BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14192_g2_i1 len=228 path=[4895:0-46 2492:47-87 5152:88-227]

Length=228
                                                                      Score     E

ref|XP_010313870.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    147   1e-40   
ref|XP_010313871.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    147   1e-40   
ref|XP_009782873.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    144   1e-39   
ref|XP_006357421.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    143   3e-39   
ref|XP_006350132.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    140   9e-39   
ref|XP_004253034.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    141   1e-38   
ref|XP_006342426.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    141   1e-38   
ref|XP_004251811.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    141   1e-38   
ref|XP_009597549.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    141   1e-38   
sp|Q9SLN8.1|DBR_TOBAC  RecName: Full=2-alkenal reductase (NADP(+)...    141   1e-38   Nicotiana tabacum [American tobacco]
emb|CDP08098.1|  unnamed protein product                                140   2e-38   
pdb|4HFJ|A  Chain A, X-ray Crystal Structure Of A Double Bond Red...    141   2e-38   
ref|XP_006350022.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    140   3e-38   
emb|CDP08100.1|  unnamed protein product                                139   5e-38   
ref|XP_009768371.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    139   6e-38   
ref|XP_004251810.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    139   8e-38   
ref|XP_004241896.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    139   1e-37   
ref|XP_009623211.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    138   1e-37   
gb|EYU36665.1|  hypothetical protein MIMGU_mgv1a009305mg                137   3e-37   
ref|XP_006348069.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    137   3e-37   
gb|ADO51748.1|  alcohol dehydrogenase                                   136   1e-36   
gb|EMT18936.1|  Putative NADP-dependent oxidoreductase P1               135   2e-36   
ref|XP_004287172.1|  PREDICTED: NADP-dependent alkenal double bon...    134   5e-36   
ref|XP_003578766.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    134   5e-36   
ref|XP_002279359.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    134   5e-36   Vitis vinifera
ref|XP_004287173.1|  PREDICTED: NADP-dependent alkenal double bon...    134   8e-36   
gb|EYU36663.1|  hypothetical protein MIMGU_mgv1a009314mg                134   8e-36   
ref|XP_010242458.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    133   8e-36   
ref|XP_010242459.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    133   8e-36   
ref|XP_011085049.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    134   9e-36   
ref|XP_011085050.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    133   1e-35   
ref|XP_007204694.1|  hypothetical protein PRUPE_ppa008180mg             133   2e-35   
gb|EMS46550.1|  putative NADP-dependent oxidoreductase P1               133   2e-35   
ref|XP_004287171.1|  PREDICTED: NADP-dependent alkenal double bon...    132   3e-35   
ref|XP_010070436.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    132   5e-35   
gb|EMT18937.1|  Putative NADP-dependent oxidoreductase P1               132   6e-35   
gb|EPS68795.1|  hypothetical protein M569_05969                         132   6e-35   
ref|XP_008813783.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    131   6e-35   
ref|XP_009121423.1|  PREDICTED: NADP-dependent alkenal double bon...    131   1e-34   
gb|KDO46203.1|  hypothetical protein CISIN_1g0244112mg                  129   1e-34   
emb|CDY16966.1|  BnaC09g40930D                                          130   1e-34   
ref|XP_006478545.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    130   2e-34   
gb|KDP35121.1|  hypothetical protein JCGZ_10655                         130   3e-34   
ref|XP_008243059.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    130   3e-34   
ref|XP_008383998.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    128   3e-34   
ref|XP_010672488.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    130   3e-34   
ref|XP_004287175.1|  PREDICTED: NADP-dependent alkenal double bon...    130   3e-34   
gb|KDO46217.1|  hypothetical protein CISIN_1g024337mg                   128   4e-34   
ref|XP_010251400.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    129   4e-34   
ref|XP_006494862.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    129   5e-34   
ref|XP_010912750.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    132   5e-34   
ref|XP_006494861.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    129   5e-34   
ref|XP_010065844.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    129   5e-34   
emb|CDP08093.1|  unnamed protein product                                129   6e-34   
ref|XP_006858752.1|  hypothetical protein AMTR_s00066p00137430          129   6e-34   
gb|KCW87980.1|  hypothetical protein EUGRSUZ_A00388                     129   6e-34   
gb|AFW56665.1|  putative alcohol dehydrogenase superfamily protein      129   7e-34   
ref|XP_006478549.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    128   8e-34   
ref|NP_001152093.1|  NADP-dependent oxidoreductase P2                   129   8e-34   Zea mays [maize]
ref|NP_197199.1|  2-alkenal reductase                                   128   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010041719.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   9e-34   
ref|XP_010070430.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    128   9e-34   
gb|KCW46083.1|  hypothetical protein EUGRSUZ_L00056                     128   1e-33   
ref|XP_009131573.1|  PREDICTED: NADP-dependent alkenal double bon...    128   1e-33   
ref|XP_006400239.1|  hypothetical protein EUTSA_v10013973mg             128   1e-33   
gb|KFK25923.1|  hypothetical protein AALP_AA8G181000                    128   1e-33   
gb|EMS60009.1|  putative NADP-dependent oxidoreductase P1               128   1e-33   
emb|CDP08119.1|  unnamed protein product                                127   2e-33   
gb|KDO41274.1|  hypothetical protein CISIN_1g026217mg                   125   2e-33   
ref|XP_010042961.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    126   2e-33   
ref|XP_002529818.1|  alcohol dehydrogenase, putative                    127   2e-33   Ricinus communis
ref|XP_010039349.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    128   2e-33   
gb|AEL78825.1|  ketone/zingerone synthase 1                             127   2e-33   
gb|EYU34270.1|  hypothetical protein MIMGU_mgv1a020420mg                127   2e-33   
ref|XP_010070429.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   2e-33   
ref|XP_004287168.1|  PREDICTED: NADP-dependent alkenal double bon...    127   2e-33   
ref|XP_006478548.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   2e-33   
ref|XP_010070435.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   2e-33   
ref|XP_010070439.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   3e-33   
ref|XP_004288354.1|  PREDICTED: NADP-dependent alkenal double bon...    127   3e-33   
gb|KCW59223.1|  hypothetical protein EUGRSUZ_H01882                     127   3e-33   
gb|KDO41286.1|  hypothetical protein CISIN_1g019042mg                   127   3e-33   
gb|KDO41273.1|  hypothetical protein CISIN_1g026217mg                   125   3e-33   
ref|XP_008813781.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   3e-33   
gb|KDO41285.1|  hypothetical protein CISIN_1g037444mg                   127   3e-33   
ref|XP_006478547.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   3e-33   
ref|XP_004960754.1|  PREDICTED: NADP-dependent alkenal double bon...    127   3e-33   
gb|KCW59215.1|  hypothetical protein EUGRSUZ_H01876                     127   4e-33   
emb|CDP08094.1|  unnamed protein product                                127   4e-33   
gb|KCW59218.1|  hypothetical protein EUGRSUZ_H01878                     127   4e-33   
ref|XP_009366246.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   4e-33   
emb|CDX78721.1|  BnaA03g06330D                                          127   4e-33   
ref|XP_010070431.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    127   4e-33   
ref|XP_010463754.1|  PREDICTED: NADP-dependent alkenal double bon...    127   4e-33   
ref|XP_007202332.1|  hypothetical protein PRUPE_ppa008142mg             126   5e-33   
ref|XP_003578761.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    126   5e-33   
gb|KDP35123.1|  hypothetical protein JCGZ_10657                         126   5e-33   
ref|XP_010238601.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    125   6e-33   
gb|KCW87979.1|  hypothetical protein EUGRSUZ_A00387                     123   6e-33   
ref|XP_008362858.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    126   6e-33   
ref|XP_008354322.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    126   6e-33   
ref|XP_006350018.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    126   6e-33   
ref|XP_008383990.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    126   7e-33   
ref|XP_008343893.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    126   7e-33   
gb|ACN65116.1|  2-alkenal reductase                                     126   7e-33   Artemisia annua [sweet Annie]
ref|XP_010242452.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    126   8e-33   
gb|KDP33137.1|  hypothetical protein JCGZ_13529                         125   8e-33   
ref|XP_006288102.1|  hypothetical protein CARUB_v10001335mg             125   9e-33   
gb|EYU17593.1|  hypothetical protein MIMGU_mgv1a020294mg                125   9e-33   
ref|XP_004157322.1|  PREDICTED: NADP-dependent alkenal double bon...    126   9e-33   
ref|XP_009366241.1|  PREDICTED: LOW QUALITY PROTEIN: 2-alkenal re...    125   1e-32   
ref|XP_004143773.1|  PREDICTED: LOW QUALITY PROTEIN: NADP-depende...    125   1e-32   
pdb|2J3H|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Do...    125   1e-32   
gb|KFK25924.1|  hypothetical protein AALP_AA8G181100                    125   1e-32   
gb|KGN51156.1|  hypothetical protein Csa_5G468980                       125   1e-32   
ref|XP_006300073.1|  hypothetical protein CARUB_v10016301mg             125   1e-32   
ref|XP_008243058.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    125   1e-32   
ref|XP_007203000.1|  hypothetical protein PRUPE_ppa017182mg             125   1e-32   
gb|KCW46084.1|  hypothetical protein EUGRSUZ_L00058                     125   2e-32   
ref|NP_001066432.1|  Os12g0226700                                       125   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008383944.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    125   2e-32   
gb|AAM53276.1|  quinone oxidoreductase-like protein                     125   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197200.2|  zinc-binding dehydrogenase family protein             122   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663915.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    125   2e-32   
ref|XP_010039351.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   2e-32   
ref|XP_010420405.1|  PREDICTED: NADP-dependent alkenal double bon...    125   2e-32   
gb|KDO41284.1|  hypothetical protein CISIN_1g019332mg                   125   2e-32   
ref|XP_010485644.1|  PREDICTED: NADP-dependent alkenal double bon...    125   2e-32   
ref|XP_010453874.1|  PREDICTED: NADP-dependent alkenal double bon...    124   3e-32   
ref|XP_008343886.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    125   3e-32   
ref|XP_008383957.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    125   3e-32   
gb|AAX99161.1|  2-alkenal reductase                                     124   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007033622.1|  Zinc-binding dehydrogenase family protein is...    120   3e-32   
ref|XP_009366242.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    125   3e-32   
ref|XP_006372685.1|  hypothetical protein POPTR_0017s03860g             124   3e-32   
gb|EYU17597.1|  hypothetical protein MIMGU_mgv1a019756mg                123   3e-32   
ref|XP_010039347.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   3e-32   
ref|XP_002443063.1|  hypothetical protein SORBIDRAFT_08g007270          124   3e-32   Sorghum bicolor [broomcorn]
ref|XP_002275595.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   3e-32   Vitis vinifera
dbj|BAJ87887.1|  predicted protein                                      124   3e-32   
gb|EAY82645.1|  hypothetical protein OsI_37864                          122   3e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_002873802.1|  hypothetical protein ARALYDRAFT_909686             124   3e-32   
ref|XP_002873801.1|  AT-AER                                             124   3e-32   
ref|XP_006372331.1|  hypothetical protein POPTR_0017s006402g            120   3e-32   
gb|KDP35119.1|  hypothetical protein JCGZ_10653                         124   3e-32   
ref|XP_006494867.1|  PREDICTED: NADP-dependent alkenal double bon...    120   3e-32   
ref|XP_002309725.1|  hypothetical protein POPTR_0007s00690g             124   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011047622.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   3e-32   
ref|XP_010506197.1|  PREDICTED: NADP-dependent alkenal double bon...    124   4e-32   
emb|CAC01711.1|  quinone oxidoreductase-like protein                    124   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039350.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   4e-32   
gb|EMT31634.1|  Putative NADP-dependent oxidoreductase P1               121   4e-32   
ref|XP_010046552.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    121   4e-32   
ref|XP_006415911.1|  hypothetical protein EUTSA_v10009666mg             124   4e-32   
ref|XP_010069210.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   4e-32   
ref|XP_008465751.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   4e-32   
ref|NP_001190322.1|  zinc-binding dehydrogenase family protein          123   4e-32   
gb|KCW59210.1|  hypothetical protein EUGRSUZ_H01871                     124   5e-32   
emb|CDP08092.1|  unnamed protein product                                124   5e-32   
gb|EEC69038.1|  hypothetical protein OsI_37853                          125   5e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_004960755.1|  PREDICTED: NADP-dependent alkenal double bon...    124   5e-32   
dbj|BAJ88221.1|  predicted protein                                      120   5e-32   
ref|XP_007033621.1|  Zinc-binding dehydrogenase family protein is...    124   5e-32   
ref|XP_011004573.1|  PREDICTED: NADP-dependent alkenal double bon...    124   5e-32   
ref|XP_009401137.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   5e-32   
emb|CDP08118.1|  unnamed protein product                                124   5e-32   
ref|XP_008455239.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   5e-32   
ref|XP_006350133.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   5e-32   
ref|XP_006663914.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   5e-32   
ref|XP_003578764.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   5e-32   
ref|XP_008243061.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   5e-32   
gb|KDO37346.1|  hypothetical protein CISIN_1g018404mg                   124   6e-32   
gb|KCW45036.1|  hypothetical protein EUGRSUZ_L01373                     120   6e-32   
ref|NP_001066433.1|  Os12g0226900                                       123   6e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDX70729.1|  BnaC03g08130D                                          124   7e-32   
ref|XP_010070438.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   7e-32   
ref|XP_008455240.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   7e-32   
ref|XP_010070437.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   8e-32   
ref|NP_197202.2|  zinc-binding dehydrogenase family protein             123   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011004565.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   8e-32   
gb|AAL38796.1|  putative quinone oxidoreductase                         123   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006478544.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   8e-32   
ref|XP_011073997.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   8e-32   
ref|XP_011073998.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   8e-32   
ref|XP_010672489.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   1e-31   
ref|XP_010101346.1|  NADP-dependent alkenal double bond reductase P1    123   1e-31   
ref|XP_011047623.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   1e-31   
ref|XP_006858754.1|  hypothetical protein AMTR_s00066p00139190          122   1e-31   
ref|XP_006645151.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    123   1e-31   
emb|CAA89262.1|  zeta-crystallin homologue                              122   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008343890.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    122   1e-31   
ref|XP_008343891.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    122   1e-31   
ref|XP_010549823.1|  PREDICTED: NADP-dependent alkenal double bon...    122   1e-31   
ref|NP_197201.1|  zinc-binding dehydrogenase family protein             122   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63201.1|  quinone oxidoreductase-like protein                     122   2e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08122.1|  unnamed protein product                                122   2e-31   
gb|EYU34265.1|  hypothetical protein MIMGU_mgv1a024393mg                122   2e-31   
gb|EMS56753.1|  putative NADP-dependent oxidoreductase P1               119   2e-31   
gb|ABA96822.1|  NADP-dependent oxidoreductase P1, putative, expre...    122   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|KCW59214.1|  hypothetical protein EUGRSUZ_H01875                     121   2e-31   
ref|XP_004137045.1|  PREDICTED: NADP-dependent alkenal double bon...    122   2e-31   
ref|XP_010453876.1|  PREDICTED: NADP-dependent alkenal double bon...    122   2e-31   
ref|XP_002309722.1|  NADP-dependent oxidoreductase family protein       122   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002529812.1|  alcohol dehydrogenase, putative                    122   2e-31   Ricinus communis
gb|EAY82640.1|  hypothetical protein OsI_37858                          121   2e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_006372688.1|  hypothetical protein POPTR_0017s03890g             122   2e-31   
ref|XP_002893408.1|  hypothetical protein ARALYDRAFT_472786             122   2e-31   
gb|KDO37817.1|  hypothetical protein CISIN_1g041355mg                   118   2e-31   
ref|XP_010549822.1|  PREDICTED: NADP-dependent alkenal double bon...    122   3e-31   
gb|KCW57493.1|  hypothetical protein EUGRSUZ_H00260                     120   3e-31   
ref|XP_004155455.1|  PREDICTED: NADP-dependent alkenal double bon...    122   3e-31   
ref|XP_002873803.1|  hypothetical protein ARALYDRAFT_909687             122   3e-31   
ref|XP_006372677.1|  hypothetical protein POPTR_0017s03780g             122   3e-31   
ref|XP_007134338.1|  hypothetical protein PHAVU_010G039100g             122   3e-31   
ref|XP_008227256.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    122   3e-31   
gb|AEL78826.1|  ketone/zingerone synthase 2                             122   3e-31   
ref|XP_006289583.1|  hypothetical protein CARUB_v10003133mg             121   3e-31   
gb|EMT16695.1|  Putative NADP-dependent oxidoreductase P1               121   3e-31   
ref|XP_008227255.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    121   3e-31   
gb|EYU17610.1|  hypothetical protein MIMGU_mgv1a024608mg                121   4e-31   
emb|CDY43153.1|  BnaA05g32330D                                          121   4e-31   
ref|XP_003557079.2|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    117   4e-31   
ref|XP_009130330.1|  PREDICTED: NADP-dependent alkenal double bon...    121   4e-31   
ref|XP_010232677.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    124   4e-31   
ref|XP_007134335.1|  hypothetical protein PHAVU_010G038800g             121   4e-31   
ref|XP_010069219.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    121   4e-31   
emb|CDY28735.1|  BnaCnng06210D                                          121   4e-31   
ref|XP_006372675.1|  hypothetical protein POPTR_0017s03750g             120   4e-31   
ref|XP_010026377.1|  PREDICTED: uncharacterized protein LOC104416725    124   4e-31   
gb|KCW59220.1|  hypothetical protein EUGRSUZ_H01880                     121   4e-31   
gb|KHG22546.1|  NADP-dependent alkenal double bond reductase P2 -...    121   5e-31   
ref|XP_010069218.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    121   5e-31   
ref|XP_010070440.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    121   5e-31   
ref|XP_010460322.1|  PREDICTED: NADP-dependent alkenal double bon...    120   5e-31   
gb|KCW87983.1|  hypothetical protein EUGRSUZ_A00392                     120   5e-31   
ref|XP_006372668.1|  hypothetical protein POPTR_0017s03680g             121   6e-31   
emb|CBI24733.3|  unnamed protein product                                121   6e-31   
ref|NP_001185098.1|  zinc-binding dehydrogenase family protein          120   6e-31   
ref|XP_004287170.1|  PREDICTED: NADP-dependent alkenal double bon...    120   7e-31   
gb|AAX83111.1|  alcohol dehydrogenase-like protein                      120   7e-31   Ocimum basilicum [basil]
ref|XP_010420406.1|  PREDICTED: NADP-dependent alkenal double bon...    120   7e-31   
ref|XP_010492631.1|  PREDICTED: NADP-dependent alkenal double bon...    121   7e-31   
ref|XP_010460323.1|  PREDICTED: NADP-dependent alkenal double bon...    120   8e-31   
ref|XP_010492633.1|  PREDICTED: NADP-dependent alkenal double bon...    120   8e-31   
gb|AAM65612.1|  allyl alcohol dehydrogenase, putative                   120   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173956.1|  zinc-binding dehydrogenase family protein             120   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455241.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    120   8e-31   
ref|XP_010070434.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    120   8e-31   
gb|KDP29827.1|  hypothetical protein JCGZ_19313                         120   8e-31   
ref|NP_186958.1|  zinc-binding dehydrogenase family protein             120   8e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AJD09821.1|  NADPH-dependent double-bond reductase 1                 120   8e-31   
ref|XP_006858756.1|  hypothetical protein AMTR_s00066p00140840          120   8e-31   
ref|XP_010477868.1|  PREDICTED: NADP-dependent alkenal double bon...    120   9e-31   
gb|KCW57494.1|  hypothetical protein EUGRSUZ_H00260                     118   9e-31   
ref|XP_007134340.1|  hypothetical protein PHAVU_010G039300g             120   9e-31   
ref|XP_010492630.1|  PREDICTED: NADP-dependent alkenal double bon...    120   9e-31   
ref|XP_010109848.1|  NADP-dependent alkenal double bond reductase P2    120   9e-31   
ref|XP_006372296.1|  hypothetical protein POPTR_0017s00310g             120   1e-30   
gb|ACU24585.1|  unknown                                                 120   1e-30   Glycine max [soybeans]
ref|NP_001276182.1|  2-alkenal reductase (NADP(+)-dependent)-like       120   1e-30   
ref|XP_007202307.1|  hypothetical protein PRUPE_ppa008021mg             120   1e-30   
ref|XP_004250672.2|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    120   1e-30   
dbj|BAK01653.1|  predicted protein                                      120   1e-30   
ref|XP_010070432.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    120   1e-30   
gb|KHN30864.1|  NADP-dependent alkenal double bond reductase P1         119   1e-30   
ref|XP_003521022.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    120   1e-30   
ref|XP_002529813.1|  alcohol dehydrogenase, putative                    120   1e-30   Ricinus communis
ref|XP_010912752.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    120   2e-30   
ref|NP_198614.1|  zinc-binding dehydrogenase family protein             120   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002529814.1|  alcohol dehydrogenase, putative                    118   2e-30   Ricinus communis
ref|XP_011005275.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    120   2e-30   
ref|XP_010070442.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    120   2e-30   
gb|EAY82641.1|  hypothetical protein OsI_37859                          119   2e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010070441.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    119   2e-30   
ref|XP_004508692.1|  PREDICTED: NADP-dependent alkenal double bon...    119   2e-30   
ref|XP_006372342.1|  hypothetical protein POPTR_0017s00690g             119   2e-30   
ref|XP_010525046.1|  PREDICTED: NADP-dependent alkenal double bon...    119   2e-30   
gb|KDO41283.1|  hypothetical protein CISIN_1g019291mg                   119   3e-30   
ref|XP_002309720.1|  hypothetical protein POPTR_0007s00550g             119   3e-30   Populus trichocarpa [western balsam poplar]
gb|KDP44165.1|  hypothetical protein JCGZ_05632                         119   3e-30   
ref|XP_010524194.1|  PREDICTED: NADP-dependent alkenal double bon...    119   3e-30   
gb|AJD09822.1|  NADPH-dependent double-bond reductase 2                 119   3e-30   
ref|XP_007134328.1|  hypothetical protein PHAVU_010G038200g             119   3e-30   
emb|CDP08120.1|  unnamed protein product                                118   3e-30   
gb|KEH18005.1|  NADP-dependent alkenal double bond reductase            119   3e-30   
ref|XP_006478546.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    119   3e-30   
pdb|4MKR|A  Chain A, Structure Of The Apo Form Of A Zingiber Offi...    119   3e-30   
ref|NP_001045054.1|  Os01g0891300                                       119   4e-30   
gb|EAZ14448.1|  hypothetical protein OsJ_04369                          119   4e-30   
gb|EEC71937.1|  hypothetical protein OsI_04748                          119   4e-30   
ref|XP_008367739.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    119   4e-30   
ref|XP_006305903.1|  hypothetical protein CARUB_v10011078mg             119   4e-30   
gb|KHN22955.1|  NADP-dependent alkenal double bond reductase P1         116   4e-30   
gb|KHG17757.1|  NADP-dependent alkenal double bond reductase P1 -...    117   5e-30   
ref|XP_007202267.1|  hypothetical protein PRUPE_ppa007810mg             118   5e-30   
ref|XP_002884357.1|  predicted protein                                  118   5e-30   
gb|KEH18025.1|  NADP-dependent alkenal double bond reductase            118   5e-30   
ref|XP_006408345.1|  hypothetical protein EUTSA_v10022339mg             118   5e-30   
gb|KHG11648.1|  NADP-dependent alkenal double bond reductase P1 -...    118   6e-30   
emb|CDX85014.1|  BnaC05g20410D                                          118   6e-30   
emb|CDP04138.1|  unnamed protein product                                118   6e-30   
gb|KCW59221.1|  hypothetical protein EUGRSUZ_H018812                    113   6e-30   
emb|CDY16150.1|  BnaA09g28840D                                          118   7e-30   
ref|XP_002309721.1|  hypothetical protein POPTR_0007s00560g             118   7e-30   
emb|CDM85416.1|  unnamed protein product                                118   7e-30   
gb|AAM61308.1|  quinone oxidoreductase-like protein                     118   7e-30   
ref|XP_004155457.1|  PREDICTED: NADP-dependent alkenal double bon...    118   7e-30   
ref|XP_011005274.1|  PREDICTED: NADP-dependent alkenal double bon...    118   7e-30   
ref|XP_009115352.1|  PREDICTED: NADP-dependent alkenal double bon...    118   7e-30   
gb|AGW81515.1|  double bond reductase                                   118   8e-30   
ref|XP_007033657.1|  Alkenal reductase, putative                        118   8e-30   
ref|XP_010453873.1|  PREDICTED: NADP-dependent alkenal double bon...    118   8e-30   
ref|XP_004510178.1|  PREDICTED: NADP-dependent alkenal double bon...    117   9e-30   
gb|KGN43686.1|  hypothetical protein Csa_7G058600                       117   9e-30   
ref|XP_002870881.1|  hypothetical protein ARALYDRAFT_494182             117   1e-29   
ref|XP_010242451.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    117   1e-29   
gb|ABK26403.1|  unknown                                                 117   1e-29   
gb|ACF82269.1|  unknown                                                 115   1e-29   
gb|AFK41083.1|  unknown                                                 117   1e-29   
ref|XP_010650738.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    117   1e-29   
ref|XP_007033632.1|  Zinc-binding dehydrogenase family protein          120   1e-29   
ref|XP_006494874.1|  PREDICTED: NADP-dependent alkenal double bon...    113   1e-29   
gb|EMS46983.1|  putative NADP-dependent oxidoreductase P1               117   2e-29   
ref|XP_011047736.1|  PREDICTED: NADP-dependent alkenal double bon...    114   2e-29   
ref|XP_010242450.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    117   2e-29   
ref|XP_010499053.1|  PREDICTED: NADP-dependent alkenal double bon...    117   2e-29   
ref|XP_008455238.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    117   2e-29   
ref|XP_004155456.1|  PREDICTED: NADP-dependent alkenal double bon...    117   2e-29   
gb|AFK44696.1|  unknown                                                 116   2e-29   
ref|XP_004136859.1|  PREDICTED: NADP-dependent alkenal double bon...    117   2e-29   
emb|CAN61472.1|  hypothetical protein VITISV_043826                     117   2e-29   
ref|XP_002279426.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    117   2e-29   
gb|KGN43685.1|  hypothetical protein Csa_7G058590                       117   2e-29   
ref|XP_010101347.1|  NADP-dependent alkenal double bond reductase P2    117   2e-29   
ref|XP_002456768.1|  hypothetical protein SORBIDRAFT_03g042360          117   2e-29   
ref|XP_010650734.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    116   2e-29   
ref|XP_004510170.1|  PREDICTED: NADP-dependent alkenal double bon...    116   2e-29   
ref|XP_007028410.1|  F5I14.9 protein                                    116   2e-29   
gb|KCW59212.1|  hypothetical protein EUGRSUZ_H018721                    116   3e-29   
ref|XP_003578765.2|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    116   3e-29   
tpg|DAA56411.1|  TPA: putative alcohol dehydrogenase superfamily ...    114   3e-29   
gb|AAM61697.1|  quinone oxidoreductase-like protein                     116   3e-29   
gb|KDO37816.1|  hypothetical protein CISIN_1g042426mg                   115   3e-29   
ref|XP_004972285.1|  PREDICTED: uncharacterized protein LOC101765051    119   3e-29   
ref|XP_007206295.1|  hypothetical protein PRUPE_ppa008058mg             116   3e-29   
ref|XP_004302181.1|  PREDICTED: NADP-dependent alkenal double bon...    116   3e-29   
gb|EEC71929.1|  hypothetical protein OsI_04735                          116   3e-29   
ref|XP_008236846.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    116   4e-29   
emb|CDY05974.1|  BnaA09g38060D                                          116   4e-29   
ref|XP_008349843.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    116   4e-29   
gb|KEH18026.1|  NADP-dependent alkenal double bond reductase            116   4e-29   
ref|XP_009605292.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    116   4e-29   
sp|Q6WAU0.1|PULR_MENPI  RecName: Full=(+)-pulegone reductase            116   4e-29   
ref|XP_006848303.1|  hypothetical protein AMTR_s00013p00130530          113   4e-29   
gb|ABW86885.1|  pulegone reductase                                      115   4e-29   
gb|EMT16699.1|  Putative NADP-dependent oxidoreductase P1               116   5e-29   
ref|XP_007033627.1|  Zinc-binding dehydrogenase family protein is...    114   5e-29   
ref|XP_002279529.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   5e-29   
ref|XP_010322652.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    113   5e-29   
ref|XP_009766056.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   5e-29   
gb|ACF85153.1|  unknown                                                 115   5e-29   
gb|EYU39757.1|  hypothetical protein MIMGU_mgv1a009340mg                115   5e-29   
gb|ACN28438.1|  unknown                                                 117   5e-29   
ref|NP_198610.1|  zinc-binding dehydrogenase family protein             115   6e-29   
ref|XP_010039352.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   6e-29   
ref|XP_006359109.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   6e-29   
ref|XP_008801004.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   7e-29   
ref|XP_010930287.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   7e-29   
ref|XP_009401138.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   7e-29   
ref|XP_006378628.1|  hypothetical protein POPTR_0010s18530g             114   8e-29   
gb|ABR15426.1|  (+)-pulegone reductase                                  115   8e-29   
ref|NP_001149563.1|  LOC100283189                                       115   8e-29   
emb|CDP08124.1|  unnamed protein product                                115   9e-29   
gb|EPS72011.1|  hypothetical protein M569_02747                         115   9e-29   
ref|XP_010930288.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   9e-29   
gb|EMT19839.1|  Putative NADP-dependent oxidoreductase P1               117   9e-29   
ref|NP_001241318.1|  uncharacterized protein LOC100809668               115   1e-28   
gb|KHN30856.1|  NADP-dependent alkenal double bond reductase P2         115   1e-28   
ref|XP_010038497.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    115   1e-28   
emb|CDX71871.1|  BnaC08g30030D                                          115   1e-28   
ref|XP_006372341.1|  hypothetical protein POPTR_0017s00680g             115   1e-28   
ref|XP_009590651.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   1e-28   
tpg|DAA56414.1|  TPA: putative alcohol dehydrogenase superfamily ...    117   1e-28   
ref|XP_007202353.1|  hypothetical protein PRUPE_ppa008375mg             114   1e-28   
ref|XP_003578763.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   1e-28   
ref|XP_006664438.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   1e-28   
gb|AFK38563.1|  unknown                                                 114   1e-28   
gb|KEH18023.1|  NADP-dependent alkenal double bond reductase            114   1e-28   
ref|XP_011084708.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   1e-28   
ref|XP_011084707.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   2e-28   
ref|XP_007033625.1|  Zinc-binding dehydrogenase family protein is...    114   2e-28   
gb|KEH18007.1|  NADP-dependent alkenal double bond reductase P2         115   2e-28   
gb|ACJ85436.1|  unknown                                                 114   2e-28   
ref|NP_198616.1|  zinc-binding dehydrogenase family protein             114   2e-28   
ref|XP_008241554.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   2e-28   
ref|XP_009760032.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   2e-28   
ref|XP_010673852.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   2e-28   
ref|XP_009760033.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    114   2e-28   
ref|XP_009116654.1|  PREDICTED: NADP-dependent alkenal double bon...    114   3e-28   
gb|AFK45354.1|  unknown                                                 111   3e-28   
gb|KFK37750.1|  hypothetical protein AALP_AA3G025200                    113   3e-28   
ref|XP_010039382.1|  PREDICTED: NADP-dependent alkenal double bon...    108   4e-28   
gb|EPS68343.1|  hypothetical protein M569_06424                         113   4e-28   
emb|CAN79472.1|  hypothetical protein VITISV_019588                     110   4e-28   
ref|XP_006584207.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    112   4e-28   
gb|KDO46204.1|  hypothetical protein CISIN_1g0244112mg                  110   4e-28   
gb|KHN34013.1|  NADP-dependent alkenal double bond reductase P1         110   6e-28   
gb|KEH18006.1|  NADP-dependent alkenal double bond reductase            112   6e-28   
ref|XP_004288092.1|  PREDICTED: NADP-dependent alkenal double bon...    112   7e-28   
ref|XP_010101348.1|  NADP-dependent alkenal double bond reductase P2    112   7e-28   
gb|KCW59219.1|  hypothetical protein EUGRSUZ_H01879                     112   7e-28   
gb|KHG17518.1|  NADP-dependent alkenal double bond reductase P2 -...    112   8e-28   
gb|KDP32487.1|  hypothetical protein JCGZ_13412                         112   8e-28   
ref|XP_006850242.1|  hypothetical protein AMTR_s00020p00040210          112   8e-28   
gb|ABA96809.2|  NADP-dependent oxidoreductase P1, putative, expre...    112   8e-28   
ref|XP_010909889.1|  PREDICTED: uncharacterized protein LOC105035869    115   8e-28   
ref|XP_002315107.2|  allyl alcohol dehydrogenase family protein         112   9e-28   
ref|NP_001066431.1|  Os12g0226400                                       109   1e-27   
gb|EAZ20019.1|  hypothetical protein OsJ_35615                          110   1e-27   
gb|KEH18021.1|  NADP-dependent alkenal double bond reductase            112   1e-27   
ref|XP_006400238.1|  hypothetical protein EUTSA_v10015976mg             112   1e-27   
ref|XP_006372339.1|  hypothetical protein POPTR_0017s00680g             110   1e-27   
gb|KFK25922.1|  hypothetical protein AALP_AA8G180900                    112   1e-27   
ref|XP_007139135.1|  hypothetical protein PHAVU_008G004400g             112   1e-27   
ref|XP_009350007.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    112   1e-27   
ref|XP_008354480.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    107   2e-27   
ref|XP_006576670.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    111   2e-27   
ref|XP_003521023.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    111   2e-27   
gb|KHN30866.1|  NADP-dependent alkenal double bond reductase P1         111   2e-27   
ref|NP_001242819.1|  uncharacterized protein LOC100813036               111   3e-27   
gb|KHN17327.1|  NADP-dependent alkenal double bond reductase P2         111   3e-27   
ref|XP_010066170.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    111   3e-27   
emb|CDX71869.1|  BnaC08g30050D                                          110   3e-27   
ref|XP_006402646.1|  hypothetical protein EUTSA_v10006077mg             110   3e-27   
ref|XP_002514771.1|  alcohol dehydrogenase, putative                    110   3e-27   
gb|EMS57643.1|  putative NADP-dependent oxidoreductase P1               110   3e-27   
ref|XP_004173950.1|  PREDICTED: (+)-pulegone reductase-like             108   4e-27   
ref|XP_007028131.1|  Zinc-binding dehydrogenase family protein is...    110   4e-27   
emb|CAN68145.1|  hypothetical protein VITISV_035662                     110   4e-27   
ref|XP_007028130.1|  Zinc-binding dehydrogenase family protein is...    110   4e-27   
ref|XP_002279720.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    110   4e-27   
ref|XP_010453877.1|  PREDICTED: NADP-dependent alkenal double bon...    110   4e-27   
ref|XP_003635107.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    110   4e-27   
gb|KDP42330.1|  hypothetical protein JCGZ_02803                         109   4e-27   
emb|CAN62492.1|  hypothetical protein VITISV_015352                     110   4e-27   
ref|NP_001053203.1|  Os04g0497000                                       110   5e-27   
gb|EAY94706.1|  hypothetical protein OsI_16484                          110   5e-27   
emb|CDP08134.1|  unnamed protein product                                108   5e-27   
gb|ABG21926.1|  oxidoreductase, zinc-binding dehydrogenase family...    110   5e-27   
ref|XP_008218495.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    110   5e-27   
ref|XP_007207051.1|  hypothetical protein PRUPE_ppa007965mg             110   6e-27   
ref|XP_010242503.1|  PREDICTED: zinc-type alcohol dehydrogenase-l...    109   6e-27   
gb|ABR17262.1|  unknown                                                 110   6e-27   
gb|KDP39114.1|  hypothetical protein JCGZ_00871                         108   6e-27   
ref|XP_006345829.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    110   6e-27   
ref|XP_007214452.1|  hypothetical protein PRUPE_ppa024393mg             109   6e-27   
ref|XP_006402221.1|  hypothetical protein EUTSA_v10014051mg             110   7e-27   
gb|KFK37749.1|  hypothetical protein AALP_AA3G025100                    110   7e-27   
ref|XP_007033626.1|  Zinc-binding dehydrogenase family protein is...    110   8e-27   
gb|KDP39116.1|  hypothetical protein JCGZ_00873                         110   8e-27   
ref|XP_011014674.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    109   8e-27   
ref|XP_004152839.1|  PREDICTED: NADP-dependent alkenal double bon...    109   1e-26   
ref|XP_010528625.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    109   1e-26   
ref|XP_002873800.1|  predicted protein                                  108   2e-26   
ref|XP_006652471.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    108   2e-26   
ref|XP_009403660.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    108   2e-26   
ref|XP_010420404.1|  PREDICTED: NADP-dependent alkenal double bon...    108   2e-26   
ref|XP_006291356.1|  hypothetical protein CARUB_v10017496mg             108   2e-26   
ref|XP_002323912.2|  hypothetical protein POPTR_0017s00260g             108   3e-26   
ref|XP_011078333.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    106   3e-26   
ref|XP_004489123.1|  PREDICTED: NADP-dependent alkenal double bon...    108   3e-26   
ref|XP_004489122.1|  PREDICTED: NADP-dependent alkenal double bon...    108   3e-26   
ref|NP_001149347.1|  NADP-dependent oxidoreductase P1                   108   3e-26   
gb|AFW79718.1|  putative alcohol dehydrogenase superfamily protein      108   3e-26   
emb|CAC01713.1|  quinone oxidoreductase-like protein                    108   4e-26   
ref|XP_006291357.1|  hypothetical protein CARUB_v10017496mg             108   4e-26   
ref|XP_009366453.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    108   4e-26   
ref|XP_009420476.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    107   4e-26   
ref|XP_009126152.1|  PREDICTED: NADP-dependent alkenal double bon...    107   4e-26   
ref|XP_003521025.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    107   6e-26   
ref|XP_007212517.1|  hypothetical protein PRUPE_ppa017873mg             105   6e-26   
ref|NP_197198.1|  zinc-binding dehydrogenase family protein             107   6e-26   
gb|AAM66098.1|  quinone oxidoreductase-like protein                     107   7e-26   
emb|CDX85479.1|  BnaA02g03340D                                          107   7e-26   
ref|NP_001078315.1|  zinc-binding dehydrogenase family protein          105   7e-26   
ref|XP_007134339.1|  hypothetical protein PHAVU_010G039200g             107   7e-26   
ref|XP_004967884.1|  PREDICTED: NADP-dependent alkenal double bon...    107   7e-26   
ref|XP_008441910.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    107   7e-26   
ref|XP_006289172.1|  hypothetical protein CARUB_v10002610mg             107   8e-26   
ref|XP_004287174.1|  PREDICTED: NADP-dependent alkenal double bon...    107   8e-26   
emb|CDP08121.1|  unnamed protein product                                107   8e-26   
ref|XP_010512261.1|  PREDICTED: NADP-dependent alkenal double bon...    107   8e-26   
ref|XP_003577628.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    107   8e-26   
ref|NP_567087.1|  zinc-binding dehydrogenase family protein             106   1e-25   
gb|AAM63904.1|  allyl alcohol dehydrogenase-like protein                106   1e-25   
gb|KFK35195.1|  hypothetical protein AALP_AA5G252700                    106   1e-25   
gb|AJD09823.1|  NADPH-dependent double-bond reductase 3 variant 1       106   1e-25   
gb|AJD09824.1|  NADPH-dependent double-bond reductase 3 variant 2       106   1e-25   
emb|CAB75803.1|  allyl alcohol dehydrogenase-like protein               107   1e-25   
ref|XP_009594567.1|  PREDICTED: 2-alkenal reductase (NADP(+)-depe...    106   1e-25   



>ref|XP_010313870.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Solanum lycopersicum]
Length=361

 Score =   147 bits (370),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDATLKRYFP+GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNL+K EG+
Sbjct  225  KEEHDLDATLKRYFPDGIDIYFENVGGKMLDAVLMNMKLHGRIAVCGMISQYNLDKTEGV  284

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  285  HNLFCLIAKRIRMEG  299



>ref|XP_010313871.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Solanum lycopersicum]
Length=358

 Score =   147 bits (370),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDATLKRYFP+GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNL+K EG+
Sbjct  222  KEEHDLDATLKRYFPDGIDIYFENVGGKMLDAVLMNMKLHGRIAVCGMISQYNLDKTEGV  281

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  282  HNLFCLIAKRIRMEG  296



>ref|XP_009782873.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Nicotiana 
sylvestris]
Length=343

 Score =   144 bits (362),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKRYFP+GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE+ EG+
Sbjct  207  KEEQDLNAALKRYFPDGIDIYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEQTEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  267  HNLFCLITKRIRMEG  281



>ref|XP_006357421.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
tuberosum]
Length=343

 Score =   143 bits (360),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKR+FP+GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLE+ EG+
Sbjct  207  KEEQDLDAALKRHFPDGIDIYFENVGGKMLDAVLLNMKIHGRIAVCGMISQYNLEQTEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLISKRIRMEG
Sbjct  267  HNLFCLISKRIRMEG  281



>ref|XP_006350132.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
tuberosum]
Length=303

 Score =   140 bits (354),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDATLKRYFP+GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNL+K EG+
Sbjct  167  KEEHDLDATLKRYFPDGIDIYFENVGGKMLDAVLVNMKLHGRIAVCGMISQYNLDKTEGV  226

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  227  HNLFCLIAKRIRMEG  241



>ref|XP_004253034.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
lycopersicum]
Length=343

 Score =   141 bits (356),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKRYFP+GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLE++EG+
Sbjct  207  KEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLLNMRVHGRIAVCGMISQYNLEQNEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLISKR+RM+G
Sbjct  267  HNLFCLISKRLRMQG  281



>ref|XP_006342426.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
tuberosum]
Length=343

 Score =   141 bits (356),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKRYFP+GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLE++EG+
Sbjct  207  KEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGMISQYNLEQNEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLISKR+RM+G
Sbjct  267  HNLFCLISKRLRMQG  281



>ref|XP_004251811.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X3 [Solanum lycopersicum]
Length=347

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDATLKRYFP+GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNL+K EG+
Sbjct  211  KEEHDLDATLKRYFPDGIDIYFENVGGKMLDAVLMNMKLHGRIAVCGMISQYNLDKTEGV  270

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  271  HNLFCLIAKRIRMEG  285



>ref|XP_009597549.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Nicotiana 
tomentosiformis]
Length=343

 Score =   141 bits (356),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKRYFP+GIDIYFENVGGKMLDAVL  M L+GRIAVCGMISQYNLE+ EG+
Sbjct  207  KEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  267  HNLFCLITKRIRMEG  281



>sp|Q9SLN8.1|DBR_TOBAC RecName: Full=2-alkenal reductase (NADP(+)-dependent); AltName: 
Full=Alkenal double bound reductase; AltName: Full=Allyl-alcohol 
dehydrogenase; AltName: Full=Allylic alcohol dehydrogenase 
1; Short=allyl-ADH1; AltName: Full=Flavin-free double 
bond reductase; Short=NtDBR; AltName: Full=Pulegone reductase; 
Short=NtRed-1 [Nicotiana tabacum]
 dbj|BAA89423.1| allyl alcohol dehydrogenase [Nicotiana tabacum]
Length=343

 Score =   141 bits (356),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKRYFP+GIDIYFENVGGKMLDAVL  M L+GRIAVCGMISQYNLE+ EG+
Sbjct  207  KEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  267  HNLFCLITKRIRMEG  281



>emb|CDP08098.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKRYFP+GIDIYFENVGGKMLDAVL  M +HGRIAVCG+ISQYNLE+HEGI
Sbjct  152  KEEQDLNAALKRYFPDGIDIYFENVGGKMLDAVLLNMRVHGRIAVCGLISQYNLEQHEGI  211

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRI+MEG
Sbjct  212  HNLFCLITKRIKMEG  226



>pdb|4HFJ|A Chain A, X-ray Crystal Structure Of A Double Bond Reductase From 
Nicotiana Tabacum
 pdb|4HFJ|B Chain B, X-ray Crystal Structure Of A Double Bond Reductase From 
Nicotiana Tabacum
 pdb|4HFM|A Chain A, X-ray Crystal Structure Of A Nadp(h)-bound Double Bond 
Reductase From Nicotiana Tabacum
 pdb|4HFM|B Chain B, X-ray Crystal Structure Of A Nadp(h)-bound Double Bond 
Reductase From Nicotiana Tabacum
 pdb|4HFN|A Chain A, X-ray Crystal Structure Of A Ternary Complex Of Double 
Bond Reductase From Nicotiana Tabacum
 pdb|4HFN|B Chain B, X-ray Crystal Structure Of A Ternary Complex Of Double 
Bond Reductase From Nicotiana Tabacum
Length=351

 Score =   141 bits (355),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKRYFP+GIDIYFENVGGKMLDAVL  M L+GRIAVCGMISQYNLE+ EG+
Sbjct  207  KEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  267  HNLFCLITKRIRMEG  281



>ref|XP_006350022.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
tuberosum]
Length=345

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQ+LDA LKRYFP+GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNL+K EG+
Sbjct  209  KEEQNLDAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLHGRIAVCGMISQYNLDKTEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  269  HNLFCLIAKRIRMEG  283



>emb|CDP08100.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   139 bits (351),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKRYFP+GIDIYFENVGGKMLDAVL  M +HGRIAVCG+ISQYNLE+HEGI
Sbjct  192  KEEQDLNAALKRYFPDGIDIYFENVGGKMLDAVLLNMRVHGRIAVCGLISQYNLEQHEGI  251

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRI+MEG
Sbjct  252  HNLFCLITKRIKMEG  266



>ref|XP_009768371.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Nicotiana 
sylvestris]
Length=342

 Score =   139 bits (351),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKRYFP+GIDIYFENVGGKMLDAVL  M +HGRIAVCG ISQYNLE+ EG+
Sbjct  206  KEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGFISQYNLEQSEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRM+G
Sbjct  266  HNLFCLITKRIRMQG  280



>ref|XP_004251810.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
lycopersicum]
Length=346

 Score =   139 bits (350),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DL A LKRYFPNGIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLEK EG+
Sbjct  210  KEEKDLVADLKRYFPNGIDIYFENVGGKMLDAVLMNMKLHGRIAVCGMISQYNLEKTEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  270  HNLFCLITKRIRMEG  284



>ref|XP_004241896.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Solanum lycopersicum]
Length=343

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LK+Y P+GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLE+ EG+
Sbjct  207  KEEQDLDAALKKYLPDGIDIYFENVGGKMLDAVLLNMKIHGRIAVCGMISQYNLEQTEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLISKRIRMEG
Sbjct  267  HNLFCLISKRIRMEG  281



>ref|XP_009623211.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Nicotiana 
tomentosiformis]
Length=342

 Score =   138 bits (348),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DL A LKRYFP+GIDIYFENVGGKMLDAVL  M +HGRIAVCG ISQYNLE+ EG+
Sbjct  206  KEEEDLSAALKRYFPDGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGFISQYNLEQSEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLISKR+RM+G
Sbjct  266  HNLFCLISKRVRMQG  280



>gb|EYU36665.1| hypothetical protein MIMGU_mgv1a009305mg [Erythranthe guttata]
Length=346

 Score =   137 bits (346),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP+GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLE+ EG+
Sbjct  210  KEEPDLDAALKRYFPDGIDIYFENVGGKMLDAVLLNMRVHGRIAVCGMISQYNLEEPEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NLFCLISKR+RM+G
Sbjct  270  RNLFCLISKRVRMQG  284



>ref|XP_006348069.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
tuberosum]
Length=343

 Score =   137 bits (346),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDATLKRYFP+GIDIYFENVGGKMLDAVL  M +HGRI+ CGMISQYNLE+ EG+
Sbjct  207  KEEHNLDATLKRYFPDGIDIYFENVGGKMLDAVLVNMKVHGRISACGMISQYNLEQTEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+K+IRMEG
Sbjct  267  HNLFCLITKQIRMEG  281



>gb|ADO51748.1| alcohol dehydrogenase [Camellia sinensis]
Length=347

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DL+A LKRYFPNGI+IYFENVGGKMLDAVL  M LH RIAVCGMISQYNLE+ EG+
Sbjct  211  KEEKDLEAALKRYFPNGINIYFENVGGKMLDAVLANMRLHSRIAVCGMISQYNLERPEGV  270

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KR+RMEG
Sbjct  271  HNLFCLITKRVRMEG  285



>gb|EMT18936.1| Putative NADP-dependent oxidoreductase P1 [Aegilops tauschii]
Length=347

 Score =   135 bits (340),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL ATLKRYFP GIDIYFENVGG MLDAVL  M LHGR+AVCGMISQYNLE+ EG+
Sbjct  211  KKEQDLTATLKRYFPEGIDIYFENVGGAMLDAVLLNMRLHGRVAVCGMISQYNLEQPEGV  270

Query  182  HNLFCLISKRIRMEG  226
             NLFC+++KRIRMEG
Sbjct  271  RNLFCIVAKRIRMEG  285



>ref|XP_004287172.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
[Fragaria vesca subsp. vesca]
Length=347

 Score =   134 bits (338),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DLDA L+RYFP+GIDIYFENVGGKMLDAVLP M L GRIAVCGMISQYNLEK EGI
Sbjct  211  KDEPDLDAALRRYFPDGIDIYFENVGGKMLDAVLPNMRLKGRIAVCGMISQYNLEKPEGI  270

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI K++RMEG
Sbjct  271  HNLMSLIVKQVRMEG  285



>ref|XP_003578766.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Brachypodium 
distachyon]
Length=347

 Score =   134 bits (338),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQD++ATLKR FP GIDIYFENVGG MLDAVL  M +HGR+ VCG+ISQYNLE+HEG+
Sbjct  211  KKEQDVNATLKRCFPEGIDIYFENVGGAMLDAVLLNMRMHGRVTVCGLISQYNLEQHEGV  270

Query  182  HNLFCLISKRIRMEG  226
            HNLFC+++KRIRMEG
Sbjct  271  HNLFCVLTKRIRMEG  285



>ref|XP_002279359.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Vitis vinifera]
 emb|CAN61471.1| hypothetical protein VITISV_043825 [Vitis vinifera]
Length=345

 Score =   134 bits (338),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE+ EG+
Sbjct  209  KEEQDLEACLKRYFPEGIDIYFENVGGKMLDAVLVNMRLHGRIAVCGMISQYNLEEPEGV  268

Query  182  HNLFCLISKRIRMEG  226
             NLF +++KRIRMEG
Sbjct  269  RNLFTIVTKRIRMEG  283



>ref|XP_004287173.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Fragaria vesca subsp. vesca]
Length=347

 Score =   134 bits (337),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DLDA L+RYFP+GIDIYFENVGGKMLDAVLP M L GRIAVCGMISQYNLEK EGI
Sbjct  211  KDEPDLDAALRRYFPDGIDIYFENVGGKMLDAVLPNMRLKGRIAVCGMISQYNLEKPEGI  270

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI K++RMEG
Sbjct  271  HNLMSLIVKQVRMEG  285



>gb|EYU36663.1| hypothetical protein MIMGU_mgv1a009314mg [Erythranthe guttata]
Length=346

 Score =   134 bits (337),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP+GID+YFENVGGKML+AVL  M +HGRIAVCGMISQYNLE+ EG+
Sbjct  210  KEEPDLNAALKRYFPDGIDVYFENVGGKMLEAVLLNMRVHGRIAVCGMISQYNLEQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NLFCLI+KRIRMEG
Sbjct  270  SNLFCLITKRIRMEG  284



>ref|XP_010242458.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Nelumbo nucifera]
Length=311

 Score =   133 bits (335),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYF+N+GGKMLDAVL  M LHGRIA CGMISQYNLEK EG+
Sbjct  175  KEEHDLDAALKRYFPEGIDIYFDNIGGKMLDAVLLNMRLHGRIAACGMISQYNLEKPEGV  234

Query  182  HNLFCLISKRIRMEG  226
            HNLF L++KRIR+EG
Sbjct  235  HNLFYLVTKRIRLEG  249



>ref|XP_010242459.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Nelumbo nucifera]
Length=305

 Score =   133 bits (334),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYF+N+GGKMLDAVL  M LHGRIA CGMISQYNLEK EG+
Sbjct  169  KEEHDLDAALKRYFPEGIDIYFDNIGGKMLDAVLLNMRLHGRIAACGMISQYNLEKPEGV  228

Query  182  HNLFCLISKRIRMEG  226
            HNLF L++KRIR+EG
Sbjct  229  HNLFYLVTKRIRLEG  243



>ref|XP_011085049.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Sesamum 
indicum]
Length=346

 Score =   134 bits (336),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKRYFP+GIDIYFENVGGKMLDAVL  M  HGRIAVCGMISQYNLE+ EG+
Sbjct  210  KEEQDLNAALKRYFPDGIDIYFENVGGKMLDAVLLNMKTHGRIAVCGMISQYNLEQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNLF L++KRIRMEG
Sbjct  270  HNLFTLVTKRIRMEG  284



>ref|XP_011085050.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Sesamum 
indicum]
Length=344

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKR FPNGIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE+ EG 
Sbjct  208  KEEPDLNAALKRCFPNGIDIYFENVGGKMLDAVLLNMRLHGRIAVCGMISQYNLEEPEGT  267

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRMEG
Sbjct  268  HNLFCLITKRIRMEG  282



>ref|XP_007204694.1| hypothetical protein PRUPE_ppa008180mg [Prunus persica]
 gb|EMJ05893.1| hypothetical protein PRUPE_ppa008180mg [Prunus persica]
Length=342

 Score =   133 bits (334),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR+FP GIDIYFENVGGKMLDAVLP M +HGRIAVCGMISQYNLE+ EG+
Sbjct  206  KEEPDLDAALKRFFPEGIDIYFENVGGKMLDAVLPNMRVHGRIAVCGMISQYNLEQPEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ K++RMEG
Sbjct  266  HNLMYLVIKQVRMEG  280



>gb|EMS46550.1| putative NADP-dependent oxidoreductase P1 [Triticum urartu]
Length=346

 Score =   133 bits (334),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDLDATLKR FP GIDIYFENVGG MLDAVL  M LHGR++VCG+ISQYNLE+ EG+
Sbjct  210  KKEQDLDATLKRCFPEGIDIYFENVGGAMLDAVLLNMRLHGRVSVCGLISQYNLEQSEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NLFC+I+KRIRMEG
Sbjct  270  RNLFCIITKRIRMEG  284



>ref|XP_004287171.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Fragaria vesca subsp. vesca]
Length=344

 Score =   132 bits (332),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DLDA L+RYFP+GIDIYFENVGGKMLDAVLP M L GRIAVCGMISQYNLEK EGI
Sbjct  208  KDEPDLDAALRRYFPDGIDIYFENVGGKMLDAVLPNMRLKGRIAVCGMISQYNLEKPEGI  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  L  K++RMEG
Sbjct  268  HNLMSLFVKQVRMEG  282



>ref|XP_010070436.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
Length=344

 Score =   132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVLP M LHGRI VCGMISQYNLE+HEG+
Sbjct  208  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLPNMKLHGRITVCGMISQYNLEQHEGV  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KR+RMEG
Sbjct  268  HNLINLIWKRVRMEG  282



>gb|EMT18937.1| Putative NADP-dependent oxidoreductase P1 [Aegilops tauschii]
Length=371

 Score =   132 bits (332),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDLDATLKR FP GIDIYFENVGG MLDAVL  M LHGR++VCG+ISQYNLE+ EG+
Sbjct  207  KKEQDLDATLKRCFPEGIDIYFENVGGAMLDAVLLNMRLHGRVSVCGLISQYNLEQSEGV  266

Query  182  HNLFCLISKRIRMEG  226
             NLFC+I+KRIRMEG
Sbjct  267  RNLFCIITKRIRMEG  281



>gb|EPS68795.1| hypothetical protein M569_05969 [Genlisea aurea]
Length=344

 Score =   132 bits (331),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP+GIDIYFENVGGKMLDAVL  M + GRIA CGMISQYNLE HEG+
Sbjct  209  KEETDLNAALKRYFPDGIDIYFENVGGKMLDAVLLNMRIRGRIAACGMISQYNLESHEGV  268

Query  182  HNLFCLISKRIRMEG  226
             NLF LI+KRIR+EG
Sbjct  269  QNLFALITKRIRVEG  283



>ref|XP_008813783.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Phoenix 
dactylifera]
Length=345

 Score =   131 bits (330),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP+GIDIYFENVGG+MLDAVL  M +HGRIAVCG+ISQYNL + EG+
Sbjct  209  KEEHDLAAALKRSFPDGIDIYFENVGGRMLDAVLLNMKVHGRIAVCGLISQYNLTQQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNLFCL++KRIRM+G
Sbjct  269  HNLFCLVAKRIRMQG  283



>ref|XP_009121423.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Brassica 
rapa]
 emb|CDX69408.1| BnaA10g17570D [Brassica napus]
Length=344

 Score =   131 bits (329),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE HEG+
Sbjct  208  KEEQDLTAALKRCFPKGIDIYFENVGGKMLDAVLLNMNIHGRIAVCGMISQYNLENHEGV  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  268  HNLSTIIYKRIRIQG  282



>gb|KDO46203.1| hypothetical protein CISIN_1g0244112mg [Citrus sinensis]
Length=268

 Score =   129 bits (324),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGGK+LDAVLP M + GRIA CGMISQYNL+K EG+
Sbjct  133  KEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGV  192

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+SKR+RMEG
Sbjct  193  HNLMYLVSKRLRMEG  207



>emb|CDY16966.1| BnaC09g40930D [Brassica napus]
Length=351

 Score =   130 bits (328),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE HEG+
Sbjct  215  KEEQDLTAALKRCFPKGIDIYFENVGGKMLDAVLLNMNIHGRIAVCGMISQYNLENHEGV  274

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  275  HNLSTIIYKRIRIQG  289



>ref|XP_006478545.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Citrus 
sinensis]
Length=342

 Score =   130 bits (326),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GI+IYFENVGGKMLDAVL  M + GRIA+CGMISQYN +K EG+
Sbjct  206  KEEPDLDAALKRYFPEGINIYFENVGGKMLDAVLLNMRIQGRIALCGMISQYNNDKPEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNL CLISKRIRMEG
Sbjct  266  HNLTCLISKRIRMEG  280



>gb|KDP35121.1| hypothetical protein JCGZ_10655 [Jatropha curcas]
Length=347

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGGKMLDAVLP M++ GRI+VCGMISQYNLE+ EG+
Sbjct  211  KEEPDLEAALKRYFPEGIDIYFENVGGKMLDAVLPNMSIRGRISVCGMISQYNLEQPEGV  270

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+SKRIRMEG
Sbjct  271  HNLMHLVSKRIRMEG  285



>ref|XP_008243059.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Prunus 
mume]
Length=408

 Score =   130 bits (328),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            +EE DLDA LKR+FP GIDIYFENVGGKMLDAVLP M +HGRIAVCGMISQYNLE+ EG+
Sbjct  272  REEPDLDAALKRFFPEGIDIYFENVGGKMLDAVLPNMRVHGRIAVCGMISQYNLEQPEGV  331

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ K+ RMEG
Sbjct  332  HNLMHLVIKQARMEG  346



>ref|XP_008383998.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Malus domestica]
Length=272

 Score =   128 bits (322),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGM+SQYNL++ EG 
Sbjct  136  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLQNMRLHGRIAVCGMVSQYNLDQPEGC  195

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI K+IRM+G
Sbjct  196  HNLMYLIIKQIRMQG  210



>ref|XP_010672488.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Beta 
vulgaris subsp. vulgaris]
Length=347

 Score =   130 bits (326),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DLDA LKRYFP GIDIYFENVGGKML+AVL  M + GRIAVCGMISQYNLE+ EG+
Sbjct  211  KEEEDLDAALKRYFPEGIDIYFENVGGKMLEAVLSNMRVKGRIAVCGMISQYNLEQPEGV  270

Query  182  HNLFCLISKRIRMEG  226
            HNLF + +KRIRMEG
Sbjct  271  HNLFHITTKRIRMEG  285



>ref|XP_004287175.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Fragaria vesca subsp. vesca]
Length=371

 Score =   130 bits (327),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYN E+HEG+
Sbjct  235  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRLHGRIAVCGMISQYNNEQHEGV  294

Query  182  HNLFCLISKRIRMEG  226
             NL  LI KR+RMEG
Sbjct  295  TNLMHLIYKRVRMEG  309



>gb|KDO46217.1| hypothetical protein CISIN_1g024337mg [Citrus sinensis]
Length=269

 Score =   128 bits (321),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GID+YFENVGGK LDAVLP M + GRIA CGMISQYNL+K EG+
Sbjct  133  KEEADLNAALKRYFPEGIDVYFENVGGKTLDAVLPNMKIRGRIAACGMISQYNLDKPEGV  192

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+SKR+RMEG
Sbjct  193  HNLMYLVSKRLRMEG  207



>ref|XP_010251400.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Nelumbo 
nucifera]
Length=348

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIA CGMISQYNL + EG+
Sbjct  212  KEEHDLDAALKRYFPRGIDIYFENVGGKMLDAVLLNMRPHGRIAACGMISQYNLPQPEGV  271

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+ RIRM+G
Sbjct  272  HNLFCLITNRIRMQG  286



>ref|XP_006494862.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Citrus 
sinensis]
Length=341

 Score =   129 bits (324),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGGK+LDAVLP M + GRIA CGMISQYNL+K EG+
Sbjct  206  KEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+SKR+RMEG
Sbjct  266  HNLMYLVSKRLRMEG  280



>ref|XP_010912750.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Elaeis 
guineensis]
Length=686

 Score =   132 bits (332),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP+GIDIYFENVGG+MLDAVL  M +HGRIAVCG+ISQYNL + EG+
Sbjct  209  KEEHDLTAALKRSFPDGIDIYFENVGGRMLDAVLLNMRVHGRIAVCGLISQYNLTQQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNLFCLI+KRIRM+G
Sbjct  269  HNLFCLITKRIRMQG  283


 Score =   127 bits (319),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DL+A LKR FP GIDIYFENVGG MLDAVL  M  HGRIAVCGMISQYNLEK EG+
Sbjct  550  KKEPDLNAALKRLFPEGIDIYFENVGGLMLDAVLSNMRNHGRIAVCGMISQYNLEKPEGV  609

Query  182  HNLFCLISKRIRMEG  226
            HNLF LI+KRIRM+G
Sbjct  610  HNLFYLITKRIRMDG  624



>ref|XP_006494861.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Citrus 
sinensis]
Length=341

 Score =   129 bits (324),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGGK+LDAVLP M + GRIA CGMISQYNL+K EG+
Sbjct  206  KEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+SKR+RMEG
Sbjct  266  HNLMYLVSKRLRMEG  280



>ref|XP_010065844.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
 ref|XP_010065913.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
 gb|KCW87981.1| hypothetical protein EUGRSUZ_A00390 [Eucalyptus grandis]
Length=346

 Score =   129 bits (324),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDA LKRYFP GIDIYFENVGGK LDAVL  M LHGRIAVCGMISQYNLE+ EG+
Sbjct  210  KEESNLDAALKRYFPEGIDIYFENVGGKTLDAVLLNMKLHGRIAVCGMISQYNLEQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI+K++RMEG
Sbjct  270  HNLMQLITKQVRMEG  284



>emb|CDP08093.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A L+RYFP+GIDIYFENVGGKMLDAVL  M +H RIAVCGMISQYNLE+ EGI
Sbjct  216  KEEADLNAALERYFPDGIDIYFENVGGKMLDAVLLNMTVHSRIAVCGMISQYNLEQPEGI  275

Query  182  HNLFCLISKRIRMEG  226
            H+L CLI+KRIRMEG
Sbjct  276  HDLLCLITKRIRMEG  290



>ref|XP_006858752.1| hypothetical protein AMTR_s00066p00137430 [Amborella trichopoda]
 gb|ERN20219.1| hypothetical protein AMTR_s00066p00137430 [Amborella trichopoda]
Length=346

 Score =   129 bits (324),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGG MLDAVL  M  HGRI+VCG+ISQYN +K EG+
Sbjct  210  KEEHDLDAALKRYFPEGIDIYFENVGGAMLDAVLLNMRDHGRISVCGLISQYNKDKPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNLFCL+SKRI M+G
Sbjct  270  HNLFCLVSKRIEMKG  284



>gb|KCW87980.1| hypothetical protein EUGRSUZ_A00388 [Eucalyptus grandis]
Length=346

 Score =   129 bits (324),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDA LKRYFP GIDIYFENVGGK LD VL  M LHGRIAVCGMISQYNLE+ EG+
Sbjct  210  KEESNLDAALKRYFPEGIDIYFENVGGKTLDVVLLNMKLHGRIAVCGMISQYNLEQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI+KR+RMEG
Sbjct  270  HNLMQLIAKRVRMEG  284



>gb|AFW56665.1| putative alcohol dehydrogenase superfamily protein [Zea mays]
Length=345

 Score =   129 bits (323),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDLDA L+RYFP GIDIYFENVGG  L+AVLP M +HGRI  CGMISQYNLE+ EG+
Sbjct  209  KKEQDLDAALRRYFPEGIDIYFENVGGSTLEAVLPNMRIHGRIPTCGMISQYNLEEPEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNLF +I+KR+RMEG
Sbjct  269  HNLFEIITKRLRMEG  283



>ref|XP_006478549.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Citrus sinensis]
Length=341

 Score =   128 bits (322),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGGK LDAVLP M + GRIA CGMISQYNL+K EG+
Sbjct  206  KEEADLNAALKRYFPEGIDIYFENVGGKTLDAVLPNMKIRGRIAACGMISQYNLDKPEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+SKR+RMEG
Sbjct  266  HNLMYLVSKRLRMEG  280



>ref|NP_001152093.1| NADP-dependent oxidoreductase P2 [Zea mays]
 gb|ACG45753.1| NADP-dependent oxidoreductase P2 [Zea mays]
Length=345

 Score =   129 bits (323),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDLDA L+RYFP GIDIYFENVGG  L+AVLP M +HGRI  CGMISQYNLE+ EG+
Sbjct  209  KKEQDLDAALRRYFPEGIDIYFENVGGSTLEAVLPNMRIHGRIPTCGMISQYNLEEPEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNLF +I+KR+RMEG
Sbjct  269  HNLFEIIAKRLRMEG  283



>ref|NP_197199.1| 2-alkenal reductase [Arabidopsis thaliana]
 sp|Q39172.1|P1_ARATH RecName: Full=NADP-dependent alkenal double bond reductase P1; 
Short=DBR1 [Arabidopsis thaliana]
 emb|CAA89838.1| zeta-crystallin homologue [Arabidopsis thaliana]
 emb|CAC01710.1| quinone oxidoreductase-like protein [Arabidopsis thaliana]
 gb|AAY25470.1| At5g16970 [Arabidopsis thaliana]
 gb|AED92364.1| 2-alkenal reductase [Arabidopsis thaliana]
Length=345

 Score =   128 bits (322),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FPNGIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  209  KEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>ref|XP_010041719.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
Length=271

 Score =   127 bits (318),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFEN GGKMLDAVL  M  HGRI VCGM+SQYNLE+HEGI
Sbjct  135  KEELDLDAALKRCFPKGIDIYFENFGGKMLDAVLLNMKFHGRITVCGMVSQYNLERHEGI  194

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KR+RMEG
Sbjct  195  HNLINLVLKRVRMEG  209



>ref|XP_010070430.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
 gb|KCW59213.1| hypothetical protein EUGRSUZ_H01873 [Eucalyptus grandis]
Length=348

 Score =   128 bits (322),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIAVCGMISQYNLE+ EGI
Sbjct  212  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAVCGMISQYNLEQPEGI  271

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  272  HNLTNFILKRIRMEG  286



>gb|KCW46083.1| hypothetical protein EUGRSUZ_L00056 [Eucalyptus grandis]
Length=313

 Score =   128 bits (321),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIAVCGMISQYNLE+ EGI
Sbjct  177  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAVCGMISQYNLEQPEGI  236

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  237  HNLTNFILKRIRMEG  251



>ref|XP_009131573.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Brassica rapa]
Length=340

 Score =   128 bits (322),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  204  KEEQDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNMHGRIAVCGMISQYNLEDQEGV  263

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  264  HNLTSIIYKRIRIQG  278



>ref|XP_006400239.1| hypothetical protein EUTSA_v10013973mg [Eutrema salsugineum]
 dbj|BAJ33830.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41692.1| hypothetical protein EUTSA_v10013973mg [Eutrema salsugineum]
Length=351

 Score =   128 bits (322),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  215  KEEQDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNMHGRIAVCGMISQYNLEDQEGV  274

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  275  HNLSTIIYKRIRIQG  289



>gb|KFK25923.1| hypothetical protein AALP_AA8G181000 [Arabis alpina]
Length=353

 Score =   128 bits (322),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN HGRIAVCGMISQYNL+ HEG+
Sbjct  217  KEEQDLTAALKRCFPKGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLKDHEGV  276

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  277  HNLSSIIYKRIRIQG  291



>gb|EMS60009.1| putative NADP-dependent oxidoreductase P1 [Triticum urartu]
Length=349

 Score =   128 bits (321),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+ TLKR FP GIDIYFENVGG MLDAVL  M LHGR++VCGMISQYNLE+ EG+
Sbjct  213  KKEQDLNPTLKRCFPEGIDIYFENVGGAMLDAVLLNMRLHGRVSVCGMISQYNLEQLEGV  272

Query  182  HNLFCLISKRIRMEG  226
             NLFC+++KRIRMEG
Sbjct  273  RNLFCIVAKRIRMEG  287



>emb|CDP08119.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   127 bits (320),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKRYFP GIDIYFENVGGK LDA L  M +H RIAVCGMISQYNL+K EGI
Sbjct  190  KEEQDLDAALKRYFPEGIDIYFENVGGKTLDATLLNMKVHSRIAVCGMISQYNLDKPEGI  249

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRIRMEG
Sbjct  250  HNLASVLYKRIRMEG  264



>gb|KDO41274.1| hypothetical protein CISIN_1g026217mg [Citrus sinensis]
Length=208

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GI+IYFENVGGKMLDAVL  M + GRI +CGMISQYN +K EG+
Sbjct  72   KEEPDLDAALKRYFPEGINIYFENVGGKMLDAVLLNMRIQGRITLCGMISQYNNDKPEGV  131

Query  182  HNLFCLISKRIRMEG  226
            HNL CLISKRIRMEG
Sbjct  132  HNLTCLISKRIRMEG  146



>ref|XP_010042961.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like, partial 
[Eucalyptus grandis]
Length=267

 Score =   126 bits (316),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDATLKRYFP GIDIYFENVGGKMLDAVL  M LHGRIA CGMISQYNLE+ EG+
Sbjct  132  KEELDLDATLKRYFPKGIDIYFENVGGKMLDAVLLNMKLHGRIAACGMISQYNLEQPEGV  191

Query  182  HNLFCLISKRIRMEG  226
             NL  LI K++RMEG
Sbjct  192  CNLMNLILKQVRMEG  206



>ref|XP_002529818.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32567.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=345

 Score =   127 bits (320),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGG+MLDAVL  M + GRIAVCGMISQYNL+K EG+
Sbjct  209  KEEPDLDAALKRYFPEGIDIYFENVGGEMLDAVLLNMRIRGRIAVCGMISQYNLDKPEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIRMEG
Sbjct  269  HNLSAIIGKRIRMEG  283



>ref|XP_010039349.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Eucalyptus grandis]
Length=359

 Score =   128 bits (321),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIAVCGMISQYNLE+ EGI
Sbjct  223  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAVCGMISQYNLEQPEGI  282

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  283  HNLTNFILKRIRMEG  297



>gb|AEL78825.1| ketone/zingerone synthase 1 [Rubus idaeus]
Length=348

 Score =   127 bits (320),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA L+RYFP+GIDIYFENVGGKMLDAVLP M   GRIAVCGMISQYNLE+ EG+
Sbjct  212  KEEADLDAALRRYFPDGIDIYFENVGGKMLDAVLPNMRPKGRIAVCGMISQYNLEQPEGV  271

Query  182  HNLFCLISKRIRMEG  226
             NL  LI K++RMEG
Sbjct  272  RNLMALIVKQVRMEG  286



>gb|EYU34270.1| hypothetical protein MIMGU_mgv1a020420mg [Erythranthe guttata]
Length=346

 Score =   127 bits (320),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEK-HEG  178
            KEE +LDA LKRYFPNGIDIYFENVGGKMLDAVL  M ++GRIAVCGMISQYNLE   EG
Sbjct  209  KEEPNLDAALKRYFPNGIDIYFENVGGKMLDAVLLNMRINGRIAVCGMISQYNLEDPDEG  268

Query  179  IHNLFCLISKRIRMEG  226
            I NL CL++KRIRMEG
Sbjct  269  IGNLLCLVTKRIRMEG  284



>ref|XP_010070429.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
Length=348

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIAVCGMISQYNLE+ EGI
Sbjct  212  KEEQDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAVCGMISQYNLEQPEGI  271

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  272  HNLTNFILKRIRMEG  286



>ref|XP_004287168.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Fragaria vesca subsp. vesca]
Length=346

 Score =   127 bits (320),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LD  LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIAVCGMISQYNLEK EG+
Sbjct  210  KEESNLDVALKRYFPEGIDIYFENVGGKMLDAVLLNMRSHGRIAVCGMISQYNLEKSEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  L++K +RM+G
Sbjct  270  HNLMSLVTKEVRMQG  284



>ref|XP_006478548.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Citrus sinensis]
Length=342

 Score =   127 bits (319),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+  LKRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  206  KEEPDLNEALKRYFPEGIDIYFENVGGKMLDAVLLNMKIHGRIAVCGMISQYNLDRPEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNL  L++KR+RMEG
Sbjct  266  HNLMYLVTKRVRMEG  280



>ref|XP_010070435.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
Length=344

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL  M LHGRI VCGMISQYNLE+HEG+
Sbjct  208  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLHGRITVCGMISQYNLEQHEGV  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KR+RMEG
Sbjct  268  HNLINLIWKRVRMEG  282



>ref|XP_010070439.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X3 [Eucalyptus grandis]
Length=332

 Score =   127 bits (318),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFEN GGKMLDAVL  M  HGRI VCGM+SQYNLE+HEGI
Sbjct  196  KEELDLDAALKRCFPKGIDIYFENFGGKMLDAVLLNMKFHGRITVCGMVSQYNLERHEGI  255

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KR+RMEG
Sbjct  256  HNLINLVLKRVRMEG  270



>ref|XP_004288354.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Fragaria vesca subsp. vesca]
Length=348

 Score =   127 bits (319),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYN-LEKHEG  178
            KEE D+DA L+RYFP+GIDIYFENVGGKMLDAVLP M L GRIAVCGMISQYN LE+ EG
Sbjct  211  KEEPDMDAALRRYFPDGIDIYFENVGGKMLDAVLPNMRLKGRIAVCGMISQYNQLERPEG  270

Query  179  IHNLFCLISKRIRMEG  226
            IHNL  LI K++RMEG
Sbjct  271  IHNLMSLIVKQVRMEG  286



>gb|KCW59223.1| hypothetical protein EUGRSUZ_H01882 [Eucalyptus grandis]
Length=370

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL  M LHGRI VCGMISQYNLE+HEG+
Sbjct  234  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLHGRITVCGMISQYNLEQHEGV  293

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KR+RMEG
Sbjct  294  HNLINLIWKRVRMEG  308



>gb|KDO41286.1| hypothetical protein CISIN_1g019042mg [Citrus sinensis]
Length=347

 Score =   127 bits (319),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DLDA LKR FP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLEK EG+
Sbjct  211  KKEPDLDAALKRCFPEGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGMISQYNLEKPEGV  270

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRIRMEG
Sbjct  271  HNLMQVVGKRIRMEG  285



>gb|KDO41273.1| hypothetical protein CISIN_1g026217mg [Citrus sinensis]
Length=241

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GI+IYFENVGGKMLDAVL  M + GRI +CGMISQYN +K EG+
Sbjct  105  KEEPDLDAALKRYFPEGINIYFENVGGKMLDAVLLNMRIQGRITLCGMISQYNNDKPEGV  164

Query  182  HNLFCLISKRIRMEG  226
            HNL CLISKRIRMEG
Sbjct  165  HNLTCLISKRIRMEG  179



>ref|XP_008813781.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Phoenix 
dactylifera]
Length=348

 Score =   127 bits (319),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DL A LKR FP GIDIYFENVGG MLDAVL  M  HGRIAVCGMISQYNLEK EG+
Sbjct  212  KKEPDLSAALKRLFPEGIDIYFENVGGPMLDAVLINMRTHGRIAVCGMISQYNLEKPEGV  271

Query  182  HNLFCLISKRIRMEG  226
            HNLF L++KRIRMEG
Sbjct  272  HNLFYLVAKRIRMEG  286



>gb|KDO41285.1| hypothetical protein CISIN_1g037444mg [Citrus sinensis]
Length=339

 Score =   127 bits (318),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL  M L GRIAVCGMISQYNLEK EG+
Sbjct  205  KEEPDLDAALKRCFPQGIDIYFENVGGKMLDAVLLNMRLRGRIAVCGMISQYNLEKPEGV  264

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KRIR+EG
Sbjct  265  HNLEQLIGKRIRLEG  279



>ref|XP_006478547.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Citrus 
sinensis]
Length=346

 Score =   127 bits (318),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL  M L GRIAVCGMISQYNLEK EG+
Sbjct  212  KEEPDLDAALKRCFPQGIDIYFENVGGKMLDAVLLNMRLRGRIAVCGMISQYNLEKPEGV  271

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KRIR+EG
Sbjct  272  HNLEQLIGKRIRLEG  286



>ref|XP_004960754.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
[Setaria italica]
Length=353

 Score =   127 bits (319),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDLDA L+RYFP GIDIYFENVGG+ L+AVL  M +HGRI VCGMISQYNLE+ EG+
Sbjct  217  KKEQDLDAALRRYFPEGIDIYFENVGGQTLEAVLDNMRVHGRIPVCGMISQYNLEQPEGV  276

Query  182  HNLFCLISKRIRMEG  226
            HNLF +++KR+RMEG
Sbjct  277  HNLFQVVAKRLRMEG  291



>gb|KCW59215.1| hypothetical protein EUGRSUZ_H01876 [Eucalyptus grandis]
Length=337

 Score =   127 bits (318),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR  P GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE+ EG+
Sbjct  201  KEEPDLDAALKRCLPEGIDIYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEQPEGV  260

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KRIRMEG
Sbjct  261  HNLMNLVLKRIRMEG  275



>emb|CDP08094.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   127 bits (318),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+  LKRYFP+GIDIYFENVGGKMLDAVL  M  +GRIA CGMISQYNLE+ EG+
Sbjct  210  KEEADLNVALKRYFPDGIDIYFENVGGKMLDAVLLNMTPYGRIAACGMISQYNLEQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NLFCL++K+IRMEG
Sbjct  270  QNLFCLVTKQIRMEG  284



>gb|KCW59218.1| hypothetical protein EUGRSUZ_H01878 [Eucalyptus grandis]
Length=344

 Score =   127 bits (318),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFEN GGKMLDAVL  M  HGRI VCGM+SQYNLE+HEGI
Sbjct  208  KEELDLDAALKRCFPKGIDIYFENFGGKMLDAVLLNMKFHGRITVCGMVSQYNLERHEGI  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KR+RMEG
Sbjct  268  HNLINLVLKRVRMEG  282



>ref|XP_009366246.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Pyrus 
x bretschneideri]
Length=350

 Score =   127 bits (318),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+ATLKRYFP GIDIYFENVGGK LDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  214  KEEHDLNATLKRYFPEGIDIYFENVGGKFLDAVLLNMRVHGRIAVCGMISQYNLDQPEGV  273

Query  182  HNLFCLISKRIRMEG  226
             NL CL+ KRI M+G
Sbjct  274  TNLMCLVYKRIHMQG  288



>emb|CDX78721.1| BnaA03g06330D [Brassica napus]
Length=355

 Score =   127 bits (318),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRI+VCGMISQYNLE  EG+
Sbjct  204  KEEQDLGAALKRCFPKGIDIYFENVGGKMLDAVLLNMNMHGRISVCGMISQYNLEDQEGV  263

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  264  HNLTSIIYKRIRIQG  278



>ref|XP_010070431.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
 gb|KCW59216.1| hypothetical protein EUGRSUZ_H01876 [Eucalyptus grandis]
Length=348

 Score =   127 bits (318),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR  P GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE+ EG+
Sbjct  212  KEEPDLDAALKRCLPEGIDIYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEQPEGV  271

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KRIRMEG
Sbjct  272  HNLMNLVLKRIRMEG  286



>ref|XP_010463754.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
[Camelina sativa]
Length=346

 Score =   127 bits (318),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKR FP GID+YFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE  EG+
Sbjct  210  KEEQDLNAALKRCFPEGIDVYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEDQEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  270  HNLATVIYKRIRIQG  284



>ref|XP_007202332.1| hypothetical protein PRUPE_ppa008142mg [Prunus persica]
 gb|EMJ03531.1| hypothetical protein PRUPE_ppa008142mg [Prunus persica]
Length=343

 Score =   126 bits (317),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +L A LKRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLE+ EG+
Sbjct  207  KEEPNLVAALKRYFPEGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGMISQYNLEQPEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNL  +ISK++RMEG
Sbjct  267  HNLTSVISKQLRMEG  281



>ref|XP_003578761.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Brachypodium distachyon]
Length=345

 Score =   126 bits (317),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+A LKR FP GIDIYFENVGG MLDAVL  M  HGRIAVCG+ISQYNLE+ EG+
Sbjct  209  KKEQDLNAALKRCFPEGIDIYFENVGGAMLDAVLLNMRNHGRIAVCGLISQYNLEQPEGV  268

Query  182  HNLFCLISKRIRMEG  226
             NLFC+++KRIRMEG
Sbjct  269  RNLFCIVAKRIRMEG  283



>gb|KDP35123.1| hypothetical protein JCGZ_10657 [Jatropha curcas]
Length=345

 Score =   126 bits (317),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M + GRIAVCGMISQYNLE  EG+
Sbjct  209  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRIRGRIAVCGMISQYNLENPEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I+KRIRMEG
Sbjct  269  HNLASIIAKRIRMEG  283



>ref|XP_010238601.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Brachypodium distachyon]
Length=318

 Score =   125 bits (315),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+A LKR FP GIDIYFENVGG MLDAVL  M  HGRIAVCG+ISQYNLE+ EG+
Sbjct  182  KKEQDLNAALKRCFPEGIDIYFENVGGAMLDAVLLNMRNHGRIAVCGLISQYNLEQPEGV  241

Query  182  HNLFCLISKRIRMEG  226
             NLFC+++KRIRMEG
Sbjct  242  RNLFCIVAKRIRMEG  256



>gb|KCW87979.1| hypothetical protein EUGRSUZ_A00387 [Eucalyptus grandis]
Length=208

 Score =   123 bits (309),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDA LKRYFP GIDIYFENV GK LDAVL  M LHGRIAVCGMISQYNLE+ EG+
Sbjct  72   KEESNLDAALKRYFPEGIDIYFENVRGKTLDAVLLNMKLHGRIAVCGMISQYNLEQPEGV  131

Query  182  HNLFCLISKRIRMEG  226
            HNL  L++KR+RMEG
Sbjct  132  HNLMQLLAKRVRMEG  146



>ref|XP_008362858.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus 
domestica]
Length=349

 Score =   126 bits (317),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGM+SQYNL++ EG 
Sbjct  213  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLQNMRLHGRIAVCGMVSQYNLDQPEGC  272

Query  182  HNLFCLISKRIRMEG  226
            HNL  L  K+IRM+G
Sbjct  273  HNLMYLXIKQIRMQG  287



>ref|XP_008354322.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus 
domestica]
Length=349

 Score =   126 bits (317),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGM+SQYNL++ EG 
Sbjct  213  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLQNMRLHGRIAVCGMVSQYNLDQPEGC  272

Query  182  HNLFCLISKRIRMEG  226
            HNL  L  K+IRM+G
Sbjct  273  HNLMYLXIKQIRMQG  287



>ref|XP_006350018.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
tuberosum]
Length=345

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKRYF +GIDIYF+NVGGKM DAVL  M LHGRIA+CGMISQYNL+K EG+
Sbjct  209  KEEQDLDAALKRYFSDGIDIYFDNVGGKMFDAVLLNMKLHGRIAMCGMISQYNLKKTEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL CLI+KRI M+G
Sbjct  269  HNLLCLIAKRICMKG  283



>ref|XP_008383990.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus 
domestica]
 ref|XP_008354320.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus 
domestica]
Length=345

 Score =   126 bits (316),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDA LKRYFP GIDIYFENVGGKMLDAVL  M  +GRIAVCGMISQYNLE+ EG+
Sbjct  209  KEEPNLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRTNGRIAVCGMISQYNLEQKEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +ISK++RM+G
Sbjct  269  HNLTSMISKQLRMQG  283



>ref|XP_008343893.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus 
domestica]
Length=349

 Score =   126 bits (316),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGM+SQYNL++ EG 
Sbjct  213  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLQNMRLHGRIAVCGMVSQYNLDQPEGC  272

Query  182  HNLFCLISKRIRMEG  226
            HNL  L  K+IRM+G
Sbjct  273  HNLMYLXIKQIRMQG  287



>gb|ACN65116.1| 2-alkenal reductase [Artemisia annua]
Length=347

 Score =   126 bits (316),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKRYFP GIDIYFENVGG+MLDAVL  M L GRI+VCGMISQYNLE+ EG+
Sbjct  211  KEEQDLDAALKRYFPEGIDIYFENVGGRMLDAVLLNMRLDGRISVCGMISQYNLEQSEGV  270

Query  182  HNLFCLISKRIRMEG  226
             NLF L++KR+ M+G
Sbjct  271  RNLFTLVTKRVTMKG  285



>ref|XP_010242452.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Nelumbo 
nucifera]
Length=346

 Score =   126 bits (316),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKR FP GIDIYFENVGG+MLDAVL  M +HGRIAVCG+ISQYNL + EG+
Sbjct  210  KEEHDLNAALKRCFPEGIDIYFENVGGRMLDAVLLNMKVHGRIAVCGLISQYNLHEQEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNLFC+I+KRIRM+G
Sbjct  270  HNLFCVITKRIRMQG  284



>gb|KDP33137.1| hypothetical protein JCGZ_13529 [Jatropha curcas]
Length=290

 Score =   125 bits (313),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQD DA LKRYFP GIDIYFENVGGKMLDAVL  +  HGRIA CGMISQYNLE  EG+
Sbjct  154  KEEQDWDAALKRYFPEGIDIYFENVGGKMLDAVLLNLRTHGRIAACGMISQYNLEHPEGV  213

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KR+R++G
Sbjct  214  HNLMTIVYKRVRIQG  228



>ref|XP_006288102.1| hypothetical protein CARUB_v10001335mg [Capsella rubella]
 gb|EOA21000.1| hypothetical protein CARUB_v10001335mg [Capsella rubella]
Length=344

 Score =   125 bits (315),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN HGRIAVCGMISQYNLE  EG+
Sbjct  208  KEEQDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGV  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  268  HNLSNIIYKRIRIQG  282



>gb|EYU17593.1| hypothetical protein MIMGU_mgv1a020294mg [Erythranthe guttata]
Length=346

 Score =   125 bits (315),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEK-HEG  178
            KEE +LDA LKRYFPNGIDIYFENVGGKM DAVL  M ++GRIAVCGMISQYNLE   EG
Sbjct  209  KEEPNLDAALKRYFPNGIDIYFENVGGKMFDAVLLNMRVNGRIAVCGMISQYNLENPEEG  268

Query  179  IHNLFCLISKRIRMEG  226
              NL CLI+KRIRMEG
Sbjct  269  TRNLLCLITKRIRMEG  284



>ref|XP_004157322.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
[Cucumis sativus]
Length=349

 Score =   126 bits (316),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+ATLKRYFP GIDIYFENVGGKMLDAVL  M  HGRI VCGMISQYNLEK EG+
Sbjct  210  KEESDLNATLKRYFPKGIDIYFENVGGKMLDAVLGNMREHGRIGVCGMISQYNLEKPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I +R+R++G
Sbjct  270  HNLLNIILRRVRVQG  284



>ref|XP_009366241.1| PREDICTED: LOW QUALITY PROTEIN: 2-alkenal reductase (NADP(+)-dependent)-like 
[Pyrus x bretschneideri]
Length=339

 Score =   125 bits (315),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDA LKRYFP GIDIYFENVGGKMLDAVL  M ++GRI VCGMISQYNLE+ EG+
Sbjct  203  KEEPNLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRMNGRITVCGMISQYNLEQKEGV  262

Query  182  HNLFCLISKRIRMEG  226
            HNL  +ISK++RM+G
Sbjct  263  HNLTSMISKQLRMQG  277



>ref|XP_004143773.1| PREDICTED: LOW QUALITY PROTEIN: NADP-dependent alkenal double 
bond reductase P2-like [Cucumis sativus]
Length=349

 Score =   125 bits (315),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+ATLKRYFP GIDIYFENVGGKMLDAVL  M  HGRI VCGMISQYNLEK EG+
Sbjct  210  KEESDLNATLKRYFPKGIDIYFENVGGKMLDAVLGNMREHGRIGVCGMISQYNLEKPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I +R+R++G
Sbjct  270  HNLLNIILRRVRVQG  284



>pdb|2J3H|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond 
Reductase (At5g16970)-Apo Form
 pdb|2J3H|B Chain B, Crystal Structure Of Arabidopsis Thaliana Double Bond 
Reductase (At5g16970)-Apo Form
 pdb|2J3I|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond 
Reductase (At5g16970)-Binary Complex
 pdb|2J3I|B Chain B, Crystal Structure Of Arabidopsis Thaliana Double Bond 
Reductase (At5g16970)-Binary Complex
 pdb|2J3J|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond 
Reductase (At5g16970)-Ternary Complex I
 pdb|2J3J|B Chain B, Crystal Structure Of Arabidopsis Thaliana Double Bond 
Reductase (At5g16970)-Ternary Complex I
 pdb|2J3K|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond 
Reductase (At5g16970)-Ternary Complex Ii
 pdb|2J3K|B Chain B, Crystal Structure Of Arabidopsis Thaliana Double Bond 
Reductase (At5g16970)-Ternary Complex Ii
Length=345

 Score =   125 bits (314),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FPNGIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  209  KEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KR R++G
Sbjct  269  HNLSNIIYKRNRIQG  283



>gb|KFK25924.1| hypothetical protein AALP_AA8G181100 [Arabis alpina]
Length=345

 Score =   125 bits (314),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN HGRIAVCGMISQYNL+  EG+
Sbjct  209  KEEQDLTAALKRCFPKGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLQDQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSSIIYKRIRIQG  283



>gb|KGN51156.1| hypothetical protein Csa_5G468980 [Cucumis sativus]
Length=317

 Score =   125 bits (313),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+ATLKRYFP GIDIYFENVGGKMLDAVL  M  HGRI VCGMISQYNLEK EG+
Sbjct  210  KEESDLNATLKRYFPKGIDIYFENVGGKMLDAVLGNMREHGRIGVCGMISQYNLEKPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I +R+R++G
Sbjct  270  HNLLNIILRRVRVQG  284



>ref|XP_006300073.1| hypothetical protein CARUB_v10016301mg [Capsella rubella]
 gb|EOA32971.1| hypothetical protein CARUB_v10016301mg [Capsella rubella]
Length=350

 Score =   125 bits (314),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE  EG+
Sbjct  214  KEEQDLSAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEDQEGV  273

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KR+R++G
Sbjct  274  HNLATVLYKRVRIQG  288



>ref|XP_008243058.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Prunus 
mume]
Length=343

 Score =   125 bits (314),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +L A L+RYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLE+ EG+
Sbjct  207  KEEPNLVAALQRYFPEGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGMISQYNLEQPEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNL  +ISK++RMEG
Sbjct  267  HNLTSVISKQLRMEG  281



>ref|XP_007203000.1| hypothetical protein PRUPE_ppa017182mg [Prunus persica]
 gb|EMJ04199.1| hypothetical protein PRUPE_ppa017182mg [Prunus persica]
Length=358

 Score =   125 bits (314),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYN E+H+G+
Sbjct  222  KEEADLAAALKRYFPQGIDIYFENVGGKMLDAVLLNMRLHGRIAVCGMISQYNFEQHQGV  281

Query  182  HNLFCLISKRIRMEG  226
             NL  L+  R+RMEG
Sbjct  282  TNLMHLVYNRVRMEG  296



>gb|KCW46084.1| hypothetical protein EUGRSUZ_L00058 [Eucalyptus grandis]
Length=320

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIAVCGMISQYNLE+ EGI
Sbjct  184  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAVCGMISQYNLEQPEGI  243

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  244  HNLTNFILKRIRMEG  258



>ref|NP_001066432.1| Os12g0226700 [Oryza sativa Japonica Group]
 gb|ABA96819.1| NADP-dependent oxidoreductase P2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29451.1| Os12g0226700 [Oryza sativa Japonica Group]
 gb|EAZ20020.1| hypothetical protein OsJ_35616 [Oryza sativa Japonica Group]
Length=346

 Score =   125 bits (313),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+A L+RYFP GIDIY+ENVGGKMLDAVLP M+L GRI  CGMISQYNLE+ EG+
Sbjct  210  KKEQDLEAALRRYFPEGIDIYYENVGGKMLDAVLPNMSLGGRIVACGMISQYNLEQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NL+ +++KR+RMEG
Sbjct  270  RNLYYIVTKRLRMEG  284



>ref|XP_008383944.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus 
domestica]
Length=362

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+  LKRYFP GIDIY+ENVGGKMLDAVL  M LHGRIAVCGMISQYN E+HEG+
Sbjct  226  KEEPDLNTALKRYFPEGIDIYWENVGGKMLDAVLMNMRLHGRIAVCGMISQYNXEEHEGV  285

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KR+RMEG
Sbjct  286  HNLMHLIYKRVRMEG  300



>gb|AAM53276.1| quinone oxidoreductase-like protein [Arabidopsis thaliana]
Length=345

 Score =   125 bits (313),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR F NGIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  209  KEESDLTAALKRCFTNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>ref|NP_197200.2| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
 dbj|BAC43246.1| putative quinone oxidoreductase [Arabidopsis thaliana]
 gb|AAO63322.1| At5g16980 [Arabidopsis thaliana]
 gb|AED92365.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
Length=239

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FPNGIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  103  KEEPDLSAALKRCFPNGIDIYFENVGGKMLDAVLMNMNMHGRIAVCGMISQYNLENQEGV  162

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  163  HNLSNIIYKRIRIQG  177



>ref|XP_006663915.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Oryza 
brachyantha]
Length=345

 Score =   125 bits (313),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DLD  LKRYFP GIDIYFENVGG  LDAVLP M L GRIA CGMISQYNL+  +G+
Sbjct  210  KKEPDLDVALKRYFPKGIDIYFENVGGSTLDAVLPNMRLFGRIAACGMISQYNLDSPDGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNLF +I+KR+RMEG
Sbjct  270  HNLFYIITKRLRMEG  284



>ref|XP_010039351.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X3 [Eucalyptus grandis]
Length=317

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIAVCGMISQYNLE+ EGI
Sbjct  181  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAVCGMISQYNLEQPEGI  240

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  241  HNLTNFILKRIRMEG  255



>ref|XP_010420405.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Camelina sativa]
Length=345

 Score =   125 bits (313),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  209  KEEPDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNVHGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>gb|KDO41284.1| hypothetical protein CISIN_1g019332mg [Citrus sinensis]
Length=342

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+  LKRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  206  KEEPDLNEALKRYFPEGIDIYFENVGGKMLDAVLLNMKIHGRIAVCGMISQYNLDRPEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNL  L++KR+RMEG
Sbjct  266  HNLMYLVTKRVRMEG  280



>ref|XP_010485644.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
[Camelina sativa]
Length=346

 Score =   125 bits (313),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DL+A LKR FP GID+YFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE  EG+
Sbjct  210  KEEKDLNAALKRCFPEGIDVYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEDQEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  270  HNLATVIYKRIRIQG  284



>ref|XP_010453874.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Camelina sativa]
Length=345

 Score =   124 bits (312),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  209  KEEPDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNVHGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>ref|XP_008343886.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus 
domestica]
Length=403

 Score =   125 bits (314),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M ++GRIAVCGMISQY L++ EG 
Sbjct  267  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLQNMRVNGRIAVCGMISQYTLDQREGC  326

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+SK++RM+G
Sbjct  327  HNLIYLVSKQVRMQG  341



>ref|XP_008383957.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus 
domestica]
Length=403

 Score =   125 bits (314),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M ++GRIAVCGMISQY L++ EG 
Sbjct  267  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLQNMRVNGRIAVCGMISQYTLDQREGC  326

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+SK++RM+G
Sbjct  327  HNLIYLVSKQVRMQG  341



>gb|AAX99161.1| 2-alkenal reductase [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   124 bits (312),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+ATLKR FP GIDIYFENVGG MLDAVL  M LHGR++VCGMISQYNLE+ +G+
Sbjct  211  KKEQDLNATLKRCFPEGIDIYFENVGGAMLDAVLLNMRLHGRVSVCGMISQYNLEQLDGV  270

Query  182  HNLFCLISKRIRMEG  226
             NLF +++KRIRMEG
Sbjct  271  RNLFHIVAKRIRMEG  285



>ref|XP_007033622.1| Zinc-binding dehydrogenase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY04548.1| Zinc-binding dehydrogenase family protein isoform 2 [Theobroma 
cacao]
Length=161

 Score =   120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  24   KEEPDLNAALKRYFPEGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGMISQYNLDQPEGV  83

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ K +R+EG
Sbjct  84   HNLMTIVYKTVRIEG  98



>ref|XP_009366242.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Pyrus 
x bretschneideri]
Length=362

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIY+ENVGGKMLDAVL  M LHGRIAVCGMISQYN E+H G+
Sbjct  226  KEEPDLNAALKRYFPEGIDIYWENVGGKMLDAVLMNMRLHGRIAVCGMISQYNFEEHVGV  285

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KR+RMEG
Sbjct  286  HNLMHLIYKRVRMEG  300



>ref|XP_006372685.1| hypothetical protein POPTR_0017s03860g [Populus trichocarpa]
 gb|ERP50482.1| hypothetical protein POPTR_0017s03860g [Populus trichocarpa]
Length=359

 Score =   124 bits (312),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIA+CGMISQYNLE+ E +
Sbjct  223  KEEHDLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRHHGRIALCGMISQYNLEQPESV  282

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ K+IRMEG
Sbjct  283  HNLIAVLFKQIRMEG  297



>gb|EYU17597.1| hypothetical protein MIMGU_mgv1a019756mg [Erythranthe guttata]
Length=283

 Score =   123 bits (309),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEK-HEG  178
            KEE++LDA LKRYFPNGIDIY ENVGG+MLDAVL  M ++GRIAVCGMISQYNLE   EG
Sbjct  145  KEERNLDAALKRYFPNGIDIYLENVGGRMLDAVLLNMRVNGRIAVCGMISQYNLEHPDEG  204

Query  179  IHNLFCLISKRIRMEG  226
              NL CL++KRIRMEG
Sbjct  205  TRNLLCLVTKRIRMEG  220



>ref|XP_010039347.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
Length=348

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIAVCGMISQYNLE+ EGI
Sbjct  212  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAVCGMISQYNLEQPEGI  271

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  272  HNLTNFILKRIRMEG  286



>ref|XP_002443063.1| hypothetical protein SORBIDRAFT_08g007270 [Sorghum bicolor]
 gb|EES16901.1| hypothetical protein SORBIDRAFT_08g007270 [Sorghum bicolor]
Length=353

 Score =   124 bits (312),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDLDA L+RYFP GIDIYFENVGG+ L+AVL  M  HGRI  CGMISQYNLE+ EG+
Sbjct  217  KKEQDLDAALRRYFPEGIDIYFENVGGRTLEAVLSNMRNHGRIPTCGMISQYNLEEPEGV  276

Query  182  HNLFCLISKRIRMEG  226
            HNLF +++KR+RMEG
Sbjct  277  HNLFQIVAKRLRMEG  291



>ref|XP_002275595.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Vitis vinifera]
Length=344

 Score =   124 bits (312),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL   LKRYFP GIDIYFENVGG MLDAVLP M +HGRIA CGMISQYNL+K EGI
Sbjct  208  KEEQDLATCLKRYFPEGIDIYFENVGGAMLDAVLPNMRVHGRIAACGMISQYNLDKPEGI  267

Query  182  HNLFCLISKRIRMEG  226
            +NL  +I+K+I+M+G
Sbjct  268  YNLMNVINKQIKMQG  282



>dbj|BAJ87887.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   124 bits (312),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+ATLKR FP GIDIYFENVGG MLDAVL  M LHGR++VCGMISQYNLE+ +G+
Sbjct  211  KKEQDLNATLKRCFPEGIDIYFENVGGAMLDAVLLNMRLHGRVSVCGMISQYNLEQLDGV  270

Query  182  HNLFCLISKRIRMEG  226
             NLF +++KRIRMEG
Sbjct  271  RNLFHIVAKRIRMEG  285



>gb|EAY82645.1| hypothetical protein OsI_37864 [Oryza sativa Indica Group]
Length=261

 Score =   122 bits (307),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DL+ATLKR FP+GIDIYFENVGG MLDAVLP M + GRIA CGMISQYNLE+ EG+
Sbjct  125  KKELDLEATLKRCFPDGIDIYFENVGGAMLDAVLPNMRVAGRIAACGMISQYNLEQPEGV  184

Query  182  HNLFCLISKRIRMEG  226
            +N  C+++KR+RM+G
Sbjct  185  YNTICIVTKRLRMQG  199



>ref|XP_002873802.1| hypothetical protein ARALYDRAFT_909686 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50061.1| hypothetical protein ARALYDRAFT_909686 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   124 bits (312),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GIDIYFENVGGKMLDAVL  MN HGRIAVCGMISQYNLE  EG+
Sbjct  210  KEEPDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  270  HNLSNIIYKRIRIQG  284



>ref|XP_002873801.1| AT-AER [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50060.1| AT-AER [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score =   124 bits (311),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FPNGIDIYFENVGGKML+AVL  MN HGRIAVCGMISQYNLE  EG+
Sbjct  209  KEEPDLTAALKRCFPNGIDIYFENVGGKMLNAVLVNMNPHGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>ref|XP_006372331.1| hypothetical protein POPTR_0017s006402g, partial [Populus trichocarpa]
 gb|ERP50128.1| hypothetical protein POPTR_0017s006402g, partial [Populus trichocarpa]
Length=153

 Score =   120 bits (300),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP+GIDIYFENVGGKMLDAV+  M + GRI+VCGM+SQYNLE+ EG+
Sbjct  17   KEELDLDAALKRYFPDGIDIYFENVGGKMLDAVVLNMRVRGRISVCGMVSQYNLEQPEGV  76

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KRI MEG
Sbjct  77   HNLMHLVPKRIHMEG  91



>gb|KDP35119.1| hypothetical protein JCGZ_10653 [Jatropha curcas]
Length=345

 Score =   124 bits (311),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+D DA LKRYFPNGIDIYFENVGGKMLDAVL  M +HGRIA CGMISQY+LE  EG+
Sbjct  209  KEEKDFDAALKRYFPNGIDIYFENVGGKMLDAVLLNMRVHGRIAACGMISQYDLEHPEGV  268

Query  182  HNLFCLISKRIRMEG  226
             NL  ++ KRIRMEG
Sbjct  269  TNLMQIVYKRIRMEG  283



>ref|XP_006494867.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
isoform X1 [Citrus sinensis]
 ref|XP_006494868.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
isoform X2 [Citrus sinensis]
 ref|XP_006494869.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
isoform X3 [Citrus sinensis]
 ref|XP_006494870.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
isoform X4 [Citrus sinensis]
 ref|XP_006494871.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
isoform X5 [Citrus sinensis]
 ref|XP_006494872.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
isoform X6 [Citrus sinensis]
Length=168

 Score =   120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP G+DIYFENVGGKMLDAV   M + GRIAVCGMISQYNLEK EG+
Sbjct  32   KEEPDLDAALKRCFPEGVDIYFENVGGKMLDAVRLNMRIRGRIAVCGMISQYNLEKSEGV  91

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRIRMEG
Sbjct  92   HNLMQVVGKRIRMEG  106



>ref|XP_002309725.1| hypothetical protein POPTR_0007s00690g [Populus trichocarpa]
 gb|EEE90175.1| hypothetical protein POPTR_0007s00690g [Populus trichocarpa]
Length=345

 Score =   124 bits (311),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKRYFP GIDIYFENVGGKMLDAVL  M   GRIA CGMISQYNLEKHEG+
Sbjct  209  KEEPDLTAALKRYFPEGIDIYFENVGGKMLDAVLANMRTLGRIAACGMISQYNLEKHEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ K+IRM+G
Sbjct  269  HNLTLIVWKQIRMQG  283



>ref|XP_011047622.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Populus 
euphratica]
 ref|XP_011005273.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Populus 
euphratica]
Length=348

 Score =   124 bits (311),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A L RYFP GIDIYFENVGGKMLDAVLP M L GRIAVCGMISQYNL+K EG+
Sbjct  212  KEEPDLNAALGRYFPEGIDIYFENVGGKMLDAVLPNMRLRGRIAVCGMISQYNLDKPEGV  271

Query  182  HNLFCLISKRIRMEG  226
             NL  ++ KR+R+EG
Sbjct  272  FNLMTVVYKRVRIEG  286



>ref|XP_010506197.1| PREDICTED: NADP-dependent alkenal double bond reductase P1 [Camelina 
sativa]
Length=346

 Score =   124 bits (311),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKR FP GID+YFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE  EG+
Sbjct  210  KEENDLNAALKRCFPEGIDVYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEDQEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  270  HNLATVIYKRIRIQG  284



>emb|CAC01711.1| quinone oxidoreductase-like protein [Arabidopsis thaliana]
Length=311

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FPNGIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  175  KEEPDLSAALKRCFPNGIDIYFENVGGKMLDAVLMNMNMHGRIAVCGMISQYNLENQEGV  234

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  235  HNLSNIIYKRIRIQG  249



>ref|XP_010039350.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Eucalyptus grandis]
Length=348

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIAVCGMISQYNLE+ EGI
Sbjct  212  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAVCGMISQYNLEQPEGI  271

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  272  HNLTNFILKRIRMEG  286



>gb|EMT31634.1| Putative NADP-dependent oxidoreductase P1 [Aegilops tauschii]
Length=208

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E+DL+A LKR FP GIDIYFENVGG ML AVLP M ++GRIAVCGMISQYNLE+  G 
Sbjct  72   KKEEDLNAALKRCFPQGIDIYFENVGGAMLAAVLPNMRMNGRIAVCGMISQYNLEQPNGA  131

Query  182  HNLFCLISKRIRMEG  226
             NLFCL++KRIRMEG
Sbjct  132  PNLFCLVAKRIRMEG  146



>ref|XP_010046552.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
 gb|KCW88795.1| hypothetical protein EUGRSUZ_A01134 [Eucalyptus grandis]
Length=208

 Score =   121 bits (303),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M   GRIA CGM SQYNLE+HEGI
Sbjct  72   KEEADLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMKSCGRIAACGMSSQYNLEQHEGI  131

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI K++RMEG
Sbjct  132  HNLMNLILKQVRMEG  146



>ref|XP_006415911.1| hypothetical protein EUTSA_v10009666mg [Eutrema salsugineum]
 gb|ESQ34264.1| hypothetical protein EUTSA_v10009666mg [Eutrema salsugineum]
Length=351

 Score =   124 bits (311),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKR FP GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE  EG+
Sbjct  215  KEEQDLNAALKRCFPEGIDIYFENVGGKMLDAVLINMKLHGRIAVCGMISQYNLEDPEGV  274

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRI+++G
Sbjct  275  HNLATILYKRIKLQG  289



>ref|XP_010069210.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
 gb|KCW57489.1| hypothetical protein EUGRSUZ_H00257 [Eucalyptus grandis]
Length=355

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    EEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGIH  184
            +EQDLDA LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYN++K EG+ 
Sbjct  220  KEQDLDAALKRYFPQGIDIYFENVGGKMLDAVLLNMRLHGRIAVCGMISQYNMDKPEGVK  279

Query  185  NLFCLISKRIRMEG  226
            NL  L+ KR+RMEG
Sbjct  280  NLMLLVYKRLRMEG  293



>ref|XP_008465751.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Cucumis 
melo]
Length=350

 Score =   124 bits (311),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL++ LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIAVCGMISQYNLEK EG+
Sbjct  210  KEESDLNSALKRYFPKGIDIYFENVGGKMLDAVLVNMREHGRIAVCGMISQYNLEKPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ +RIR++G
Sbjct  270  HNLLNIVLQRIRVQG  284



>ref|NP_001190322.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
 gb|AED92366.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
Length=305

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FPNGIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  169  KEEPDLSAALKRCFPNGIDIYFENVGGKMLDAVLMNMNMHGRIAVCGMISQYNLENQEGV  228

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  229  HNLSNIIYKRIRIQG  243



>gb|KCW59210.1| hypothetical protein EUGRSUZ_H01871 [Eucalyptus grandis]
Length=370

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIA+CGMISQYNLE+ EGI
Sbjct  234  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAICGMISQYNLEQPEGI  293

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  294  HNLTNFILKRIRMEG  308



>emb|CDP08092.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP+GIDIYF+NVGGKMLDAVL  M  H RIA CGMISQYNLE+ EG+
Sbjct  210  KEETDLNAALKRYFPDGIDIYFDNVGGKMLDAVLLHMTFHSRIAACGMISQYNLEQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NL CLI+KRIRMEG
Sbjct  270  CNLMCLIAKRIRMEG  284



>gb|EEC69038.1| hypothetical protein OsI_37853 [Oryza sativa Indica Group]
Length=439

 Score =   125 bits (313),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DLDA LKRYFP GIDIYFENVGG  LDAVLP M L GRIA CGMISQYNL   +G+
Sbjct  303  KKELDLDAALKRYFPEGIDIYFENVGGATLDAVLPNMRLRGRIAACGMISQYNLANPDGV  362

Query  182  HNLFCLISKRIRMEG  226
            HNLF +++KR+RMEG
Sbjct  363  HNLFYIVTKRLRMEG  377



>ref|XP_004960755.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Setaria italica]
Length=352

 Score =   124 bits (311),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+A L+RYFP GIDIYFENVGG ML+AVL  M +HGRI VCGMISQYNLE+ EG+
Sbjct  216  KKEQDLNAALQRYFPEGIDIYFENVGGTMLEAVLLNMRVHGRITVCGMISQYNLEQPEGV  275

Query  182  HNLFCLISKRIRMEG  226
             NL  LI+KR+RMEG
Sbjct  276  RNLLSLITKRVRMEG  290



>dbj|BAJ88221.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=187

 Score =   120 bits (301),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+ATLKR FP GIDIYFENVGG MLDAVL  M LHGR+ VCGMISQYNLE+ +G+
Sbjct  59   KKEQDLNATLKRCFPEGIDIYFENVGGAMLDAVLVNMRLHGRVCVCGMISQYNLEQLDGV  118

Query  182  HNLFCLISKRIRMEG  226
             NLF +++KRIRMEG
Sbjct  119  RNLFYIVAKRIRMEG  133



>ref|XP_007033621.1| Zinc-binding dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04547.1| Zinc-binding dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=350

 Score =   124 bits (310),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  213  KEEPDLNAALKRYFPEGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGMISQYNLDQPEGV  272

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ K +R+EG
Sbjct  273  HNLMTIVYKTVRIEG  287



>ref|XP_011004573.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Populus euphratica]
Length=390

 Score =   124 bits (312),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIA+CGMISQYNLE+ E +
Sbjct  254  KEEHDLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRHHGRIALCGMISQYNLEQPESV  313

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ K+IRMEG
Sbjct  314  HNLIAVLFKQIRMEG  328



>ref|XP_009401137.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Musa 
acuminata subsp. malaccensis]
Length=345

 Score =   124 bits (310),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DLDA LKR FP+GIDIYFENVGGKMLDAVL  M +HGRIAVCG+ISQYNL + EGI
Sbjct  209  KEEEDLDAALKRCFPDGIDIYFENVGGKMLDAVLLNMRVHGRIAVCGLISQYNLTQREGI  268

Query  182  HNLFCLISKRIRMEG  226
            +N+  +++KRI+M+G
Sbjct  269  YNMTAIVTKRIKMQG  283



>emb|CDP08118.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   124 bits (310),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQ LDA LKRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCG+ISQYNLEK EG+
Sbjct  215  KEEQGLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRMHGRIAVCGLISQYNLEKPEGL  274

Query  182  HNLFCLISKRIRMEG  226
            +N+  ++ KR+R+EG
Sbjct  275  YNVASILFKRLRVEG  289



>ref|XP_008455239.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Cucumis 
melo]
Length=344

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKR FP GIDIYFENVGGKMLDAVL  M  HGRIAVCGMISQYNL++ EG+
Sbjct  208  KEEQDLDAALKRCFPEGIDIYFENVGGKMLDAVLLNMRPHGRIAVCGMISQYNLDQSEGV  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ +RIRMEG
Sbjct  268  HNLLRLVVQRIRMEG  282



>ref|XP_006350133.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Solanum 
tuberosum]
Length=297

 Score =   123 bits (308),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  35   RYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGIHNLFCLISKRI  214
            RYFPNGIDIYFENVGGKMLDAVL  M L GRIAVCGMISQYNLEK EG+HNLFCLI+KRI
Sbjct  172  RYFPNGIDIYFENVGGKMLDAVLVNMKLRGRIAVCGMISQYNLEKTEGVHNLFCLITKRI  231

Query  215  RMEG  226
            RMEG
Sbjct  232  RMEG  235



>ref|XP_006663914.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Oryza 
brachyantha]
Length=346

 Score =   124 bits (310),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DLD  LKRYFP GIDIYF+NVGG  LDAVLP M L GRIA CGMISQYNLE  +G+
Sbjct  210  KKELDLDTALKRYFPEGIDIYFDNVGGSTLDAVLPNMRLFGRIAACGMISQYNLESPDGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNLF +I+KR+RMEG
Sbjct  270  HNLFYIITKRLRMEG  284



>ref|XP_003578764.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Brachypodium 
distachyon]
Length=349

 Score =   124 bits (310),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+A LKR FP GIDIYFENVGG MLDAVL  M  HGRIA CGMISQYNLE+ EG+
Sbjct  213  KKEQDLNAALKRCFPEGIDIYFENVGGAMLDAVLLNMRNHGRIAACGMISQYNLEQQEGV  272

Query  182  HNLFCLISKRIRMEG  226
             NL C+++KRIRMEG
Sbjct  273  RNLLCVVAKRIRMEG  287



>ref|XP_008243061.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Prunus 
mume]
Length=348

 Score =   124 bits (310),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGG +LDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  213  KEEHDLNAALKRYFPEGIDIYFENVGGNLLDAVLLNMRVHGRIAVCGMISQYNLDRPEGV  272

Query  182  HNLFCLISKRIRMEG  226
             NL CL+ KRI M+G
Sbjct  273  TNLMCLVYKRIHMQG  287



>gb|KDO37346.1| hypothetical protein CISIN_1g018404mg [Citrus sinensis]
Length=356

 Score =   124 bits (310),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFE+VGGKMLDAVL  M LHGRIA CGMISQYNL + EG+
Sbjct  220  KEENDLDAALKRCFPEGIDIYFEHVGGKMLDAVLLNMRLHGRIAACGMISQYNLSQPEGV  279

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRIRMEG
Sbjct  280  HNLMNVVYKRIRMEG  294



>gb|KCW45036.1| hypothetical protein EUGRSUZ_L01373 [Eucalyptus grandis]
Length=214

 Score =   120 bits (302),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    EEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGIH  184
            +EQDLDA LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIAVCGMISQYN++K EG+ 
Sbjct  79   KEQDLDAALKRYFPQGIDIYFENVGGKMLDAVLLNMRPHGRIAVCGMISQYNMDKPEGVK  138

Query  185  NLFCLISKRIRMEG  226
            NL  L+ KR+RMEG
Sbjct  139  NLMLLVYKRLRMEG  152



>ref|NP_001066433.1| Os12g0226900 [Oryza sativa Japonica Group]
 gb|ABA96821.1| NADP-dependent oxidoreductase P2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29452.1| Os12g0226900 [Oryza sativa Japonica Group]
 gb|EAZ20022.1| hypothetical protein OsJ_35618 [Oryza sativa Japonica Group]
 dbj|BAG92593.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96636.1| unnamed protein product [Oryza sativa Japonica Group]
Length=346

 Score =   123 bits (309),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DL+A L+RYFP GIDIYFENVGG+ LDAVLP M L GRIA CGMISQYNLE+ EG+
Sbjct  210  KKEPDLEAALRRYFPEGIDIYFENVGGETLDAVLPNMRLGGRIAACGMISQYNLERPEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NLF +++KR+RMEG
Sbjct  270  KNLFYIVTKRLRMEG  284



>emb|CDX70729.1| BnaC03g08130D [Brassica napus]
Length=473

 Score =   124 bits (312),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  287  KDEGDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNMHGRIAVCGMISQYNLEDQEGV  346

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  347  HNLTSIIYKRIRIQG  361



>ref|XP_010070438.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Eucalyptus grandis]
Length=340

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFEN GGKMLDAVL  M  HGRI VCGM+SQYNLE+HEGI
Sbjct  204  KEELDLDAALKRCFPKGIDIYFENFGGKMLDAVLLNMKFHGRITVCGMVSQYNLERHEGI  263

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KR+RMEG
Sbjct  264  HNLINLVLKRVRMEG  278



>ref|XP_008455240.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Cucumis 
melo]
Length=344

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKR FP GIDIYFENVGGKMLDAVL  M  HGRIAVCGMISQYNL++ EG+
Sbjct  208  KEEQDLDAALKRCFPEGIDIYFENVGGKMLDAVLLNMRPHGRIAVCGMISQYNLDQSEGV  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ +RIRMEG
Sbjct  268  HNLLHLVLQRIRMEG  282



>ref|XP_010070437.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Eucalyptus grandis]
Length=344

 Score =   123 bits (309),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFEN GGKMLDAVL  M  HGRI VCGM+SQYNLE+HEGI
Sbjct  208  KEELDLDAALKRCFPKGIDIYFENFGGKMLDAVLLNMKFHGRITVCGMVSQYNLERHEGI  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KR+RMEG
Sbjct  268  HNLINLVLKRVRMEG  282



>ref|NP_197202.2| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
 gb|AAL24178.1| AT5g16970/F2K13_120 [Arabidopsis thaliana]
 gb|AAN12951.1| putative quinone oxidoreductase [Arabidopsis thaliana]
 gb|AED92368.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
Length=345

 Score =   123 bits (309),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GIDIYFENVGGKMLDAVL  MN HGRIAVCGMISQYNLE  EG+
Sbjct  209  KEEPDLSAALKRCFPTGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>ref|XP_011004565.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Populus 
euphratica]
Length=348

 Score =   123 bits (309),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYF +GIDIYFENVGGKMLDAVL  M +HGRI VCGM+SQYNLE+ EG+
Sbjct  212  KEELDLDAALKRYFLDGIDIYFENVGGKMLDAVLLNMRVHGRICVCGMVSQYNLEQPEGV  271

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+ KRI MEG
Sbjct  272  HNLMHLVPKRIHMEG  286



>gb|AAL38796.1| putative quinone oxidoreductase [Arabidopsis thaliana]
Length=345

 Score =   123 bits (309),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GIDIYFENVGGKMLDAVL  MN HGRIAVCGMISQYNLE  EG+
Sbjct  209  KEEPDLSAALKRCFPTGIDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>ref|XP_006478544.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Citrus 
sinensis]
 gb|KDO37347.1| hypothetical protein CISIN_1g018404mg [Citrus sinensis]
Length=346

 Score =   123 bits (309),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFE+VGGKMLDAVL  M LHGRIA CGMISQYNL + EG+
Sbjct  210  KEENDLDAALKRCFPEGIDIYFEHVGGKMLDAVLLNMRLHGRIAACGMISQYNLSQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRIRMEG
Sbjct  270  HNLMNVVYKRIRMEG  284



>ref|XP_011073997.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Sesamum indicum]
Length=344

 Score =   123 bits (309),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE D +A LKRYFPNGIDIYF+NVGGKMLDAVL  M LHGRI+ CGMISQY++++ EG+
Sbjct  208  KEEPDFNAALKRYFPNGIDIYFDNVGGKMLDAVLLNMRLHGRISACGMISQYDVQELEGV  267

Query  182  HNLFCLISKRIRMEG  226
             NLF +++KRIRMEG
Sbjct  268  KNLFNVVTKRIRMEG  282



>ref|XP_011073998.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Sesamum indicum]
Length=341

 Score =   123 bits (308),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE D +A LKRYFPNGIDIYF+NVGGKMLDAVL  M LHGRI+ CGMISQY++++ EG+
Sbjct  205  KEEPDFNAALKRYFPNGIDIYFDNVGGKMLDAVLLNMRLHGRISACGMISQYDVQELEGV  264

Query  182  HNLFCLISKRIRMEG  226
             NLF +++KRIRMEG
Sbjct  265  KNLFNVVTKRIRMEG  279



>ref|XP_010672489.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Beta 
vulgaris subsp. vulgaris]
Length=346

 Score =   123 bits (308),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DLDA L+RYFP GIDIYFENVGGKML+AVL  M  +GRI VCGMISQYNL + EG+
Sbjct  210  KEEEDLDAALRRYFPEGIDIYFENVGGKMLEAVLSNMRNNGRIPVCGMISQYNLVQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNLF + +KRIRMEG
Sbjct  270  HNLFNITTKRIRMEG  284



>ref|XP_010101346.1| NADP-dependent alkenal double bond reductase P1 [Morus notabilis]
 gb|EXB88293.1| NADP-dependent alkenal double bond reductase P1 [Morus notabilis]
Length=345

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DLDA LKRYFP GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQY+L++ EG+
Sbjct  209  KEEKDLDAALKRYFPQGIDIYFENVGGKMLDAVLLNMRLHGRIAVCGMISQYDLDEPEGV  268

Query  182  HNLFCLISKRIRMEG  226
             NL  L+ KRIRM+G
Sbjct  269  RNLMYLVFKRIRMQG  283



>ref|XP_011047623.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Populus 
euphratica]
 ref|XP_011005276.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Populus 
euphratica]
Length=345

 Score =   123 bits (308),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKRYFP GIDIYFENVGGKMLDAVL  M   GRIA CGMISQYNLEKHEG+
Sbjct  209  KEEPDLTAALKRYFPEGIDIYFENVGGKMLDAVLANMRNLGRIAACGMISQYNLEKHEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ K+IRM+G
Sbjct  269  HNLTLIVWKQIRMQG  283



>ref|XP_006858754.1| hypothetical protein AMTR_s00066p00139190 [Amborella trichopoda]
 gb|ERN20221.1| hypothetical protein AMTR_s00066p00139190 [Amborella trichopoda]
Length=346

 Score =   122 bits (307),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GIDIYFENVGG MLDAVL  M   GRIAVCG+ISQYN EK EG+
Sbjct  210  KEENDLVAALKRCFPQGIDIYFENVGGPMLDAVLLNMREKGRIAVCGLISQYNREKPEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NLFCLISKRIRMEG
Sbjct  270  FNLFCLISKRIRMEG  284



>ref|XP_006645151.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Oryza 
brachyantha]
Length=353

 Score =   123 bits (308),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKRYFP GIDIYFENVGG+MLDAVL  M +HGRIAVCGM+SQ+ L    GI
Sbjct  217  KEEPDLTAALKRYFPEGIDIYFENVGGQMLDAVLLNMRVHGRIAVCGMVSQHGLTDPVGI  276

Query  182  HNLFCLISKRIRMEG  226
            HNL+CL+ KRIRM+G
Sbjct  277  HNLYCLVPKRIRMQG  291



>emb|CAA89262.1| zeta-crystallin homologue [Arabidopsis thaliana]
Length=342

 Score =   122 bits (307),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GID+YFENVGGKMLDAVL  MN HGRIAVCGMISQYNLE  EG+
Sbjct  206  KEESDLSAALKRCFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGV  265

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  266  HNLSNIIYKRIRIQG  280



>ref|XP_008343890.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Malus domestica]
Length=353

 Score =   122 bits (307),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+ATLKRYF  GIDIYFENVGGK LDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  217  KEEHDLNATLKRYFXEGIDIYFENVGGKFLDAVLLNMRVHGRIAVCGMISQYNLDQPEGV  276

Query  182  HNLFCLISKRIRMEG  226
             NL CL+ KRI M+G
Sbjct  277  TNLMCLVYKRIHMQG  291



>ref|XP_008343891.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Malus domestica]
Length=350

 Score =   122 bits (307),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+ATLKRYF  GIDIYFENVGGK LDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  214  KEEHDLNATLKRYFXEGIDIYFENVGGKFLDAVLLNMRVHGRIAVCGMISQYNLDQPEGV  273

Query  182  HNLFCLISKRIRMEG  226
             NL CL+ KRI M+G
Sbjct  274  TNLMCLVYKRIHMQG  288



>ref|XP_010549823.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010549825.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
isoform X2 [Tarenaya hassleriana]
Length=354

 Score =   122 bits (307),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP+GIDIYFENVGGKMLDAVL  M ++GRIAVCGMISQYNLE  EG+
Sbjct  218  KEEPDLDAALKRCFPDGIDIYFENVGGKMLDAVLLNMRMNGRIAVCGMISQYNLEDPEGV  277

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  278  HNLATVIYKRIRIQG  292



>ref|NP_197201.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
 sp|Q39173.2|P2_ARATH RecName: Full=NADP-dependent alkenal double bond reductase P2 
[Arabidopsis thaliana]
 emb|CAC01712.1| quinone oxidoreductase-like protein [Arabidopsis thaliana]
 gb|AAL38729.1| putative quinone oxidoreductase [Arabidopsis thaliana]
 gb|AAM14259.1| putative quinone oxidoreductase [Arabidopsis thaliana]
 gb|AED92367.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
Length=343

 Score =   122 bits (307),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GID+YFENVGGKMLDAVL  MN HGRIAVCGMISQYNLE  EG+
Sbjct  207  KEESDLSAALKRCFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  267  HNLSNIIYKRIRIQG  281



>gb|AAM63201.1| quinone oxidoreductase-like protein [Arabidopsis thaliana]
Length=343

 Score =   122 bits (307),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GID+YFENVGGKMLDAVL  MN HGRIAVCGMISQYNLE  EG+
Sbjct  207  KEESDLSAALKRCFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGV  266

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  267  HNLSNIIYKRIRIQG  281



>emb|CDP08122.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   122 bits (307),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR+FP GIDIYFENVGGKMLDAVL  MN+ GRIAVCGMISQYNL++ EG+
Sbjct  214  KEEHDLDAALKRHFPQGIDIYFENVGGKMLDAVLLNMNMFGRIAVCGMISQYNLDEPEGV  273

Query  182  HNLFCLISKRIRMEG  226
             NL  LI KRI M G
Sbjct  274  KNLMWLIHKRINMRG  288



>gb|EYU34265.1| hypothetical protein MIMGU_mgv1a024393mg [Erythranthe guttata]
Length=326

 Score =   122 bits (306),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEK-HEG  178
            KE+ +LDA LK YFPNGIDIYFENVGGKMLDAVL  M ++GRIAVCGMISQYNLE   EG
Sbjct  189  KEKPNLDAALKSYFPNGIDIYFENVGGKMLDAVLLNMRVNGRIAVCGMISQYNLENPDEG  248

Query  179  IHNLFCLISKRIRMEG  226
              NL CL++KRIRMEG
Sbjct  249  TRNLLCLVTKRIRMEG  264



>gb|EMS56753.1| putative NADP-dependent oxidoreductase P1 [Triticum urartu]
Length=208

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E+DL+A LKR FP GIDIYFENVGG ML AVLP M ++GRI VCGMISQYNLE+  G 
Sbjct  72   KKEEDLNAALKRCFPQGIDIYFENVGGAMLAAVLPNMRMNGRITVCGMISQYNLEQPNGA  131

Query  182  HNLFCLISKRIRMEG  226
             NLFCL++KRIRMEG
Sbjct  132  PNLFCLVAKRIRMEG  146



>gb|ABA96822.1| NADP-dependent oxidoreductase P1, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ20023.1| hypothetical protein OsJ_35620 [Oryza sativa Japonica Group]
 dbj|BAH01658.1| unnamed protein product [Oryza sativa Japonica Group]
Length=346

 Score =   122 bits (306),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E DL+A LKR FP+GIDIYFENVGG MLDAVLP M + GRIA CGMISQYNLE+ EG+
Sbjct  210  KKELDLEAALKRCFPDGIDIYFENVGGAMLDAVLPNMRVAGRIAACGMISQYNLEQPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            +N+ C+++KR+RM+G
Sbjct  270  YNMICIVTKRLRMQG  284



>gb|KCW59214.1| hypothetical protein EUGRSUZ_H01875 [Eucalyptus grandis]
Length=290

 Score =   121 bits (304),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFE  GGKMLDAVL  M LHGRIAVCG+ISQYNLE+ EG+
Sbjct  175  KEELDLDAALKRCFPEGIDIYFEIFGGKMLDAVLLNMKLHGRIAVCGLISQYNLEQPEGV  234

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KR+RMEG
Sbjct  235  HNLTNLILKRVRMEG  249



>ref|XP_004137045.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Cucumis sativus]
Length=327

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKR FP GIDIYFENVGGKMLDAVL  M  HGRIAVCGMISQYNL++ EG+
Sbjct  191  KEEQDLDAALKRCFPEGIDIYFENVGGKMLDAVLLNMRPHGRIAVCGMISQYNLDQSEGV  250

Query  182  HNLFCLISKRIRMEG  226
            HNL  L  +RIRMEG
Sbjct  251  HNLLQLAIQRIRMEG  265



>ref|XP_010453876.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
[Camelina sativa]
Length=345

 Score =   122 bits (306),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GIDIYFENVGGKMLDAVL  MN+ GRIAVCGMISQYNLE  EG+
Sbjct  209  KEEPDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNVKGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>ref|XP_002309722.1| NADP-dependent oxidoreductase family protein [Populus trichocarpa]
 gb|ABK93507.1| unknown [Populus trichocarpa]
 gb|EEE90172.1| NADP-dependent oxidoreductase family protein [Populus trichocarpa]
Length=348

 Score =   122 bits (306),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A L RYFP GIDIYFENVGGKMLDAVLP M   GRIAVCGMISQYNL+K EG+
Sbjct  212  KEEPDLNAALGRYFPEGIDIYFENVGGKMLDAVLPNMRFRGRIAVCGMISQYNLDKPEGV  271

Query  182  HNLFCLISKRIRMEG  226
             NL  ++ KR+R+EG
Sbjct  272  FNLMTVVYKRVRIEG  286



>ref|XP_002529812.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32561.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=352

 Score =   122 bits (306),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KE  D DA LKRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNLEK EG+
Sbjct  216  KEVPDWDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRIHGRIAVCGMISQYNLEKPEGV  275

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KR+ ++G
Sbjct  276  HNLMTIVYKRVLIKG  290



>gb|EAY82640.1| hypothetical protein OsI_37858 [Oryza sativa Indica Group]
Length=288

 Score =   121 bits (303),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+A L+R FP GIDIY+ENVGGKMLDAVLP M L GRI  CGMISQYNLE+ EG+
Sbjct  152  KKEQDLEAALRRCFPEGIDIYYENVGGKMLDAVLPNMRLGGRIVACGMISQYNLEQPEGV  211

Query  182  HNLFCLISKRIRMEG  226
             NL+ +++KR+RMEG
Sbjct  212  RNLYYIVTKRLRMEG  226



>ref|XP_006372688.1| hypothetical protein POPTR_0017s03890g [Populus trichocarpa]
 gb|ERP50485.1| hypothetical protein POPTR_0017s03890g [Populus trichocarpa]
Length=359

 Score =   122 bits (306),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIA+CGMISQYNLE+ E +
Sbjct  223  KEEHDLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRHHGRIALCGMISQYNLEQPESV  282

Query  182  HNLFCLISKRIRMEG  226
             NL  L+ K+IRMEG
Sbjct  283  QNLIALLFKQIRMEG  297



>ref|XP_002893408.1| hypothetical protein ARALYDRAFT_472786 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69667.1| hypothetical protein ARALYDRAFT_472786 [Arabidopsis lyrata subsp. 
lyrata]
Length=351

 Score =   122 bits (306),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+D  A L+RYFP GIDIYFENVGGKMLDAVL  M LHGR+AVCGMISQYNLE  EG+
Sbjct  215  KEEKDFSAALRRYFPEGIDIYFENVGGKMLDAVLINMRLHGRVAVCGMISQYNLEDPEGV  274

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRI+++G
Sbjct  275  HNLPTILYKRIQLQG  289



>gb|KDO37817.1| hypothetical protein CISIN_1g041355mg [Citrus sinensis]
Length=180

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR+FP GIDIYFENVGGKMLDAVL  M L GRIAV  +ISQYNLEK EG+
Sbjct  53   KEEPDLDAALKRWFPQGIDIYFENVGGKMLDAVLLNMRLRGRIAVSSIISQYNLEKPEGV  112

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KRIR+EG
Sbjct  113  HNLEQLIGKRIRLEG  127



>ref|XP_010549822.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
isoform X1 [Tarenaya hassleriana]
Length=432

 Score =   122 bits (307),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP+GIDIYFENVGGKMLDAVL  M ++GRIAVCGMISQYNLE  EG+
Sbjct  296  KEEPDLDAALKRCFPDGIDIYFENVGGKMLDAVLLNMRMNGRIAVCGMISQYNLEDPEGV  355

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  356  HNLATVIYKRIRIQG  370



>gb|KCW57493.1| hypothetical protein EUGRSUZ_H00260 [Eucalyptus grandis]
Length=276

 Score =   120 bits (302),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE + +A LKRYFP GIDIYF+NVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  140  KEEPNFEAALKRYFPEGIDIYFDNVGGKMLDAVLLNMRIHGRIAVCGMISQYNLDQPEGV  199

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ +R+RM+G
Sbjct  200  HNLVNIVGRRVRMQG  214



>ref|XP_004155455.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
[Cucumis sativus]
 gb|KGN43684.1| hypothetical protein Csa_7G058580 [Cucumis sativus]
Length=344

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDLDA LKR FP GIDIYFENVGGKMLDAVL  M  HGRIAVCGMISQYNL++ EG+
Sbjct  208  KEEQDLDAALKRCFPEGIDIYFENVGGKMLDAVLLNMRPHGRIAVCGMISQYNLDQSEGV  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  L  +RIRMEG
Sbjct  268  HNLLQLAIQRIRMEG  282



>ref|XP_002873803.1| hypothetical protein ARALYDRAFT_909687 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50062.1| hypothetical protein ARALYDRAFT_909687 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   122 bits (305),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN  GRIAVCGMISQYNLE  EG+
Sbjct  209  KEEQDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNPLGRIAVCGMISQYNLENQEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  269  HNLSNIIYKRIRIQG  283



>ref|XP_006372677.1| hypothetical protein POPTR_0017s03780g [Populus trichocarpa]
 gb|ERP50474.1| hypothetical protein POPTR_0017s03780g [Populus trichocarpa]
Length=346

 Score =   122 bits (305),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIA+CGMISQYNLE+ E +
Sbjct  223  KEEHDLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRYHGRIALCGMISQYNLEQPESV  282

Query  182  HNLFCLISKRIRMEG  226
             NL  ++ K IRMEG
Sbjct  283  ENLIAVLFKHIRMEG  297



>ref|XP_007134338.1| hypothetical protein PHAVU_010G039100g [Phaseolus vulgaris]
 gb|ESW06332.1| hypothetical protein PHAVU_010G039100g [Phaseolus vulgaris]
Length=343

 Score =   122 bits (305),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKRYFP GIDIYFENVGGK LDAVLP M LHGRI VCGMISQYNL + EG+
Sbjct  207  KEEPDLNAALKRYFPEGIDIYFENVGGKTLDAVLPNMRLHGRIVVCGMISQYNLTQPEGV  266

Query  182  HNLFCLISKRIRMEG  226
             NL  LI KR++MEG
Sbjct  267  TNLAHLIFKRVKMEG  281



>ref|XP_008227256.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Prunus mume]
Length=346

 Score =   122 bits (305),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+AT KRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  211  KEEADLNATFKRYFPEGIDIYFENVGGKMLDAVLLNMRVHGRIAVCGMISQYNLDQAEGV  270

Query  182  HNLFCLISKRIRMEG  226
             NL  L+ KRIR+ G
Sbjct  271  TNLMHLVYKRIRLHG  285



>gb|AEL78826.1| ketone/zingerone synthase 2 [Rubus idaeus]
Length=352

 Score =   122 bits (305),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDA LKRYFP GIDIYFENVGGKMLDAVL  M   GRIAVCGMISQYNLEK EG+
Sbjct  216  KEEPNLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRFRGRIAVCGMISQYNLEKPEGV  275

Query  182  HNLFCLISKRIRMEG  226
             NL  LI K +R++G
Sbjct  276  QNLMSLIYKEVRIQG  290



>ref|XP_006289583.1| hypothetical protein CARUB_v10003133mg [Capsella rubella]
 gb|EOA22481.1| hypothetical protein CARUB_v10003133mg [Capsella rubella]
Length=346

 Score =   121 bits (304),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL A LKR FP GIDIYFENVGGKMLDAVL  MN  GRIAVCGMISQYNLE  EG+
Sbjct  210  KEEQDLTAALKRCFPTGIDIYFENVGGKMLDAVLLNMNPLGRIAVCGMISQYNLENQEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  270  HNLSNIIYKRIRIQG  284



>gb|EMT16695.1| Putative NADP-dependent oxidoreductase P1 [Aegilops tauschii]
Length=346

 Score =   121 bits (304),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+EQDL+A LKR FP GIDIYF+NVGG MLDA L  M LHGR+A+CG+ISQYNLE HEG+
Sbjct  210  KKEQDLNAALKRCFPEGIDIYFDNVGGAMLDAALLNMRLHGRVAMCGLISQYNLELHEGV  269

Query  182  HNLFCLISKRIRMEG  226
             NL C+++KR+R+EG
Sbjct  270  RNLACVVTKRVRIEG  284



>ref|XP_008227255.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Prunus mume]
Length=351

 Score =   121 bits (304),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+AT KRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  216  KEEADLNATFKRYFPEGIDIYFENVGGKMLDAVLLNMRVHGRIAVCGMISQYNLDQAEGV  275

Query  182  HNLFCLISKRIRMEG  226
             NL  L+ KRIR+ G
Sbjct  276  TNLMHLVYKRIRLHG  290



>gb|EYU17610.1| hypothetical protein MIMGU_mgv1a024608mg [Erythranthe guttata]
Length=332

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE D +  LKRYFP+GIDIYFENVGGKML+AVL  M +HGRIAVCGMISQY+L + +G+
Sbjct  196  KEESDYNVALKRYFPDGIDIYFENVGGKMLEAVLNNMRIHGRIAVCGMISQYSLAQPDGV  255

Query  182  HNLFCLISKRIRMEG  226
            HNLF LISKRI+MEG
Sbjct  256  HNLFNLISKRIKMEG  270



>emb|CDY43153.1| BnaA05g32330D [Brassica napus]
Length=344

 Score =   121 bits (304),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKR FP GIDIYFENVGGKMLDAVL  M L+GRIAVCGMISQYNLE+ EG+
Sbjct  208  KEEQDLNAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLNGRIAVCGMISQYNLEEQEGV  267

Query  182  HNLFCLISKRIRMEG  226
             NL  +I KR+R++G
Sbjct  268  RNLSTVIYKRVRLQG  282



>ref|XP_003557079.2| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like, partial 
[Glycine max]
Length=163

 Score =   117 bits (294),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+ATLKRYFP GIDIYFENVGGK LDAVLP M + GRI VCGM+SQYNL + EG+
Sbjct  27   KEESDLNATLKRYFPEGIDIYFENVGGKTLDAVLPNMRVLGRIPVCGMVSQYNLTQPEGV  86

Query  182  HNLFCLISKRIRMEG  226
             NL  LI KRIRM+G
Sbjct  87   TNLANLIFKRIRMQG  101



>ref|XP_009130330.1| PREDICTED: NADP-dependent alkenal double bond reductase P1 [Brassica 
rapa]
Length=344

 Score =   121 bits (304),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKR FP GIDIYFENVGGKMLDAVL  M L+GRIAVCGMISQYNLE+ EG+
Sbjct  208  KEEQDLNAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLNGRIAVCGMISQYNLEEQEGV  267

Query  182  HNLFCLISKRIRMEG  226
             NL  +I KR+R++G
Sbjct  268  RNLSTVIYKRVRLQG  282



>ref|XP_010232677.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Brachypodium distachyon]
Length=631

 Score =   124 bits (311),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKRYFP GIDIYFENVGG MLDAVL  M  HGRIAVCGMISQ+ +    GI
Sbjct  495  KEEPDLMAALKRYFPEGIDIYFENVGGPMLDAVLLNMRTHGRIAVCGMISQHGMTDPVGI  554

Query  182  HNLFCLISKRIRMEG  226
            HNLFCL+SKRIRM+G
Sbjct  555  HNLFCLVSKRIRMQG  569



>ref|XP_007134335.1| hypothetical protein PHAVU_010G038800g [Phaseolus vulgaris]
 gb|ESW06329.1| hypothetical protein PHAVU_010G038800g [Phaseolus vulgaris]
Length=342

 Score =   121 bits (304),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+ TLKRYFP GIDIYFENVGGK LDAVLP M LHGRI VCGM+SQYNL + EG+
Sbjct  206  KEESDLNGTLKRYFPEGIDIYFENVGGKTLDAVLPNMRLHGRIPVCGMVSQYNLIEPEGV  265

Query  182  HNLFCLISKRIRMEG  226
             NL  LI K+IRMEG
Sbjct  266  TNLTNLIFKQIRMEG  280



>ref|XP_010069219.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X2 [Eucalyptus grandis]
Length=362

 Score =   121 bits (304),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE + +A LKRYFP GIDIYF+NVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  226  KEEPNFEAALKRYFPEGIDIYFDNVGGKMLDAVLLNMRIHGRIAVCGMISQYNLDQPEGV  285

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ +R+RM+G
Sbjct  286  HNLVNIVGRRVRMQG  300



>emb|CDY28735.1| BnaCnng06210D [Brassica napus]
Length=345

 Score =   121 bits (304),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL+A LKR FP GIDIYFENVGGKMLDAVL  M L+GRIAVCGMISQYNLE+ EG+
Sbjct  209  KEEQDLNAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLNGRIAVCGMISQYNLEEQEGV  268

Query  182  HNLFCLISKRIRMEG  226
             NL  +I KR+R++G
Sbjct  269  RNLATVIYKRVRLQG  283



>ref|XP_006372675.1| hypothetical protein POPTR_0017s03750g [Populus trichocarpa]
 gb|ERP50472.1| hypothetical protein POPTR_0017s03750g [Populus trichocarpa]
Length=293

 Score =   120 bits (301),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYF  GIDIYFENVGGKMLDAVL  M  HGRIA+CGMISQYNLE+ E +
Sbjct  157  KEEHDLDAALKRYFTEGIDIYFENVGGKMLDAVLLNMRHHGRIALCGMISQYNLEQPESV  216

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ K+IRMEG
Sbjct  217  HNLIAVLFKQIRMEG  231



>ref|XP_010026377.1| PREDICTED: uncharacterized protein LOC104416725 [Eucalyptus grandis]
Length=684

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL +M LHGRIA+CGMISQYNLE+ EGI
Sbjct  548  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLSMKLHGRIAICGMISQYNLEQPEGI  607

Query  182  HNLFCLISKRIRMEG  226
            HNL   I KRIRMEG
Sbjct  608  HNLTNFILKRIRMEG  622


 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYFENVGGKMLDAVL  M L GRIA+CG+ISQYNLE+ EG 
Sbjct  211  KEELDLDAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLRGRIALCGLISQYNLEQPEGP  270

Query  182  HNLFCLISKRIRMEG  226
            +NL  LI K++RMEG
Sbjct  271  YNLMNLILKQVRMEG  285



>gb|KCW59220.1| hypothetical protein EUGRSUZ_H01880 [Eucalyptus grandis]
Length=329

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYF+NVGGKMLDAVL  M LHGRI +CGMISQYNLE+ EGI
Sbjct  193  KEELDLDAALKRCFPEGIDIYFDNVGGKMLDAVLLNMKLHGRITLCGMISQYNLEQPEGI  252

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KR+RMEG
Sbjct  253  HNLMNLILKRVRMEG  267



>gb|KHG22546.1| NADP-dependent alkenal double bond reductase P2 -like protein 
[Gossypium arboreum]
Length=347

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M +HGRIAVCGMISQYN +K E  
Sbjct  211  KEEPDLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRVHGRIAVCGMISQYNNDKPEAT  270

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KR+RM+G
Sbjct  271  HNLMYIIPKRVRMQG  285



>ref|XP_010069218.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW57492.1| hypothetical protein EUGRSUZ_H00260 [Eucalyptus grandis]
Length=349

 Score =   121 bits (303),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE + +A LKRYFP GIDIYF+NVGGKMLDAVL  M +HGRIAVCGMISQYNL++ EG+
Sbjct  213  KEEPNFEAALKRYFPEGIDIYFDNVGGKMLDAVLLNMRIHGRIAVCGMISQYNLDQPEGV  272

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ +R+RM+G
Sbjct  273  HNLVNIVGRRVRMQG  287



>ref|XP_010070440.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform 
X4 [Eucalyptus grandis]
Length=351

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR FP GIDIYF+NVGGKMLDAVL  M LHGRI +CGMISQYNLE+ EGI
Sbjct  215  KEELDLDAALKRCFPEGIDIYFDNVGGKMLDAVLLNMKLHGRITLCGMISQYNLEQPEGI  274

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI KR+RMEG
Sbjct  275  HNLMNLILKRVRMEG  289



>ref|XP_010460322.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
isoform X1 [Camelina sativa]
Length=288

 Score =   120 bits (300),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DL+A LKR FP GIDIYFENVGGKMLDAVL  M LHGR+AVCGMISQYNLE  EG+
Sbjct  152  KEEKDLNAALKRCFPEGIDIYFENVGGKMLDAVLINMKLHGRVAVCGMISQYNLEDPEGV  211

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRI+++G
Sbjct  212  HNLPTILYKRIQIQG  226



>gb|KCW87983.1| hypothetical protein EUGRSUZ_A00392 [Eucalyptus grandis]
Length=297

 Score =   120 bits (301),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDA LKRYFP GIDIYFENVG K LDAVL  M LHGRI VCGMISQYNLE+ E +
Sbjct  184  KEESNLDAALKRYFPEGIDIYFENVGEKTLDAVLLNMKLHGRITVCGMISQYNLEQPESV  243

Query  182  HNLFCLISKRIRME  223
            HNL  LI KR+RME
Sbjct  244  HNLMQLIKKRVRME  257



>ref|XP_006372668.1| hypothetical protein POPTR_0017s03680g [Populus trichocarpa]
 gb|ERP50465.1| hypothetical protein POPTR_0017s03680g [Populus trichocarpa]
Length=359

 Score =   121 bits (303),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKRYFP GIDIYFENVGGKMLDAVL  M  HGRIA+CGMISQYNLE+ E +
Sbjct  223  KEEHDLDAALKRYFPEGIDIYFENVGGKMLDAVLLNMRHHGRIALCGMISQYNLEQPESV  282

Query  182  HNLFCLISKRIRMEG  226
             NL  ++ K IRMEG
Sbjct  283  QNLIAVLYKHIRMEG  297



>emb|CBI24733.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQDL   LKRYFP GIDIYFENVGG MLDAVLP M +HGRIA CGMISQYNL+K EGI
Sbjct  229  KEEQDLATCLKRYFPEGIDIYFENVGGAMLDAVLPNMRVHGRIAACGMISQYNLDKPEGI  288

Query  182  HNLFCLISKRIRMEG  226
            +NL  +I+K+I+M+G
Sbjct  289  YNLMNVINKQIKMQG  303



>ref|NP_001185098.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
 gb|AEE30676.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
Length=346

 Score =   120 bits (302),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+D  A LKRYFP GIDIYFENVGGKMLDAVL  M LHGR+AVCGMISQYNL   EG+
Sbjct  210  KEEKDFSAALKRYFPEGIDIYFENVGGKMLDAVLINMKLHGRVAVCGMISQYNLVDPEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRI+++G
Sbjct  270  HNLPTILYKRIQLQG  284



>ref|XP_004287170.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=348

 Score =   120 bits (302),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE +LDA LKR FP GIDIY+ENVGGKMLDAVL  M   GRIAVCGMISQYNLEK EG+
Sbjct  212  KEESNLDAALKRCFPEGIDIYYENVGGKMLDAVLLNMRSRGRIAVCGMISQYNLEKPEGV  271

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI+K +RM+G
Sbjct  272  HNLTSLIAKEVRMQG  286



>gb|AAX83111.1| alcohol dehydrogenase-like protein [Ocimum basilicum]
Length=345

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K+E+D  A LKRYFPNGIDIYF+NVGGKML+A +  M  HGRIA+CGM+SQY LE+HEG+
Sbjct  209  KDEKDYSAALKRYFPNGIDIYFDNVGGKMLEAAISNMRAHGRIAICGMVSQYGLEQHEGV  268

Query  182  HNLFCLISKRIRMEG  226
            HNLF +++K+IRM+G
Sbjct  269  HNLFTILTKQIRMQG  283



>ref|XP_010420406.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
[Camelina sativa]
Length=346

 Score =   120 bits (302),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DL A LKR FP GIDIYFENVGGKMLDAVL  MN  GRIAVCGMISQYNLE  EG+
Sbjct  210  KEEEDLSAALKRCFPTGIDIYFENVGGKMLDAVLLNMNPLGRIAVCGMISQYNLENQEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  270  HNLSNIIYKRIRIQG  284



>ref|XP_010492631.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Camelina 
sativa]
Length=374

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL A LKR FP GIDIYFENVGGKMLDAVL  MN+HGRIAVCGMISQYNLE  EG+
Sbjct  238  KEEPDLSAALKRCFPKGIDIYFENVGGKMLDAVLLNMNVHGRIAVCGMISQYNLENQEGV  297

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  298  HNLSNIIYKRIRIQG  312



>ref|XP_010460323.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like 
isoform X2 [Camelina sativa]
Length=351

 Score =   120 bits (302),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DL+A LKR FP GIDIYFENVGGKMLDAVL  M LHGR+AVCGMISQYNLE  EG+
Sbjct  215  KEEKDLNAALKRCFPEGIDIYFENVGGKMLDAVLINMKLHGRVAVCGMISQYNLEDPEGV  274

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRI+++G
Sbjct  275  HNLPTILYKRIQIQG  289



>ref|XP_010492633.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like 
[Camelina sativa]
Length=346

 Score =   120 bits (302),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+DL A LKR FP GIDIYFENVGGKMLDAVL  MN  GRIAVCGMISQYNLE  EG+
Sbjct  210  KEEEDLSAALKRCFPTGIDIYFENVGGKMLDAVLLNMNPLGRIAVCGMISQYNLENQEGV  269

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  270  HNLSNIIYKRIRIQG  284



>gb|AAM65612.1| allyl alcohol dehydrogenase, putative [Arabidopsis thaliana]
Length=351

 Score =   120 bits (302),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+D  A LKRYFP GIDIYFENVGGKMLDAVL  M LHGR+AVCGMISQYNL   EG+
Sbjct  215  KEEKDFSAALKRYFPEGIDIYFENVGGKMLDAVLINMKLHGRVAVCGMISQYNLVDPEGV  274

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRI+++G
Sbjct  275  HNLPTILYKRIQLQG  289



>ref|NP_173956.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
 gb|AAG50689.1|AC079829_22 allyl alcohol dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAO41917.1| putative allyl alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAO50501.1| putative allyl alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AEE30675.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
Length=351

 Score =   120 bits (302),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE+D  A LKRYFP GIDIYFENVGGKMLDAVL  M LHGR+AVCGMISQYNL   EG+
Sbjct  215  KEEKDFSAALKRYFPEGIDIYFENVGGKMLDAVLINMKLHGRVAVCGMISQYNLVDPEGV  274

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KRI+++G
Sbjct  275  HNLPTILYKRIQLQG  289



>ref|XP_008455241.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Cucumis 
melo]
Length=344

 Score =   120 bits (302),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DL+A LKR FP+GIDIYFENVGGK LDAVL  M LHGRIAVCGMISQYNL++ EG+
Sbjct  208  KEEPDLNAALKRCFPDGIDIYFENVGGKTLDAVLLNMRLHGRIAVCGMISQYNLDQTEGV  267

Query  182  HNLFCLISKRIRMEG  226
            HNL  L+++RIRMEG
Sbjct  268  HNLMRLVTQRIRMEG  282



>ref|XP_010070434.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Eucalyptus 
grandis]
Length=361

 Score =   120 bits (302),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEE DLDA LKR  P GIDIYFENVGGKMLDAVL  M  HGRI VCGMISQYNLE+HEG+
Sbjct  225  KEELDLDAALKRCLPEGIDIYFENVGGKMLDAVLLNMKPHGRITVCGMISQYNLEQHEGV  284

Query  182  HNLFCLISKRIRMEG  226
            HNL  LI K++RMEG
Sbjct  285  HNLMHLIWKQVRMEG  299



>gb|KDP29827.1| hypothetical protein JCGZ_19313 [Jatropha curcas]
Length=348

 Score =   120 bits (302),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            KEEQD DA LKR FP GIDIYFENVGGKMLDAVL  +  HGR+A CGMISQYNLE  EG+
Sbjct  212  KEEQDWDAALKRSFPEGIDIYFENVGGKMLDAVLLNLRTHGRVAACGMISQYNLEHPEGV  271

Query  182  HNLFCLISKRIRMEG  226
            HNL  ++ KR+R++G
Sbjct  272  HNLMTIVYKRVRIQG  286



>ref|NP_186958.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
 gb|AAF26116.1|AC012328_19 putative NADP-dependent oxidoreductase [Arabidopsis thaliana]
 gb|AEE73899.1| zinc-binding dehydrogenase family protein [Arabidopsis thaliana]
Length=350

 Score =   120 bits (302),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    KEEQDLDATLKRYFPNGIDIYFENVGGKMLDAVLPTMNLHGRIAVCGMISQYNLEKHEGI  181
            K E DL+A LKR FP GIDIYFENVGGKMLDAVL  M LHGRIAVCGMISQYNLE  EG+
Sbjct  214  KAEPDLNAALKRCFPEGIDIYFENVGGKMLDAVLLNMKLHGRIAVCGMISQYNLEDQEGV  273

Query  182  HNLFCLISKRIRMEG  226
            HNL  +I KRIR++G
Sbjct  274  HNLANVIYKRIRIKG  288



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522609235886