEDPKL---------------  224

Query  833  QKLPKELTEEQ-IVDIVKLGSLICSDKIN  916
                 +L+ +Q +VD+VKLGS   S ++N
Sbjct  225  -----QLSAQQVVVDVVKLGSTTVSLEVN  248



>ref|XP_009779208.1| PREDICTED: bidirectional sugar transporter SWEET12-like, partial 
[Nicotiana sylvestris]
Length=264

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 184/241 (76%), Gaps = 8/241 (3%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            +FAFG+LGNIISF VF+SP+PTFY I KKKSAEG+QS+PYVVALFSSMLWIYYA  K+N 
Sbjct  1    IFAFGILGNIISFTVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMTKTNE  60

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            TL+ITINSFGC+ ETIYI  Y  YA KK R+QT+++++LL   GFG +  ++Q L K A 
Sbjct  61   TLIITINSFGCIAETIYIAIYFAYATKKTRMQTLRLVLLLNFGGFGLILFLTQILCKGAK  120

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             RA+V+GW+C+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LT+SAVMWF YGLLL+
Sbjct  121  -RAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGLLLR  179

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            DI + VPN+ G + G+LQMVLY +Y+  K    E++     LPTVV LEE   LP ++  
Sbjct  180  DIYVTVPNIAGMVLGVLQMVLYGIYRNAKPNQAEEK----KLPTVVKLEE---LPTKVNS  232

Query  860  E  862
            E
Sbjct  233  E  233



>ref|XP_007137870.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
 gb|ESW09864.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
Length=264

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 201/269 (75%), Gaps = 19/269 (7%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF+VFL+PLPTFYQIYKKK+AEG+QS+PYVVALFSSMLWIYYA +K +
Sbjct  8    WAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIYYALVKKD  67

Query  317  ATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            A+LL ITINSFGC++E+IY+  ++ YA  K R+ TIK+L+LL + GFGA+ L+S   F +
Sbjct  68   ASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAM-LLSTLYFTT  126

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
               R  V+GW+CLVF++ VF APLCI+K+VI+TKSVE+MP  LS FLT++AVMWFFYGLL
Sbjct  127  GSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMWFFYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
            LKD  IA+PN LGF+FGI+QM+LY +Y+  K +                LEE  KL +EL
Sbjct  187  LKDYYIALPNTLGFLFGIIQMMLYLVYRNAKPK---------------TLEEPTKL-QEL  230

Query  854  TEEQIVDIVKLGSLICSDKINVAAAACCS  940
                IVD+VKLG++  S+  +V  +   +
Sbjct  231  -NGHIVDVVKLGTMAPSEPNHVTKSGAVT  258



>ref|XP_007209422.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
 gb|EMJ10621.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
Length=293

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 204/285 (72%), Gaps = 23/285 (8%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA+      +FG+LGNIISF+VFL+P+PTFY IYK+K+AEG+Q++PYV+AL SSML+IYY
Sbjct  1    MAIQHPLTLSFGLLGNIISFLVFLAPVPTFYTIYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  299  AFLKS----NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  466
            A LK     +AT LITINSFGC+VET+YI  +++YA KKAR+ T+ ++ LL + GFG + 
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNLFGFGLMM  120

Query  467  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSA  646
            L++ FL  +  +R ++VGW+CLVFSL VFVAPL ++++VIRTKSVE MP  LS FLT+ A
Sbjct  121  LLTHFL-ATGEMRLKIVGWICLVFSLSVFVAPLGVLRRVIRTKSVEFMPFPLSFFLTLGA  179

Query  647  VMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALE  826
            V WFFYGLL+KD NIA PN+LGF+FGI QMVLY +YK  K+                 LE
Sbjct  180  VTWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKK----------------VLE  223

Query  827  EKQKLPKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQDKLLH  961
            E+ K+ +EL+ E I+D+VK+ SL+C +   V       I + ++ 
Sbjct  224  EQPKV-QELS-EHIIDVVKISSLVCPELNPVVLQPTLDITNDMIE  266



>ref|XP_008464393.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
melo]
Length=296

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 203/266 (76%), Gaps = 11/266 (4%)
 Frame = +2

Query  119  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MA+S   + F FG+LGNIISF+VFL+PLPTFY+IYKKKSAEGYQS+PYVVALFS+MLWIY
Sbjct  1    MAISPQTLAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LK+NAT LITINSFGC++E++YI  +I YA  K R QT K++ LL ++GFG +  ++
Sbjct  61   YALLKTNATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALT  120

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              L K    R +V+GW+CLVF+L VF APL I+ +VI+TKSVE+MP  LS FLT++AVMW
Sbjct  121  LVLAKGEK-RLKVLGWICLVFNLSVFAAPLLIMGKVIKTKSVEYMPFALSFFLTLNAVMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
            FFYGLLLKD  IA+PNV+GF+FGI+QM+LY +    K   ++ R+P  V   + A   K 
Sbjct  180  FFYGLLLKDYYIALPNVVGFVFGIIQMILYVIV---KNIGNKSRIP--VKDELGA--AKA  232

Query  836  KLPKELTE--EQIVDIVKLGSLICSD  907
              P +L E  EQI+D VKLG+++C++
Sbjct  233  AAPPQLHELSEQIIDAVKLGTMVCTE  258



>ref|XP_008239633.1| PREDICTED: bidirectional sugar transporter SWEET10 [Prunus mume]
Length=291

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 199/267 (75%), Gaps = 23/267 (9%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA+      AFG+LGNIISF+VFL+P+PTFY +YK+K+AEG+Q++PYV+AL SSML+IYY
Sbjct  1    MAIQHPLTLAFGLLGNIISFLVFLAPVPTFYTVYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  299  AFLKS----NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  466
            A LK     +AT LITINSFGC+VET+YI  +++YA KKAR+ T+ ++ LL + G+G + 
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNVFGYGLMM  120

Query  467  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSA  646
            +++ FL  +  +R ++VGW+CLVFSL VFVAPL +++QVIRTKSVE MP  LS FLT+ A
Sbjct  121  MLTHFL-ATGEIRLKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGA  179

Query  647  VMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALE  826
            V WFFYGLL+KD NIA PN+LGF+FGI QMVLY +YK  K+                 LE
Sbjct  180  VTWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKK----------------VLE  223

Query  827  EKQKLPKELTEEQIVDIVKLGSLICSD  907
            E+ K+ +EL+ E I+D+VK+ SL+C +
Sbjct  224  EQPKV-QELS-EHIIDVVKISSLVCPE  248



>ref|XP_011084749.1| PREDICTED: bidirectional sugar transporter N3-like [Sesamum indicum]
Length=292

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 207/262 (79%), Gaps = 5/262 (2%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VF FG+LGN++SF V+L+P+PTFY+I+KKKS EG+QS+PYVVAL SSMLWIYYA LKSN 
Sbjct  11   VFTFGILGNLVSFAVYLAPMPTFYRIFKKKSTEGFQSVPYVVALLSSMLWIYYATLKSNE  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            TLLITINS GC +E+IYI  YI YA KK R+  +K+L LL  VGFG + + + FL K  P
Sbjct  71   TLLITINSAGCFIESIYIAIYIAYAPKKPRMGALKLLSLLNFVGFGLIVIFTHFLVK-GP  129

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             R QV+GW+ +  S  V++APL I++QVIRTKSV+HMP LLS+FLT+SAVMWFFYGLLLK
Sbjct  130  ERVQVLGWISVTLSASVYIAPLSIMRQVIRTKSVQHMPFLLSLFLTLSAVMWFFYGLLLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            D NIA+PNVLGF FG+LQMVLY MY+  ++  +EK LP+++   ++ L+E QK+P ELT 
Sbjct  190  DFNIAIPNVLGFSFGVLQMVLYLMYRNAEKTKEEK-LPEILQKQIIILDE-QKIP-ELT-  245

Query  860  EQIVDIVKLGSLICSDKINVAA  925
            +QI+DI+KL +   S+KI V +
Sbjct  246  QQIIDIIKLSACRSSEKIPVVS  267



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 178/217 (82%), Gaps = 2/217 (1%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS+EG+QS+PYVVALFSSMLWIYYAF+K +
Sbjct  8    WAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYAFVKKD  67

Query  317  ATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            A+LL ITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFGA+ L+S     +
Sbjct  68   ASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAM-LLSTLYLTT  126

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
               R  V+GW+CLVF++ VF APLCI+K+VI+TKSVE MP  LS  LT++AVMWFFYGLL
Sbjct  127  GSKRLTVIGWICLVFNISVFAAPLCIMKRVIKTKSVEFMPFSLSFSLTINAVMWFFYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEK  784
            LKD  IA+PN LGF+FGI+QMVLY +Y+  K+++  K
Sbjct  187  LKDYYIALPNTLGFLFGIIQMVLYLIYRNAKKDEPMK  223



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 201/300 (67%), Gaps = 27/300 (9%)
 Frame = +2

Query  125   LSGH--WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
             LS H  W F FG+LGNIISF+V+LSPLPTF+++YKKKS EG+QS+PYVVALFS+MLWIYY
Sbjct  4     LSVHHPWAFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALFSAMLWIYY  63

Query  299   AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
             A LK++  LLITIN+ GC++E+IYI  YI YA KKA++ T K++VLL +  F  + L++ 
Sbjct  64    ALLKTDGYLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVFCMILLLTL  123

Query  479   FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
             F F   P R +V+GWVC+ FS+CVF APL I++ VI+TKSVE MP  LS  LT+SAVMWF
Sbjct  124   F-FVQGPKRVRVLGWVCVTFSVCVFAAPLSIMRLVIQTKSVEFMPFSLSFSLTLSAVMWF  182

Query  659   FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
              YGLL KD  IA+PNVLGFIFGI+QMVLY +YKG K+   +K+LP               
Sbjct  183   SYGLLTKDFYIALPNVLGFIFGIIQMVLYIIYKGTKKAFIDKKLP---------------  227

Query  839   LPKELTEEQIVDIVKLGSLICSD--KINVAAAACCSIQDKLLHQgggggggTATADHNIN  1012
                    EQ+V+IVK+ +L  SD   IN  A +   + D +            T   N+ 
Sbjct  228   -------EQVVNIVKISTLGSSDVFPINGQAVSGECVTDSVEKSLEQVVIVAHTVTENVQ  280



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 188/254 (74%), Gaps = 11/254 (4%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS E +QS+PYVVALFSSMLWIYYA +K +
Sbjct  8    WAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIYYALVKKD  67

Query  317  ATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            A+LL ITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFGA+ L + +L  +
Sbjct  68   ASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL-TT  126

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
               R  V+GW+CLVF++ VF APLCI+K+VI+TKSVE MP  LS FLT++AVMWFFYGLL
Sbjct  127  GSKRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKE-  850
            LKD  +A+PN LGF+F I+QMVLY +Y+  K  D   +L ++   T+   +  +  P E 
Sbjct  187  LKDYYVALPNTLGFLFSIIQMVLYLIYRNAKTPDLPMKLQELNSHTIDVGKLSRMEPSEP  246

Query  851  --------LTEEQI  868
                    LTE +I
Sbjct  247  NHVTKNGTLTEREI  260



>gb|AFK48645.1| unknown [Lotus japonicus]
Length=247

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 201/261 (77%), Gaps = 19/261 (7%)
 Frame = +2

Query  119  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MA++   W F FG++GN+ISF+VFL+PLPTFYQIYKKK+AEG+Q++PYVVALFS+MLWIY
Sbjct  1    MAMTRESWAFVFGLMGNVISFMVFLAPLPTFYQIYKKKTAEGFQALPYVVALFSAMLWIY  60

Query  296  YAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  472
            YAF+K  +A LLITIN+FG +VE+IYI F+++YA KK+R+ TIK+L+LL + GFGA+ L 
Sbjct  61   YAFVKRESALLLITINTFGIVVESIYIAFFLFYAPKKSRLSTIKLLLLLNVFGFGAMLLA  120

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            + +L K A  R Q++GW+CLVF++ VF APL I+ +VIRT+SVE+MP  LS  LT++AVM
Sbjct  121  TLYLSKGAK-RLQIIGWICLVFNISVFAAPLFIISKVIRTRSVEYMPFFLSFSLTINAVM  179

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEK  832
            WFFYG+LL+D  +A+PN LGF+FGI+QMV+Y +Y+                 T V +EEK
Sbjct  180  WFFYGMLLRDYYVALPNTLGFVFGIIQMVVYLIYRNA---------------TPVVIEEK  224

Query  833  QKLPKELTEEQIVDIVKLGSL  895
             K  +E++ + I+D+ K G++
Sbjct  225  VK-GQEMSGDHIIDVAKGGAV  244



>ref|XP_010093933.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
 gb|EXB54896.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
Length=295

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 198/266 (74%), Gaps = 19/266 (7%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA   +   AFG+LGNI+SF+VFL+P+PTF++IYKKKSAEG+QS+PYV+AL SSMLWIYY
Sbjct  1    MASHHYLTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK +A LLITINS GC++ET+YI  +++YA KK R++T+K+L++L +VG+G + +++ 
Sbjct  61   ALLKKDALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTI  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL +    R Q VGW+CL F+L VF APLCI++QVIRTKSVE MP  LS FLT+ AVMWF
Sbjct  121  FLAEGEK-RLQAVGWICLAFNLSVFAAPLCIMRQVIRTKSVEFMPFPLSFFLTLGAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYGLLLKD NIA PNVLGF FGI QM LY +YK  K+               + LE K  
Sbjct  180  FYGLLLKDYNIAFPNVLGFFFGIAQMALYIVYKNAKK--------------TILLEPKL-  224

Query  839  LPKELTEEQIVDIVKLGSLICSDKIN  916
              +EL+ E ++D+VK+ +L+C  ++N
Sbjct  225  --QELS-EHVIDVVKISALVCPTELN  247



>ref|XP_006347482.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=267

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 201/255 (79%), Gaps = 4/255 (2%)
 Frame = +2

Query  170  ISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITINSFG  349
            +SFIVFL+PLPTFY IYKKKS EGYQSIPYVVAL S+M+ IYY  LK +   +I IN+ G
Sbjct  3    VSFIVFLAPLPTFYNIYKKKSTEGYQSIPYVVALCSAMILIYYVHLKGDLVYVIIINAIG  62

Query  350  CLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVC  529
              +ETIYI FYI+YA KKA+VQTIK+L+L V+VG+G V LV+QFL K A +R  +VGW+ 
Sbjct  63   VFIETIYIVFYIFYAPKKAKVQTIKLLLLFVVVGYGGVFLVAQFLLKGA-IRTTIVGWIS  121

Query  530  LVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDINIAVPNVL  709
            + FS+C FVAPL I+++VI+TK+VE+MP LLS+FLT+SAV+WF YG   K++ I  PN+L
Sbjct  122  IAFSVCTFVAPLGIMRKVIKTKNVEYMPFLLSLFLTLSAVLWFIYGFTKKNVVIYAPNIL  181

Query  710  GFIFGILQMVLYAMYKGKKQED--DEKRLPQVVLPTVVALEEKQKLPKELTEEQIVDIVK  883
            GF FG++QMVLY +YK KK+ +   E++L +V+   V+ LE+ +KL  +LT+EQI+DI K
Sbjct  182  GFTFGVVQMVLYVVYKNKKESNVTKEQKLSEVLQNHVIILEDGKKLT-QLTQEQIIDIWK  240

Query  884  LGSLICSDKINVAAA  928
            LG+LI S+K+N +AA
Sbjct  241  LGTLIYSEKLNASAA  255



>ref|XP_003523161.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31282.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=258

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 193/257 (75%), Gaps = 20/257 (8%)
 Frame = +2

Query  119  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MA+S   W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS+EG+QS+PYVVALFSSMLWIY
Sbjct  1    MAISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  296  YAFLKSNATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  472
            YA +K +A+LL ITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFG + L+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGM-LL  119

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            S     +   R  V+GW+CLVF++ VF APLCI+K+VI+T+SVE MP  LS+ LT++AVM
Sbjct  120  STLYLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSLSLTINAVM  179

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEK  832
            WFFYGLLLKD  IA+PN LGF+FGI+QMVLY +Y+  K        PQ        LEE 
Sbjct  180  WFFYGLLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAK--------PQ-------TLEEP  224

Query  833  QKLPKELTEEQIVDIVK  883
             K+ +EL    I+D+VK
Sbjct  225  TKV-QEL-NGHIIDVVK  239



>ref|XP_008392763.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=248

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 177/234 (76%), Gaps = 11/234 (5%)
 Frame = +2

Query  95   SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  274
            +S HP           FAFG+LGNI+SFIVFL+PLPTF+++YKKKS EG+QS+PYV ALF
Sbjct  5    TSHHP---------LAFAFGILGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALF  55

Query  275  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  454
            S+M+WIYYAFLKS+  LLITINSFGC++ETIYI  Y+ YA K ARV T+++L+L+   GF
Sbjct  56   SAMIWIYYAFLKSHVILLITINSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGF  115

Query  455  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFL  634
              + L+S FL    P R +V+GWVC+ FS+ VF APL +++ VIRTKSVE MP  LS FL
Sbjct  116  CLILLLSHFL-SQGPTRVEVLGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFL  174

Query  635  TVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ  796
            T+SAVMW  YGLLLKD+ +A PN+LGF FG++QM LYA Y+  K   +EK LP+
Sbjct  175  TLSAVMWLCYGLLLKDLYVATPNILGFSFGVVQMALYAKYRNTKTIVEEK-LPE  227



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 189/250 (76%), Gaps = 19/250 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS +G+QS+PY+VALFSSMLWIYYA +K +
Sbjct  8    WAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALVKKD  67

Query  317  ATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            A+LL ITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFGA+ L + +L  +
Sbjct  68   ASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL-TT  126

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
               R  V+GW+CLV ++ VF APLCI+K+VI+TKSVE MP  LS FLT++AVMWFFYGLL
Sbjct  127  GSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
            LKD  IA+PN LGF+FGI+QMVLY +Y+  K        PQ        LEE  K+ +EL
Sbjct  187  LKDYYIALPNTLGFLFGIIQMVLYLIYRNAK--------PQ-------GLEEPTKV-QEL  230

Query  854  TEEQIVDIVK  883
                I+D+VK
Sbjct  231  -NGHIIDVVK  239



>ref|XP_006436901.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
 gb|ESR50141.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
Length=285

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 195/252 (77%), Gaps = 20/252 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            WVFAFG+LGNI+SFIVFL+P+PTFY++ KKKS EG+QS+PYVVALFS+MLWIYYA +K +
Sbjct  10   WVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LLITIN+FGC++ETIY+  YI +A K+AR+ T+++L+LL   GFG++ L+S FL K +
Sbjct  70   AFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGS  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              R +++GW+C+VFS+ VF APL I++ V+RTKSVE MP  LS+FLT++AVMWFFYGL L
Sbjct  130  AARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFL  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KD+ +AVPNVLGFIFG++QM+LYA+Y+  ++               V +E+  K+P    
Sbjct  190  KDVYVAVPNVLGFIFGVVQMILYAIYRNYRR---------------VVVEDVNKVP----  230

Query  857  EEQIVDIVKLGS  892
             E  VD+VKL +
Sbjct  231  -EHTVDVVKLST  241



>gb|KHG02402.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=273

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 192/260 (74%), Gaps = 19/260 (7%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   WVF FG+LGN +SF+V L+PLPTFYQI+KKK++EG+QSIPYVV+LFS+MLWIYY
Sbjct  1    MALHLSWVFVFGILGNAVSFMVSLAPLPTFYQIFKKKTSEGFQSIPYVVSLFSAMLWIYY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK +A  LITIN+F   ++T YI  Y YY  KK ++ T+K+++L  + GFG + L + 
Sbjct  61   ALLKKDAIFLITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATY  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL K+  +R  ++G++C+ F+L VFVAPL IV++VI+TKSVE+MP  LSVFLT+ AVMWF
Sbjct  121  FL-KNPSLRLLILGYICMAFALAVFVAPLAIVRKVIKTKSVEYMPFTLSVFLTLGAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYGL LKD+N+AVPN+LGFIFG+LQM+LYA+YK   ++  E+  P++             
Sbjct  180  FYGLCLKDMNVAVPNILGFIFGVLQMILYAVYKNHPKKTVEESDPKL-------------  226

Query  839  LPKELTEEQ--IVDIVKLGS  892
               +L++    +VD+ KLGS
Sbjct  227  ---QLSDHPVVVVDVAKLGS  243



>gb|ACU23483.1| unknown [Glycine max]
Length=258

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 192/257 (75%), Gaps = 20/257 (8%)
 Frame = +2

Query  119  MALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MA+S   W F FG+LGN+ISF+VFL+PLPTFYQIYKKKS+EG+QS+PYVVALFSSMLWIY
Sbjct  1    MAISHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIY  60

Query  296  YAFLKSNATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  472
            YA +K +A+LL ITINSFGC++ETI++  ++ YA  K R+ TIK+L++L + GFG + L+
Sbjct  61   YALVKKDASLLLITINSFGCVIETIHLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGM-LL  119

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            S     +   R  V+GW+CLVF++ VF APLCI+K+VI+T+SVE MP  LS  LT++AVM
Sbjct  120  STLYLTTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSSSLTINAVM  179

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEK  832
            WFFYGLLLKD  IA+PN LGF+FGI+QMVLY +Y+  K        PQ        LEE 
Sbjct  180  WFFYGLLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAK--------PQ-------TLEEP  224

Query  833  QKLPKELTEEQIVDIVK  883
             K+ +EL    I+D+VK
Sbjct  225  TKV-QEL-NGHIIDVVK  239



>ref|XP_004297511.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Fragaria 
vesca subsp. vesca]
Length=310

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 174/219 (79%), Gaps = 2/219 (1%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            FAFG+LGNI+SFIVFL+P+PTFY++YKKKS EG+QSIPY+ ALFS+ +WIYYA LKS+  
Sbjct  10   FAFGILGNIVSFIVFLAPVPTFYRVYKKKSTEGFQSIPYIFALFSATIWIYYASLKSDEM  69

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITIN FGC++ETIYI  YI YA KKARV T+++L+L+   GF  +  +S FL    P 
Sbjct  70   LLITINGFGCVIETIYIAMYITYAPKKARVNTLRLLLLVNFGGFCLILFLSHFL-TQGPT  128

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R +V+GWVC+ FS+ VF APL I++ VIRTKSVE MP  LS FLT+SA+MW FYGLLLKD
Sbjct  129  RVKVLGWVCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAIMWLFYGLLLKD  188

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQE-DDEKRLPQ  796
            + +A PN+LGF FG++QM+LYA Y+ KK    DE+++P+
Sbjct  189  LYVAAPNILGFSFGVVQMILYAAYRNKKTVLVDEEKVPE  227



>ref|XP_009337539.1| PREDICTED: bidirectional sugar transporter N3 [Pyrus x bretschneideri]
Length=298

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 178/234 (76%), Gaps = 11/234 (5%)
 Frame = +2

Query  95   SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  274
            +S HP           FAFG+LGNI+SFIVFL+PLPTF+++YK+KS EG+QS+PYV ALF
Sbjct  5    TSHHP---------LAFAFGILGNIVSFIVFLAPLPTFWRVYKRKSTEGFQSVPYVFALF  55

Query  275  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  454
            S+M+WIYYAFLKS+  LLITINSFGC++ETIYI  Y+ YA K+ARV T+++L+L+   GF
Sbjct  56   SAMIWIYYAFLKSHVILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLLLVNFGGF  115

Query  455  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFL  634
              + L+S+FL    P R +V+GWVC+ FS+ VF APL +++ VIRTKSVE MP  LS FL
Sbjct  116  CLILLLSRFL-SQGPTRVEVLGWVCVTFSVGVFAAPLSVMRMVIRTKSVEFMPFNLSFFL  174

Query  635  TVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ  796
            T+SAVMW  YGLLLKD+ +A PN++GF FG++QM LY  Y+  K   +EK LP+
Sbjct  175  TLSAVMWLCYGLLLKDLYVATPNIIGFSFGVVQMALYTKYRNTKTIGEEK-LPE  227



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   281 bits (720),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 150/297 (51%), Positives = 199/297 (67%), Gaps = 24/297 (8%)
 Frame = +2

Query  137   WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
             W F FG+LGN+ISF+V+L+PLPTF++IYKKKS EG+QS+PYVVALFS+MLWIYYAFLK +
Sbjct  10    WTFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLWIYYAFLKPD  69

Query  317   ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
             A LLITINSFGC +ET+YI  ++ YA+KK R++TIK+L+LL  VG   + L+        
Sbjct  70    AHLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLN-VGTFCLILLLTLFLAHG  128

Query  497   PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
               RAQ+VGW+C+ FS+ VF APL I++ VIRTKSVE MP  LS FLT+SAVMWF YG L 
Sbjct  129   TKRAQIVGWLCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAVMWFSYGFLQ  188

Query  677   KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
             KD+ +A+PN+LGFIFGILQM+LY +YK  K+               V +EE++     + 
Sbjct  189   KDLYVALPNILGFIFGILQMLLYVIYKDSKK---------------VIIEEQK-----VN  228

Query  857   EEQIVDIVKLGSLICSDKINVAAAACCSIQDKL-LHQgggggggTATADHNINIPTK  1024
              E I+D+ KL S    +   V +     I D+  L         TA  ++N+  P +
Sbjct  229   NEHIIDVRKLNS--TENPAEVRSVDLTRIHDECNLGIDQRAREPTAHKENNVGAPNE  283



>ref|XP_003532478.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN16865.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=254

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 193/254 (76%), Gaps = 19/254 (7%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK-S  313
            W F FGV+GNIISF VFL+PLPTFYQIYKKKS EG+QS+PYVVALFS+MLWIYYAF+K  
Sbjct  8    WAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVKRE  67

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
             A LLITIN+FG +VE+IY+  ++ YA +K R+ TIK+L+LL + GFGA+ L + +L K 
Sbjct  68   TALLLITINTFGIVVESIYLSIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLSKG  127

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
            A  R  ++GW+CLVF++ VF APL I+++VI+T+SVE+MP  LS+FLT++AVMWFFYGLL
Sbjct  128  AK-RLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMWFFYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
            L+D  +A+PN LGF+FGI+QMV+Y MY+                 T VALEE  K  +EL
Sbjct  187  LRDYYVALPNTLGFVFGIIQMVMYLMYRNA---------------TPVALEEPVK-AQEL  230

Query  854  TEEQIVDIVKLGSL  895
                I+D+VK+G++
Sbjct  231  -NGHIIDVVKIGTM  243



>ref|XP_006493253.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X2 [Citrus sinensis]
Length=285

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 194/251 (77%), Gaps = 20/251 (8%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VFAFG+LGNI+SFIVFL+P+PTFY++ KKKS EG+QS+PYVVALFS+MLWIYYA +K +A
Sbjct  11   VFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDA  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
             LLITIN+FGC++ETIY+  YI +A K+AR+ T+++L+LL   GFG++ L+S FL K + 
Sbjct  71   FLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSA  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             R +++GW+C+VFS+ VF APL I++ V+RTKSVE MP  LS+FLT++AVMWFFYGL LK
Sbjct  131  ARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLK  190

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            D+ +AVPNVLGFIFG++QM+LYA+Y+  ++               V +E+  K+P     
Sbjct  191  DVYVAVPNVLGFIFGVVQMILYAIYRNYRR---------------VVVEDVNKVP-----  230

Query  860  EQIVDIVKLGS  892
            E  VD+VKL +
Sbjct  231  EHTVDVVKLST  241



>ref|XP_011020821.1| PREDICTED: bidirectional sugar transporter N3-like [Populus euphratica]
Length=285

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  F FG+LGNIIS +VFL+P+PTF +I+KKKS E +QS+PY++ALFSSMLW+YYA LK 
Sbjct  8    HLAFTFGILGNIISTMVFLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWLYYAMLKK  67

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            +  LL+TINSFGCL+ET YI  YI YA +++RV TIK+L+ + +  F  + L++ FL  S
Sbjct  68   DTILLVTINSFGCLIETTYIAIYIVYATRESRVSTIKLLISMNMGLFSLILLLAHFLV-S  126

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
              VR +V+GW+C+  S+CVF APL I+KQVIRTKSVE MP  LS FLT+SAVMWF YGLL
Sbjct  127  GSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVMWFAYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLP  793
            LKD+ +A+PN+LGFI G+LQMVLY +Y+  ++ +++K+LP
Sbjct  187  LKDLCVALPNILGFILGLLQMVLYGIYRNAQKVEEKKKLP  226



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   278 bits (711),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 186/250 (74%), Gaps = 19/250 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF+VFL+ LPT YQIYKKKS +G+QS+PY+VALFSSMLWIYYA +K +
Sbjct  8    WAFIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALVKKD  67

Query  317  ATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            A+LL ITINSFGC++ETIY+  ++ YA  K R+ TIK+L++L + GFGA+ L+S     +
Sbjct  68   ASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAM-LLSTLYLTT  126

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
               R  V+GW+CLV ++ VF APLCI+K+VI+TKSVE MP  LS FLT++AVMWFFYGLL
Sbjct  127  GSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
            LKD  IA+PN LGF+FGI+QMVLY +Y+  K        PQ        LEE  K+ +EL
Sbjct  187  LKDYYIALPNTLGFLFGIIQMVLYLIYRNAK--------PQ-------GLEEPTKV-QEL  230

Query  854  TEEQIVDIVK  883
                I+D+VK
Sbjct  231  -NGHIIDVVK  239



>ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
 ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
Length=295

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 183/241 (76%), Gaps = 3/241 (1%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             ++L   W F FG+LGNIISF+V+L+PLPTFY++YKKKS EG+QS+PYVVALFS+MLWIY
Sbjct  3    GLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYKKKSTEGFQSVPYVVALFSAMLWIY  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YAF+K++A LL+TINS GC++ET+YI  Y+ YA KKAR+ T ++L+LL +  FG + LV+
Sbjct  63   YAFIKADAYLLVTINSIGCVIETMYIVMYLSYAPKKARIFTAQVLLLLNVGLFGLIVLVT  122

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              + K  P R  V+GWVC+ FS+ VFVAPL I++ VIRTKSVE MP  LS FLT+SA+ W
Sbjct  123  LMVAK-GPERVHVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTMSAIAW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ--EDDEKRLPQVVLPTVVALEE  829
            F YGLL KDI +A+PN+LGFIFG++QM +Y  YKG ++   D +K    ++  T V   E
Sbjct  182  FSYGLLTKDIYVALPNILGFIFGVVQMGIYIAYKGTEKVAYDHQKVAEHIITITKVGTSE  241

Query  830  K  832
            +
Sbjct  242  R  242



>ref|XP_008374287.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=298

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 172/234 (74%), Gaps = 11/234 (5%)
 Frame = +2

Query  95   SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  274
            +S HP           FAFGVLGNI SFIVFL+PLPTF+++YKKKS EG+QS+PYV ALF
Sbjct  5    TSHHP---------LAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALF  55

Query  275  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  454
            ++ +WIYYAFLKSN  LLITINSFGC++ETIYI  Y+ YA K+ARV T+ +L L+   GF
Sbjct  56   TATIWIYYAFLKSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLTLLFLVNFGGF  115

Query  455  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFL  634
              + L++ FL    P R  V+GWVC+ FS+ VF APL  +K VIRTKSVE MP  LS FL
Sbjct  116  CLILLLAHFL-SQGPTRVAVLGWVCVTFSVSVFAAPLSAMKMVIRTKSVEFMPFNLSFFL  174

Query  635  TVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ  796
            T+SAVMW  YGLLLKD+ +A PN++GF FG++QM LYA Y+  K   +EK LP+
Sbjct  175  TLSAVMWLSYGLLLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNVEEK-LPE  227



>ref|XP_004490502.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=270

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  F FG+LGNIISF+VFL+PLPTFY+I+KKKS +G+QS+PY+VALFSSMLW+YYA +K+
Sbjct  6    HLAFVFGILGNIISFMVFLAPLPTFYRIWKKKSTQGFQSLPYLVALFSSMLWLYYAIVKT  65

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            NA LLITINSFGC++ETIYI  Y  YA K AR+ T+K+ +++ +  F  +   +QF    
Sbjct  66   NARLLITINSFGCVIETIYIVIYTIYATKDARILTVKLFMVMNVGSFALIFFTTQFGMHG  125

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
            + +R QV+GW+C+ F++CVF APLCIV +VIRTKSVE MP  LS FLT+SA+MWF YGLL
Sbjct  126  S-LRVQVLGWICVSFAVCVFAAPLCIVAKVIRTKSVEFMPFNLSFFLTLSAIMWFAYGLL  184

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMY-KGKK---QED  775
            LKDI IA+PNVLGF  G+LQM+LYA+Y KG K   +ED
Sbjct  185  LKDICIALPNVLGFTLGLLQMLLYAIYNKGSKVSIKED  222



>ref|XP_002321731.1| N3 like family protein [Populus trichocarpa]
 gb|EEF05858.1| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 193/267 (72%), Gaps = 19/267 (7%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   W+ AFG+LGN+IS +V L+PLPTFYQIYKKK++EG+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHLTWMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A    +A LLITIN+F   +E  YI  Y+ YA KK ++ T K+L+L    GFG + +++ 
Sbjct  61   AIFSEDAILLITINTFAFFMEFGYITVYLLYATKKDKILTFKLLLLFNSFGFGLICVLTL  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL +    R QV+GW+C++FSLCVFVAPL IV++VI+TKSVE MP  LS FLT+SAVMWF
Sbjct  121  FLTQGQK-RVQVLGWICMIFSLCVFVAPLFIVREVIKTKSVEFMPFSLSFFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG L KD  +AVPN+LGF+FGI+QMVLY +Y+   +              ++ +E K  
Sbjct  180  FYGYLKKDQFVAVPNILGFLFGIIQMVLYVIYRNPMK--------------ILVVEPKL-  224

Query  839  LPKELTEEQIVDIVKLGSLICSDKINV  919
              +EL+ E IVDI KLG+ ICS+ IN+
Sbjct  225  --QELSHEHIVDIRKLGTAICSE-INI  248



>gb|KFK26707.1| hypothetical protein AALP_AA8G282900 [Arabis alpina]
Length=281

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 192/256 (75%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LG+IISF V L+P+PTF +IYK+KS+EGYQSIPYV+ALFS+MLWIYYA ++ +A LL
Sbjct  12   FGLLGDIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVIALFSAMLWIYYALVRKHAVLL  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITIN+F C+++  YI FY++YA KK +  T+K ++ + +  FG + L++ FL      R 
Sbjct  72   ITINTFCCVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGLIFLLTYFLTHGIK-RV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            QV+G++C+VF+LCVFVAPL I+++VI+TKS E MP  LS FLT+SAVMWFFYGLLLKD+N
Sbjct  131  QVLGYICMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            +A+PNVLGFIFG+LQM+LY +YK        K   +V+ P+ + L++          E +
Sbjct  191  VALPNVLGFIFGVLQMILYMIYK--------KPGTKVLEPSGIKLQD--------ISEHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L S++CS ++ 
Sbjct  235  VDVVRLSSMVCSSQMR  250



>ref|NP_001241307.1| uncharacterized protein LOC100810946 [Glycine max]
 gb|ACU19376.1| unknown [Glycine max]
 gb|KHN17481.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=257

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 196/268 (73%), Gaps = 23/268 (9%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FGV+GNIISF VFL+PLPTFYQIYKKKS EG+QS+PYVVALFS+MLWIYYAF+K  
Sbjct  8    WAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVKRE  67

Query  317  ATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            A LL ITIN+FG +VE+IY+  ++ YA +K R+ TIK+L+LL + GFGA+ L + +L K 
Sbjct  68   AALLLITINTFGIVVESIYLAIFLLYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLSKG  127

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
            A  R  ++GW+CLVF++ VF APL I+++VI+T+SVE+MP  LS+FLT++AVMWFFYGLL
Sbjct  128  AK-RLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMWFFYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
            L+D  +A+PN LGF+FGI+QM +Y MY+                 T VALEE  K  +EL
Sbjct  187  LRDYYVALPNTLGFVFGIIQMGMYLMYRNA---------------TPVALEEPVK-AQEL  230

Query  854  TEEQIVDIVKLGSLICSDKINVAAAACC  937
                I+D+ K+G++    + N AA A  
Sbjct  231  -NGHIIDVGKMGTM----EPNHAATAGA  253



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 187/265 (71%), Gaps = 22/265 (8%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            S ++   W+F FG+LGN +SF+VFL+P+PTF +I +KKS EG+QS+PYVVALFS+M+W+Y
Sbjct  3    SFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIWLY  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LKS+A LLITINS GC +E IYI  Y+ YA K+AR+ T+++L+LL   GF AV L+S
Sbjct  63   YASLKSDALLLITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLLLS  122

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
             F  K +  R +V+GWVC++FS+ VF APL I++ VIRT+SVE MP  LS FLT+SA+MW
Sbjct  123  HFFVKGSN-RVKVLGWVCVIFSVSVFAAPLSIMRIVIRTRSVEFMPFTLSFFLTLSAIMW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
             FYG+LLKD  IA+PN+LGFIFG+LQMVLY +YK  K              T V +E   
Sbjct  182  LFYGVLLKDFYIAIPNILGFIFGVLQMVLYVIYKNSK--------------TAVPMEP--  225

Query  836  KLPKELTEEQIVDIVKLGSLICSDK  910
             LP+        DI KL S+ C  K
Sbjct  226  TLPQNSN-----DIAKLSSISCEMK  245



>ref|XP_009347840.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=327

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 181/254 (71%), Gaps = 21/254 (8%)
 Frame = +2

Query  95   SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  274
            +S HP           FAFGVLGNI SFIVFL+PLPTF+++YKKKS EG+QS+PYV ALF
Sbjct  5    TSHHP---------LAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALF  55

Query  275  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  454
            ++ +WIYYAFLKSN  LLITINSFGC++ETIYI  Y+ YA K+ARV T+++L L+   GF
Sbjct  56   TATIWIYYAFLKSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLFLVNFGGF  115

Query  455  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFL  634
              + L++ FL    P R  V+GWVC+ FS+ VF APL ++K VI TKSVE MP  LS FL
Sbjct  116  CFILLLAHFL-SQGPTRVAVLGWVCVTFSVSVFAAPLSVMKMVIHTKSVEFMPFNLSFFL  174

Query  635  TVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTV  814
            T+SAVMW  YGLLLKD+ +A PN++GF FG++QM LYA Y+  K  + EK+LP       
Sbjct  175  TLSAVMWLSYGLLLKDLYVATPNIVGFSFGLVQMALYAKYRNNK-TNVEKKLP-------  226

Query  815  VALEEKQKLPKELT  856
               E+K  + K++T
Sbjct  227  ---EQKADVVKQMT  237



>ref|XP_006366912.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 196/273 (72%), Gaps = 15/273 (5%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VF FG+LGN++SF+VF++P+PTFY+I KKKS+EG+ S+PYVV LFS+MLWIYYA +K+N 
Sbjct  11   VFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVKTNV  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            TLLITINSFGC+ ETIY+  Y  YA KKAR++T+ +++LL    FG +  ++Q L +   
Sbjct  71   TLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQGTK  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             RA+V+GW+C+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LTVSAVMWF YGLLLK
Sbjct  131  -RAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLLLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQED--DEKRLPQVVLPTVVALEEKQKLPKEL  853
            DI +AVPN+ G I G+LQM+LY +Y+  K  +   EK      LPTVV ++++Q  P ++
Sbjct  190  DIYVAVPNIPGMILGVLQMILYGIYRNFKSNNVATEKE-----LPTVVKVDQEQ--PTKV  242

Query  854  TEEQIVDIVKLGSLICSDKINVAAAACCSIQDK  952
              E  V  V + SL   D  N  A    +++D 
Sbjct  243  NCE--VYPVNISSL---DSENGEAKDAKNLEDS  270



>ref|XP_004235470.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=276

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/277 (52%), Positives = 195/277 (70%), Gaps = 15/277 (5%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            V+ FG+LGN++SF+VF++P+PTFY+I KKKS+EG+ S+PYVV LFS+MLWIYYA +K+N 
Sbjct  11   VYTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVKTNV  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            TLLITINSFGC+ ETIY+  Y  YA KKAR++T+ +++LL    FG +  ++Q L +   
Sbjct  71   TLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQGTK  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             RA+V+GW+C+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LTVSAVMWF YGLLLK
Sbjct  131  -RAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLLLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQED--DEKRLPQVVLPTVVALEEKQKLPKEL  853
            D+ +AVPN+ G I G+LQM+LY +Y+  K  +   EK LP VV       +  Q+ P ++
Sbjct  190  DVYVAVPNIPGMILGVLQMILYGIYRNSKSNNVATEKELPIVV-------KVDQEQPTKV  242

Query  854  TEEQIVDIVKLGSLICSDKINVAAAACCSIQDKLLHQ  964
              E  V  V + SL   D  N  A    ++QD  ++ 
Sbjct  243  NSE--VYPVNISSL---DSENGEAKDGKNLQDPQMNS  274



>ref|XP_009385515.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 181/257 (70%), Gaps = 14/257 (5%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGNIISF+VFLSPLPTFY+IY+KKS EG+QS+PYVVAL S ML IYYA +K+NA 
Sbjct  12   FIFGILGNIISFMVFLSPLPTFYRIYRKKSTEGFQSVPYVVALSSCMLLIYYALVKTNAV  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGC +ET YI  Y+ YA KKAR+  I++ VLL +V F A+ L+++  F + P 
Sbjct  72   LLITINSFGCFIETAYITIYLIYATKKARIFCIQIFVLLNVVAFAAIVLLTRLAF-TGPD  130

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R  VVGW+C+ FSLCVF APL I++ VIRTKSVE MP  LS FLT++A+ WF YG   KD
Sbjct  131  RVTVVGWICVGFSLCVFAAPLSIIRLVIRTKSVEFMPFYLSFFLTLNAIAWFGYGFFTKD  190

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDD-------EKRLPQVVLPTV------VAL  823
            + + +PNVLGF+FG++QMV+Y +YK    + D       E R+    L +       V+L
Sbjct  191  LYVELPNVLGFVFGVVQMVVYMLYKNNNNKKDAAVAAVPEHRVKIAELSSAPASELQVSL  250

Query  824  EEKQKLPKELTEEQIVD  874
            EEK +  + + + Q  D
Sbjct  251  EEKDQNKRSMEDSQDTD  267



>ref|XP_006347653.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 179/232 (77%), Gaps = 4/232 (2%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VF FG+LGN++SF+VF++P+PTFY+I KKKS+EG+ S+PYVV LFS+MLWIYYA +K+N 
Sbjct  11   VFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVKTNV  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            TLLITINSFGC+ ETIY+  Y  YA KKAR++T+ +++LL    FG +  ++Q L +   
Sbjct  71   TLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQGTK  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             RA+V+GW+C+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LTVSAVMWF YGLLLK
Sbjct  131  -RAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLLLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
            D+ +AVPN+ G I G+LQM+LY +Y+  K  +   +     LPTVV ++++Q
Sbjct  190  DVYVAVPNISGMILGVLQMILYGIYRNSKSNNVATKKE---LPTVVKVDQEQ  238



>ref|XP_011023934.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=283

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 193/267 (72%), Gaps = 19/267 (7%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   W+ AFG+LGN+IS +V L+PLPTFYQIYKKK++EG+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHLTWMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A    +A LLITIN+F   +E  YI  Y+ YA KK ++ T K+L+L    GFG + L++ 
Sbjct  61   AIFSEDAILLITINTFAFFMEFGYIVVYLLYATKKDKILTFKLLLLFNSFGFGLICLLTL  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL +    R QV+GW+C++FSLCVFVAPL IV++VI+TKSVE MP  LS FLT+SAVMWF
Sbjct  121  FLTQGQK-RVQVLGWICMIFSLCVFVAPLFIVREVIKTKSVEFMPFSLSFFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG L KD  +AVPN+LGF+FGI+QMVLY +Y          R P  +L     +E K  
Sbjct  180  FYGYLKKDHFVAVPNILGFLFGIIQMVLYVIY----------RKPMKIL----VVEPKL-  224

Query  839  LPKELTEEQIVDIVKLGSLICSDKINV  919
              ++L+ E IVDI KLG+ ICS+ IN+
Sbjct  225  --QDLSHEHIVDIRKLGTAICSE-INI  248



>ref|XP_009132693.1| PREDICTED: bidirectional sugar transporter SWEET10 [Brassica 
rapa]
Length=289

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 190/256 (74%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF+V L+P+PTF +IYK+KS+EGYQSIPYV+ALFS+MLWIYYA +K+N  ++
Sbjct  12   FGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTNVVIM  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITIN+   +++  YI FY++YA KK +  T+K ++ + +  FG +  ++ FL      R 
Sbjct  72   ITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHGQK-RV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            Q++G++C+VFSLCVFVAPL I+++VI+T+S E MP  LS FLT+SAVMWFFYGLLLKD+N
Sbjct  131  QILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            IA+PNVLGFIFG+LQM+LY +YK        K   +V+ P V+ L+E          + +
Sbjct  191  IALPNVLGFIFGVLQMILYMIYK--------KPGTKVLEPPVINLQE--------ISDHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L S++CS ++ 
Sbjct  235  VDVVRLSSMVCSSQMR  250



>ref|XP_002322281.2| N3 like family protein [Populus trichocarpa]
 gb|EEF06408.2| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 187/263 (71%), Gaps = 18/263 (7%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   WVF FG+LGN IS +V L+PLPTFY+I KKK+++G+ SIPYV+ALFS+MLW++Y
Sbjct  1    MALHLTWVFGFGLLGNFISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A  K +A LLITINSF   +E  YI  Y+ YA KK ++ T K+L+L  + GFG + ++++
Sbjct  61   ALFKEDALLLITINSFTFFMEIGYIFMYLLYATKKDKILTFKLLLLFNVFGFGLICVLTR  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL +    R QV+GW+C+ FSLCVFVAPL IV++VIRTKSVE MP  LS FLT+SAVMWF
Sbjct  121  FLTQRQK-RVQVLGWICMTFSLCVFVAPLFIVRKVIRTKSVEFMPFSLSFFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG L KD  +AVPN+LG +FGILQMVLY +Y+  K+              VV +E K K
Sbjct  180  FYGFLKKDQFVAVPNILGLLFGILQMVLYMIYRNSKK--------------VVVVEPKLK  225

Query  839  LPKELTEEQIVDIVKLGSLICSD  907
            L      E +VD+ KLG+ ICS+
Sbjct  226  LD---ISEHVVDLEKLGAAICSE  245



>ref|XP_002511128.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51730.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   276 bits (706),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 190/271 (70%), Gaps = 17/271 (6%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MA      FAFG+LGNIISF+V L+P+PTFYQI KKK++EG+QSIPYV+ALFS+ LW++Y
Sbjct  1    MAFHLTLAFAFGLLGNIISFLVCLAPMPTFYQICKKKTSEGFQSIPYVIALFSATLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A   ++ATLLITINSF   +ET YI  Y++YA KK R+ T K+++ L I  FG++ +++ 
Sbjct  61   AIFANDATLLITINSFAFFMETAYIAIYLFYAVKKDRLFTTKLVLSLNIFAFGSICVIAM  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL      R Q++GW+C+VF+LCVFVAPL IV++VI+TKSVE MP  LS FLT+SAVMWF
Sbjct  121  FL-THGQKRVQLLGWICMVFALCVFVAPLAIVRKVIKTKSVEFMPFSLSFFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG L KD+ +AVPN+LGF+FG+LQM+LY +Y+  K+  D+              ++  +
Sbjct  180  FYGFLKKDLYVAVPNILGFMFGVLQMILYLIYRNPKKTGDDD-------------QKANE  226

Query  839  LPKELTEEQIVDIVKLGSLICSDKINVAAAA  931
            LP    +  I+D+ KL + +   + N    A
Sbjct  227  LPN---QHSIIDVAKLNTRVSCCEPNATTVA  254



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 184/255 (72%), Gaps = 12/255 (5%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            FAFG+LGN+ISF+VFL+P+PTFY++Y+KKS EG+ S+PYVVALFS MLWIYYAF+K+N+ 
Sbjct  12   FAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLWIYYAFVKTNSM  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFG  +ETIYI  Y+ YA KKAR+  I++ VLL +V F A+ L++Q +FK +  
Sbjct  72   LLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVLLTQLVFKGSN-  130

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R  V+GW+C+ FS+ VF APL +++ VIRTKSVE MP  LS FLT+SA+ WF YGL  KD
Sbjct  131  RVTVLGWICVGFSISVFAAPLSVIRLVIRTKSVEFMPFFLSFFLTLSAIAWFGYGLFTKD  190

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTV-----------VALEE  829
            I + +PNVLGF+FGI QM+LY +YK KK    E  +P+ +L              V++EE
Sbjct  191  IYVQLPNVLGFVFGIAQMLLYIIYKKKKNVVVEPTVPEHILKIAELITTPASELQVSIEE  250

Query  830  KQKLPKELTEEQIVD  874
              +  K   + + VD
Sbjct  251  NDRKKKANEDAEGVD  265



>gb|KFK27668.1| hypothetical protein AALP_AA8G413300 [Arabis alpina]
Length=288

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 186/260 (72%), Gaps = 3/260 (1%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFVFGMLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  +I +ANKKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYISIFIAFANKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+WF YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWFLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            +DI +A PNVLGF+ G LQM+LY +YK  K   D  E+ L    LP V     K      
Sbjct  189  RDIYVAFPNVLGFVLGALQMILYVVYKYCKTSSDLVEQELEAAKLPEVSIDMLKLGTHAS  248

Query  851  LTEEQIVDIVKLGSLICSDK  910
                +I  +  L + +C+D+
Sbjct  249  PKPAEITVVRSLNTCLCNDR  268



>ref|XP_011023931.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
 ref|XP_011023932.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=258

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 188/263 (71%), Gaps = 18/263 (7%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   WVF FG+LGNIIS +V L+PLPTFY+I KKK+++G+ SIPYV+ALFS+MLW++Y
Sbjct  1    MALHLTWVFGFGLLGNIISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A  K +A LLITINSF   +E  YI  Y++YA KK ++ T K+L+L  + GFG + ++++
Sbjct  61   ALYKEDALLLITINSFTFFMEIGYIFMYLFYATKKDKILTFKLLLLFNVFGFGLICVLTR  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL +    R QV+GW+C+ FSLCVFVAPL IV++VI+TKSVE MP  LS FLT+SAVMWF
Sbjct  121  FLTQRQK-RVQVLGWICMTFSLCVFVAPLFIVRKVIKTKSVEFMPFSLSFFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG L KD  +AVPN+LG +FGILQMVLY +Y+  K+              VV +E K +
Sbjct  180  FYGFLKKDQFVAVPNILGLLFGILQMVLYMIYRNSKK--------------VVVVEPKLQ  225

Query  839  LPKELTEEQIVDIVKLGSLICSD  907
            L      E +VD+ K G+ ICS+
Sbjct  226  LD---ISEHVVDLEKFGATICSE  245



>ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 185/262 (71%), Gaps = 10/262 (4%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             ++L   W F FG+LGNIISF+V+L+PLPTFY++ ++KS EG+ S+PYVVALFS+ LWI+
Sbjct  3    GLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVCRRKSTEGFHSVPYVVALFSATLWIF  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YAFLK+NA LLITIN+ GC++ET Y+  Y  YA K A++ T K LVLLV VG   + LV 
Sbjct  63   YAFLKTNAGLLITINAVGCVIETAYVVVYFTYAPKAAKMFTAK-LVLLVNVGMFGLILVL  121

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              LF     R +V+GW+C+ FS+ VFVAPL I++ VIRTKSVE MP  LS FLT SAV+W
Sbjct  122  TLLFARGAKRVEVLGWICMSFSVSVFVAPLSIIRLVIRTKSVEFMPFSLSFFLTWSAVVW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEE--  829
            F YGLL KD+ +A+PNVLGFIFG+LQMVLY  Y+ K +   E++LP+ +   +   E+  
Sbjct  182  FGYGLLTKDLYVALPNVLGFIFGVLQMVLYVAYRNKDKAMVEQKLPEHIASKLGTAEKVL  241

Query  830  -------KQKLPKELTEEQIVD  874
                   ++K+P    EEQ  D
Sbjct  242  EIYAIGVEEKVPNRAQEEQEED  263



>ref|XP_007222479.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
 gb|EMJ23678.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
Length=277

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 196/284 (69%), Gaps = 19/284 (7%)
 Frame = +2

Query  116  SMALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  292
            ++A S H W F FG+LGN+ISF+V+L+P+PTFY IYKKKS +G+QS+PY+VALFS MLW 
Sbjct  3    ALADSHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGMLWF  62

Query  293  YYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  472
            YYA LK NA LLITINSFG ++ETIYI  +I+YA K AR  T+K+   + +  F ++ ++
Sbjct  63   YYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVL  122

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            S F  +S   R  V+GW+ +  S+ VF APL IV QVIRT+SVE MP  LS FLT+SAVM
Sbjct  123  SHFAVRSE-YRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVM  181

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ-EDDEKRLP-------QVVLP  808
            WF YGL LKDI IA+PNVLGFI G+LQM+LYA+Y+ +K  EDDEK++P        VV  
Sbjct  182  WFSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNRKPIEDDEKKIPAADQHVKNVVGL  241

Query  809  TVVALEEKQKL-PKELTEEQIVDIVKLGSLICSDKINVAAAACC  937
            T +A  E   + P     ++ V+ V  GS       + AAA+C 
Sbjct  242  TTLATSEVHPVDPPPRDHDKSVE-VDAGS-------HTAAASCA  277



>ref|XP_006663471.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Oryza 
brachyantha]
Length=310

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 200/318 (63%), Gaps = 30/318 (9%)
 Frame = +2

Query  116   SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
              M+L   W FAFG+LGNIISF+ +L+PLPTFY+IYK KS +G+QSIPYVVALFS+MLWIY
Sbjct  3     GMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLWIY  62

Query  296   YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
             YA LKS+  LLITINS GC++ET+YI  Y+ YA KKARV T ++L LLV VG   + L+ 
Sbjct  63    YALLKSDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLL-LLVNVGVFGLILLL  121

Query  476   QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
               L  + P R  V+GWVC+ FS+ VFVAPL I++ V+RTKSVE MP  LS+ LTVSAV+W
Sbjct  122   TLLLSAGPRRVVVLGWVCVGFSVSVFVAPLSIMRLVVRTKSVEFMPFSLSLSLTVSAVVW  181

Query  656   FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
             F YGLL+KD  +A+PNVLGF FG++QM LYAMY+    +            T+VA E + 
Sbjct  182   FLYGLLIKDKYVALPNVLGFTFGVIQMGLYAMYRNSTPKRS----------TMVAKEVEA  231

Query  836   KL--------PKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQDKLLHQgggggggTA  991
                       P    +E +V+I KL           +AAA   ++ + +H          
Sbjct  232   TATDDDDAASPTAGVKEHVVNIAKL-----------SAAAAIDVKTREVHPVESPPAEDH  280

Query  992   TADHNINIPTKPLDDETN  1045
              +      P  P DD++ 
Sbjct  281   PSVAAAGSPPPPEDDKSG  298



>ref|NP_001239695.1| uncharacterized protein LOC100777741 [Glycine max]
 gb|ACU24541.1| unknown [Glycine max]
 gb|KHN03191.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=268

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 184/249 (74%), Gaps = 9/249 (4%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            FAFG+LGN+ISF+VFL+P+ TFY+I+KKKS EG+QS+PY+VALFSSMLW+YYA LK +A 
Sbjct  10   FAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALLKKDAM  69

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LL+TINSFGC++E IYI  YI YA + AR  T+K+   + +  F  + LV+ F    + +
Sbjct  70   LLLTINSFGCVIEVIYIILYITYATRDARNLTLKLFFAMNVGAFALILLVTHFAVHGS-L  128

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R QV+GW+C+  S+ VF APL IV QV+RTKSVE MP  LS  LT+SA+MWF YGL LKD
Sbjct  129  RVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLFLKD  188

Query  683  INIAVPNVLGFIFGILQMVLYAMYK-GKKQEDD--EKRLPQVVLPTVV---ALEEKQ--K  838
            I IA+PNVLGF  G+LQM+LYA+Y+ G K+ D   EK+ P   L TVV    LEEKQ  K
Sbjct  189  ICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKIMEKKAPLEPLKTVVIETGLEEKQQGK  248

Query  839  LPKELTEEQ  865
              KE +EE+
Sbjct  249  KSKENSEEK  257



>ref|XP_002303766.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
 gb|EEE78745.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
Length=287

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 180/230 (78%), Gaps = 1/230 (0%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  F FG+LGNIIS +V+L+P+PTF +I+KKKS E +QS+PY++ALFSSMLW+YYA LK 
Sbjct  8    HLAFTFGILGNIISTMVYLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWLYYAMLKK  67

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            +  LL+TINSFGC++ET YI  YI YA +++RV TIK+L+ + +  F  + L++ FL  S
Sbjct  68   DTILLVTINSFGCVIETTYIAIYIVYATRESRVSTIKLLISMNLGLFSLILLLAHFLV-S  126

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
              VR +V+GW+C+  S+CVF APL I+KQVIRTKSVE MP  LS FLT+SAVMWF YGLL
Sbjct  127  GSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVMWFAYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVAL  823
            LKD+ IA+PN+LGFI G+LQM+LY +Y+  ++ +++K+LP   L ++V L
Sbjct  187  LKDLCIALPNILGFILGLLQMLLYGIYRNAQKVEEKKKLPAENLKSIVIL  236



>ref|XP_008222221.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=282

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 148/290 (51%), Positives = 196/290 (68%), Gaps = 25/290 (9%)
 Frame = +2

Query  116  SMALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  292
            ++A S H W F FG+LGN+ISF+V+L+P+PTFY IYKKKS +G+QS+PY+VALFS MLW 
Sbjct  3    ALADSHHPWAFTFGILGNVISFLVYLAPMPTFYGIYKKKSTQGFQSVPYLVALFSGMLWF  62

Query  293  YYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  472
            YYA LK NA LLITINSFG ++ETIYI  +I+YA K AR  T+K+   + +  F ++ ++
Sbjct  63   YYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVL  122

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            S F  +S   R  V+GW+ +  S+ VF APL IV QVIRT+SVE MP  LS FLT+SAVM
Sbjct  123  SHFAVRSE-YRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVM  181

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ---EDDEKRLP----------  793
            WF YGL LKDI IA+PNVLGFI G+LQM+LYA+Y+ ++Q   EDDEK++P          
Sbjct  182  WFSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNREQVIIEDDEKKIPAAAAADQHVK  241

Query  794  QVVLPTVVALEEKQKL-PKELTEEQIVDIVKLGSLICSDKINVAAAACCS  940
             VV  T +A  E   + P     ++ V++         D  +  AAA C+
Sbjct  242  NVVGLTTLATSEVHPVDPPPHDHDKSVEV---------DSGSHTAAASCA  282



>ref|XP_006366913.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=357

 Score =   276 bits (707),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 181/243 (74%), Gaps = 10/243 (4%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VF FG+LGN++SF+VF++P+PTFY+I KKKS+EG+ S+PYVV LFS+MLWIYYA +K+N 
Sbjct  11   VFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVKTNV  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            TLLITINSFGC+ ETIY+  Y  YA KKAR++T+ +++LL    FG +  ++Q L +   
Sbjct  71   TLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQGTK  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             RA+V+GW+C+ FS+ VFVAPL I+ +VIRTKSVE MP  LS+ LTVSAVMWF YGLLLK
Sbjct  131  -RAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLLLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQED--DEKRLPQVVLPTVVALEEKQKLPKEL  853
            D  +AVPN+ G I G+LQM+LY +Y+  K  +   EK LP VV       +  Q+LP ++
Sbjct  190  DFYVAVPNISGMILGVLQMILYGIYRNSKSNNVATEKELPTVV-------KVDQELPPKV  242

Query  854  TEE  862
              E
Sbjct  243  NCE  245



>ref|XP_004503778.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Cicer 
arietinum]
Length=255

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 188/254 (74%), Gaps = 18/254 (7%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
             W F FG+LGNIISF VFLSPLPTFY I+KKKS EG+QS+PYVVALFS+MLWIYYAF+K 
Sbjct  7    SWAFVFGLLGNIISFAVFLSPLPTFYLIFKKKSTEGFQSLPYVVALFSAMLWIYYAFVKR  66

Query  314  NATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
             A LL ITIN+FG +VE+ Y+  ++ YA KK+R+ TIK+L+LL + GFGA+ L + +L K
Sbjct  67   EAALLLITINTFGIVVESCYLIVFLIYATKKSRLSTIKLLLLLNVFGFGAMLLSTLYLAK  126

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
             A  R  ++GW+CLVF++ VF APL I+ +VIRT+SVE+MP  LS FLT++AVMWFFYGL
Sbjct  127  GAK-RLAIIGWICLVFNITVFAAPLFIISRVIRTRSVEYMPFFLSFFLTINAVMWFFYGL  185

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKE  850
            LLKD  +A+PN LGF+FGI+QMV+Y +Y+                 T V L+   K  +E
Sbjct  186  LLKDYYVALPNTLGFVFGIIQMVMYLIYRNA---------------TPVPLDGPVK-GQE  229

Query  851  LTEEQIVDIVKLGS  892
            L+   IVD+VK+GS
Sbjct  230  LSGGHIVDVVKIGS  243



>ref|XP_008239523.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=296

 Score =   274 bits (701),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 189/267 (71%), Gaps = 22/267 (8%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            V AFG+LGN++SF+VFL+P+PTF++IYKKKS EG+QS+PYV ALFS+M+WIYYAFLKS+ 
Sbjct  11   VIAFGILGNVVSFVVFLAPVPTFWRIYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSDE  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
             LLITIN+FGC++ETIYI  YI YA K+ARV  +++L+L+   GF  + L+S FL    P
Sbjct  71   FLLITINAFGCIIETIYISMYITYAPKQARVFALRLLLLVNFGGFCLILLLSHFL-AQGP  129

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             R +V+GWVC+ FS+ VF APL I++ VIRTKS   MP  LS FLT+SAVMW FYGLLLK
Sbjct  130  TRVEVLGWVCVAFSVSVFAAPLSIMRVVIRTKS---MPFSLSFFLTLSAVMWLFYGLLLK  186

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            D+ +A PN+LGF FG+ QM+LYA+Y+ KK                  L E QKLP  + +
Sbjct  187  DLYVACPNILGFTFGVAQMILYAIYRNKK----------------TVLVEDQKLP--VHK  228

Query  860  EQIVDIVKLGSLICSDKINVAAAACCS  940
              +V  +++ S     +I V AAA  S
Sbjct  229  GDVVKQIQILSTTPEVEIQVQAAAVSS  255



>ref|XP_007159993.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
 gb|ESW31987.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
Length=258

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 188/254 (74%), Gaps = 19/254 (7%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGNIISF VFL+PLPTFYQIYKKKS EG+QS+PYVVALFS+MLWIYYAF+K  
Sbjct  8    WAFVFGLLGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFVKRE  67

Query  317  ATLL-ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            A LL ITIN+FG +VE+IY+  ++ YA +K R+ TIK+L+LL + GFGA+ L + +L K 
Sbjct  68   AALLLITINTFGIVVESIYLTIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYLTKG  127

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
            A  R  ++GW+CLVF++ VF APL I+ +VI+T+SVE+MP  LS+FLT++AVMWFFYGLL
Sbjct  128  AK-RLAIIGWICLVFNISVFAAPLFIISRVIKTRSVEYMPFTLSMFLTINAVMWFFYGLL  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
            L+D  +A+PN LGF+FGI+QM +Y MY+                 T VALEE  K   + 
Sbjct  187  LRDYYVALPNTLGFVFGIIQMGMYLMYRNA---------------TPVALEEPVK--GQE  229

Query  854  TEEQIVDIVKLGSL  895
            +   IV  VK+G++
Sbjct  230  SNGHIVGAVKMGTI  243



>ref|XP_008392764.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=283

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 167/212 (79%), Gaps = 2/212 (1%)
 Frame = +2

Query  161  GNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITIN  340
            GNI+SFIVFL+PLPTF+++YKKKS EG+QS+PYV ALFS+M+WIYYAFLKS+  LLITIN
Sbjct  3    GNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSHVILLITIN  62

Query  341  SFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVG  520
            SFGC++ETIYI  Y+ YA K ARV T+++L+L+   GF  + L+S FL    P R +V+G
Sbjct  63   SFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFL-SQGPTRVEVLG  121

Query  521  WVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDINIAVP  700
            WVC+ FS+ VF APL +++ VIRTKSVE MP  LS FLT+SAVMW  YGLLLKD+ +A P
Sbjct  122  WVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLLKDLYVATP  181

Query  701  NVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ  796
            N+LGF FG++QM LYA Y+  K   +EK LP+
Sbjct  182  NILGFSFGVVQMALYAKYRNTKTIVEEK-LPE  212



>ref|XP_010454652.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 188/260 (72%), Gaps = 19/260 (7%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TIN FGC +ETIYI  ++ +A KKAR+ T+K+L+L+ + GF A+ L+ QFL K A
Sbjct  70   VFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKGA  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF+ G LQM+LY +YK  K   +  EK L            E  KLP E
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKEL------------ETAKLPDE  236

Query  851  LTEEQIVDIVKLGSLICSDK  910
            ++    +D++KLG+LI S +
Sbjct  237  VS----IDMLKLGTLIASPE  252



>ref|XP_010482380.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Camelina 
sativa]
Length=288

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 191/256 (75%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF V L+P+PTF +IYK+KS+EGYQS+PYV++LFS+MLW+YYA +K +A +L
Sbjct  12   FGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKDAMML  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSF  +V+ +YI  Y +YA KK ++ T+K ++ + +  FG + L++ FL      R 
Sbjct  72   ITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFL-THGNKRG  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            QV+G++C+VF+L VFVAPL I+++VI+TKS E MP  LS FLT+SA+MWFFYGLLLKD+N
Sbjct  131  QVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLKDMN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            IA+PN+LGFIFG+LQM+L+ +YK        K   +V+ P+V+ L++          E +
Sbjct  191  IALPNILGFIFGVLQMILFVIYK--------KPGTKVLEPSVIKLQD--------ISEHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L S++C+ ++ 
Sbjct  235  VDVVRLSSMVCNSQMR  250



>ref|XP_009765830.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=278

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 185/255 (73%), Gaps = 7/255 (3%)
 Frame = +2

Query  128  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  307
            + H  F FGVLGN +SF+V+LSP+PTFY+IYK+KS EG+QSIPY VALFS+ML++YYA+L
Sbjct  6    ASHLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAYL  65

Query  308  KS-NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            K  N  LLITINSFG  +E IY+  ++ YA ++A++ T K+++LL I  FGA+  ++ ++
Sbjct  66   KEKNGILLITINSFGTAIEFIYLTIFLMYATREAKIYTTKLVLLLNIGSFGAIVALT-YI  124

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            F     R  +VGW+C VFS+CVF APL I+++VI+T+SVE MP  LS FLT+ AVMWFFY
Sbjct  125  FAKDKTRVTIVGWICAVFSVCVFAAPLSIMRRVIKTRSVEFMPFPLSFFLTICAVMWFFY  184

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ-----EDDEKRLPQVVLPTVVALEE  829
            GLL+KD+ IA PN+LGF FGI QM+LYA+++ +KQ     + + K L QVV+     + E
Sbjct  185  GLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQVVIDMKAMVLE  244

Query  830  KQKLPKELTEEQIVD  874
             Q+      E ++ D
Sbjct  245  MQENSDPNKEAEVDD  259



>ref|XP_011071246.1| PREDICTED: bidirectional sugar transporter N3 [Sesamum indicum]
Length=297

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 190/272 (70%), Gaps = 15/272 (6%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FGVLGNIIS  V+L+PLPTF++IYK++S  G+ S+PYVVALFS+MLW+YYAFLK+N
Sbjct  10   WAFTFGVLGNIISVFVYLAPLPTFFRIYKERSTMGFDSLPYVVALFSAMLWMYYAFLKTN  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LLI+IN FGC++E IYI  Y++YA+KKAR  T K+L L+ +     + L++ F+FK  
Sbjct  70   AILLISINLFGCVIEAIYIFIYLFYASKKARTHTAKLLSLINVGLLALIFLLTFFIFK-G  128

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
            P+R  VVGW+C+  S+ VF APL IV QV+RT+SVE MP  LS FLT+SAVMWF YGL  
Sbjct  129  PIRVHVVGWICVAVSVSVFAAPLTIVFQVVRTRSVEFMPFPLSFFLTLSAVMWFAYGLFQ  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KD+ +A+PNVLGF  G+LQM+LY +++  K E+++K+LP+ V+  ++ L   +  P +  
Sbjct  189  KDLCVALPNVLGFFLGLLQMLLYGIFRNVKPENEDKKLPEHVI-NIMVLGTPEVHPVD--  245

Query  857  EEQIVDIVKLGSLICSDKINVAAAACCSIQDK  952
                       S  C DKI V+       +D+
Sbjct  246  -----------SQNCPDKIGVSQEENKDEEDE  266



>ref|XP_010493487.1| PREDICTED: bidirectional sugar transporter SWEET12 [Camelina 
sativa]
Length=289

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 188/260 (72%), Gaps = 19/260 (7%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TIN FGC +ETIYI  ++ +A KKAR+ T+K+L+L+ + GF A+ L+ QFL K A
Sbjct  70   VFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKGA  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF+ G LQM+LY +YK  K   +  EK L            E  KLP E
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKEL------------ETAKLPDE  236

Query  851  LTEEQIVDIVKLGSLICSDK  910
            ++    +D++KLG+LI S +
Sbjct  237  VS----IDMLKLGTLIASPE  252



>ref|NP_197755.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
 sp|O82587.1|SWT12_ARATH RecName: Full=Bidirectional sugar transporter SWEET12; Short=AtSWEET12; 
AltName: Full=MtN3-like protein [Arabidopsis thaliana]
 gb|AAC64192.1| MTN3 homolog [Arabidopsis thaliana]
 dbj|BAA97235.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL09814.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAL15214.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAM47150.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AED93195.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
Length=285

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/277 (52%), Positives = 191/277 (69%), Gaps = 23/277 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QSIPYVVALFS+MLW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ +A+KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF+ G LQM+LY +YK  K   D  EK L            E  KLP  
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKIN---VAAAACCSIQDK  952
               E  +D+VKLG+L   + +    V +   C+  D+
Sbjct  235  ---EVSIDMVKLGTLTSPEPVAITVVRSVNTCNCNDR  268



>ref|XP_003602778.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES73029.1| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=311

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 181/261 (69%), Gaps = 17/261 (7%)
 Frame = +2

Query  131  GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK  310
             H  FAFGVLGNI SF+ FL+PLPTFY+I KKKS EG+QSIPYV ALFS+MLW++YA+ K
Sbjct  6    SHLSFAFGVLGNISSFVCFLAPLPTFYRICKKKSTEGFQSIPYVAALFSAMLWMFYAYTK  65

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
               TLLITIN+FGC++ETIY+  ++ Y  KK R+ T++M+VL+  VGFG + L++ FL K
Sbjct  66   KGETLLITINAFGCVIETIYLAVFVTYCPKKVRMSTLRMIVLMNFVGFGTIVLLTHFLAK  125

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
                R +++GW+C+VF+  VF APL I++ VIRTKSVE +P  LSV L +SAVMW  YGL
Sbjct  126  QEEGRIKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSVLLLISAVMWLLYGL  185

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDE-----------KRLPQVVLPTVV  817
             L+DI + +PNV+G  FGI+Q+ LYAMY+  K   DE           K +  VV+P+  
Sbjct  186  SLRDIYVTLPNVVGLTFGIVQITLYAMYRNSKPVIDEKLPEHKGDIVDKEIENVVVPSKT  245

Query  818  ALEEKQKLPKELTEEQIVDIV  880
              +EK+       E  +VD+V
Sbjct  246  TNDEKK------LEVSVVDMV  260



>ref|XP_010322967.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
lycopersicum]
Length=267

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 204/267 (76%), Gaps = 5/267 (2%)
 Frame = +2

Query  170  ISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITINSFG  349
            +SFIVFL+PLPTFY IYKKKS EGYQSIPYVVAL S+M+ IYY  L      +I IN+ G
Sbjct  3    VSFIVFLAPLPTFYNIYKKKSTEGYQSIPYVVALCSAMILIYYVILLGGLVEVIIINAIG  62

Query  350  CLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVC  529
              +ETIYI FYI+YA KKA+VQT+K+L+L ++VGFG V L++QFL K A +R ++VG + 
Sbjct  63   VFIETIYIIFYIFYAPKKAKVQTVKLLLLFLVVGFGGVFLIAQFLLKGA-IRTKIVGRIS  121

Query  530  LVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDINIAVPNVL  709
              FS+C F APLCI+K+VI+TK+VE MP LLS FLT+SAV+WFFYG++ K+  I  PN+L
Sbjct  122  TAFSICTFAAPLCILKKVIKTKNVECMPFLLSFFLTISAVLWFFYGVIKKNYVIYAPNIL  181

Query  710  GFIFGILQMVLYAMYKGKKQEDD---EKRLPQVVLPTVVALEEKQKLPKELTEEQIVDIV  880
            GF  G++QMVLY +YK  K+ED+   E++L +++   V+ L++ +KLP +LT+EQI+DI 
Sbjct  182  GFTLGVIQMVLYVVYKKYKKEDNVIKEQKLSELLQNHVIILDDGKKLP-QLTQEQIIDIW  240

Query  881  KLGSLICSDKINVAAAACCSIQDKLLH  961
            KLG+LI S+K+N +AA   + + KL +
Sbjct  241  KLGTLIYSEKLNASAADVDNNRPKLAN  267



>ref|XP_010678287.1| PREDICTED: bidirectional sugar transporter SWEET12 [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W+  FG+LGN ISF+VFLSP+PTFY+IYKKKS E +QSIPYVVA FS+MLW+ YA++K++
Sbjct  12   WITIFGLLGNTISFMVFLSPIPTFYRIYKKKSTEEFQSIPYVVAFFSAMLWLLYAYVKTD  71

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
               L+TIN FG  +ETIY+  ++ YANK+AR+  IK L+L  + GFG +   +  + K+ 
Sbjct  72   VIFLVTINCFGLFIETIYLVIFLVYANKEARISAIKQLLLFNVFGFGVIVFFTAVIAKTT  131

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
             VR  ++GWVCLVFS CVFVAPL ++++VIRTKSVE+MP  LS FLT+SAV+WFFYGLL 
Sbjct  132  RVRLLILGWVCLVFSFCVFVAPLGVMRKVIRTKSVEYMPFFLSFFLTLSAVVWFFYGLLK  191

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDE  781
            +D+ +AVPNVLGF FGI+QM+LY MY+  K  + +
Sbjct  192  RDVYVAVPNVLGFTFGIVQMILYMMYRNAKPVEKD  226



>ref|XP_010442555.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X1 [Camelina sativa]
 ref|XP_010442556.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X2 [Camelina sativa]
Length=288

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 190/256 (74%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF V L+P+PTF +IYK+KS+EGYQS+PYV++LFS+MLW+YYA +K +A +L
Sbjct  12   FGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKDAMML  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSF  +V+ +YI  Y +YA KK ++ T+K ++ + +  FG + L++ FL      R 
Sbjct  72   ITINSFAFVVQIVYISLYFFYAPKKEKILTVKCVLFVDVFAFGLIFLLTYFL-THGNKRV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            QV+G++C+VFSL VFVAPL I+++VI+TKS E MP  LS FLT+SA+MWFFYGLLLKD N
Sbjct  131  QVLGYICMVFSLSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLKDKN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            IA+PNVLGFIFG+LQM+L+ +YK        K   +V+ P+V+ L++          E +
Sbjct  191  IALPNVLGFIFGVLQMILFVIYK--------KPGTKVLEPSVIKLQD--------ISEHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L S++C+ ++ 
Sbjct  235  VDVVRLSSMVCNSQMR  250



>ref|XP_010421173.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 136/258 (53%), Positives = 186/258 (72%), Gaps = 15/258 (6%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TIN FGC +ETIYI  ++ +A KKAR+ T+K+L+L+ + GF A+ L+ QFL K A
Sbjct  70   VFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKGA  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KDI +A PNV+GF+ G LQM+LY +YK  K   +              L EK+    +L 
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSE--------------LVEKELETAKLH  234

Query  857  EEQIVDIVKLGSLICSDK  910
            +E  +D++KLG+LI S +
Sbjct  235  DEVSIDMLKLGTLIASPE  252



>ref|XP_010442345.1| PREDICTED: bidirectional sugar transporter SWEET10 [Camelina 
sativa]
Length=289

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 190/256 (74%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF V L+P+PTF +IYK+KS+EGYQS+PYV++LFS+MLW+YYA +K +A +L
Sbjct  12   FGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKDAMML  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSF  +V+ +YI  Y +YA KK ++ T+K ++ + +  FG + L++ FL      R 
Sbjct  72   ITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFL-THGNKRV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            QV+G++C+VF+L VFVAPL I+++VI+TKS E MP  LS FLT+SA+MWFFYGLLLKD N
Sbjct  131  QVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLKDKN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            IA+PNVLGFIFG+LQM+L+ +YK        K   +V+ P+V+ L++          E +
Sbjct  191  IALPNVLGFIFGVLQMILFVIYK--------KPGTKVLEPSVIKLQD--------ISEHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L S++C+ ++ 
Sbjct  235  VDVVRLSSMVCNSQMR  250



>emb|CDX84877.1| BnaA03g13530D [Brassica napus]
Length=272

 Score =   271 bits (692),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 189/256 (74%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF+V L+P+PTF +IYK+KS+EGYQSIPYV+ALFS+MLWIYYA +K+N  ++
Sbjct  12   FGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTNVVIM  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITIN+   +++  YI FY++YA KK +  T+K ++ + +  FG +  ++ FL      R 
Sbjct  72   ITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHGQK-RV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            Q++G++C+VFSLCVFVAPL I+++VI+T+S E MP  LS FLT+SAVMWFFYGLLLKD+N
Sbjct  131  QILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            IA+PNVLGFIFG+LQM+LY +YK        K   +V+ P V+ L+E          + +
Sbjct  191  IALPNVLGFIFGVLQMILYMIYK--------KPGTKVLEPPVINLQE--------ISDHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L S++ +  I+
Sbjct  235  VDVVRLSSMVYTITID  250



>ref|NP_199892.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
 sp|Q9LUE3.1|SWT10_ARATH RecName: Full=Bidirectional sugar transporter SWEET10; Short=AtSWEET10 
[Arabidopsis thaliana]
 dbj|BAA96992.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAK96739.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL47380.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAM61234.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AED95992.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
Length=289

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 192/256 (75%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF V L+P+PTF +IYK+KS+EGYQSIPYV++LFS+MLW+YYA +K +A +L
Sbjct  12   FGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMYYAMIKKDAMML  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSF  +V+ +YI  + +YA KK +  T+K ++ + ++GFGA+ +++ F+   A  R 
Sbjct  72   ITINSFAFVVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFVLTYFIIH-ANKRV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            QV+G++C+VF+L VFVAPL I+++VI+TKS E MP  LS FLT+SAVMWFFYGLLLKD+N
Sbjct  131  QVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            IA+PNVLGFIFG+LQM+L+ +YK        K   +V+ P  + L++          E +
Sbjct  191  IALPNVLGFIFGVLQMILFLIYK--------KPGTKVLEPPGIKLQD--------ISEHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L +++C+ ++ 
Sbjct  235  VDVVRLSTMVCNSQMR  250



>ref|XP_006493252.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X1 [Citrus sinensis]
Length=290

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 190/250 (76%), Gaps = 20/250 (8%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F   ++GNI+SFIVFL+P+PTFY++ KKKS EG+QS+PYVVALFS+MLWIYYA +K +A 
Sbjct  17   FHVTIIGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDAF  76

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITIN+FGC++ETIY+  YI +A K+AR+ T+++L+LL   GFG++ L+S FL K +  
Sbjct  77   LLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSAA  136

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R +++GW+C+VFS+ VF APL I++ V+RTKSVE MP  LS+FLT++AVMWFFYGL LKD
Sbjct  137  RLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLKD  196

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEE  862
            + +AVPNVLGFIFG++QM+LYA+Y+  ++               V +E+  K+P     E
Sbjct  197  VYVAVPNVLGFIFGVVQMILYAIYRNYRR---------------VVVEDVNKVP-----E  236

Query  863  QIVDIVKLGS  892
              VD+VKL +
Sbjct  237  HTVDVVKLST  246



>ref|XP_002321730.2| N3 like family protein [Populus trichocarpa]
 gb|EEF05857.2| N3 like family protein [Populus trichocarpa]
Length=269

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 171/228 (75%), Gaps = 2/228 (1%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   WVF FG+LGNIIS +V L+PLPTFYQI KKK+++G+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHFTWVFGFGLLGNIISCLVCLAPLPTFYQICKKKTSQGFQSIPYVIALFSAMLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A    NA LLITINSF   +E  YI  Y++YA KK ++ T K+L+L  I GFG +  +S 
Sbjct  61   ASFSENAMLLITINSFAFFMEIGYIAVYLFYATKKDKILTFKLLLLFNIFGFGLICALS-  119

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
             L      R  V+GW+C+VF+LCVFVAPL +V++VIRTKSVE MP  LS FLT+SAVMWF
Sbjct  120  LLLTEGTKRVHVLGWICMVFALCVFVAPLGVVRKVIRTKSVEFMPFALSFFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKG-KKQEDDEKRLPQV  799
            FYG L KD  +A+PN+LGFIFGILQMVLY +Y+  KK E  E R  ++
Sbjct  180  FYGYLKKDKFVAIPNILGFIFGILQMVLYLIYRNPKKNEVAEPRTQEL  227



>ref|XP_007043874.1| Senescence-associated gene 29 [Theobroma cacao]
 gb|EOX99705.1| Senescence-associated gene 29 [Theobroma cacao]
Length=287

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 184/244 (75%), Gaps = 9/244 (4%)
 Frame = +2

Query  119  MALSGH---WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLW  289
            MA+ G    W  AFGV GNIIS +V+L+P+PTFY+IY+KKS E +QS+PY VALFSSMLW
Sbjct  1    MAVMGDHHSWAVAFGVFGNIISVLVYLAPVPTFYRIYRKKSTESFQSLPYQVALFSSMLW  60

Query  290  IYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL  469
            +YYA +K +A LLITINSFGC+VET+YI  YI YA+K +R+  +K+ V + +  F  + +
Sbjct  61   LYYALIKKDAFLLITINSFGCIVETMYISIYIAYASKNSRMSAMKLFVGMNVGLFSLILI  120

Query  470  VSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAV  649
            +++FL KS+ +R Q++GW+C+  S+ VF APL IV +VIRT SVE MP  LS FLT+SA+
Sbjct  121  LTRFLVKSS-IRIQLLGWICVAISVSVFAAPLNIVARVIRTGSVEFMPFNLSFFLTLSAI  179

Query  650  MWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ-----VVLPTV  814
            MWF YGL +KDI +A+PNVLGF+ G+LQM+LYA+Y+  K+  +EK+ P+     VVL T+
Sbjct  180  MWFAYGLFIKDICVALPNVLGFVLGMLQMLLYAVYRNTKKAIEEKKPPEQLKTVVVLSTI  239

Query  815  VALE  826
             A E
Sbjct  240  GASE  243



>ref|XP_009609628.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=277

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 184/255 (72%), Gaps = 7/255 (3%)
 Frame = +2

Query  128  SGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFL  307
            +    F FGVLGN +SF+V+LSP+PTFY+IYK+KS EG+QSIPY VALFS+ML++YYA+L
Sbjct  6    ASQLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAYL  65

Query  308  KS-NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            K  N  LL+TINSFG  +E IY+  ++ YA ++A++ T K+++LL I  +GA+  ++ ++
Sbjct  66   KEKNGILLVTINSFGTAIELIYLTIFLIYATREAKIYTTKLVLLLNIGSYGAIVALT-YI  124

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
            F     R  +VGW+C VFS+CVF APL I+++VIRT+SVE MP  LS FLT+ AVMWFFY
Sbjct  125  FAKDETRVTIVGWICAVFSVCVFAAPLSIMRRVIRTRSVEFMPFPLSFFLTICAVMWFFY  184

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ-----EDDEKRLPQVVLPTVVALEE  829
            GLL+KD+ IA PN+LGF FGI QM+LYA+++ +KQ     + + K L QVV+     + E
Sbjct  185  GLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQVVIDMKAMVLE  244

Query  830  KQKLPKELTEEQIVD  874
             Q+      E ++ D
Sbjct  245  MQENSDPNKEAEVDD  259



>gb|KEH20983.1| bidirectional sugar transporter [Medicago truncatula]
Length=255

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 188/254 (74%), Gaps = 19/254 (7%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK-  310
             W F FG++GNIISF VFLSPLPTFY I+KKKSAEG+Q++PYVVALFS+MLWIYYAF+K 
Sbjct  7    SWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFVKR  66

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
             +A LLITIN+FG +VE+ YI  ++ YA KK R+ TIK+L+LL + GFGA+ L + +L K
Sbjct  67   ESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTLYLSK  126

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
             A  R  ++GW+CLVF++ VF APL ++ +VIR++SVE+MP  LS FLT++AVMWFFYGL
Sbjct  127  GAK-RLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYGL  185

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKE  850
            LL+D  +A+PN LGF+FGI+QMV+Y +Y+                P V A  + Q    E
Sbjct  186  LLRDYYVALPNTLGFVFGIIQMVVYLIYRNAT-------------PVVEAPMKGQ----E  228

Query  851  LTEEQIVDIVKLGS  892
            L+   I+D+VK+G+
Sbjct  229  LSGGHIIDVVKIGT  242



>emb|CAC44123.1| N3 like protein [Medicago truncatula]
Length=255

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 188/254 (74%), Gaps = 19/254 (7%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK-  310
             W F FG++GNIISF VFLSPLPTFY I+KKKSAEG+Q++PYVVALFS+MLWIYYAF+K 
Sbjct  7    SWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFVKR  66

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
             +A LLITIN+FG +VE+ YI  ++ YA KK R+ TIK+L+LL + GFGA+ L + +L K
Sbjct  67   ESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTLYLSK  126

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
             A  R  ++GW+CLVF++ VF APL ++ +VIR++SVE+MP  LS FLT++AVMWFFYGL
Sbjct  127  GAK-RLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYGL  185

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKE  850
            LL+D  +A+PN LGF+FGI+QMV+Y +Y+                P V A  + Q    E
Sbjct  186  LLRDYYVALPNTLGFVFGIIQMVVYLIYRNAT-------------PVVEAPMKGQ----E  228

Query  851  LTEEQIVDIVKLGS  892
            L+   I+D+VK+G+
Sbjct  229  LSGGHIIDVVKIGT  242



>gb|KHN24976.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=272

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 180/254 (71%), Gaps = 7/254 (3%)
 Frame = +2

Query  119  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            MA++ H + F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY+VALFSSMLW+Y
Sbjct  1    MAITHHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LK +A LLITINSFGC++E IYI  YI YA + AR  TIK+   + +  F  + LV+
Sbjct  61   YALLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVT  120

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
             F     P+R QV+GW+C+  S+ VF APL IV QV+RTKSVE MP  LS  LT+SA+MW
Sbjct  121  HFGVH-GPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYK--GKKQEDDEKRL---PQVVLPTVVA  820
            F YGL LKDI IA+PNVLGF+ G+LQM+LY +Y+   KK   +EK L   P   +  V  
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTNTNEKSLSVKPLKNIAVVNP  239

Query  821  LEEKQKLPKELTEE  862
            L   +  P E  E+
Sbjct  240  LGTGEVFPVEEDEQ  253



>ref|XP_010093935.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
 gb|EXB54898.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
Length=304

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VF FG+LGN+ S IVFL+P+PTFY++YKKKS EG+QS+PYVVALFS+M+W+YYA LKS+ 
Sbjct  11   VFIFGLLGNVTSLIVFLAPVPTFYRVYKKKSTEGFQSVPYVVALFSAMMWLYYATLKSDL  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
             LLITINS GC++ETIYI  YI YA K+AR+ T+++++LL   GF  + L+S FL K + 
Sbjct  71   ILLITINSVGCVIETIYIALYIAYATKQARIFTLRLILLLNFGGFCLILLLSHFLAKGS-  129

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
            +RA V+GWVC  F++ VF APL I++ VIRTKSVE MP+ LS FLT+SA MW  YGL+LK
Sbjct  130  LRATVLGWVCTSFAVSVFAAPLSIIRVVIRTKSVEFMPLPLSFFLTLSATMWLMYGLMLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKK  766
            D+ +A+PNV+G IFG+LQMVLY +Y+  K
Sbjct  190  DLCVAIPNVMGLIFGVLQMVLYVIYRKNK  218



>ref|XP_006288378.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
 gb|EOA21276.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
Length=287

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 181/254 (71%), Gaps = 20/254 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QSIPYVVALFS+MLW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ +A K AR+ T+K+L+L+ + GF A+ L+ QFL K A
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAFATKNARMLTVKLLLLMNVGGFCAILLLCQFLAKGA  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF  G LQM+LY +YK  K   D  EK L            E  KLP  
Sbjct  189  KDIYVAFPNVIGFALGALQMILYVVYKYCKTSSDLVEKEL------------ENAKLP--  234

Query  851  LTEEQIVDIVKLGS  892
               E  +D++KLG 
Sbjct  235  ---EVSIDMLKLGG  245



>ref|XP_004310113.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 184/266 (69%), Gaps = 19/266 (7%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF+V+L+P+PTFY+I+KKKS EG+QS+PY+VALFS+ LW+YYA LK N
Sbjct  11   WAFTFGILGNLISFMVYLAPVPTFYRIFKKKSTEGFQSVPYLVALFSATLWLYYAMLKQN  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LLITIN+FG ++ET+YI  YI YA K +R  TIK+L  + +  F  + ++ Q+ F S 
Sbjct  71   AVLLITINTFGSVIETLYIAMYIVYATKASRKFTIKLLGFMNLGLFSLILVILQYAFHSE  130

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA V+GW+ +  S+CVF APL IV  VIRTKSVE MP  LS FLT+SAVMWF YGL L
Sbjct  131  -YRAPVLGWINVAISVCVFAAPLSIVAHVIRTKSVEFMPFSLSFFLTLSAVMWFAYGLFL  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KDI IA+PNVLGFI G+LQM+LYA+Y+ +K             P +   E+K + P    
Sbjct  190  KDICIALPNVLGFILGLLQMLLYAIYRNRK-------------PVIFDPEDKLRAP----  232

Query  857  EEQIVDIVKLGSLICSDKINVAAAAC  934
             EQ+  IV L ++  S+   V A  C
Sbjct  233  -EQMKSIVILSTIPTSEVHPVDAKHC  257



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 178/263 (68%), Gaps = 16/263 (6%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS +LW+YYAFLKS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLLWMYYAFLKSG  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LL+TIN  GC +ET+YI  Y+ YA K AR+ T K+ + L +  FG +ALV+  L  + 
Sbjct  71   AELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIALVT-MLVSAG  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
             +R Q+VGW+C+  +L VF APL I++ VIRTKSVE MPI LS FL +SAV+WF YGLL 
Sbjct  130  TLRVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAVIWFAYGLLK  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KD+ +AVPNVLGF+FG+ QM LY  Y+ K              P +  + ++ KLP+ + 
Sbjct  190  KDVFVAVPNVLGFVFGVAQMALYMAYRNKS-------------PAITVVHQEMKLPEHVK  236

Query  857  EEQIVDIVKLGSLICSDKINVAA  925
            E  +    KLG      +I+  A
Sbjct  237  E--VTTNTKLGGAPTEGRISCGA  257



>ref|XP_010090683.1| Bidirectional sugar transporter N3 [Morus notabilis]
 gb|EXB40347.1| Bidirectional sugar transporter N3 [Morus notabilis]
Length=286

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 173/232 (75%), Gaps = 2/232 (1%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGNIIS +V+L+P+ TFY++Y+KKS E + S+PY+VALFSSMLW+YYA LK++
Sbjct  10   WTFTFGILGNIISVLVYLAPVTTFYRVYRKKSTEDFHSLPYLVALFSSMLWLYYALLKTD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LLITINSFGC++E IYI  +I YA   A+  TIK   L+ +  F  + LV+QF    +
Sbjct  70   AMLLITINSFGCVIEMIYITMFIVYAPSHAKKLTIKFFALMNVGMFSLIFLVTQFAVGHS  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              R QV+GW+C+  S+ VF APL IV QVIRT+SVE MP  LS FLT+SA+ WF YGLLL
Sbjct  130  -YRVQVLGWICVAISVSVFAAPLSIVAQVIRTRSVEFMPFTLSFFLTLSAITWFAYGLLL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKG-KKQEDDEKRLPQVVLPTVVALEE  829
            KDI IAVPNVLGF+ G+LQM+LYA+Y+  K +ED EK+L + +  T+   ++
Sbjct  189  KDICIAVPNVLGFVLGLLQMLLYAIYRNYKTEEDQEKKLSEHMRNTLATSDQ  240



>ref|XP_004138250.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=302

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/290 (48%), Positives = 198/290 (68%), Gaps = 17/290 (6%)
 Frame = +2

Query  119  MALS----GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSML  286
            MALS      W+FAFG+LGNI SFIVFL+P+PTF ++ +KKS EG+QSIPYVVALFS++L
Sbjct  1    MALSFMNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALL  60

Query  287  WIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  466
             IYY+ L ++   L+TINS GC +ETIYI  YI YA KKAR+ T++ ++LL +VGF ++ 
Sbjct  61   LIYYSTLNADEFFLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSIL  120

Query  467  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSA  646
            +V+QFL K A  RA+V+G++C   S+ VF APL I+K+VIRT+SVE+MP  LS FLT+SA
Sbjct  121  VVTQFLVKRA-YRARVIGFICGGLSVSVFAAPLSIMKRVIRTRSVEYMPFSLSFFLTLSA  179

Query  647  VMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLP--------QVV  802
            VMW  YGL LKD+ +A+PN LGF FG+ QM+LYA+Y+  K    E++LP        Q+V
Sbjct  180  VMWLCYGLFLKDLYVALPNTLGFTFGMAQMILYAIYRNAKPLPSEEKLPQHKADIETQIV  239

Query  803  LPTVVALEEKQKLPKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQDK  952
            +       +  +  +   ++Q++++        ++     A + C+  DK
Sbjct  240  ITATPTNPDDHQGDEHQNQDQVINVPPPPPQSNTNH----APSVCNNNDK  285



>ref|XP_002865823.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42082.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 190/256 (74%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF V L+P+PTF +IYK+KS+EGYQSIPYV++LFS+MLW+YYA +K +A +L
Sbjct  12   FGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMYYAMIKKDAMML  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSF  +++ +YI  Y +YA KK +  T+K ++ + + GFGA+ +++ FL   A  R 
Sbjct  72   ITINSFAFVIQIVYISLYFFYAPKKEKTLTVKFVLFVDVFGFGAIFVLTYFLIH-ANKRV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
             V+G++C+VF+L VF+APL I+++VI+TKS E MP  LS FLT+SAVMWFFYGLLLKD+N
Sbjct  131  HVLGYICMVFALSVFLAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            IA+PNVLGFIFG+LQM+L+ +YK        K   +V+ P  + L++          E +
Sbjct  191  IALPNVLGFIFGVLQMILFLIYK--------KPGTKVLEPPGIKLQD--------ISEHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L +++C+ ++ 
Sbjct  235  VDVVRLSTMVCNSQMR  250



>ref|XP_008392727.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=295

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 191/267 (72%), Gaps = 23/267 (9%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL      AFG+LGNIIS +VFL+P+PTFY +YKKK+ EG+Q++PYV+ L SSM+++YY
Sbjct  1    MALHHTLSLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYVYY  60

Query  299  AFLKS----NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  466
            A LK     +ATL+ITINS GC++ETIYI  +++YA KKAR+ T  +L LL +  +G + 
Sbjct  61   ALLKEELKEDATLVITINSVGCVIETIYIXLFLFYAPKKARISTATLLFLLNLFSYGMMV  120

Query  467  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSA  646
            ++++FL  +   R ++VGW+CLVFSL VFVAPL +++QVIRTKSVE MP  LS FLT+ A
Sbjct  121  VLTRFL-ATGETRFKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGA  179

Query  647  VMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALE  826
            V WFFYG L+KD  IA PN+LGF FG++QM +Y +YK  K+                 LE
Sbjct  180  VAWFFYGFLIKDYYIAFPNILGFFFGVVQMAVYVVYKNAKK----------------FLE  223

Query  827  EKQKLPKELTEEQIVDIVKLGSLICSD  907
            ++ K+ +EL+ E I+D++K+ +L+C +
Sbjct  224  DQPKV-QELS-EHIIDVMKISTLVCPE  248



>ref|XP_009141677.1| PREDICTED: bidirectional sugar transporter SWEET12 [Brassica 
rapa]
Length=277

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 187/260 (72%), Gaps = 20/260 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W FAFG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC++ETIYI  ++ +A K+AR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCVIETIYIAIFVAFATKEARMFTVKLLLLMNFGGFFLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF+ G LQM+LY ++K  K   D  EK L            E  KLP  
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDK  910
               E  +D++KLG+L+ S +
Sbjct  235  ---EVSIDMLKLGTLVASPE  251



>ref|XP_006394628.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
 gb|ESQ31914.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
Length=288

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 184/255 (72%), Gaps = 20/255 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W FAFG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYIAIFVAFAPKKARMFTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LSV LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSVSLTLSAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF+ G LQM+LY ++K  K   D  EK L            E  KLP  
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLMEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSL  895
               E  +D++KLG+L
Sbjct  235  ---EVSIDMLKLGTL  246



>ref|XP_003531061.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=274

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 189/261 (72%), Gaps = 17/261 (7%)
 Frame = +2

Query  119  MALS--GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  292
            MAL+   H   AFG+LGN+ISF+V+L+PLPTFY+IYKKKS EG+QS+PY+VALFSSMLW+
Sbjct  1    MALNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWL  60

Query  293  YYAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL  469
            YYA LK ++ATLLITINS GC++E +YI  +  YA K AR  T+K+ +++ +  F  + L
Sbjct  61   YYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFL  120

Query  470  VSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAV  649
            V+ F    + +R QVVGWVC+  ++ VF APL IV QVIRTK+VE MP  LS+FLT+SAV
Sbjct  121  VTYFAIHGS-LRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTLSAV  179

Query  650  MWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEE  829
            MWFFYGLLLKDI IA+PN+LGF  G+LQM+LYA+Y+  K  + E           VA +E
Sbjct  180  MWFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKE-----------VATKE  228

Query  830  KQKLPKELTEEQIVDIVKLGS  892
            ++ L  E   + +V +  LG+
Sbjct  229  EKAL--EAIMKNVVVVNPLGT  247



>ref|XP_010045482.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Eucalyptus 
grandis]
 gb|KCW83109.1| hypothetical protein EUGRSUZ_B00063 [Eucalyptus grandis]
Length=279

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 183/256 (71%), Gaps = 19/256 (7%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            FAFG+LGNI+SF+ FL+PLPTFY IYK K  +G+QSIPYVV+L S+ML +YY  +K + T
Sbjct  11   FAFGLLGNIVSFMTFLAPLPTFYGIYKTKKTQGFQSIPYVVSLLSAMLLLYYGLVKKD-T  69

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITIN  GC++ET Y+  Y+ YA+K  RV T+K+ +++ ++G+G V   + FL K A  
Sbjct  70   LLITINGIGCVIETAYVAAYLIYASKNDRVLTLKLFLIMNVLGYGVVLSTTFFLSKGAK-  128

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            RA ++GW+C+ FSL VFVAPLCI+K+VI+T+SVE MPI LS+FLT+ A++WFFYG LLKD
Sbjct  129  RAWIIGWICMTFSLGVFVAPLCILKKVIKTRSVEFMPITLSIFLTLGAIVWFFYGFLLKD  188

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEE  862
              IAVPNVLGF+ G++QMVLYA YK     + E+               +Q+ P+    E
Sbjct  189  FFIAVPNVLGFVLGVIQMVLYATYKNANTVEVERN-------------SQQQEPR----E  231

Query  863  QIVDIVKLGSLICSDK  910
            +I+D++KL +  C + 
Sbjct  232  EIIDVMKLSAAACPEN  247



>gb|AFK35161.1| unknown [Medicago truncatula]
Length=255

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 187/254 (74%), Gaps = 19/254 (7%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK-  310
             W F FG++GNIISF VFLSPLPTFY I+KKKSAEG+Q++PYVVALFS+MLWIYYAF+K 
Sbjct  7    SWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFVKR  66

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
             +A LLITIN+FG +VE+ YI  ++ YA KK R+ TIK+L+LL + GFGA+ L + +L K
Sbjct  67   ESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTLYLSK  126

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
             A  R  ++GW+CLVF++ VF  PL ++ +VIR++SVE+MP  LS FLT++AVMWFFYGL
Sbjct  127  GAK-RLAIIGWICLVFNISVFATPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYGL  185

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKE  850
            LL+D  +A+PN LGF+FGI+QMV+Y +Y+                P V A  + Q    E
Sbjct  186  LLRDYYVALPNTLGFVFGIIQMVVYLIYRNAT-------------PVVEAPMKGQ----E  228

Query  851  LTEEQIVDIVKLGS  892
            L+   I+D+VK+G+
Sbjct  229  LSGGHIIDVVKIGT  242



>emb|CDY16863.1| BnaA09g05190D [Brassica napus]
Length=277

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/278 (51%), Positives = 193/278 (69%), Gaps = 24/278 (9%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W FAFG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC++ETIYI  ++ +A K+AR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSV++MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVKYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF+ G LQM+LY ++K  K   D  EK L            E  KLP  
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKINVAA----AACCSIQDK  952
               E  +D++KLG+L+ S ++ V       + C   DK
Sbjct  235  ---EVSIDMLKLGTLVGSPELAVNTVVRPVSMCVCNDK  269



>gb|KHN39181.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=274

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 188/261 (72%), Gaps = 17/261 (7%)
 Frame = +2

Query  119  MALS--GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  292
            MAL+   H   AFG+LGN+ISF+V+L+PLPTFY+IYKKKS EG+QS+PY+VALFSSMLW+
Sbjct  1    MALNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWL  60

Query  293  YYAFLK-SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL  469
            YYA LK ++ATLLITINS GC++E +YI  +  YA K AR  T+K+ +++ +  F  + L
Sbjct  61   YYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFL  120

Query  470  VSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAV  649
            V+ F    + +R QVVGWVC+  ++ VF APL IV QVIRTK VE MP  LS+FLT+SAV
Sbjct  121  VTYFAIHGS-LRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKDVEFMPFNLSLFLTLSAV  179

Query  650  MWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEE  829
            MWFFYGLLLKDI IA+PN+LGF  G+LQM+LYA+Y+  K  + E           VA +E
Sbjct  180  MWFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKE-----------VATKE  228

Query  830  KQKLPKELTEEQIVDIVKLGS  892
            ++ L  E   + +V +  LG+
Sbjct  229  EKAL--EAIMKNVVVVNPLGT  247



>ref|XP_003530901.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=272

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 179/254 (70%), Gaps = 7/254 (3%)
 Frame = +2

Query  119  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            M ++ H + F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY+VALFSSMLW+Y
Sbjct  1    MVITHHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LK +A LLITINSFGC++E IYI  YI YA + AR  TIK+   + +  F  + LV+
Sbjct  61   YALLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVT  120

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
             F     P+R QV+GW+C+  S+ VF APL IV QV+RTKSVE MP  LS  LT+SA+MW
Sbjct  121  HFGVH-GPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYK--GKKQEDDEKRL---PQVVLPTVVA  820
            F YGL LKDI IA+PNVLGF+ G+LQM+LY +Y+   KK   +EK L   P   +  V  
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTNTNEKSLSVKPLKNIAVVNP  239

Query  821  LEEKQKLPKELTEE  862
            L   +  P E  E+
Sbjct  240  LGTGEVFPVEEDEQ  253



>ref|XP_008464392.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=297

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 178/230 (77%), Gaps = 5/230 (2%)
 Frame = +2

Query  119  MALS----GHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSML  286
            MALS      W+FAFG+LGNI SFIVFL+P+PTF ++ +KKS EG+QSIPYVVALFS++L
Sbjct  1    MALSFMNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALL  60

Query  287  WIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  466
             IYY+ L ++   L+TINS GC +ET+YI  YI YA KKAR+ T++ ++LL +VGF ++ 
Sbjct  61   LIYYSTLNADEFFLMTINSVGCFIETVYIALYIAYAPKKARIFTVRFVLLLDVVGFCSIL  120

Query  467  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSA  646
            +V+QFL K A  RA+V+G++C   S+ VF APL I+K+VIRT+SVE+MP  LS FLT+SA
Sbjct  121  VVTQFLVKRA-YRARVIGFICGGLSVSVFAAPLSIMKKVIRTRSVEYMPFSLSFFLTLSA  179

Query  647  VMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ  796
            VMW  YGL LKD+ +A+PN LGF FG+ QM+LYA+Y+  K   +E++LPQ
Sbjct  180  VMWLCYGLFLKDLYVALPNTLGFTFGMAQMILYAIYRNAKPLPNEEKLPQ  229



>ref|XP_002877428.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53687.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 189/277 (68%), Gaps = 23/277 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QSIPYVVALFS+MLW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +E IYI  ++ +A+KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIEIIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF+ G LQM+LY +YK  K   D  EK L            E  KLP  
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKIN---VAAAACCSIQDK  952
               E  +D++KLG+L   +      V +   C+  D+
Sbjct  235  ---EVSIDMLKLGTLTSPEPAAITVVRSVNTCNCNDR  268



>emb|CDX87161.1| BnaC09g04760D [Brassica napus]
Length=277

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 189/263 (72%), Gaps = 20/263 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W FAFG+LGN+ISF VFLSP+PTFY+I KKK+ EG+QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC++ETIYI  ++ +A K+AR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF+ G LQM+LY ++K  K   D  EK L            E  KLP  
Sbjct  189  KDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKINV  919
               E  ++++KLG+L+ S ++ V
Sbjct  235  ---EVSINMLKLGTLVGSPELAV  254



>ref|XP_002270131.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
Length=276

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 175/249 (70%), Gaps = 7/249 (3%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  FAFG+LGNI+SF+V+LSPLPTFY+IYK+KS EG+QSIPY VALFS+ML +YYAFLK+
Sbjct  8    HMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLLYYAFLKT  67

Query  314  -NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
             N  +LITINS G  +E  Y+  Y+ YA + A++ T K+L+L     +GA+ L S F   
Sbjct  68   DNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVL-STFFLS  126

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
                RA++VGWVC  FSLCVF APL I++ VIRTKSVE+MP  LS FLT+ AVMWFFYGL
Sbjct  127  KGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVMWFFYGL  186

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ----EDDEKRLPQ-VVLPTVVALEEKQ  835
            L++D  IA PN+LGF FGI QM+LY +YK  K+    E   + LP  +V PT+   E   
Sbjct  187  LIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKGVLAEFKLQELPNGLVFPTLKKAENTD  246

Query  836  KLPKELTEE  862
              P +  E+
Sbjct  247  TNPNDQPED  255



>gb|EYU42078.1| hypothetical protein MIMGU_mgv1a010705mg [Erythranthe guttata]
Length=304

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 171/223 (77%), Gaps = 6/223 (3%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FGVLGNIIS  V+L+PLPTF +I+K+KS  G+ S+PY VALFS+MLW+YYAFLK+N
Sbjct  10   WAFTFGVLGNIISIFVYLAPLPTFRRIFKEKSTMGFDSLPYAVALFSAMLWLYYAFLKTN  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LLI+IN+FGC+VETIYI  +++YA+KKAR +T K+L ++ +     + +V+ F+FK  
Sbjct  70   AVLLISINTFGCIVETIYISMFLFYASKKARGRTAKLLGVVNVGVLSLIFVVTFFIFKGQ  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              R  VVGW+C+  S+CVF APL IV QV+RT+SVE MP  LS FLT+SAVMWF YGL  
Sbjct  130  N-RVHVVGWICVAVSVCVFAAPLSIVFQVVRTRSVEFMPFPLSFFLTLSAVMWFGYGLFE  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQE-----DDEKRL  790
            KD+ +AVPNVLGFI G+LQMVLY +++  K E     DDEK++
Sbjct  189  KDLCVAVPNVLGFILGVLQMVLYGIFRNVKAEAINDVDDEKKM  231



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 189/284 (67%), Gaps = 14/284 (5%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGNIISFIVFL+P+PTF +IYKKKS EG+QSIPYVVALFS+MLW+YYA    N T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINS GCL+ETIY+  +I +A K+ RV T++ ++LL   GF  + LV+ FL   +  
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN-  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R +VVGW+C+ FS+ VF APL I++ VIRTKSVE MP  LS FLT+SA  W  YG+ LKD
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ-----VVLPTVVALEEKQK---  838
            I IAVPN+ GF+FGI QM+LY +YK K++   E +LPQ      V+ +     +KQK   
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIYK-KRETAMEMQLPQHSTDNTVIVSAATNSDKQKQHS  250

Query  839  --LP-KELTEEQIVDIVKLGSLICSDKINVAAAACCSIQDKLLH  961
              LP   L    + D V   +    D IN        ++D+L H
Sbjct  251  SSLPSNNLVGAAVDDDVTTTTKNGIDPIN-NLEENHQVKDQLNH  293



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 174/237 (73%), Gaps = 7/237 (3%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGNIISFIVFL+P+PTF +IYKKKS EG+QSIPYVVALFS+MLW+YYA    N T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINS GCL+ETIY+  +I +A K+ RV T++ ++LL   GF  + LV+ FL   +  
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN-  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R +VVGW+C+ FS+ VF APL I++ VIRTKSVE MP  LS FLT+SA  W  YG+ LKD
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ-----VVLPTVVALEEKQK  838
            I IAVPN+ GF+FGI QM+LY +YK K++   E +LPQ     +V+ +     +KQK
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIYK-KRETAMEMQLPQHSTDNIVIVSAATNSDKQK  247



>gb|AHB08882.1| bidirectional sugar transporter SWEET14-like protein [Suaeda 
glauca]
Length=323

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 174/225 (77%), Gaps = 2/225 (1%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            WVFAFG+LGNIISF+VFL+PLPTF ++YKKKS EG+QS+PYVVA+FS+MLWIYYA LK N
Sbjct  8    WVFAFGILGNIISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYAMLKGN  67

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            + LLITIN  G ++ETIY+  +I YA ++AR+ T+K+L+LL   GF  + L+  +L K  
Sbjct  68   SVLLITINIAGVIIETIYVAIFITYAPRQARISTLKLLMLLNFGGFCGIILLCHYLAKGQ  127

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              R Q+ GW+C+ FS+ VFVAPL +++ VIRTKSVE+MP  LS  LT++A +WFFYG + 
Sbjct  128  -ARLQLYGWICVAFSISVFVAPLSVIRTVIRTKSVEYMPFNLSCCLTLTATVWFFYGFVQ  186

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGK-KQEDDEKRLPQVVLP  808
            KD+ + +PNV+GFIFGI QM LY +Y  K  +E ++++LP+V  P
Sbjct  187  KDLYVTLPNVVGFIFGIAQMTLYLVYSRKYGKEAEKQKLPEVASP  231



>emb|CBI32263.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 175/249 (70%), Gaps = 7/249 (3%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  FAFG+LGNI+SF+V+LSPLPTFY+IYK+KS EG+QSIPY VALFS+ML +YYAFLK+
Sbjct  8    HMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLLYYAFLKT  67

Query  314  -NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
             N  +LITINS G  +E  Y+  Y+ YA + A++ T K+L+L     +GA+ L S F   
Sbjct  68   DNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVL-STFFLS  126

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
                RA++VGWVC  FSLCVF APL I++ VIRTKSVE+MP  LS FLT+ AVMWFFYGL
Sbjct  127  KGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVMWFFYGL  186

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ----EDDEKRLPQ-VVLPTVVALEEKQ  835
            L++D  IA PN+LGF FGI QM+LY +YK  K+    E   + LP  +V PT+   E   
Sbjct  187  LIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKGVLAEFKLQELPNGLVFPTLKKAENTD  246

Query  836  KLPKELTEE  862
              P +  E+
Sbjct  247  TNPNDQPED  255



>ref|XP_003551863.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=271

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 170/227 (75%), Gaps = 3/227 (1%)
 Frame = +2

Query  119  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            M +S H + F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY+VALFSSMLW+Y
Sbjct  1    MVISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LK +A LLITINSFGC++E IYI  YI YA + AR  TIK+   + +  F  + LV+
Sbjct  61   YAMLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVT  120

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
             F     P+R QV+GW+C+  S+ VF APL IV QV+RTKSVE MP  LS  LT+SA+MW
Sbjct  121  HFAVH-GPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMY-KGKKQEDDEKRLP  793
            F YGL LKDI IA+PNVLGF+ G+LQM+LY +Y KG K+    ++ P
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNEKSP  226



>ref|XP_002511126.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51728.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 185/239 (77%), Gaps = 6/239 (3%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VF FG+LGNI+SF+VFL+P+PTF ++ KKKS EG+QS PYVV+LFS+MLW+YYA LKS+A
Sbjct  11   VFVFGLLGNIVSFVVFLAPVPTFLRVCKKKSTEGFQSFPYVVSLFSAMLWLYYASLKSDA  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
             LLITINS GCL+ETIYI  +I YA K+AR+ T+K+L+LL   GF  + L+S FL K + 
Sbjct  71   FLLITINSVGCLIETIYITLFITYAPKQARITTLKILLLLNFGGFCLILLLSHFLAKGSE  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             RA ++GWVC++FS+ VF APL +++ VIRTKSVE MP  LS FLT+SA+MW FYGLLLK
Sbjct  131  -RATILGWVCVIFSVSVFAAPLSVMRIVIRTKSVEFMPFYLSFFLTLSAIMWLFYGLLLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ-----VVLPTVVALEEKQKL  841
            D+ IAVPN+LG +FG+LQM+LY +YK  K   +E +LP+     V L  V+  E +Q++
Sbjct  190  DLYIAVPNILGLVFGVLQMILYVIYKNVKTVVEEPKLPEHNVDNVKLSAVITCEVQQEV  248



>ref|NP_190443.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
 sp|Q9SMM5.1|SWT11_ARATH RecName: Full=Bidirectional sugar transporter SWEET11; Short=AtSWEET11 
[Arabidopsis thaliana]
 gb|AAK32837.1|AF361825_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAL31891.1|AF419559_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 emb|CAB62363.1| MTN3-like protein [Arabidopsis thaliana]
 gb|AAL49908.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AAL77742.1| AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAM20244.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AEE78451.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
Length=289

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 189/276 (68%), Gaps = 22/276 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QSIPYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TIN+FGC +ETIYI  ++ YA K AR+ T+KML+L+   GF A+ L+ QFL K A
Sbjct  70   VFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKMLLLMNFGGFCAILLLCQFLVKGA  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNVLGF  G LQM+LY +YK  K      EK +            E  KLP  
Sbjct  189  KDIYVAFPNVLGFALGALQMILYVVYKYCKTSPHLGEKEV------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKINVAAAA--CCSIQDK  952
               E  +D++KLG++   + I+V   A  C    D+
Sbjct  235  ---EVSLDMLKLGTVSSPEPISVVRQANKCTCGNDR  267



>ref|XP_002453892.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
 gb|EES06868.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
Length=336

 Score =   268 bits (685),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 169/238 (71%), Gaps = 12/238 (5%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLWI+YA LKS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYALLKSG  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LL+TIN  GC++ET+Y+G Y+ YA K ARV T KML+ L +  FG VALV+  L  + 
Sbjct  71   AELLVTINGVGCVIETVYLGMYLLYAPKAARVLTAKMLLGLNVGVFGLVALVTMVL-SNG  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
             +R +V+GW+C+  +L VF APL I++QVIRTKSVE MPI LS FL +SAV+WF YG L 
Sbjct  130  GLRVKVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVIWFAYGALK  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKE  850
            KD+ +A PNVLGF+FG+ QM LY  Y+ KK                V + E+ KLP E
Sbjct  190  KDVFVAAPNVLGFVFGLAQMALYMAYRNKKPAA-----------AAVIMVEEVKLPAE  236



>gb|KHN03192.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=271

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 178/253 (70%), Gaps = 6/253 (2%)
 Frame = +2

Query  119  MALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            M +S H + F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY+VALFSSMLW+Y
Sbjct  1    MVISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLY  60

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LK +A LLITINSFGC++E IYI  YI YA + AR  TIK+   + +  F  + LV+
Sbjct  61   YAMLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVT  120

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
             F     P+R QV+GW+C+  S+ VF APL IV QV+RTKSVE MP  LS  LT+SA+MW
Sbjct  121  HFAVH-GPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMW  179

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMY-KGKKQEDDEKRLPQVVLPTVV---AL  823
            F YGL LKDI IA+PNVLGF+ G+LQM+LY +Y KG K+     + P   L ++     L
Sbjct  180  FGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNDKSPVEPLKSIAVVNPL  239

Query  824  EEKQKLPKELTEE  862
               +  P E  E+
Sbjct  240  GTGEVFPVEEDEQ  252



>emb|CDX88041.1| BnaA06g26320D [Brassica napus]
Length=288

 Score =   266 bits (680),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 183/255 (72%), Gaps = 20/255 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W FAFG+LGNIISF VFLSP+PTFY+I+KKK+ E +QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            +DI +A PNV+GF  G LQM+LY ++K  K   D  EK L            E  KLP  
Sbjct  189  RDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSL  895
               E  +D++KLG+L
Sbjct  235  ---EVSIDMLKLGTL  246



>ref|XP_009150896.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Brassica 
rapa]
Length=288

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 189/277 (68%), Gaps = 23/277 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W FAFG+LGNIISF VFLSP+PTFY+I+KKK+ E +QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            +DI +A PNV+GF  G LQM+LY ++K  K   D  EK L            E  KLP  
Sbjct  189  RDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKIN---VAAAACCSIQDK  952
               E  +D++KLG+L   +      V  A  C   D+
Sbjct  235  ---EVSIDMLKLGTLASPEPAEITVVPTANKCICNDR  268



>ref|XP_003524088.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
 gb|KHN22921.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=283

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK-  310
            H    FG+LGN+ISF+V+L+PLPTFY+IYKKKS EG+QS+PY+VALFSSMLW+YYA LK 
Sbjct  9    HLALGFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYASLKP  68

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
            ++ATLLITINS GC++E +YI  +  YA K AR  T+K+ +++ +  F  + LV+ F   
Sbjct  69   ADATLLITINSLGCVIEIVYIIMFTIYATKDARNLTVKLFMVMNVGSFALIFLVTYFAMH  128

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
             + +R QVVGWVC+  ++ VF APL IV QVIRTK+VE MP  LS+FLT+SAVMWFFYGL
Sbjct  129  GS-LRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTISAVMWFFYGL  187

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDE  781
            LLKDI IA+PN+LGF  G+LQM+LYA+Y+  K  + E
Sbjct  188  LLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKE  224



>ref|XP_008389921.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  116  SMALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  292
            ++A S H   F FGVLGN++S +V+L+P+PTFY+IY+KKS EG+ S+PY+VA+FSSMLW+
Sbjct  3    TVADSHHPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWL  62

Query  293  YYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  472
            YYA LK NA LLITINSFG   E IYI  ++ YA K AR  T+K+  ++ +  F  + +V
Sbjct  63   YYASLKKNAMLLITINSFGSFAEMIYIVIFVVYAPKDARKLTVKLFGIMNVGLFTLILVV  122

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            S FL   A  R  V+GW+ +  S  VF APL IV QVIRT+SVE MP  LS FLT+SA+M
Sbjct  123  SHFLVSRA-YRVPVLGWINVAISTSVFAAPLSIVSQVIRTRSVEFMPFRLSFFLTLSAIM  181

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ---EDDEKRLP  793
            WF YGL LKDI +A+PNVLGF+ G+LQM+LYAMY+ +KQ   ED EK+LP
Sbjct  182  WFAYGLFLKDICVAIPNVLGFVLGLLQMLLYAMYRNRKQVIIEDHEKKLP  231



>gb|KDO64482.1| hypothetical protein CISIN_1g047365mg, partial [Citrus sinensis]
Length=243

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 181/244 (74%), Gaps = 31/244 (13%)
 Frame = +2

Query  164  NIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLLITINS  343
            NI SF+V L+P+PTFY+IYKKKS EG+QS+PYV++LFS+M+WIYYA LK NA  L+TIN+
Sbjct  1    NITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYYALLKQNAIFLMTINT  60

Query  344  FGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRAQVVGW  523
            F C+++TIYI  Y++YA KK R+QT+K+L+LL I GFGA             +R +++G+
Sbjct  61   FCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGA-------------IREKILGY  107

Query  524  VCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDINIAVPN  703
            +C+ F+L VF APL IV++VI+TKSVE+MP  LS FLT+ AV WFFYGLL+KD+N+A+PN
Sbjct  108  ICMTFALSVFAAPLFIVRKVIKTKSVEYMPFTLSFFLTIGAVAWFFYGLLIKDLNVAIPN  167

Query  704  VLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQIVDIVK  883
            VLGFIFG+LQM+LY +YK   ++                + E+ KL +EL+ E +VD+VK
Sbjct  168  VLGFIFGVLQMILYVIYKNPNKK----------------IVEQTKL-QELS-EHVVDVVK  209

Query  884  LGSL  895
            L ++
Sbjct  210  LSTM  213



>ref|XP_006281748.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
 gb|EOA14646.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
Length=290

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 197/287 (69%), Gaps = 18/287 (6%)
 Frame = +2

Query  149   FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
             FG+LGN+ISF V L+P+PTF +IYK+KS+EGYQS+PYV++LFS+MLW+YYA +K +A +L
Sbjct  12    FGILGNVISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKDAVML  71

Query  329   ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
             ITINSF  +++ +YI  + +YA KK ++ T+K ++ + +  FG +   + F       R 
Sbjct  72    ITINSFAFVIQIVYISLFFFYAPKKDKILTVKFVLFVDVFAFGLIFFSTYFPIHGNK-RV  130

Query  509   QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
             QV+G++C+VF+L VFVAPL I+++VI+TKS E MP  LS FLT+SAVMWFFYGLLLKD N
Sbjct  131   QVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLKDKN  190

Query  689   IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
             IA+PNVLGFIFG+LQMVL+ +YK        K   +V+ P+V+ L++          E +
Sbjct  191   IALPNVLGFIFGVLQMVLFVIYK--------KPGTKVLEPSVIKLQD--------ISEHV  234

Query  869   VDIVKLGSLICSDKIN-VAAAACCSIQDKLLHQgggggggTATADHN  1006
             VD+V+L S++C+ ++  +       ++D +  +    G      D+N
Sbjct  235   VDVVRLSSMVCNSQMRTLVPQDSADMEDTIDIEEKMKGDIEKNKDNN  281



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 187/266 (70%), Gaps = 20/266 (8%)
 Frame = +2

Query  95   SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  274
             + HP          VFAFG+LGNIISFIVFL+P+PTF +IYKKKS EG+QS+PYVVALF
Sbjct  5    DTHHPG---------VFAFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALF  55

Query  275  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  454
            S+MLW+YYA   SN TLLITINS GCL+ET+YI  +I +A K+ RV T++ ++LL   GF
Sbjct  56   SAMLWLYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGF  115

Query  455  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFL  634
              + LV+ FL   +  + +VVGW+C+ FS+ VF APL I++ VIRTKSVE MP  LS FL
Sbjct  116  CIILLVTHFLVHGSN-QVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFL  174

Query  635  TVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE---DDEKRLPQVVL  805
            T+SA+ W  YG+ LKDI +A+PNVLGFIFG+ QM+LY +Y  +K E     E +LP+   
Sbjct  175  TLSAITWLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIY--RKYEIAIAKEMKLPE---  229

Query  806  PTVVALEEKQKLPKELTEEQIVDIVK  883
             T V +  KQK  ++ + E I  I+K
Sbjct  230  QTTVDIVMKQK--QDSSVEAIEVIIK  253



>emb|CDX80379.1| BnaC07g30650D [Brassica napus]
Length=288

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/277 (51%), Positives = 189/277 (68%), Gaps = 23/277 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W FAFG++GNIISF VFLSP+PTFY+I+KKK+ E +QS+PYVVALFS+MLW+YYA  K +
Sbjct  10   WAFAFGLVGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+ QFL K +
Sbjct  70   VFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGS  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+TKSVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            +DI +A PNV+GF  G LQM+LY ++K  K   D  EK L            E  KLP  
Sbjct  189  RDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKEL------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKIN---VAAAACCSIQDK  952
               E  +D++KLG+L   +      V  A  C   D+
Sbjct  235  ---EVSIDMLKLGTLASPEPAEITVVPTANKCICNDR  268



>ref|XP_002511127.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51729.1| conserved hypothetical protein [Ricinus communis]
Length=277

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 178/255 (70%), Gaps = 20/255 (8%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FGVL NIIS +V L+PLPTFYQI KKK++EG+QS+PYV+ALFS+MLW++YA    NAT
Sbjct  9    FLFGVLANIISSMVCLAPLPTFYQICKKKTSEGFQSVPYVIALFSAMLWLFYATFDDNAT  68

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSF   +E  Y+  Y++Y  +K R+ T K+++   + GFG +A+++ FL      
Sbjct  69   LLITINSFTFFMEVGYLSVYLFYGTRKDRMLTTKLVLFFNVFGFGMIAILTLFL-THGRK  127

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R  V+GW+C++F+LCVFVAPL I+++VI+TKSVE MP  LS FLT+SAVMWFFYG L KD
Sbjct  128  RVDVLGWICMIFALCVFVAPLGIMRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYGFLKKD  187

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEE  862
            I + +PNVLGF FGI+QM+LY +Y+  K+  +E +  +                     E
Sbjct  188  IYVYIPNVLGFFFGIVQMILYLIYRNSKKPVEEPKSQEF-------------------SE  228

Query  863  QIVDIVKLGSLICSD  907
             IVD+ KL ++ICS+
Sbjct  229  HIVDVAKLSAVICSE  243



>ref|XP_004145147.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=295

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 174/237 (73%), Gaps = 7/237 (3%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGNIISFIVFL+P+PTF +IYKKKS EG+QSIPYVVALFS+MLW+YYA    N T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINS GCL+ETIY+  +I +A K+ RV T++ ++LL   GF  + LV+ FL   +  
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN-  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            + +VVGW+C+ FS+ VF APL I++ VIRTKSVE MP  LS FLT+SA  W  YG+ LKD
Sbjct  132  QVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ-----VVLPTVVALEEKQK  838
            I IAVPN+ GF+FGI QM+LY +YK K++   E +LPQ     +V+ +     +KQK
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIYK-KRETAMEMQLPQHSTDNIVIVSAATNSDKQK  247



>ref|XP_010536596.1| PREDICTED: bidirectional sugar transporter SWEET10 [Tarenaya 
hassleriana]
Length=311

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 192/278 (69%), Gaps = 26/278 (9%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LG+ ISF+V L+PLPTFY+IYK+KSAEGYQSIPYV+AL S+MLWIYYA ++ +ATLL
Sbjct  12   FGILGDAISFLVCLAPLPTFYRIYKRKSAEGYQSIPYVIALLSAMLWIYYAMIRKHATLL  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITIN+F  +++T YI  Y+YYA KK ++ T K + L  ++GFGAV L++ F+      R 
Sbjct  72   ITINTFCIVIQTFYIVVYMYYAPKKDKILTTKFIFLFNVLGFGAVLLLTLFV-THGDKRV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRT--KSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
             VVG+VC+VF+LCVFVAPL I+    +T  KSVE MP  LS FLT+ AVMWFFYGLLLKD
Sbjct  131  SVVGYVCMVFALCVFVAPLGIIVTSKQTNIKSVEFMPFPLSFFLTLGAVMWFFYGLLLKD  190

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEE  862
            +NIA+PNVLGF FG+ QM+LY +YK                PT   LE+     ++++ E
Sbjct  191  LNIALPNVLGFAFGVAQMLLYVIYKK---------------PTKNVLEQPAIKLQDIS-E  234

Query  863  QIVDIVKLGSLICSD-------KINVAAAACCSIQDKL  955
             +VD+V+L +++CS        +++    A   I DK+
Sbjct  235  HVVDVVRLSTMVCSSEMRSVVPQLSADMEATIDIDDKI  272



>ref|XP_008440025.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=291

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 178/243 (73%), Gaps = 6/243 (2%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VFAFG+LGNIISFIVFL+P+PTF +I KKKS EG+QS+PYVVALFS+MLW+YYA   SN 
Sbjct  11   VFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLWLYYASFNSNE  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            TLLITINS GCL+ET+YI  +I +A K+ RV T++ ++LL   GF  + LV+ FL   + 
Sbjct  71   TLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHGSN  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             + +VVGW+C+ FS+ VF APL I++ VIRTKSVE MP  LS FLT+SA+ W  YG+ LK
Sbjct  131  -QVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAITWLLYGVFLK  189

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQE---DDEKRLPQVVLPTVVALEEKQKLPKE  850
            DI +A+PNVLGFIFG+ QM+LY +Y  +K E     E +LP+      +A+++KQ    E
Sbjct  190  DIYVALPNVLGFIFGVAQMILYLIY--RKYEIAIAKEMKLPEQTKMDDIAMKQKQDSSVE  247

Query  851  LTE  859
              E
Sbjct  248  AIE  250



>sp|A2X5B4.1|SWT15_ORYSI RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Indica Group]
 gb|EAY86024.1| hypothetical protein OsI_07385 [Oryza sativa Indica Group]
Length=319

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+IS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLW+YYAF+KS 
Sbjct  11   WAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LL+TIN  GC++ET+Y+  Y+ YA K AR+ T KML+ L I  FG +ALV+  L    
Sbjct  71   AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVT-LLLSRG  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
             +R  V+GW+C+  SL VF APL I++ VIRTKSVE MP  LS FL +SAV+WF YGLL 
Sbjct  130  ELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLYGLLK  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKK  766
            KD+ +A+PNVLGF+FG+ QM LY  Y+ KK
Sbjct  190  KDVFVALPNVLGFVFGVAQMALYMAYRSKK  219



>ref|XP_009612477.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=314

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 189/254 (74%), Gaps = 4/254 (2%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
            L   W+F FGVLGNIIS  VFL+P+PTF +IYK+KS  G+QS+PYVVALFSSMLW+YYAF
Sbjct  6    LHHPWLFVFGVLGNIISIFVFLAPVPTFRRIYKEKSTMGFQSVPYVVALFSSMLWMYYAF  65

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            +K NATLLI+INSFGC+VETIYI  ++ YA+K+AR QT+K+LV L+   +  + LV+ F 
Sbjct  66   IKKNATLLISINSFGCIVETIYISIFLLYASKEARRQTVKLLVSLIGGLYTLIFLVTLFP  125

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
               A +R QVVGW+C+  ++ VF APL IV QV+RTKSVE +P  LS FLT+SA+MWF Y
Sbjct  126  LNGA-LRVQVVGWICVAVAVAVFAAPLSIVCQVVRTKSVEFLPFTLSFFLTLSAIMWFGY  184

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKG-KKQEDDEKRLPQVVLPTVVALEEKQKL  841
            GLL KD+ IA+PNVLGF  G++QM+LY +Y+  K   + EK++P+ V+  VV    +Q  
Sbjct  185  GLLQKDLCIALPNVLGFFLGMIQMLLYGLYRNVKPAAELEKKVPEHVVNIVVLGNSEQIH  244

Query  842  PKELTEEQIVDIVK  883
            P  +  E+  D++K
Sbjct  245  P--VKSEKNEDMIK  256



>ref|XP_007038077.1| Medicago truncatula MTN3, putative [Theobroma cacao]
 gb|EOY22578.1| Medicago truncatula MTN3, putative [Theobroma cacao]
Length=289

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 175/225 (78%), Gaps = 1/225 (0%)
 Frame = +2

Query  122  ALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYA  301
            A    WVF  G+LGNI SF+VFL+PLPTF ++ KKKS EG+QS+PYVVALFS+MLW+YYA
Sbjct  5    ATDNPWVFISGLLGNISSFVVFLAPLPTFIRVCKKKSTEGFQSVPYVVALFSAMLWMYYA  64

Query  302  FLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQF  481
            F+KS A LL+TINSFGC+VET YI  YI YA K+AR+ T+++L+L+   GF ++ LVS+F
Sbjct  65   FVKSGAFLLVTINSFGCVVETAYIAIYIAYAPKQARMFTLRILLLMNFGGFCSILLVSRF  124

Query  482  LFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFF  661
            L K +  R +V+GW+C+ F+  VF APL I++QVIRTKSVE MP  LS FLT+SA+MW  
Sbjct  125  LAKGSN-RVEVLGWICVAFATGVFAAPLSIIRQVIRTKSVEFMPFYLSFFLTLSAIMWLL  183

Query  662  YGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ  796
            YG+ LKD+ IA+PNVLGFIFG+LQMVLYA+Y+  K    E   P+
Sbjct  184  YGIFLKDLYIAIPNVLGFIFGLLQMVLYAIYRNSKTVTKEVEAPE  228



>ref|NP_001046944.1| Os02g0513100 [Oryza sativa Japonica Group]
 sp|Q6K602.1|SWT15_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Japonica Group]
 dbj|BAD23245.1| putative nodulin 3 [Oryza sativa Japonica Group]
 dbj|BAF08858.1| Os02g0513100 [Oryza sativa Japonica Group]
 dbj|BAG95984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57067.1| hypothetical protein OsJ_06889 [Oryza sativa Japonica Group]
Length=319

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+IS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLW+YYAF+KS 
Sbjct  11   WAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LL+TIN  GC++ET+Y+  Y+ YA K AR+ T KML+ L I  FG +ALV+  L    
Sbjct  71   AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVT-LLLSRG  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
             +R  V+GW+C+  SL VF APL I++ VIRTKSVE MP  LS FL +SAV+WF YGLL 
Sbjct  130  ELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLYGLLK  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKK  766
            KD+ +A+PNVLGF+FG+ QM LY  Y+ KK
Sbjct  190  KDVFVALPNVLGFVFGVAQMALYMAYRSKK  219



>gb|KDP22573.1| hypothetical protein JCGZ_26404 [Jatropha curcas]
Length=285

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 186/263 (71%), Gaps = 19/263 (7%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL    VF FGVL NIIS +V L+PLPTFYQI KKK++EG+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHLSGVFIFGVLANIISAMVCLAPLPTFYQICKKKTSEGFQSIPYVIALFSAMLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A   +NATLLITIN+F   +E  YI  Y+ YA K  R+ TIK+++   + GFG + +++ 
Sbjct  61   AIFDNNATLLITINTFTFFMEICYIIVYLIYATKNDRMFTIKLVLFFNVFGFGTICILTL  120

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL      R  V+GW+C+VF+LCVFVAPL I+++VI+TKSVE MP  LS FLT++AVMWF
Sbjct  121  FL-THGRKRVDVLGWICMVFALCVFVAPLGIMRKVIKTKSVEFMPFSLSFFLTLTAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG L KDI +AVPN LGF+FGI+QMV+Y +Y+                P  + +EE + 
Sbjct  180  FYGFLKKDIYVAVPNTLGFLFGIIQMVIYLIYRK---------------PQKLTVEEPKL  224

Query  839  LPKELTEEQIVDIVKLGSLICSD  907
              +EL+ + IVD+ KL + +CS+
Sbjct  225  --RELS-DHIVDVAKLSATLCSE  244



>gb|KDO64483.1| hypothetical protein CISIN_1g020739mg [Citrus sinensis]
Length=285

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 143/251 (57%), Positives = 194/251 (77%), Gaps = 20/251 (8%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VFAFG+LGNI+SFIVFL+P+PTFY++ KKKS EG+QS+PYVVALFS+MLWIYYA +K +A
Sbjct  11   VFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDA  70

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
             LLITIN+FGC++ETIY+  YI +A K+AR+ T+++L+LL   GFG++ L+S FL K + 
Sbjct  71   FLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSA  130

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             R +++GWVC+VFS+ VF APL I++ V+RTKSVE MP  LS+FLT++AVMWFFYGL LK
Sbjct  131  ARLRLLGWVCVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLK  190

Query  680  DINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            D+ +AVPNVLGFIFG++QM+LYA+Y+  ++               V +E+  K+P     
Sbjct  191  DVYVAVPNVLGFIFGVVQMILYAIYRNYRR---------------VVVEDVNKVP-----  230

Query  860  EQIVDIVKLGS  892
            E  VD+VKL +
Sbjct  231  EHTVDVVKLST  241



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 174/260 (67%), Gaps = 13/260 (5%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLWI+YA LK+ 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYALLKTG  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LL+TIN  GC++ET+YI  Y+ YA + ARV T KML+ L +  FG V+LV+  L  + 
Sbjct  71   AVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVSLVTMVL-SNG  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
             +R  V+GW+C+  +L VF APL I++QVIRTKSVE MP  LS FL +SAV+WF YG L 
Sbjct  130  NLRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAVIWFAYGALK  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KD+ +A PNVLGF+FG+ QM LY  Y+ +K                V + E+ KLP+ + 
Sbjct  190  KDVFVAFPNVLGFVFGLAQMALYMAYRNRKPA------------AAVVMVEEVKLPEHVK  237

Query  857  EEQIVDIVKLGSLICSDKIN  916
            E     +   G   C  +++
Sbjct  238  EVAAAPVAHEGRASCGAEVH  257



>ref|XP_009405955.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 179/232 (77%), Gaps = 6/232 (3%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             ++L   W F FG+LGNIISF+V+L+PLPTFY++YK+KS EG+QS+PYVVALFS+MLWI 
Sbjct  4    GLSLDRPWAFTFGILGNIISFMVYLAPLPTFYRVYKRKSTEGFQSVPYVVALFSAMLWIS  63

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YAFLK++A LLITINS GC +ET+YI     YA K  ++ T K+++L+++  FG + L++
Sbjct  64   YAFLKTDACLLITINSVGCAIETVYI----VYAPKATKIFTAKLVLLVIVAMFGLILLLT  119

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              L + A  R +++GW+C+ FS+ VFVAPL +++ VIRTKSVE MP  LS FLT+SAV+W
Sbjct  120  LLLSEGAK-RVEILGWICVSFSVSVFVAPLSVIRLVIRTKSVEFMPFSLSFFLTLSAVVW  178

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLPQVVLP  808
            F YGLL++D+ +++PNVLGFIFGILQM LY  YK +K+    E+  P+ VLP
Sbjct  179  FAYGLLIRDLYVSLPNVLGFIFGILQMALYVAYKDRKKAAVVEQEPPEHVLP  230



>ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix 
dactylifera]
Length=296

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 172/218 (79%), Gaps = 0/218 (0%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             ++L   W F FG+LGNIISF+V+++PLPTFY++Y KKS EG+QS+PYVVALFS+MLWIY
Sbjct  3    GLSLDHPWAFTFGILGNIISFMVYVAPLPTFYRVYIKKSTEGFQSVPYVVALFSAMLWIY  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA +K+++ LL+TINS GC++ET+YI  Y+ YA KKAR+ T ++L+LL +  FG + L++
Sbjct  63   YALIKTDSYLLVTINSIGCIIETMYIIMYLSYAPKKARIFTAQILLLLNVGLFGLIVLLT  122

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              L K    + +V+GWVC+ FS+ VFVAPL I++ VIRTKSVE MP  LS FLT+SA+ W
Sbjct  123  LLLAKGPREQVRVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTLSAIAW  182

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ  769
            F YGLL KDI +A+PN+LGFIFG++QM +Y  YKG K+
Sbjct  183  FSYGLLTKDIYVALPNILGFIFGVVQMGIYIAYKGAKR  220



>ref|XP_002514863.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47417.1| conserved hypothetical protein [Ricinus communis]
Length=272

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 192/267 (72%), Gaps = 17/267 (6%)
 Frame = +2

Query  98   SRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFS  277
            S HP  +        FAFG+LGNIIS +V+L+P+PTFY+IY+KKS EG+QS+PY+VALFS
Sbjct  5    STHPPLA--------FAFGILGNIISILVYLAPVPTFYRIYRKKSTEGFQSLPYLVALFS  56

Query  278  SMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFG  457
            SMLW+YYA LK +  LL+TIN+FGC++ETIYI  YI YA KK RV T K+L  + +  F 
Sbjct  57   SMLWLYYAMLKKDVFLLVTINAFGCVIETIYIIMYIIYATKKNRVSTFKVLTSMNLGLFA  116

Query  458  AVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLT  637
             + L S FL KS+ VRAQV+GW+C+  S+CVF APL IV QVI+T+SVE MP  LS FLT
Sbjct  117  FIILFSHFLVKSS-VRAQVLGWICVAVSVCVFAAPLSIVAQVIKTRSVEFMPFNLSFFLT  175

Query  638  VSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVV  817
            +SA+MWF YGL  KD  +A+PNVLGFI G+LQMVLY +Y+  K+   E++LP+  L T+V
Sbjct  176  LSAIMWFAYGLSTKDTCVALPNVLGFILGLLQMVLYVIYRKAKKVILEEKLPE-HLKTIV  234

Query  818  ALEEKQKLPKELTEEQIVDIVKLGSLI  898
             L          +E+Q+V  V  GSL+
Sbjct  235  VLSTLGN-----SEQQLVTPV--GSLL  254



>ref|XP_006402062.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
 gb|ESQ43515.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
Length=289

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/256 (51%), Positives = 186/256 (73%), Gaps = 17/256 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF+V L+P+PTF +IYK+KS+EGYQSIPYV+ LFS+MLWIYYA +K N  +L
Sbjct  12   FGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIGLFSAMLWIYYAMIKKNVMIL  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITIN+   +++  YI  Y++YA KK +  T+K+++ + +  FG + +++ FL      R 
Sbjct  72   ITINAVSFVIQIFYIAVYLFYAPKKEKTLTVKLVLFVNVFAFGLIFVLTYFLLHGNK-RV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
             V+G+VC+VF+LCVFVAPL I+++VI+TKS E MP  LS FLT+SAVMWFFYGLL KD+N
Sbjct  131  TVLGYVCMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLNKDMN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQI  868
            +A+PNVLGF+FG+LQMVLY +YK        K   +V+ P  + L++          + +
Sbjct  191  VALPNVLGFVFGVLQMVLYLIYK--------KPGTKVLEPPGIKLQD--------ISDHV  234

Query  869  VDIVKLGSLICSDKIN  916
            VD+V+L S++CS ++ 
Sbjct  235  VDVVRLSSMVCSSQMR  250



>ref|XP_009336454.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 168/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  116  SMALSGH-WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWI  292
            ++A S H   F FGVLGN++S +V+L+P+PTFY+IY+KKS EG+ S+PY+VA+FSSMLW 
Sbjct  3    TVADSHHPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWF  62

Query  293  YYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALV  472
            YYA LK NA LLITINSFG   E  YI  ++ YA + AR  T+K+  ++ +  F  + +V
Sbjct  63   YYASLKKNAMLLITINSFGSFAEMTYIVIFVVYAPRDARKLTVKLFGIMNVGLFTLILVV  122

Query  473  SQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVM  652
            S FL   A  R  V+GW+ +  S  VF APL IV QVIRT+SVE MP  LS FLT+SAVM
Sbjct  123  SHFLVSRA-YRVPVLGWINVAISTSVFAAPLSIVAQVIRTRSVEFMPFRLSFFLTLSAVM  181

Query  653  WFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQ---EDDEKRLP  793
            WF YGL LKDI IA+PNVLGF+ G+LQM+LYAMY+ +KQ   ED EK+LP
Sbjct  182  WFAYGLFLKDICIAIPNVLGFVLGLLQMLLYAMYRNRKQEILEDHEKKLP  231



>gb|KDP26857.1| hypothetical protein JCGZ_18015 [Jatropha curcas]
Length=293

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 177/235 (75%), Gaps = 3/235 (1%)
 Frame = +2

Query  125  LSGH--WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            LS H    FAFG+LGNIIS +V+L+P+PTF +IY+KKS EG+ S+PY+VALFSSMLW++Y
Sbjct  4    LSTHQPLAFAFGLLGNIISVLVYLAPVPTFLRIYRKKSTEGFHSLPYLVALFSSMLWLHY  63

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK +  LL+TIN FGC +ETIYI  Y++YA+K+ RV T ++LV + I  F ++ L + 
Sbjct  64   AMLKKDVFLLVTINVFGCAIETIYIFLYMFYASKEIRVSTFRLLVSMNIALFSSIVLFTH  123

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
            FL K + +R QV+GW+C+  S+ VF +PL IV QV+RT+SVE MP  LS FLT+SAVMWF
Sbjct  124  FLMKGS-IRVQVLGWICVAVSVSVFASPLSIVAQVVRTRSVEFMPFTLSFFLTLSAVMWF  182

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVAL  823
             YG   K++ +A+PN+LGFI G+LQM+LYA+Y+  K    E++LP+  L ++V L
Sbjct  183  AYGFTTKNMCVALPNILGFILGLLQMLLYAIYRKAKVVVIEEKLPEKNLKSIVIL  237



>ref|XP_010249453.1| PREDICTED: bidirectional sugar transporter SWEET12 [Nelumbo nucifera]
Length=292

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 188/270 (70%), Gaps = 28/270 (10%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W FAFG+LGNIIS +V+L+P+PTF +IYKKKS EG+QS+PYVVALFS+MLWIYY  LK +
Sbjct  10   WTFAFGLLGNIISLMVYLAPVPTFIRIYKKKSTEGFQSVPYVVALFSAMLWIYYGLLKPD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LLITINS GC++ET YI  ++ YA KKARV  IK+L+LL +  F ++ L + FL K +
Sbjct  70   AHLLITINSVGCVIETSYITMFMVYAPKKARVLAIKLLLLLNVGTFCSILLFTLFLAKGS  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              R +V+G +C+ FS+ VF APL I++ VIR+KSVE MP  LS FLT+SAVMWF YG LL
Sbjct  130  N-RVRVLGSICVAFSVSVFAAPLSIMRLVIRSKSVEFMPFSLSFFLTLSAVMWFSYGFLL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KD  IA+PN+LGFIFG+ QMVLYA+YK   + + E              E++QK+     
Sbjct  189  KDFYIALPNILGFIFGVAQMVLYAIYKDANRSNIE--------------EQQQKV-----  229

Query  857  EEQIVDIVKLGSLICSDKINVAAAACCSIQ  946
             E ++D++KL S        VA+   C ++
Sbjct  230  NEHVIDVIKLNS--------VASPEVCPVE  251



>ref|XP_011023933.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=269

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 167/219 (76%), Gaps = 1/219 (0%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   WVF FG+LGNIIS +V L+PLPTFYQI +KK+++G+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHFTWVFGFGLLGNIISCLVCLAPLPTFYQICRKKTSQGFQSIPYVIALFSAMLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A    NA LLITINSF   +E  YI  Y++Y+ KK ++ T K+L+L  I GFG +  ++ 
Sbjct  61   AIFSENAMLLITINSFTFFMEIGYIAVYLFYSTKKDKILTFKLLLLFNIFGFGLICALT-  119

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
             L      R QV+GW+C+VF+LCVFVAPL +V++VI+TKSVE MP  LS FLT+SAVMWF
Sbjct  120  LLLTEGIKRVQVLGWICMVFALCVFVAPLGVVRKVIKTKSVEFMPFSLSFFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED  775
            FYG L KD  +A+PN+LGFIFG+LQM LY +Y+  K+ +
Sbjct  180  FYGYLKKDKFVAIPNILGFIFGMLQMALYLIYRNPKKNE  218



>ref|XP_002877629.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53888.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 187/276 (68%), Gaps = 22/276 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QSIPYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TIN+FGC +ETIYI  ++ YA K AR+ T+K L+L+   GF  + L+ QFL K A
Sbjct  70   VFLLVTINAFGCFIETIYIAMFLAYATKPARMLTVKTLLLMNFGGFCVILLLCQFLVKGA  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF  G LQM+LY +YK  K      EK +            E  KLP  
Sbjct  189  KDIYVAFPNVIGFALGALQMILYVVYKYCKTSPHLGEKEV------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKINVAAAA--CCSIQDK  952
               E  +D++KLG++   + I+V   A  C    D+
Sbjct  235  ---EVSLDMLKLGTVSSPEPISVVRQANKCTCGNDR  267



>emb|CDY69440.1| BnaCnng63490D, partial [Brassica napus]
Length=214

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIISF+V L+P+PTF +IYK+KS+EGYQSIPYV+ALFS+MLWIYYA +K+N  ++
Sbjct  12   FGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTNVVIM  71

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITIN+   +++  YI FY++YA KK +  T+K ++ + +  FG +  ++ FL      R 
Sbjct  72   ITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHGQK-RV  130

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            Q++G++C+VFSLCVFVAPL I+++VI+T+S E MP  LS FLT+SAVMWFFYGLLLKD+N
Sbjct  131  QILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  689  IAVPNVLGFIFGILQMVLYAMYK  757
            IA+PNVLGFIFG+LQM+LY +YK
Sbjct  191  IALPNVLGFIFGVLQMILYMIYK  213



>ref|NP_196821.1| senescence-associated protein 29 [Arabidopsis thaliana]
 sp|Q9FY94.1|SWT15_ARATH RecName: Full=Bidirectional sugar transporter SWEET15; Short=AtSWEET15; 
AltName: Full=Senescence-associated protein 29 [Arabidopsis 
thaliana]
 emb|CAC05445.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
 gb|AAK76623.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AAM44982.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AED91859.1| senescence-associated protein 29 [Arabidopsis thaliana]
Length=292

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 177/241 (73%), Gaps = 5/241 (2%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN+ISF+VFL+P+PTFY+IYK+KS E +QS+PY V+LFS MLW+YYA +K +A 
Sbjct  12   FIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYYALIKKDAF  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGC+VET+YI  +  YA ++ R+  +K+ + + +  F  + +V+ F+ K+ P+
Sbjct  72   LLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTHFVVKTPPL  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            +  V+GW+C+  S+ VF APL IV +VI+TKSVE+MP  LS FLT+SAVMWF YGL L D
Sbjct  132  QVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAVMWFAYGLFLND  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDD-----EKRLPQVVLPTVVALEEKQKLPK  847
            I IA+PNV+GF+ G+LQMVLY +Y+   ++ +     E++L  +V+ + + + E   +  
Sbjct  192  ICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEQQLKSIVVMSPLGVSEVHPVVT  251

Query  848  E  850
            E
Sbjct  252  E  252



>gb|AAM65389.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
Length=292

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 177/241 (73%), Gaps = 5/241 (2%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN+ISF+VFL+P+PTFY+IYK+KS E +QS+PY V+LFS MLW+YYA +K +A 
Sbjct  12   FIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYYALIKKDAF  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGC+VET+YI  +  YA ++ R+  +K+ + + +  F  + +V+ F+ K+ P+
Sbjct  72   LLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTHFVVKTPPL  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            +  V+GW+C+  S+ VF APL IV +VI+TKSVE+MP  LS FLT+SAVMWF YGL L D
Sbjct  132  QVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAVMWFAYGLFLND  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDD-----EKRLPQVVLPTVVALEEKQKLPK  847
            I IA+PNV+GF+ G+LQMVLY +Y+   ++ +     E++L  +V+ + + + E   +  
Sbjct  192  ICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEEQLKSIVVMSPLGVSEVHPVVT  251

Query  848  E  850
            E
Sbjct  252  E  252



>ref|XP_006647263.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Oryza 
brachyantha]
Length=319

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 171/241 (71%), Gaps = 9/241 (4%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PYVV LFS MLW+YYAF+KS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            A LL+TIN  GC++ET+Y+  Y+ YA K  R+ T +ML+ L +  FG +ALV+  L + A
Sbjct  71   AELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIALVTLLLPQGA  130

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
             +R  V+GWVC+  SL VF APL I++ VIRTKSVE MP  LS FL +SAV+WF YGLL 
Sbjct  131  -LRVHVLGWVCVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFGYGLLK  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KD+ +A+PNVLGF+FG+ QM LY  Y+ KK        P     +  A  ++ KLP+ + 
Sbjct  190  KDVFVALPNVLGFVFGVAQMALYMAYRTKK--------PPASSSSSAAAGQEIKLPEHVK  241

Query  857  E  859
            E
Sbjct  242  E  242



>ref|XP_006413354.1| hypothetical protein EUTSA_v10025975mg [Eutrema salsugineum]
 gb|ESQ54807.1| hypothetical protein EUTSA_v10025975mg [Eutrema salsugineum]
Length=270

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 179/254 (70%), Gaps = 25/254 (10%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG++GNIISFIVFL+P+PTF++IYKKKS EG+QS+PYV ALFS+MLWIYYA  K  + 
Sbjct  8    FTFGIMGNIISFIVFLAPVPTFFRIYKKKSIEGFQSLPYVSALFSAMLWIYYAMQKDGSG  67

Query  323  -LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
             LLITIN+ GC +ETIYI  +I YANKKARV T+K+L LL  +GF A+ LV + L K A 
Sbjct  68   FLLITINAVGCFIETIYIVLFITYANKKARVSTLKVLGLLNFLGFAAIVLVCELLTK-AS  126

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             R +V+G +C+ FS+CVF APL I++ VIRTKSVE MP  LS+FLT+SA+ W FYGL +K
Sbjct  127  NREKVLGGICVGFSVCVFAAPLSIMRVVIRTKSVEFMPFSLSLFLTLSAITWLFYGLAIK  186

Query  680  DINIAVPNVLGFIFGILQMVLYAM---YKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKE  850
            D  +A+PN+LG   G +QM+LY +   YKG K +D EK                   PK 
Sbjct  187  DFYVALPNILGAFLGAVQMILYVIFKYYKGPKADDTEK-------------------PKT  227

Query  851  LTEEQIVDIVKLGS  892
            +++  I D+VKL S
Sbjct  228  VSDHSI-DMVKLAS  240



>ref|XP_010678288.1| PREDICTED: bidirectional sugar transporter N3 [Beta vulgaris 
subsp. vulgaris]
Length=324

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 178/248 (72%), Gaps = 4/248 (2%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            WVFAFG+LGN+ISF+VFL+PLPTF ++YKKKS EG+QS+PYVVA+FS+MLWIYYA LK N
Sbjct  8    WVFAFGLLGNVISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYALLKGN  67

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            + LLITIN  G ++ETIY+  YI YA ++AR+ T+K+L+ +   GF  + L   +L K A
Sbjct  68   SVLLITINVAGVIIETIYVAIYITYAPRQARISTLKLLLFMNFCGFCTIVLFCHYLVK-A  126

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              R QV GW+C+ FS+ VF APL +++ VI TKSVE+MPI LS+ LT++A +WF YG + 
Sbjct  127  ENRLQVFGWICVAFSISVFAAPLSVMRTVISTKSVEYMPINLSISLTLTATIWFLYGFVQ  186

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLP---TVVALEEKQKLPK  847
            KD+ I +PNV+GF+FG+ QM LY++Y+    +  +++LP+V  P     V ++     P 
Sbjct  187  KDLYITLPNVVGFMFGVAQMGLYSIYRKYDIKAKKEKLPEVASPVKQETVEIDTINSSPN  246

Query  848  ELTEEQIV  871
            +   E  +
Sbjct  247  KTESEDYI  254



>ref|XP_006404221.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
 gb|ESQ45674.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
Length=291

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 188/278 (68%), Gaps = 24/278 (9%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TIN+FGC +ETIYI  Y+ YA K A++ T+K+L+L+   GF  + L+ QFLFK  
Sbjct  70   VFLLVTINAFGCFIETIYISMYLAYAPKTAKMLTVKLLLLMNFGGFCLILLICQFLFK-G  128

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
            P RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  129  PTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KD  +A PNV+GF+ G LQM+LY +YK  K      EK +            E  KLP  
Sbjct  189  KDFYVAFPNVIGFVLGALQMILYVVYKYCKTPPHLGEKEV------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKINVA----AAACCSIQDK  952
               E  +D++KLG++   +   +A    A  C    D+
Sbjct  235  ---EVSLDMLKLGTISSPEPAPIAVVRQANKCTCGNDR  269



>ref|NP_001131289.1| mtN3-like protein [Zea mays]
 gb|ACF79630.1| unknown [Zea mays]
 gb|ACG31892.1| mtN3-like protein [Zea mays]
 gb|AFW60846.1| mtN3-like protein [Zea mays]
Length=293

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 174/236 (74%), Gaps = 9/236 (4%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            FAFG+LGNIISF+ +L+PLPTFY+IYK KS EG+QS+PYVVALFS+MLWIYYA LKSN  
Sbjct  12   FAFGLLGNIISFMTYLAPLPTFYRIYKNKSTEGFQSVPYVVALFSAMLWIYYALLKSNEL  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINS GC++ET+YI  Y+ YA KKA++ T K+L+LL +  FG + L++  L  +   
Sbjct  72   LLITINSAGCVIETLYIAMYLLYAPKKAKLFTAKILLLLNVGVFGLILLLTL-LLSAGQR  130

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R  V+GWVC+ FS+ VFVAPL I++QV+RT+SVE MP  LS+ LTVSAV+WF YGLL+KD
Sbjct  131  RVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWFLYGLLIKD  190

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKE  850
              +A+PNV+GF FG++QM LYA+Y+           P+V    V     K K P E
Sbjct  191  KYVALPNVIGFSFGVVQMGLYALYRNAT--------PRVPAKDVADDASKDKAPGE  238



>ref|XP_004161953.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64434.1| hypothetical protein Csa_1G051720 [Cucumis sativus]
Length=291

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 186/266 (70%), Gaps = 20/266 (8%)
 Frame = +2

Query  95   SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALF  274
             + HP          VFAFG+LGNIISFIVFL+P+PTF +I KKKS EG+QS+PYVVALF
Sbjct  5    DTHHPG---------VFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALF  55

Query  275  SSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGF  454
            S+MLW+YYA   SN TLLITINS GCL+ET+YI  +I +A K+ RV T++ ++LL   GF
Sbjct  56   SAMLWLYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGF  115

Query  455  GAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFL  634
              + LV+ FL   +  + +VVGW+C+ FS+ VF APL I++ VIRTKSVE MP  LS FL
Sbjct  116  CIILLVTHFLVHGSN-QVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFL  174

Query  635  TVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE---DDEKRLPQVVL  805
            T+SA+ W  YG+ LKDI +A+PNVLGFIFG+ QM+LY +Y  +K E     E +LP+   
Sbjct  175  TLSAITWLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIY--RKYEIAIAKEMKLPE---  229

Query  806  PTVVALEEKQKLPKELTEEQIVDIVK  883
             T V +  KQK  ++ + E I  I+K
Sbjct  230  QTTVDIVMKQK--QDSSVEAIEVIIK  253



>ref|XP_007159040.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
 gb|ESW31034.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
Length=273

 Score =   260 bits (665),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 178/248 (72%), Gaps = 14/248 (6%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLK-  310
            H   AFG+LGNIISF+V+L+PLPTFY+IYKKKS EG+QS+PY+VALFSSMLW+YYA LK 
Sbjct  9    HLALAFGLLGNIISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAVLKP  68

Query  311  SNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFK  490
            ++ATLLITINS G ++ET+YI  +  YA   AR  T+K+ V++ +  F  + LV+ F   
Sbjct  69   ADATLLITINSVGTVIETVYIVLFTVYATTDARKLTVKLFVVMNVGSFALIFLVTFFTMH  128

Query  491  SAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGL  670
             A +R QVVGWVC+  S+ VF APL IV QVIRTK+VE MP  LS+FLT+SA+ WF YG 
Sbjct  129  GA-LRIQVVGWVCVAISVGVFAAPLSIVTQVIRTKNVEFMPFNLSLFLTLSAITWFSYGF  187

Query  671  LLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQE--DDEKRLPQVVL----------PTV  814
             LKDI IA+PNVLGF  G++QM+LYAMY+  K +   +E+ +  VV+          P  
Sbjct  188  FLKDICIAIPNVLGFTLGLVQMLLYAMYRNGKSKIVTEEEAMKNVVVVSPLGTCEGYPVQ  247

Query  815  VALEEKQK  838
            +  EEK+K
Sbjct  248  IMDEEKEK  255



>ref|XP_002264875.1| PREDICTED: bidirectional sugar transporter N3 [Vitis vinifera]
 emb|CBI38167.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 179/266 (67%), Gaps = 25/266 (9%)
 Frame = +2

Query  116  SMALSGHWVFA--FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLW  289
            +MA++ H      FG+LGNIISF+V+ +P PTFY+IYK+KSAEG+ S+PY+VALFS+MLW
Sbjct  2    AMAMANHHTLGLIFGILGNIISFLVYFAPAPTFYRIYKRKSAEGFHSLPYIVALFSAMLW  61

Query  290  IYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL  469
            +YYA LK +A LLITINSFGC +E+ YI  Y +YA  +A+ QT+K+++ L +  F  + +
Sbjct  62   LYYALLKKDAFLLITINSFGCAIESFYILLYFFYAPMQAKKQTLKVVISLNVGVFSILVV  121

Query  470  VSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAV  649
            + QFL K +  R  V GW+C  FS+ VF APL IV +VIRTKSVE MP  LS FLT+SA+
Sbjct  122  LIQFLLKGSN-RINVFGWICASFSVAVFAAPLSIVAKVIRTKSVEFMPFSLSFFLTLSAI  180

Query  650  MWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEE  829
            MWF YGLL  D  +A+PN+LG I G++QMVLY  Y+   +E  EK+LP            
Sbjct  181  MWFAYGLLKNDPCVAIPNILGVILGLVQMVLYGFYRNAGKEKMEKKLP------------  228

Query  830  KQKLPKELTEEQIVDIVKLGSLICSD  907
                      E I+D+V L +L  SD
Sbjct  229  ----------EHIIDMVMLSTLGTSD  244



>ref|XP_010419882.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 182/275 (66%), Gaps = 20/275 (7%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN ISF+VFL+P+PTFY+IYKKKS E +QS+PY V+LFS MLW+YYA +K +A 
Sbjct  12   FIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKQDAF  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGC+VETIYI  +  YA +  R+  +K+ + + +  F  + +V+ F+ ++  +
Sbjct  72   LLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFIAINVAFFSMILMVTHFVVRTPTI  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            +  V+GW+C+  S+ VF APL IV +VI+TKSVE MP  LS FLT+SAVMWF YGL L D
Sbjct  132  QVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFLHD  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDD-EKRLPQVVLPTVVALEEKQKLPKELTE  859
            I IA+PNV+GF+ G+LQMVLY +Y+   ++ + EK++                    L+E
Sbjct  192  ICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKI-------------------NLSE  232

Query  860  EQIVDIVKLGSLICSDKINVAAAACCSIQDKLLHQ  964
            +Q+  IV +  L  S+   V       + D + H+
Sbjct  233  QQLKSIVVMSPLGVSEVHPVVTEPVGPLSDAVHHE  267



>ref|XP_010556111.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Tarenaya 
hassleriana]
Length=307

 Score =   261 bits (668),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 167/226 (74%), Gaps = 0/226 (0%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGN ISF+VFL+P+PTFY+IYKKKS E ++S+PY V+LFS MLW+YYA LK NA LL
Sbjct  14   FGILGNAISFLVFLAPVPTFYRIYKKKSTESFRSLPYQVSLFSCMLWLYYALLKQNAFLL  73

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSFGC+VET YI  +I YA K  R+  +K+ + + +  F  + +V+ FL K++  + 
Sbjct  74   ITINSFGCVVETFYIAMFIAYAAKDKRISAMKLFMAMNVTFFSLILIVTHFLVKNSSHQI  133

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
             ++GW+C+  S+ VF APL +V +VIRTKSVE MP  LS FLT+SAVMWF YGL L DI 
Sbjct  134  VILGWICVAISVSVFAAPLSVVARVIRTKSVEFMPFTLSFFLTISAVMWFAYGLFLHDIC  193

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALE  826
            IA+PNVLGF  G++QM+LY +Y+  ++ + EK++    L T+V L 
Sbjct  194  IAIPNVLGFALGMVQMILYGIYRNSEKSNLEKKIQDHQLKTIVVLS  239



>emb|CDX77928.1| BnaC03g52910D [Brassica napus]
Length=285

 Score =   261 bits (666),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 187/274 (68%), Gaps = 21/274 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I+++VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRKVIKTRSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNVLGF  G LQM+LY +YK  K      EK +            E  KLP  
Sbjct  189  KDIYVAFPNVLGFALGALQMILYVVYKYCKTPPHLGEKEV------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKINVAAAACCSIQDK  952
               E  +DI+KLG+ + S ++  A    C    +
Sbjct  235  ---EVSLDILKLGT-VSSPEVRQANKCTCGNDRR  264



>ref|XP_011015361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=269

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 166/219 (76%), Gaps = 1/219 (0%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL   WVF FG+LGNIIS +V L+PLPTFYQI +KK+++G+QSIPYV+ALFS+MLW++Y
Sbjct  1    MALHFTWVFGFGLLGNIISCLVCLAPLPTFYQICRKKTSQGFQSIPYVIALFSAMLWLFY  60

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A    NA LLITINSF   +E  YI  Y++YA KK ++ T K+L+L  I GFG +  ++ 
Sbjct  61   AIFSENAMLLITINSFTFFMEIGYIAVYLFYATKKDKILTFKLLLLFNIFGFGLICALT-  119

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
             L      R QV+GW+C+VF+LCVFVAPL +V++VI+TKSVE MP  LS FLT+SAVMWF
Sbjct  120  LLLTEGIKRVQVLGWICMVFALCVFVAPLGVVRKVIKTKSVEFMPFSLSFFLTLSAVMWF  179

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQED  775
            FYG   KD  +A+PN+LGFIFG+LQM LY +Y+  K+ +
Sbjct  180  FYGYQKKDKFVAIPNILGFIFGMLQMALYLIYRNPKKNE  218



>ref|XP_010492063.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 182/275 (66%), Gaps = 20/275 (7%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN ISF+VFL+P+PTFY+IYKKKS E +QS+PY V+LFS MLW+YYA +K +A 
Sbjct  12   FIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKQDAF  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGC+VETIYI  +  YA +  R+  +K+ + + +  F  + +V+ F+ K+  +
Sbjct  72   LLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFITINVAVFSLILMVTHFVVKTPTL  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            +  V+GW+C+  S+ VF APL IV +VI+T+SVE MP  LS FLT+SAVMWF YGL L D
Sbjct  132  QVSVLGWICVAISVSVFAAPLMIVARVIKTRSVEFMPFTLSFFLTISAVMWFAYGLFLHD  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDD-EKRLPQVVLPTVVALEEKQKLPKELTE  859
            I IA+PNV+GF+ G+LQMVLY +Y+   ++ + EK++                    L+E
Sbjct  192  ICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKI-------------------HLSE  232

Query  860  EQIVDIVKLGSLICSDKINVAAAACCSIQDKLLHQ  964
            +Q+  IV +  L  S+   V       + D + H+
Sbjct  233  QQLKSIVVMSPLGVSEVHPVVTEPVGPLSDAVHHE  267



>ref|XP_004491680.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=257

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 176/242 (73%), Gaps = 2/242 (1%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN+ISF+VFL+P+ TFY+IYKKKS E +QS+PY+VALFSSMLW+YYA +K+N  
Sbjct  10   FGFGMLGNVISFMVFLAPMTTFYRIYKKKSTEQFQSLPYLVALFSSMLWLYYALVKTNEF  69

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGCLVE IYI  YI YA K AR  T+K+L+ + +  FG +  V+ +    A +
Sbjct  70   LLITINSFGCLVEIIYILLYITYAPKDARKLTLKLLLAMNMGSFGLILSVTHYAMHGA-L  128

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R QV+GW+C+  S+ VF APL IV QV+RTKSVE MP  LS  LT+SA+MWF YGL LKD
Sbjct  129  RVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLFLKD  188

Query  683  INIAVPNVLGFIFGILQMVLYAMYK-GKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTE  859
            I IA+PNVLGF+ G++QM+LY +Y+ G K+   +  +  +    V  ++E  ++  +  E
Sbjct  189  ICIALPNVLGFVLGLVQMILYGIYRNGNKKATLKTVVSSLENGEVFPVQEDHEIGNKNKE  248

Query  860  EQ  865
            E+
Sbjct  249  EK  250



>ref|XP_004239304.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=295

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 189/268 (71%), Gaps = 17/268 (6%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
            L   W+F FGVLGN+IS +VFL+P+P F +I K+KS  GYQS+PYVVALFSSMLW+YYAF
Sbjct  6    LHHPWLFVFGVLGNVISILVFLAPVPAFRRICKEKSTMGYQSVPYVVALFSSMLWMYYAF  65

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            +K NA LL++INSFGC+VETIYI  +I YA+K+AR QT+++LVLL+   +  + L++ F 
Sbjct  66   IKKNAILLVSINSFGCIVETIYITIFILYASKEARRQTVQLLVLLIGGLYTLIFLITLFP  125

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
                 +R QVVGW+C+  ++ VF APL IV QV+RT++VE MP  LS FLT+SA+MWF Y
Sbjct  126  LNGV-LRVQVVGWICVTVAVGVFAAPLSIVFQVVRTRTVEFMPFTLSFFLTLSAIMWFGY  184

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD-EKRLPQVVLPTVVALEEKQKL  841
            GLLLKD+ IA+PNVLGF  G++QM+LY +Y+  K   D EK++ +       A+  +Q  
Sbjct  185  GLLLKDLCIALPNVLGFFLGMIQMLLYGIYRNAKPAIDLEKKVCE------HAVNSEQIY  238

Query  842  PKELTEEQIVDIVKLGSLICSDKINVAA  925
            P +  +    D         +++IN+AA
Sbjct  239  PVDSEDVNFND---------TEEINMAA  257



>ref|XP_010426372.1| PREDICTED: bidirectional sugar transporter SWEET11 [Camelina 
sativa]
Length=292

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 182/255 (71%), Gaps = 19/255 (7%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TIN+FGC +ETIYI  ++ YA K AR+ T+K+L+L+   GF  + L+ QFL K A
Sbjct  70   VFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCIILLICQFLVKGA  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQED--DEKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF  G LQM+LY +YK  K      EK +            E  KLP E
Sbjct  189  KDIYVAFPNVIGFGLGALQMILYIVYKYCKTSPHLGEKEV------------EAAKLPAE  236

Query  851  LTEEQIVDIVKLGSL  895
            +T    +D++KLG++
Sbjct  237  VT----LDMLKLGTI  247



>gb|KGN61326.1| hypothetical protein Csa_2G083730 [Cucumis sativus]
Length=262

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/277 (49%), Positives = 189/277 (68%), Gaps = 18/277 (6%)
 Frame = +2

Query  122  ALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
             LS H + F FG+LGNIISF+VFL+P+PTF+ IYKKK++EG+QSIPYVVAL S+ML +YY
Sbjct  3    GLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLLYY  62

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK+NA LL++INSFGC++E IYI  Y++YA KK ++ T+K+ ++  + GF  V +   
Sbjct  63   AALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNL-GFSGVMVGGT  121

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
              F     R   VGW+C  F+L VF +PL I+K+VI TKSVE+MP  LS FLT+SA MWF
Sbjct  122  MFFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMWF  181

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG  +KD+ IA+PNV+GF+ G++QM++Y +YK  K + +EK            LEE  K
Sbjct  182  FYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDSKGKVEEK------------LEEGAK  229

Query  839  LPKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQD  949
              +E  ++Q + IVK  S   + +IN+A      I +
Sbjct  230  FCEE--DDQTLSIVKTQS--ETKEINMAETNHYKIHE  262



>ref|XP_009149800.1| PREDICTED: bidirectional sugar transporter SWEET11 [Brassica 
rapa]
Length=289

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 188/278 (68%), Gaps = 26/278 (9%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ----KLP  844
            KDI +A PNV+GF  G LQM+LY +YK  K              T   LEEK+    KLP
Sbjct  189  KDIYVAFPNVIGFALGALQMILYVVYKYCK--------------TPPHLEEKEVEAAKLP  234

Query  845  KELTEEQIVDIVKLGSLICSDKINVAAAA--CCSIQDK  952
                 E  +D++KLG++   + I     A  C    D+
Sbjct  235  -----EVTLDMLKLGTVSSPETITAVRQANKCTCGNDR  267



>ref|XP_010503515.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Camelina 
sativa]
Length=294

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 182/255 (71%), Gaps = 19/255 (7%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGN+ISF VFLSP+PTFY+I+KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLLGNVISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TIN+FGC +ETIYI  ++ YA K AR+ T+K+L+L+   GF  + L+ QFL K A
Sbjct  70   VFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKILLLMNFGGFCIILLICQFLVKGA  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQED--DEKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF  G LQM+LY +YK  K      EK +            E  KLP E
Sbjct  189  KDIYVAFPNVIGFGLGALQMILYIVYKYCKTSPHIGEKEV------------EAAKLPAE  236

Query  851  LTEEQIVDIVKLGSL  895
            +T    +D++KLG++
Sbjct  237  VT----LDMLKLGTI  247



>emb|CDY08093.1| BnaA06g16330D [Brassica napus]
Length=289

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 188/278 (68%), Gaps = 26/278 (9%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ----KLP  844
            KDI +A PNV+GF  G LQM+LY +YK  K              T   LEEK+    KLP
Sbjct  189  KDIYVAFPNVIGFALGALQMILYVVYKYCK--------------TPPHLEEKEVEAAKLP  234

Query  845  KELTEEQIVDIVKLGSLICSDKINVAAAA--CCSIQDK  952
                 E  +D++KLG++   + I     A  C    D+
Sbjct  235  -----EVTLDMLKLGTVSSPETITAVRQANKCTCGNDR  267



>ref|XP_004155149.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
NEC1-like [Cucumis sativus]
Length=262

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/277 (49%), Positives = 190/277 (69%), Gaps = 18/277 (6%)
 Frame = +2

Query  122  ALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
             LS H + F FG+LGNIISF+VFL+P+PTF+ IYKKK++EG+QSIPYVVAL S+ML +YY
Sbjct  3    GLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLLYY  62

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK+NA LL++INSFGC++E IYI  Y++YA KK ++ T+K+ ++  + GF  V +   
Sbjct  63   AALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNL-GFSGVMVGGT  121

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
             +F     R   VGW+C  F+L VF +PL I+K+VI TKSVE+MP  LS FLT+SA MWF
Sbjct  122  XVFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMWF  181

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG  +KD+ IA+PNV+GF+ G++QM++Y +YK  K + +EK            LEE  K
Sbjct  182  FYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDSKGKVEEK------------LEEGAK  229

Query  839  LPKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQD  949
              +E  ++Q + IVK  S   + +IN+A      I +
Sbjct  230  FCEE--DDQTLSIVKTQS--ETKEINMAETNHYKIHE  262



>ref|XP_003615405.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES98363.1| bidirectional sugar transporter [Medicago truncatula]
Length=269

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGNIIS +V+L+PLPTFY+I+KKKS EG+QS+PY+VALFSSMLW+YY F+K +A 
Sbjct  11   FIFGILGNIISSMVYLAPLPTFYRIWKKKSTEGFQSLPYLVALFSSMLWLYYGFVKKHAF  70

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINS GC++ETIYI  Y+ YA K AR+ TIK+ + + +     + L +Q L     +
Sbjct  71   LLITINSAGCVIETIYIVTYLIYATKDARILTIKLFMAMNVACSVLIVLTTQ-LAMHGKL  129

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R  V+GW+C  F++CVF APL I+ +VIRTKSVE MPI LS FLT+SA++WFFYGLLL D
Sbjct  130  RVHVLGWICTSFAICVFAAPLTIMAKVIRTKSVEFMPINLSFFLTLSAIVWFFYGLLLHD  189

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQED  775
            I IA+PNVLGFI G+LQM+LYA+Y    +E+
Sbjct  190  ICIAIPNVLGFILGLLQMLLYAIYNKSVKEE  220



>dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/307 (47%), Positives = 199/307 (65%), Gaps = 36/307 (12%)
 Frame = +2

Query  71   LGGL*IR*SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQS  250
            +GGL    S++HP         W F FG+LGN+ISF+ +L+PLPTFY+IYK KS +G+QS
Sbjct  1    MGGL----SAQHP---------WAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQS  47

Query  251  IPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKML  430
            +PYVVALFS+MLWIYYA LKS+  LLITIN+ GC++ETIYI  Y+ YA K+AR+ T K+L
Sbjct  48   VPYVVALFSAMLWIYYALLKSDEYLLITINTAGCVIETIYIVLYLAYAPKQARLFTAKIL  107

Query  431  VLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHM  610
            +LL +  FG + L++  L  +   R  ++GWVC+ FS+CVFVAPL +++ V+RT+SVE M
Sbjct  108  LLLNVGVFGLILLLTL-LLTAGERRVVMLGWVCVGFSVCVFVAPLSVIRLVVRTRSVEFM  166

Query  611  PILLSVFLTVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRL  790
            P  LS+ LT SAV+WF YGLL+KD  +A+PN+LGF FG++QM LYA+Y+        K +
Sbjct  167  PFSLSLSLTASAVVWFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNATPIPAPKEM  226

Query  791  PQVVLPTVVALEEKQKLPKELTEEQIVDIVKLGSLICSDKINV------------AAAAC  934
                     A E +    K    E +V+I KLG+   + ++N               A  
Sbjct  227  D--------APESEDGAVK--APEHVVNIAKLGTAAAAIELNTNHPVEPPPPMKEGTAKA  276

Query  935  CSIQDKL  955
            C+  +KL
Sbjct  277  CATGEKL  283



>ref|XP_009777590.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=315

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 187/254 (74%), Gaps = 4/254 (2%)
 Frame = +2

Query  125  LSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAF  304
            L   W+F FG LGNIIS  VFL+P+PTF +IYK+KS  G+QS+PYVVALFSSMLW+YYAF
Sbjct  6    LHHPWLFVFGALGNIISIFVFLAPVPTFRRIYKEKSTMGFQSVPYVVALFSSMLWMYYAF  65

Query  305  LKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFL  484
            +K NA LLI+INSFGC+VETIYI  ++ YA+K+AR QT+K+LV L+   +  + LV+ F 
Sbjct  66   IKKNAILLISINSFGCIVETIYISIFLLYASKEARRQTVKLLVSLIGGLYTLIFLVTLFP  125

Query  485  FKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFY  664
               A +R QVVGW+C+  ++ VF APL IV QV+RTKSVE +P  LS FLT+SA+MWF Y
Sbjct  126  LNGA-LRVQVVGWICVAVAVAVFAAPLSIVFQVVRTKSVEFLPFTLSFFLTLSAIMWFGY  184

Query  665  GLLLKDINIAVPNVLGFIFGILQMVLYAMYKG-KKQEDDEKRLPQVVLPTVVALEEKQKL  841
            GLL KD+ IA+PNVLGF  G++QM+LY +Y+  K   + EK++P+ ++  VV    +Q  
Sbjct  185  GLLQKDLCIALPNVLGFFLGMIQMLLYGLYRKVKPAAELEKKVPEHIVNIVVVGNSEQIH  244

Query  842  PKELTEEQIVDIVK  883
            P  +  E+  D++K
Sbjct  245  P--VKSEKNEDMIK  256



>ref|XP_008356571.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Malus 
domestica]
Length=295

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/267 (50%), Positives = 186/267 (70%), Gaps = 23/267 (9%)
 Frame = +2

Query  119  MALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
            MAL      AFG+LGNIIS +VFL+P+PTFY IYKKK+ EG+Q++PYV+ L SSML+IYY
Sbjct  1    MALQHTLSLAFGLLGNIISLLVFLAPVPTFYTIYKKKTTEGFQALPYVIGLLSSMLYIYY  60

Query  299  AFLKS----NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVA  466
            A LK     +ATLLITINS G ++ET+YI  +++YA KKAR+    +L LL    +  + 
Sbjct  61   ALLKEEIKYDATLLITINSVGSVIETLYISLFLFYAPKKARISNATLLFLLNGFSYAVMV  120

Query  467  LVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSA  646
            ++++FL  +  +R ++VGW+CLVFS+ VFVAPL +++QV RTKSVE MP  LS FLT+ A
Sbjct  121  VLTRFL-ATGEMRIKIVGWICLVFSISVFVAPLGVLRQVXRTKSVEFMPFPLSFFLTLGA  179

Query  647  VMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALE  826
            V WFFYG L+KD  IA+PN+LGF  G++QMV+Y +YK  K+                 LE
Sbjct  180  VAWFFYGFLIKDFYIALPNILGFFLGVVQMVVYIVYKNAKE----------------VLE  223

Query  827  EKQKLPKELTEEQIVDIVKLGSLICSD  907
            ++ K  +EL+ E I+D+ K+ +L+C +
Sbjct  224  DQPK-GQELS-EHIIDVRKISTLVCPE  248



>ref|XP_002322282.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
 gb|EEF06409.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
Length=276

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 182/265 (69%), Gaps = 23/265 (9%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
            S ++   W+F FG+LGN +SF+VFL+P+PTF +I +KK+ EG+QS+PYVVALFS+M+W+Y
Sbjct  3    SFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFLRICRKKTTEGFQSLPYVVALFSAMIWLY  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LKS+  LLITINS GC +E IYI  Y+ YA K+AR+ T+++L+L    GF ++ L+S
Sbjct  63   YASLKSDVLLLITINSVGCFIEMIYIALYVAYAPKQARIATLRILILFNFGGFCSILLLS  122

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
             F  K +  R +V+GW C++FS+ VF APL I++ VIRTKSVE MP  LS FLT+SA+ W
Sbjct  123  HFFVKGSN-RVKVLGWACVIFSVSVFAAPLNIMRIVIRTKSVEFMPFTLSFFLTLSAITW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
              YG+L+KD  IA+PN++GFIFG+LQMVLY +YK  K              T V +E   
Sbjct  182  LVYGVLVKDYYIAIPNIVGFIFGVLQMVLYVIYKNFK--------------TAVPMEP--  225

Query  836  KLPKELTEEQIVDIVKLGSLICSDK  910
            KLP        +DI KL  + C  K
Sbjct  226  KLPYS------IDIAKLSPVSCEMK  244



>ref|XP_006289174.1| hypothetical protein CARUB_v10002612mg [Capsella rubella]
 gb|EOA22072.1| hypothetical protein CARUB_v10002612mg [Capsella rubella]
Length=286

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 184/273 (67%), Gaps = 20/273 (7%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGN +SF+V ++PLPTFY+IYKKKS E +QS+PY V+LFS MLW+YYA +K NA LL
Sbjct  14   FGILGNAVSFLVLVAPLPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKKNAFLL  73

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSFGC+V+TIYI  ++ YA +  R+  +K+ + + +V F  + LV+ F+ K+  ++ 
Sbjct  74   ITINSFGCVVQTIYIAMFLAYATRDKRISAMKLFIAINVVFFSLILLVTHFVVKTPTLQV  133

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
             V+GW+C+  S+ VF APL IV +V++TKSVE+MP  LS FLT+SAVMWF YGL L DI 
Sbjct  134  SVLGWICVAISVAVFAAPLMIVARVVKTKSVEYMPFTLSFFLTISAVMWFGYGLFLNDIC  193

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQEDD-EKRLPQVVLPTVVALEEKQKLPKELTEEQ  865
            IA+PNV+GF+ G+LQMVLY +Y+   ++ + EK++                    L+E+Q
Sbjct  194  IAIPNVVGFVLGMLQMVLYCVYRNASEKPEIEKKI-------------------NLSEQQ  234

Query  866  IVDIVKLGSLICSDKINVAAAACCSIQDKLLHQ  964
            +  IV +  L  S+   V  A+     D + H+
Sbjct  235  LKSIVVMSPLGVSEVHPVVTASVGPPSDAVHHE  267



>gb|EMS46194.1| Bidirectional sugar transporter SWEET15 [Triticum urartu]
Length=345

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 172/257 (67%), Gaps = 7/257 (3%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG+QS PY+V LFS +LW+YYAFLKS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYLVTLFSCLLWMYYAFLKSG  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            + LL+TIN+ GC++E++YI  Y+ YA K AR+ T K+ + L +  FG +ALV+  L    
Sbjct  71   SELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIALVT-MLASHG  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
            P+R QVVGW+C+  +L VF APL I++ VIRTKSVE MP  LS FL +SAV+WF YG L 
Sbjct  130  PLRVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFAYGALK  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQ------EDDEKRLPQVVLPTVVALEEKQK  838
            KDI +A+PNVLGF+FG+ QM LY  Y+ KK       +   ++  +  +P        + 
Sbjct  190  KDIFVAMPNVLGFLFGVAQMALYMAYRNKKPATVAVIDTTPRQRQRCTMPVGRQTRRHKP  249

Query  839  LPKELTEEQIVDIVKLG  889
               E       D +K G
Sbjct  250  FATEKNRGSTNDALKRG  266



>ref|NP_001067955.1| Os11g0508600 [Oryza sativa Japonica Group]
 sp|Q2R3P9.1|SWT14_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Japonica Group]
 gb|ABA93969.1| nodulin MtN3 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28318.1| Os11g0508600 [Oryza sativa Japonica Group]
 gb|EAZ18482.1| hypothetical protein OsJ_34008 [Oryza sativa Japonica Group]
 dbj|BAG95290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=303

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 166/214 (78%), Gaps = 1/214 (0%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             M+L   W FAFG+LGNIISF+ +L+PLPTFY+IYK KS +G+QS+PYVVALFS+MLWIY
Sbjct  3    GMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIY  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LKS+  LLITINS GC++ETIYI  Y+ YA KKA++ T K+L LLV VG   + L+ 
Sbjct  63   YALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLL-LLVNVGVFGLILLL  121

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              L  +   R  V+GWVC+ FS+ VFVAPL I++ V+RTKSVE MP  LS  LT+SAV+W
Sbjct  122  TLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVVW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYK  757
            F YGLL+KD  +A+PNVLGF FG++QM LYAMY+
Sbjct  182  FLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYR  215



>ref|XP_009150178.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Brassica 
rapa]
Length=285

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 186/274 (68%), Gaps = 21/274 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNVLGF  G LQM+LY +YK  K      EK +            E  KLP  
Sbjct  189  KDIYVAFPNVLGFALGALQMILYVVYKYCKTPPHLGEKEV------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKINVAAAACCSIQDK  952
               E  +DI+KLG+ + S ++  A    C    +
Sbjct  235  ---EVSLDILKLGT-VSSPEVRQANKCTCGNDRR  264



>emb|CDP13388.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 171/228 (75%), Gaps = 1/228 (0%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
             WVFAFGVLGN++S I +L PLPTFY+IY++KS  GY+++PYVVAL S+MLW+YYA LK 
Sbjct  10   RWVFAFGVLGNLVSVIAYLGPLPTFYRIYREKSTMGYEALPYVVALSSAMLWMYYALLKP  69

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
             ATLLI+INS GC++ET+YI FYI YA+K+AR  TIK++ +L +    A+ +V+ F  K 
Sbjct  70   -ATLLISINSLGCIIETLYILFYILYASKQARKHTIKLVGMLNVGLICAIFVVANFALKE  128

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
              VR  VVGW+C+ FS+ VF APL IV QV+RT++ E MP+ LS  LT+SAVMWFFYG L
Sbjct  129  VSVRIMVVGWICVAFSVSVFAAPLSIVFQVVRTRNAEFMPVALSATLTLSAVMWFFYGFL  188

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVV  817
              D+ + VPN++GF  G+LQM+LY +Y+  K    EK++P+ V+  V+
Sbjct  189  KADMCVTVPNIMGFFLGVLQMMLYVIYRKPKPLVAEKKVPEHVINIVM  236



>sp|B8BKP4.1|SWT14_ORYSI RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Indica Group]
 gb|EEC68230.1| hypothetical protein OsI_36230 [Oryza sativa Indica Group]
Length=303

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 166/214 (78%), Gaps = 1/214 (0%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             M+L   W FAFG+LGNIISF+ +L+PLPTFY+IYK KS +G+QS+PYVVALFS+MLWIY
Sbjct  3    GMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIY  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LKS+  LLITINS GC++ETIYI  Y+ YA KKA++ T K+L LLV VG   + L+ 
Sbjct  63   YALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLL-LLVNVGVFGLILLL  121

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              L  +   R  V+GWVC+ FS+ VFVAPL I++ V+RTKSVE MP  LS  LT+SAV+W
Sbjct  122  TLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVVW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYK  757
            F YGLL+KD  +A+PNVLGF FG++QM LYAMY+
Sbjct  182  FLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYR  215



>ref|XP_010453373.1| PREDICTED: bidirectional sugar transporter SWEET15 [Camelina 
sativa]
Length=296

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 182/275 (66%), Gaps = 20/275 (7%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN ISF+VFL+P+PTFY+IYKKKS E +QS+PY V+LFS MLW+YYA +K +A 
Sbjct  12   FIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKQDAF  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGC+VETIYI  +  YA ++ R+  +K+ + + +  F  + +V+ F+ K+  +
Sbjct  72   LLITINSFGCVVETIYIAMFFAYATREKRISAMKLFIAINVAFFSLILMVTHFVVKTPTL  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            +  V+GW+C+  S+ VF APL IV +VI+TKSVE MP  LS FLT+SAVMWF YGL L D
Sbjct  132  QVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFLHD  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDD-EKRLPQVVLPTVVALEEKQKLPKELTE  859
            I IA+PNV+GF+ G+LQMVLY +Y+   ++ + EK++                     +E
Sbjct  192  ICIAIPNVVGFVLGMLQMVLYGIYRNSSEKPEMEKKINS-------------------SE  232

Query  860  EQIVDIVKLGSLICSDKINVAAAACCSIQDKLLHQ  964
            +Q+  IV +  L  S+   V       + D + H+
Sbjct  233  QQLKSIVVMSPLGVSEVHPVVTEPVGPLSDAVHHE  267



>ref|XP_004979336.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=296

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 187/259 (72%), Gaps = 13/259 (5%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             ++L     FAFG+LGNIISF+ +L+PLPTFY+IYK KS +G+QS+PYVVALFS+MLWIY
Sbjct  3    GLSLQHPLAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIY  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA LKSN  LLITIN+ GC++ET+YI  Y+ YA KKA++ T K+L+LL +  FG + L++
Sbjct  63   YALLKSNECLLITINAAGCVIETLYIAMYLTYAPKKAKLFTAKILLLLNVGVFGLILLLT  122

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              L  +   R  ++GWVC+ FS+ VFVAPL I++QV+RT+SVE MP  LS+ LTVSAV+W
Sbjct  123  L-LLSAGQNRLVILGWVCVGFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
            F YGLL+KD  +A+PNVLGF FG++QM LYA+Y+           P+V  P     ++K+
Sbjct  182  FLYGLLIKDKYVALPNVLGFSFGVIQMGLYALYRNAT--------PRV--PAKEVADDKE  231

Query  836  KLPKELTEEQIVDIVKLGS  892
             + K    E +V I KLG+
Sbjct  232  DIIK--VPEHVVTIAKLGA  248



>gb|EMT09236.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=310

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 169/241 (70%), Gaps = 13/241 (5%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG+LGNIIS +VFLSPLPTFY++Y+KKS EG Q  PY+V LFS +LW+YYAFLKS 
Sbjct  11   WAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGVQPTPYLVTLFSCLLWMYYAFLKSG  70

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
            + LL+TIN+ GC++E++YI  Y+ YA K AR+ T K+ + L +  FG +ALV+  L    
Sbjct  71   SELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIALVT-MLASYG  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
            P+R QVVGW+C+  +L VF APL I++ VIRTKSVE MP  LS FL +SAV+WF YG L 
Sbjct  130  PLRVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFAYGALK  189

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KDI +A+PNVLG +FG+ QM LY  Y+ KK              TVV + E+ KLP+ + 
Sbjct  190  KDIFVAMPNVLGLLFGVAQMALYMAYRNKKPA------------TVVLVHEEMKLPEHVK  237

Query  857  E  859
            E
Sbjct  238  E  238



>ref|XP_002442119.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
 gb|EES15957.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
Length=302

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 187/261 (72%), Gaps = 20/261 (8%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             ++L   W FAFG+LGN+ISF+ FL+P+PTFY+IYK KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSLQHPWAFAFGLLGNVISFLTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIF  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA +KSN T LITIN+ GC++ETIYI  Y  YA KKA++ T K+++LL +  FG + LV+
Sbjct  63   YALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILLVT  122

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
              LFK    R  ++GW+C+ FS+ VFVAPL I+++VI+TKSVE+MP  LS+ LT+SAV+W
Sbjct  123  LLLFKGDK-RVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVVW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
            F YGLL+KD  +A+PN+LGF FG++QMVLY +Y  K               T VA+ E +
Sbjct  182  FLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNK---------------TPVAVAEGK  226

Query  836  ----KLPKELTEEQIVDIVKL  886
                KLP    E  +V+I KL
Sbjct  227  DAGVKLPSAADEHVLVNITKL  247



>ref|XP_010242697.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=276

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 170/221 (77%), Gaps = 2/221 (1%)
 Frame = +2

Query  140  VFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNA  319
            VFAFG+LGNI+S  V+L+P+PTFY+IYKKKS EG+QSIPYVVALFS+MLWIYYA LK+N 
Sbjct  10   VFAFGILGNIVSCAVYLAPVPTFYRIYKKKSTEGFQSIPYVVALFSAMLWIYYALLKTNV  69

Query  320  TLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAP  499
            T+LITIN  GC +ETIYI  Y+ YA K  ++ T+K+L+LL +  +G + L+S   FK   
Sbjct  70   TMLITINGIGCTIETIYITLYLVYAPKGTKIFTVKLLLLLNMGAYGLILLLSFLFFKGFG  129

Query  500  VRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLK  679
             R  VVGWVC  FS+ VF APL I+++VIRTKSVE MPI LS FLT+ AV WFFYG+L+K
Sbjct  130  -RVTVVGWVCAGFSVIVFAAPLSIMRRVIRTKSVEFMPISLSFFLTLCAVFWFFYGILMK  188

Query  680  DINIAVPNVLGFIFGILQMVLYAMYK-GKKQEDDEKRLPQV  799
            D+ IA+PNVLGF  G+ QM+LY +Y+  KK    E +LP++
Sbjct  189  DLYIAIPNVLGFALGVAQMILYIIYRDSKKHLIVELKLPEL  229



>gb|KHG20984.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=289

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 177/234 (76%), Gaps = 9/234 (4%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG+LGNIIS +VFL+P+PTF +IYKKKS E +QS+PY VALFS MLW+YYA +K  A LL
Sbjct  14   FGILGNIISVLVFLAPVPTFCRIYKKKSTESFQSLPYQVALFSCMLWLYYALIKKGAFLL  73

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSFGC+VETIYI  ++ YA+K +R+  +K+ + + +  F  + +++ FL KS+ +R 
Sbjct  74   ITINSFGCVVETIYISMFLAYASKNSRMSAMKLFISMNLGLFSFILILTHFLLKSS-IRI  132

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
            QV+GW+C+  S+ VF APL I+ +VIRTKSVE MP  LS FLT+SAVMWF YGL +KD+ 
Sbjct  133  QVLGWICVAISVSVFAAPLNIMARVIRTKSVEFMPFTLSFFLTLSAVMWFAYGLFIKDLC  192

Query  689  IAVPNVLGFIFGILQMVLYAMYKGKKQED-DEKRLP-------QVVLPTVVALE  826
            +A+PNVLGFI G+LQM+LYA+Y+  ++ + +EK+LP        VVL T+ A E
Sbjct  193  VALPNVLGFILGMLQMLLYAIYRHSEKVNIEEKKLPAEQMKSINVVLTTLGASE  246



>emb|CDX83046.1| BnaA01g20460D [Brassica napus]
Length=286

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/259 (52%), Positives = 184/259 (71%), Gaps = 16/259 (6%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ +A KKAR+ T+K+L+L+   GF  + L+SQFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLSQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELT  856
            KDI +A PNVLGF  G LQM+LY +Y+  K        PQ+    V    E  KLP    
Sbjct  189  KDIYVAFPNVLGFALGALQMILYVVYRYCKTP------PQLGEKEV----EAAKLP----  234

Query  857  EEQIVDIVKLGSLICSDKI  913
             E  +D++KLG++   + I
Sbjct  235  -EVSLDMLKLGTVSSPEPI  252



>ref|XP_006399805.1| hypothetical protein EUTSA_v10014234mg [Eutrema salsugineum]
 gb|ESQ41258.1| hypothetical protein EUTSA_v10014234mg [Eutrema salsugineum]
Length=297

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 173/246 (70%), Gaps = 8/246 (3%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNATLL  328
            FG LGN ISF+VFL+P+PTFY+IYKKKS E +QS+PY V+LFS MLW+YYA +K NA LL
Sbjct  14   FGALGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKQNAFLL  73

Query  329  ITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVRA  508
            ITINSFGC+VET+YI  +  YA K  R+  +K+ + + +  F  + +V+ F+ KS  ++ 
Sbjct  74   ITINSFGCVVETLYIAMFFAYATKDKRIAAMKLFITMNVAFFSLILMVTHFVVKSPTLQV  133

Query  509  QVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDIN  688
             V+GWVC+  S+ VF APL IV +VI+TKSVE MP  LS FLT+SAVMWF YGL L DI 
Sbjct  134  SVIGWVCVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFLHDIC  193

Query  689  IAVPNVLGFIFGILQMVLYAMYKG--------KKQEDDEKRLPQVVLPTVVALEEKQKLP  844
            IA+PNV+GFI G++QMVLY +Y+         KK    +++L  +V+ + + + E   + 
Sbjct  194  IAIPNVVGFILGMVQMVLYGVYRNSGEKLDIEKKVNTSDQQLKSIVVMSPLGVSEVHPID  253

Query  845  KELTEE  862
             ++TE 
Sbjct  254  VKMTES  259



>ref|XP_002873602.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49861.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=295

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 183/275 (67%), Gaps = 20/275 (7%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN+ISF+VFL+P+PTFY+IYKKKS E +QS+PY V+LFS MLW+YYA +K +A 
Sbjct  12   FIFGILGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKKDAF  71

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGC+VET+YI  +  YA K  R+  +K+ + + +  F  + +V+ F+ ++  +
Sbjct  72   LLITINSFGCVVETLYIAMFFAYATKDKRISALKLFIAMNVAFFSLILMVTHFVVETPTL  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            +  V+GW+C+  S+ VF APL IV +VI+TKSVE MP  LS FLT+SAVMWF YGL L D
Sbjct  132  QVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFLND  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDD-EKRLPQVVLPTVVALEEKQKLPKELTE  859
            I IA+PNV+GF+ G+LQMVLY +Y+   ++ + EK++                     +E
Sbjct  192  ICIAIPNVVGFVLGLLQMVLYGVYRNSNEKPEMEKKINS-------------------SE  232

Query  860  EQIVDIVKLGSLICSDKINVAAAACCSIQDKLLHQ  964
            +Q+  IV +  L  S+   V   +   + D + H+
Sbjct  233  QQLKSIVVMSPLGVSEVHPVVTESVDPLSDAVHHE  267



>emb|CDY05867.1| BnaC08g20440D [Brassica napus]
Length=289

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/276 (49%), Positives = 186/276 (67%), Gaps = 22/276 (8%)
 Frame = +2

Query  137  WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSN  316
            W F FG++GN+ISF VFLSP+PTFY+++KKK+ EG+QS+PYVVALFS+ LW+YYA  K +
Sbjct  10   WAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKD  69

Query  317  ATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSA  496
              LL+TINSFGC +ETIYI  ++ YA KKAR+ T+K+L+L+   GF  + L+ QFL K  
Sbjct  70   VFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT  129

Query  497  PVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLL  676
              RA+++G +C+ FS+CVF APL I++ VI+T+SVE+MP  LS+ LT+SAV+W  YGL L
Sbjct  130  -TRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLAL  188

Query  677  KDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDD--EKRLPQVVLPTVVALEEKQKLPKE  850
            KDI +A PNV+GF  G LQM+LY +YK  K      EK +            E  KLP  
Sbjct  189  KDIYVAFPNVIGFALGALQMILYVVYKYCKTPPHLGEKEV------------EAAKLP--  234

Query  851  LTEEQIVDIVKLGSLICSDKINVAAAA--CCSIQDK  952
               E  +D++KLG++   + I     A  C    D+
Sbjct  235  ---EVTLDMLKLGTVSSPETITAVRQANKCTCGNDR  267



>ref|XP_007050795.1| Medicago truncatula MTN3 [Theobroma cacao]
 gb|EOX94952.1| Medicago truncatula MTN3 [Theobroma cacao]
Length=306

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 180/250 (72%), Gaps = 14/250 (6%)
 Frame = +2

Query  149  FGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS-NATL  325
            FG+LGNI+SF+V+L+PLPTFY+I+KKKS EG+QSIPY VALFS+ML +YYAFLK  +A +
Sbjct  41   FGLLGNILSFLVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLLLYYAFLKKHDAFM  100

Query  326  LITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPVR  505
            LITINS GC +E+IY+  Y+ YA K ARV T K+L+   +   G++ L++ F+F     R
Sbjct  101  LITINSIGCFIESIYLLLYMVYATKSARVYTTKLLIFFNLGALGSIILLT-FIFSKGSSR  159

Query  506  AQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKDI  685
              VVGW+C VFS+CVF APL I++ VI+TK+VE+MP  LS FLT+ AV WF YG  L+D 
Sbjct  160  ISVVGWICAVFSVCVFAAPLSIIRLVIKTKTVEYMPFPLSFFLTLCAVTWFLYGFSLRDY  219

Query  686  NIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKELTEEQ  865
             IA PN+LGFIFGI QM+LY +Y+G ++E         +LP + A   ++ LP+   +EQ
Sbjct  220  YIATPNILGFIFGITQMILYLLYRGGRKEQ--------ILPEIKA---QETLPESKAKEQ  268

Query  866  IVDIVKLGSL  895
              + V+L +L
Sbjct  269  -ANGVQLSTL  277



>ref|XP_006438820.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
 ref|XP_006483041.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Citrus 
sinensis]
 gb|ESR52060.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
Length=305

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 172/233 (74%), Gaps = 2/233 (1%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
             W  AFG+LGNIISF+V+L+P+PTFY+IY+KKS E +QS+PY+VALFSSMLW YYA +K 
Sbjct  9    QWGVAFGILGNIISFLVYLAPVPTFYRIYRKKSTESFQSLPYLVALFSSMLWFYYALVKQ  68

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            NA LL+TIN FGC++ETIYI  +I YA K +R  T+K+ V + +  F  + L++ FL  +
Sbjct  69   NAFLLVTINCFGCVIETIYIILFITYAPKGSRNSTVKLFVSMNVGVFSLILLLTHFL-AT  127

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
               R  ++GW+C+  S+ VF APL IV QVIRTKSVE MP +LS FLT+SA+MWF YGL 
Sbjct  128  DSTRILILGWICVAVSVSVFAAPLSIVAQVIRTKSVEFMPFILSFFLTLSAIMWFAYGLF  187

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYK-GKKQEDDEKRLPQVVLPTVVALEE  829
             KDI +A+PN++GF+ G+ QM+LY +YK   K   +EK+LP+  L ++V L  
Sbjct  188  QKDICVALPNIVGFLLGLTQMLLYVIYKNANKVIIEEKKLPEAQLKSIVVLSN  240



>gb|EMT11081.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=285

 Score =   258 bits (660),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 179/254 (70%), Gaps = 14/254 (6%)
 Frame = +2

Query  116  SMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIY  295
             ++L   W FAFG+LGNIISF   L+P+PTFY+I+K KS EG+QS+PYVVALFS+MLWI+
Sbjct  3    GLSLEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIF  62

Query  296  YAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVS  475
            YA +K+   LLI+IN+ GC++ET+YI  Y+ YA +KA++ T K++VLL + GFG + L++
Sbjct  63   YALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNVAGFGLILLLT  122

Query  476  QFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMW  655
             F F     R   +GW+C+ FS+CVFVAPL I+ +VI+TKSVE+MP  LS+ LT+SAV+W
Sbjct  123  LFAFH-GETRVISLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVVW  181

Query  656  FFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQ  835
            F YGLL+KD  +A+PN+LGF FG++QMVLY  Y                 P V  L+E +
Sbjct  182  FLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNAT-------------PVVSDLKEGK  228

Query  836  KLPKELTEEQIVDI  877
            +  K   EE +V I
Sbjct  229  EGLKMSAEEHVVVI  242



>gb|EMT20808.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=290

 Score =   258 bits (660),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 184/269 (68%), Gaps = 27/269 (10%)
 Frame = +2

Query  71   LGGL*IR*SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQS  250
            +GGL    S  HP         W FAFG+LGN+ISF   L+P+PTFY+I+K KS EG+QS
Sbjct  1    MGGL----SMEHP---------WAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQS  47

Query  251  IPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKML  430
            +PYVVALFS+MLWI+YA +K+   LLI+IN+ GC++ET+YI  Y+ YA++KA++ T K++
Sbjct  48   VPYVVALFSAMLWIFYALVKTGEGLLISINAAGCVIETVYIVMYLVYADRKAKIFTAKIV  107

Query  431  VLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHM  610
            VLL I GFG + L++ F F     R   +GW+C+ FS+CVFVAPL I+ +VI+TKSVE+M
Sbjct  108  VLLNIAGFGLIFLLTLFAFH-GETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYM  166

Query  611  PILLSVFLTVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRL  790
            P  LS+ LT+SA++WF YGLL+KD  +A+PN+LGF FG++QMVLY  Y  K         
Sbjct  167  PFTLSLTLTLSAIVWFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKT--------  218

Query  791  PQVVLPTVVALEEKQKLPKELTEEQIVDI  877
                 P    ++E ++  K   E+ +V I
Sbjct  219  -----PVASQVKEGKEAWKAPAEDHVVVI  242



>ref|XP_008441812.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
melo]
Length=262

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/277 (48%), Positives = 191/277 (69%), Gaps = 18/277 (6%)
 Frame = +2

Query  122  ALSGHWV-FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYY  298
             LS H + F FG+LGNIISF+VFL+P+PTF+ IYKKK++EG+QSIPYVVAL S+ML +YY
Sbjct  3    GLSAHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLLYY  62

Query  299  AFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQ  478
            A LK++A LLI+INSFGC++E IYI  Y++YA KK ++ T+K+ ++  + G   V +   
Sbjct  63   AALKTDAYLLISINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNL-GCSGVMVGGT  121

Query  479  FLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWF  658
             +F     R   VGW+C  F+L VF +PL I+K+VIRTKSVE+MP  LS FLT+SA MWF
Sbjct  122  MVFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVIRTKSVEYMPFFLSFFLTLSATMWF  181

Query  659  FYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQK  838
            FYG  +KD+ IA+PNV+GF+ G++QM++Y +YK +K + +EK            L+E  K
Sbjct  182  FYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDRKGKVEEK------------LDEGAK  229

Query  839  LPKELTEEQIVDIVKLGSLICSDKINVAAAACCSIQD  949
              +E  ++Q + IVK      + +IN+A     +I +
Sbjct  230  FWEE--DDQNLSIVKTQR--ETKEINMAETNHYTIHE  262



>gb|KHN23961.1| Bidirectional sugar transporter SWEET12 [Glycine soja]
Length=309

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 179/246 (73%), Gaps = 11/246 (4%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H  FAFG+LGNI SF+ FL+PLPTFY++ KKKS EG+QSIPYV ALFS+MLWI+YA++K+
Sbjct  5    HLSFAFGILGNIASFVCFLAPLPTFYRVCKKKSTEGFQSIPYVAALFSAMLWIFYAYVKT  64

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
              TLLITIN+FGC++ETIY+  +I Y  KKAR+ T++M+VLL   GF  + L++  L K 
Sbjct  65   GETLLITINAFGCVIETIYLAVFITYCPKKARMSTLRMIVLLNFGGFCTIVLLTHLLAKG  124

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
               R +++GW+C+VF+  VF APL I++ VIRTKSVE +P  LS+ L +SA+MW  YG+ 
Sbjct  125  EEARVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSLLLLISAIMWLLYGIS  184

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQ----------VVLPTVVAL  823
            LKDI + +PNV+G  FG++Q+ LYAMY+  K   D+K LP+          V+ PTV   
Sbjct  185  LKDIYVTLPNVVGLTFGVIQIGLYAMYRNNKPIKDQK-LPEHKGDIVESENVIAPTVNGE  243

Query  824  EEKQKL  841
            +++Q++
Sbjct  244  KQEQEV  249



>ref|XP_011085139.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=262

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 177/249 (71%), Gaps = 3/249 (1%)
 Frame = +2

Query  134  HWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKS  313
            H    FG+LGN++SF+VFL+P+PTFY I+KKKS+EG+QSIPY VA  S+ L +YYAFLK+
Sbjct  8    HLAVLFGLLGNLVSFLVFLAPMPTFYTIWKKKSSEGFQSIPYSVAFLSASLLLYYAFLKT  67

Query  314  NATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKS  493
            NA ++++IN  GC++E IY+  YI YA KKAR+ TIK++VL    G G V LVS   +K 
Sbjct  68   NAYMIVSINGIGCVIEMIYLLIYITYAPKKARMFTIKLVVLFNFGGMGLVMLVSLLAYKG  127

Query  494  APVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLL  673
            +  R  +VGW C +F+L VF APL I+++VIRTKSVE MP  LS FLT+ A MWFFYG  
Sbjct  128  SK-RVSLVGWACAIFNLAVFAAPLSIMRRVIRTKSVEFMPFTLSFFLTLCATMWFFYGFF  186

Query  674  LKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLPQVVLPTVVALEEKQKLPKEL  853
            +KD  IA+PNVLGF+FGI QM+LY +YK  K+E + K + ++     V LE  + + K L
Sbjct  187  VKDYYIALPNVLGFLFGIAQMILYFIYKNAKKEVESKNV-ELETSKDVELETSKDVEKNL  245

Query  854  T-EEQIVDI  877
              ++Q V +
Sbjct  246  ELKDQAVAV  254



>ref|XP_007137872.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
 gb|ESW09866.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
Length=291

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 176/242 (73%), Gaps = 11/242 (5%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FGVLGN+ SF+ FL+PLPTFY++ KKKS EG+QS+PYV ALFS+MLWI+YA++K+  T
Sbjct  8    FLFGVLGNVASFVCFLAPLPTFYRVCKKKSTEGFQSVPYVAALFSAMLWIFYAYVKTGET  67

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            LLITINSFGC++ETIY+  ++ Y  KKAR+ T++M+VL    GF  + L++  L K A  
Sbjct  68   LLITINSFGCVIETIYLAIFLTYCPKKARMSTLRMIVLFNFGGFCTIVLLTHLLAKGAG-  126

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R +++GW+C+VF+  VF APL I++ VIRTKSVE +P  LS+ L +SA+MW  YG+ LKD
Sbjct  127  RVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSMLLLLSAIMWLLYGISLKD  186

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRLP---------QVVLPTVVALEEKQ  835
            I + +PNV+G  FG++Q+VLY MY+  K   +EK LP         + V PTV A  ++Q
Sbjct  187  IYVTLPNVVGLTFGVIQIVLYMMYRNNKTLKNEK-LPEHKGDIDNNENVAPTVSAENQEQ  245

Query  836  KL  841
            ++
Sbjct  246  EV  247



>gb|EMT03611.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=294

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 183/269 (68%), Gaps = 27/269 (10%)
 Frame = +2

Query  71   LGGL*IR*SSRHPDRSMALSGHWVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQS  250
            +GGL    S  HP         W FAFG+LGN+ISF   L+P+PTFY+I+K KS EG+QS
Sbjct  1    MGGL----SMEHP---------WAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQS  47

Query  251  IPYVVALFSSMLWIYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKML  430
            +PYVVALFS+MLWI+YA +K+   LLI+IN+ GC++ET+YI  Y+ YA +KA++ T K++
Sbjct  48   VPYVVALFSAMLWIFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIV  107

Query  431  VLLVIVGFGAVALVSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHM  610
            VLL I GFG + L++ F F     R   +GW+C+ FS+CVFVAPL I+ +VI+TKSVE+M
Sbjct  108  VLLNIAGFGLIFLLTLFAFHGE-TRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYM  166

Query  611  PILLSVFLTVSAVMWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGKKQEDDEKRL  790
            P  LS+ LT+SA++WF YGLL+KD  +A+PN+LGF FG++QMVLY  Y  K         
Sbjct  167  PFTLSLTLTLSAIVWFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKT--------  218

Query  791  PQVVLPTVVALEEKQKLPKELTEEQIVDI  877
                 P    ++E ++  K   E+ +V I
Sbjct  219  -----PMASQVKEGKEAWKAPAEDHVVVI  242



>ref|XP_010027258.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=294

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/294 (48%), Positives = 185/294 (63%), Gaps = 32/294 (11%)
 Frame = +2

Query  119  MALSGH---WVFAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLW  289
            MA   H   W   FG+LGNI+SF VFL+P PTFY+IYK+KS EG+QSIPY+VALFSSMLW
Sbjct  1    MAFFDHHHFWTLTFGILGNIVSFFVFLAPAPTFYRIYKEKSTEGFQSIPYLVALFSSMLW  60

Query  290  IYYAFLKSNATLLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVAL  469
            +YYAFLK ++ LLITINSFGC++E +YI  YI YA + AR  TIK+  L+ +  F  + L
Sbjct  61   LYYAFLKGHSFLLITINSFGCVIEMVYIAIYIAYALRAARSSTIKLFALMNVGLFSLLIL  120

Query  470  VSQFLFKSAPVRAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAV  649
            +  F+  +   R  V GW+C   S+ VF APL IV +V+RTKSVE MP  LS FLT+SA+
Sbjct  121  IIHFI-PNGDARTTVFGWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAI  179

Query  650  MWFFYGLLLKDINIAVPNVLGFIFGILQMVLYAMYKGK-----KQEDDEKRLPQ------  796
            MWF YG   KD  I +PN++GF+ G+ QMVLY  Y+ K     K E  +++LPQ      
Sbjct  180  MWFGYGFFQKDWCIMIPNIVGFVLGLSQMVLYGYYRNKGVIIIKDEIMDEKLPQHVVHPT  239

Query  797  -----VVLPTVVAL-----------EEKQKLPKELTEEQIVDIVKLGSLICSDK  910
                 VV P  V +           +E+Q  P +L E   V++V  G+   SD+
Sbjct  240  SGRASVVHPVTVEISLPINGGEARADEQQPQPSQLPEGA-VEVVVSGNDPGSDQ  292



>ref|XP_008340254.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
 ref|XP_008353052.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 167/223 (75%), Gaps = 4/223 (2%)
 Frame = +2

Query  143  FAFGVLGNIISFIVFLSPLPTFYQIYKKKSAEGYQSIPYVVALFSSMLWIYYAFLKSNAT  322
            F FG+LGN+IS +V+LSP+PTFY+IY+KKS EG+ S+PY+VALFSSMLW+YYA +K NA 
Sbjct  13   FTFGILGNLISTMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSMLWLYYALVKKNAM  72

Query  323  LLITINSFGCLVETIYIGFYIYYANKKARVQTIKMLVLLVIVGFGAVALVSQFLFKSAPV  502
            +LITINSFG  VE IYI  +  YA K+AR  T+K+  ++ +  F  + +VS FL  SA  
Sbjct  73   MLITINSFGSFVEIIYIVMFXVYAPKEARKLTVKLFGIMNVGLFTMILVVSHFLVGSA-Y  131

Query  503  RAQVVGWVCLVFSLCVFVAPLCIVKQVIRTKSVEHMPILLSVFLTVSAVMWFFYGLLLKD  682
            R  ++GW+ +  S  VFVAPL IV QVIRT+SVE MP  LS FLT+SAV+WF YG LLKD
Sbjct  132  RVPILGWINVAISTSVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSAVIWFAYGYLLKD  191

Query  683  INIAVPNVLGFIFGILQMVLYAMYKGKKQ---EDDEKRLPQVV  802
            I +A+PN LGF+ G+LQM+LY +Y+ ++Q   +D EK+LP  +
Sbjct  192  ICVAIPNFLGFVLGLLQMLLYGIYRNREQVIIDDHEKKLPGAI  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3699094222096