BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14194_g1_i1 len=569 path=[547:0-242 1183:243-247 795:248-253
801:254-568]

Length=569
                                                                      Score     E

emb|CDP18430.1|  unnamed protein product                              64.7    2e-10   
ref|XP_009616521.1|  PREDICTED: uncharacterized protein LOC104109046  63.2    1e-09   
ref|XP_009765312.1|  PREDICTED: uncharacterized protein LOC104216873  62.8    1e-09   
ref|XP_009768060.1|  PREDICTED: uncharacterized protein LOC104219128  62.8    1e-09   
ref|XP_006356625.1|  PREDICTED: uncharacterized protein LOC102584537  61.2    4e-09   
ref|XP_011081864.1|  PREDICTED: uncharacterized protein LOC105164790  53.1    3e-06   
gb|EPS58607.1|  hypothetical protein M569_16206                       49.3    7e-05   



>emb|CDP18430.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = +1

Query  133  MLSQDVVGDDAVYACLGGCYNKCFILSKQPPFETLVCFFKCFLTDCVSSGPPPANFVDSC  312
            ML+Q+  G  + YAC GGCYN CF+LS +P  E   C+F C L  C       +     C
Sbjct  1    MLAQNATGQ-STYACWGGCYNVCFLLSSRPIVERYPCYFNC-LASCFPQSALESQLY-YC  57

Query  313  GVGCSMEFCPLQSLDEATLGQCIGSCGDMCE  405
             VGCS + C LQ  D +   +C G CGD C+
Sbjct  58   HVGCSAQRC-LQIKDASAREKCFGGCGDACK  87



>ref|XP_009616521.1| PREDICTED: uncharacterized protein LOC104109046 [Nicotiana tomentosiformis]
Length=110

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = +1

Query  97   LVVLMTVSLGMVMLSQDV--VGDDAVYACLGGCYNKCFILSKQP---PFETLVCFFKCFL  261
            + V +T+ + ++++ +++  V  D+ YAC GGCYN+C ILS Q    P     C+ +C L
Sbjct  4    ISVFVTLFIVLIVVGKEMHNVSADSPYACWGGCYNQCIILSFQAGTIPNNNNPCYVQC-L  62

Query  262  TDCVSSGPPPANFVDSCGVGCSMEFC-PLQSLDEATLGQCIGSCGDMCE  405
            + C+      A + + C +GCS+E C P +S   A L +C G+CG++C 
Sbjct  63   SKCIPRS--AAEYQNYCKIGCSLELCVPTRSDAGADLDKCFGNCGNVCR  109



>ref|XP_009765312.1| PREDICTED: uncharacterized protein LOC104216873 [Nicotiana sylvestris]
Length=101

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = +1

Query  136  LSQDVVGDDAVYACLGGCYNKCFILSKQ-PPFETLVCFFKCFLTDCVSSGPPPANFVDSC  312
            +  +VV    +Y+C GGCYN CF+L K     ++  C+F C L +C +S     +F   C
Sbjct  1    MEDEVVTSSKMYSCWGGCYNNCFLLQKNDDSAQSFQCYFNC-LNNCTTS-SSALDFQSVC  58

Query  313  GVGCSMEFCPLQSLDEATLGQCIGSCGDMCELLKSLGTTQ  432
              GC +E C   S   A +G C+GSC ++C+   +    Q
Sbjct  59   RGGCYLEMCIPLSFVGANVGDCLGSCTNLCKFFSNFTKMQ  98



>ref|XP_009768060.1| PREDICTED: uncharacterized protein LOC104219128 [Nicotiana sylvestris]
Length=110

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 62/109 (57%), Gaps = 9/109 (8%)
 Frame = +1

Query  97   LVVLMTVSLGMVMLSQDV--VGDDAVYACLGGCYNKCFILSKQP---PFETLVCFFKCFL  261
            + V +T+ + ++++ + V  V  D  YAC GGCYN+C ILS Q    P     C+ +C L
Sbjct  4    ISVFVTLLIVLIVVGKQVHNVSADNPYACWGGCYNQCIILSFQAGVTPNSNNPCYVQC-L  62

Query  262  TDCVSSGPPPANFVDSCGVGCSMEFC-PLQSLDEATLGQCIGSCGDMCE  405
            + C+      A + + C +GCS+E C P +S   A L +C G+CG++C 
Sbjct  63   SKCIPRS--AAEYQNYCKIGCSLELCVPTRSDAGADLDKCFGNCGNVCR  109



>ref|XP_006356625.1| PREDICTED: uncharacterized protein LOC102584537 [Solanum tuberosum]
Length=110

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 62/111 (56%), Gaps = 8/111 (7%)
 Frame = +1

Query  91   RFLVVLMTVSLGMVMLSQD--VVGDDAVYACLGGCYNKCFILSKQP--PFETLVCFFKCF  258
            R   + ++V + + ++  +  +V  D+ YAC GGCYNKC +L+ +   P     C+ KC 
Sbjct  3    RITSIFVSVLIVLFVVGNEMYIVNGDSPYACWGGCYNKCILLTMKSRIPSGNDPCYVKC-  61

Query  259  LTDCVSSGPPPANFVDSCGVGCSMEFC-PLQSLDEATLGQCIGSCGDMCEL  408
            L+ C+ +    + + D C +GCS+E C P++    A L  C GSCG +C +
Sbjct  62   LSKCIPTS--ASEYRDYCTIGCSLELCVPIRFDAGADLDACYGSCGSICRV  110



>ref|XP_011081864.1| PREDICTED: uncharacterized protein LOC105164790 [Sesamum indicum]
Length=107

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (52%), Gaps = 3/83 (4%)
 Frame = +1

Query  157  DDAVYACLGGCYNKCFILSKQPPFETLVCFFKCFLTDCVSSGPPPANFVDSCGVGCSMEF  336
            +  +Y C GGCYN CF+ S       L C++ C L+ C       + F   C +GCS+E 
Sbjct  27   NAQLYTCWGGCYNVCFLRSNGTSPVGLPCYYPC-LSSCNRGSASDSQFY--CQIGCSLER  83

Query  337  CPLQSLDEATLGQCIGSCGDMCE  405
            C   S D A L  C+GSC  +C+
Sbjct  84   CDPVSNDGARLENCLGSCTKLCK  106



>gb|EPS58607.1| hypothetical protein M569_16206 [Genlisea aurea]
Length=105

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 49/104 (47%), Gaps = 7/104 (7%)
 Frame = +1

Query  106  LMTVSLGMVMLSQDVVGDDAVYACLGGCYNKCFILSKQPPFETLVCFFKCFLTDCVSSGP  285
            +  + L +V ++  +  +   Y C GGCYN C   +     E L C+++C    C+    
Sbjct  6    VTAILLAVVAMAAGI--EAQRYTCWGGCYNVCIGGNNNNNPEGLSCYYRCLSRQCIPR--  61

Query  286  PPANFVDSCGVGCSMEFCPL---QSLDEATLGQCIGSCGDMCEL  408
               +F   C VGCS++ C +    S D   L QC+  C + C++
Sbjct  62   TATDFEYYCQVGCSLQTCAVLRSSSEDGGRLEQCLDGCNNQCKI  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 619402163716