BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14183_g1_i1 len=823 path=[47:0-271 319:272-279 @327@!:280-543
590:544-551 23:552-822]

Length=823
                                                                      Score     E

ref|XP_008356863.1|  PREDICTED: pentatricopeptide repeat-containi...    405   1e-135   
ref|XP_006367245.1|  PREDICTED: pentatricopeptide repeat-containi...    415   2e-134   
ref|XP_006445764.1|  hypothetical protein CICLE_v10014488mg             407   3e-134   
ref|XP_007010457.1|  Pentatricopeptide repeat-containing protein ...    409   6e-134   
ref|XP_009762336.1|  PREDICTED: pentatricopeptide repeat-containi...    408   2e-133   
ref|XP_004250470.2|  PREDICTED: pentatricopeptide repeat-containi...    410   2e-132   
ref|XP_007010456.1|  Pentatricopeptide repeat-containing protein ...    409   3e-132   
ref|XP_009619247.1|  PREDICTED: pentatricopeptide repeat-containi...    409   4e-132   
ref|XP_004236808.1|  PREDICTED: pentatricopeptide repeat-containi...    406   7e-132   
ref|XP_007213789.1|  hypothetical protein PRUPE_ppa018727m1g            402   1e-131   
ref|XP_006485466.1|  PREDICTED: pentatricopeptide repeat-containi...    407   3e-131   
gb|EYU19828.1|  hypothetical protein MIMGU_mgv1a000898mg                406   4e-131   
gb|EYU19829.1|  hypothetical protein MIMGU_mgv1a000898mg                406   4e-131   
ref|XP_011076849.1|  PREDICTED: pentatricopeptide repeat-containi...    406   4e-131   
ref|XP_008231812.1|  PREDICTED: pentatricopeptide repeat-containi...    406   6e-131   
ref|XP_010673127.1|  PREDICTED: pentatricopeptide repeat-containi...    402   1e-129   
gb|KCW65188.1|  hypothetical protein EUGRSUZ_G02683                     402   2e-129   
ref|XP_010067123.1|  PREDICTED: pentatricopeptide repeat-containi...    402   2e-129   
ref|XP_002269194.2|  PREDICTED: pentatricopeptide repeat-containi...    400   6e-129   Vitis vinifera
gb|KDP44599.1|  hypothetical protein JCGZ_22497                         399   3e-128   
ref|XP_011032910.1|  PREDICTED: pentatricopeptide repeat-containi...    397   1e-127   
ref|XP_004135367.1|  PREDICTED: pentatricopeptide repeat-containi...    397   2e-127   
ref|XP_004308615.1|  PREDICTED: pentatricopeptide repeat-containi...    395   4e-127   
gb|EPS65574.1|  hypothetical protein M569_09203                         392   6e-127   
ref|XP_008446749.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    396   7e-127   
ref|XP_011015622.1|  PREDICTED: pentatricopeptide repeat-containi...    397   7e-127   
ref|XP_010262938.1|  PREDICTED: pentatricopeptide repeat-containi...    394   2e-126   
ref|XP_002316488.2|  hypothetical protein POPTR_0010s24770g             392   9e-126   Populus trichocarpa [western balsam poplar]
gb|KDO43025.1|  hypothetical protein CISIN_1g0037492mg                  377   2e-125   
ref|XP_002515794.1|  pentatricopeptide repeat-containing protein,...    389   1e-124   Ricinus communis
ref|XP_010552883.1|  PREDICTED: pentatricopeptide repeat-containi...    382   3e-123   
emb|CDO99926.1|  unnamed protein product                                378   2e-122   
ref|XP_010552882.1|  PREDICTED: pentatricopeptide repeat-containi...    382   1e-121   
ref|XP_004514863.1|  PREDICTED: pentatricopeptide repeat-containi...    382   1e-121   
ref|XP_006605717.1|  PREDICTED: pentatricopeptide repeat-containi...    381   2e-121   
ref|XP_011024163.1|  PREDICTED: pentatricopeptide repeat-containi...    381   2e-121   
ref|XP_003556878.1|  PREDICTED: pentatricopeptide repeat-containi...    381   2e-121   
ref|XP_007145390.1|  hypothetical protein PHAVU_007G234900g             379   3e-121   
gb|KEH41294.1|  pentatricopeptide (PPR) repeat protein                  380   4e-121   
ref|XP_003535211.1|  PREDICTED: pentatricopeptide repeat-containi...    379   8e-121   
ref|XP_009122568.1|  PREDICTED: pentatricopeptide repeat-containi...    375   4e-119   
emb|CDX70202.1|  BnaA10g25510D                                          373   1e-118   
emb|CDY44879.1|  BnaC09g50790D                                          372   4e-118   
ref|XP_006398932.1|  hypothetical protein EUTSA_v10012596mg             371   1e-117   
ref|XP_002871115.1|  pentatricopeptide repeat-containing protein        369   4e-117   
ref|XP_010491001.1|  PREDICTED: pentatricopeptide repeat-containi...    369   1e-116   
gb|KHG05816.1|  Pentatricopeptide repeat-containing, chloroplasti...    368   1e-116   
ref|XP_006290044.1|  hypothetical protein CARUB_v10003679mg             368   3e-116   
ref|XP_010909108.1|  PREDICTED: pentatricopeptide repeat-containi...    366   4e-116   
ref|XP_010452382.1|  PREDICTED: pentatricopeptide repeat-containi...    367   6e-116   
ref|XP_010423534.1|  PREDICTED: pentatricopeptide repeat-containi...    367   7e-116   
gb|KHN12616.1|  Pentatricopeptide repeat-containing protein, chlo...    360   1e-115   
ref|XP_008809839.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    364   2e-115   
gb|KFK24918.1|  hypothetical protein AALP_AA8G042000                    364   5e-115   
emb|CAB86023.1|  putative protein                                       362   6e-115   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568141.2|  pentatricopeptide (PPR) repeat-containing protein     362   3e-114   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB08985.1|  membrane-associated salt-inducible protein-like        362   3e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AAL11611.1|AF424618_1  AT5g04810/MUK11_13                            362   4e-114   Arabidopsis thaliana [mouse-ear cress]
emb|CBI25022.3|  unnamed protein product                                360   1e-113   
ref|XP_011024162.1|  PREDICTED: pentatricopeptide repeat-containi...    360   4e-113   
gb|KGN52179.1|  hypothetical protein Csa_5G613570                       355   1e-111   
ref|XP_006854727.1|  hypothetical protein AMTR_s00030p00239430          352   2e-110   
ref|XP_007010458.1|  Pentatricopeptide repeat-containing protein ...    345   7e-108   
ref|XP_002310993.2|  hypothetical protein POPTR_0008s01830g             333   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_009408751.1|  PREDICTED: pentatricopeptide repeat-containi...    331   5e-103   
ref|XP_004960011.1|  PREDICTED: pentatricopeptide repeat-containi...    324   2e-100   
ref|NP_001105869.1|  pentatricopeptide repeat protein                   317   8e-98    Zea mays [maize]
ref|XP_002447352.1|  hypothetical protein SORBIDRAFT_06g033480          315   7e-97    Sorghum bicolor [broomcorn]
ref|NP_001054310.1|  Os04g0684500                                       314   2e-96    Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86163.1|  H0913C04.4                                             313   4e-96    Oryza sativa [red rice]
ref|XP_010094357.1|  Pentatricopeptide repeat-containing protein        313   9e-96    
ref|XP_006653052.1|  PREDICTED: pentatricopeptide repeat-containi...    311   3e-95    
gb|EAZ32470.1|  hypothetical protein OsJ_16686                          299   5e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580849.1|  PREDICTED: pentatricopeptide repeat-containi...    293   2e-88    
dbj|BAJ97477.1|  predicted protein                                      292   5e-88    
ref|XP_010319289.1|  PREDICTED: pentatricopeptide repeat-containi...    286   1e-87    
ref|XP_006367145.1|  PREDICTED: pentatricopeptide repeat-containi...    280   1e-85    
ref|XP_010319290.1|  PREDICTED: pentatricopeptide repeat-containi...    273   5e-83    
ref|XP_004171307.1|  PREDICTED: pentatricopeptide repeat-containi...    265   1e-82    
ref|XP_009619253.1|  PREDICTED: pentatricopeptide repeat-containi...    271   2e-82    
ref|XP_006367146.1|  PREDICTED: pentatricopeptide repeat-containi...    270   4e-82    
ref|XP_010312517.1|  PREDICTED: pentatricopeptide repeat-containi...    270   5e-82    
emb|CAE03450.1|  OSJNBa0088H09.8                                        253   6e-74    Oryza sativa Japonica Group [Japonica rice]
gb|EMT10625.1|  Pentatricopeptide repeat-containing protein             245   3e-71    
ref|XP_002978768.1|  hypothetical protein SELMODRAFT_109608             236   2e-68    
ref|XP_001771925.1|  predicted protein                                  234   3e-67    
ref|XP_002984681.1|  hypothetical protein SELMODRAFT_30598              216   3e-61    
ref|XP_006367148.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-59    
ref|XP_010909109.1|  PREDICTED: pentatricopeptide repeat-containi...    212   3e-59    
ref|XP_001763946.1|  predicted protein                                  208   4e-58    
ref|XP_006367149.1|  PREDICTED: pentatricopeptide repeat-containi...    205   8e-58    
ref|XP_010262940.1|  PREDICTED: pentatricopeptide repeat-containi...    204   4e-57    
ref|XP_008363252.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    201   1e-55    
ref|XP_002994591.1|  hypothetical protein SELMODRAFT_138844             177   3e-47    
ref|XP_010240633.1|  PREDICTED: pentatricopeptide repeat-containi...    162   5e-42    
ref|XP_004172167.1|  PREDICTED: pentatricopeptide repeat-containi...    137   2e-33    
ref|XP_006367153.1|  PREDICTED: pentatricopeptide repeat-containi...    121   6e-29    
gb|KHN14012.1|  Pentatricopeptide repeat-containing protein           90.9    4e-17    
gb|EPS59538.1|  hypothetical protein M569_15265                       90.1    1e-16    
ref|XP_002975593.1|  hypothetical protein SELMODRAFT_103638           88.2    2e-16    
gb|EMS45043.1|  hypothetical protein TRIUR3_16364                     88.2    2e-16    
gb|KDP21342.1|  hypothetical protein JCGZ_21813                       86.3    2e-16    
ref|XP_010910591.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  89.0    3e-16    
ref|XP_009784742.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    1e-15    
ref|XP_010939783.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    1e-15    
ref|XP_009615415.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    2e-15    
ref|XP_010522744.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    2e-15    
ref|XP_008799867.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    3e-15    
ref|XP_004301139.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    4e-15    
gb|EMT18607.1|  hypothetical protein F775_09904                       84.7    4e-15    
ref|XP_009412775.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    5e-15    
ref|XP_010247360.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    6e-15    
ref|XP_009604239.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    6e-15    
ref|XP_006394512.1|  hypothetical protein EUTSA_v10005336mg           84.3    8e-15    
gb|KCW88461.1|  hypothetical protein EUGRSUZ_A00848                   84.0    8e-15    
ref|XP_010044295.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    8e-15    
ref|XP_010276196.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    1e-14    
ref|XP_006494534.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    1e-14    
ref|XP_011085593.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    1e-14    
gb|EYU35805.1|  hypothetical protein MIMGU_mgv1a021716mg              83.6    1e-14    
ref|XP_010922654.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    1e-14    
gb|EPS68486.1|  hypothetical protein M569_06282                       82.8    2e-14    
ref|XP_010096308.1|  hypothetical protein L484_021054                 83.2    2e-14    
ref|XP_010529910.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    2e-14    
gb|EYU21818.1|  hypothetical protein MIMGU_mgv1a0008301mg             82.8    2e-14    
ref|XP_010315244.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    2e-14    
ref|XP_003563115.2|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  82.0    2e-14    
ref|XP_007208650.1|  hypothetical protein PRUPE_ppa020258mg           81.6    2e-14    
ref|XP_010275891.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    2e-14    
ref|XP_010274884.1|  PREDICTED: putative pentatricopeptide repeat...  82.8    3e-14    
ref|XP_002314524.2|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  82.0    3e-14    Populus trichocarpa [western balsam poplar]
ref|XP_004294524.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14    
ref|XP_010541010.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14    
gb|KGN51232.1|  hypothetical protein Csa_5G496480                     82.4    3e-14    
ref|XP_004167903.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14    
ref|XP_007044407.1|  Pentatricopeptide repeat (PPR-like) superfam...  82.4    3e-14    
ref|XP_010239993.1|  PREDICTED: putative pentatricopeptide repeat...  81.3    3e-14    
gb|EYU28680.1|  hypothetical protein MIMGU_mgv1a019615mg              82.4    3e-14    
ref|XP_010435859.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14    
ref|XP_010541012.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    3e-14    
ref|XP_004140820.1|  PREDICTED: putative pentatricopeptide repeat...  82.0    3e-14    
gb|EMS53207.1|  Protein Rf1, mitochondrial                            82.0    4e-14    
gb|KGN57460.1|  hypothetical protein Csa_3G188330                     81.6    4e-14    
ref|XP_009411130.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    4e-14    
ref|XP_007048893.1|  Tetratricopeptide repeat-like superfamily pr...  81.6    4e-14    
ref|XP_006483272.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    5e-14    
emb|CBI32450.3|  unnamed protein product                              82.0    5e-14    
ref|XP_011009008.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    5e-14    
emb|CDM84948.1|  unnamed protein product                              80.1    6e-14    
ref|XP_008451225.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    6e-14    
ref|XP_007217681.1|  hypothetical protein PRUPE_ppa021203mg           80.1    6e-14    
ref|XP_008228917.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    6e-14    
emb|CBI21003.3|  unnamed protein product                              81.6    7e-14    
ref|XP_010648635.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    7e-14    
ref|XP_010931310.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    7e-14    
ref|XP_006346446.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    7e-14    
ref|XP_010518888.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    7e-14    
ref|XP_007013815.1|  Pentatricopeptide repeat superfamily protein...  81.6    7e-14    
ref|XP_007038120.1|  Pentatricopeptide repeat superfamily protein...  81.6    7e-14    
ref|XP_010246577.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    7e-14    
ref|XP_007211305.1|  hypothetical protein PRUPE_ppa001411mg           81.3    8e-14    
ref|XP_010530463.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    8e-14    
ref|XP_003631789.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    8e-14    
ref|XP_009773242.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    8e-14    
ref|XP_010523070.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    8e-14    
ref|XP_010539051.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    9e-14    
ref|XP_010539050.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    9e-14    
ref|XP_008463574.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    9e-14    
ref|XP_011071527.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    9e-14    
ref|XP_010934958.1|  PREDICTED: putative pentatricopeptide repeat...  80.9    9e-14    
ref|XP_002451024.1|  hypothetical protein SORBIDRAFT_05g022840        80.9    1e-13    Sorghum bicolor [broomcorn]
ref|XP_008776298.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    1e-13    
ref|XP_010554934.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    1e-13    
ref|XP_010248027.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    1e-13    
ref|XP_008241311.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    1e-13    
ref|XP_010529887.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    1e-13    
gb|EMT25987.1|  hypothetical protein F775_14273                       80.5    1e-13    
ref|XP_004168332.1|  PREDICTED: putative pentatricopeptide repeat...  80.5    1e-13    
ref|XP_010530330.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    1e-13    
gb|EEC79766.1|  hypothetical protein OsI_21159                        79.7    1e-13    Oryza sativa Indica Group [Indian rice]
ref|NP_001174544.1|  Os05g0583900                                     79.7    1e-13    
ref|XP_010043774.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    1e-13    
ref|XP_009356190.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    1e-13    
ref|XP_002514728.1|  pentatricopeptide repeat-containing protein,...  80.1    1e-13    Ricinus communis
gb|KCW88409.1|  hypothetical protein EUGRSUZ_A00796                   80.1    1e-13    
ref|XP_010106480.1|  hypothetical protein L484_025237                 80.1    2e-13    
ref|XP_004979539.1|  PREDICTED: protein Rf1, mitochondrial-like i...  80.1    2e-13    
ref|XP_010043749.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-13    
gb|EEE64841.1|  hypothetical protein OsJ_19698                        79.7    2e-13    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003631674.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-13    
ref|XP_002892307.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  80.5    2e-13    
gb|EYU40330.1|  hypothetical protein MIMGU_mgv1a025391mg              80.1    2e-13    
ref|XP_010518883.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    2e-13    
ref|XP_010052756.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-13    
ref|XP_008778703.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-13    
ref|XP_008445872.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-13    
ref|XP_008790931.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-13    
ref|XP_007204201.1|  hypothetical protein PRUPE_ppa003538mg           79.7    2e-13    
ref|XP_010450780.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-13    
ref|XP_008367001.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    2e-13    
ref|XP_008239557.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-13    
ref|XP_010275661.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    2e-13    
ref|XP_008389244.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    2e-13    
ref|XP_010544768.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    2e-13    
ref|XP_009628319.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    3e-13    
ref|XP_011073790.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    3e-13    
ref|XP_007041360.1|  Pentatricopeptide repeat (PPR) superfamily p...  79.3    3e-13    
ref|XP_008796942.1|  PREDICTED: putative pentatricopeptide repeat...  79.3    3e-13    
ref|NP_198787.1|  pentatricopeptide repeat-containing protein EMB...  79.3    3e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646472.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    3e-13    
ref|XP_008243127.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    3e-13    
ref|XP_010933122.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    3e-13    
ref|XP_006423450.1|  hypothetical protein CICLE_v10028233mg           79.0    3e-13    
emb|CAN66662.1|  hypothetical protein VITISV_031722                   79.3    3e-13    Vitis vinifera
emb|CDM86292.1|  unnamed protein product                              79.3    3e-13    
ref|XP_008792260.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    4e-13    
ref|XP_009801387.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    4e-13    
ref|XP_010263016.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    4e-13    
gb|EPS72780.1|  hypothetical protein M569_01977                       79.3    4e-13    
ref|XP_011101702.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    4e-13    
ref|XP_010276630.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    4e-13    
ref|XP_003634263.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    4e-13    
ref|XP_006645506.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  79.0    4e-13    
ref|XP_006468968.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    4e-13    
emb|CBI15198.3|  unnamed protein product                              79.0    4e-13    
ref|NP_200948.1|  pentatricopeptide repeat-containing protein         78.6    4e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782000.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    4e-13    
ref|XP_007035595.1|  Pentatricopeptide repeat-containing protein,...  79.0    5e-13    
ref|XP_004970535.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    5e-13    
ref|XP_006446843.1|  hypothetical protein CICLE_v10014674mg           78.6    5e-13    
ref|XP_010530278.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    5e-13    
ref|XP_004296842.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    5e-13    
gb|KDO63441.1|  hypothetical protein CISIN_1g007543mg                 78.6    5e-13    
gb|KDO63442.1|  hypothetical protein CISIN_1g007543mg                 78.6    5e-13    
ref|XP_006384483.1|  hypothetical protein POPTR_0004s15480g           78.2    5e-13    
emb|CBI28459.3|  unnamed protein product                              79.0    5e-13    
emb|CAN81487.1|  hypothetical protein VITISV_033285                   79.0    5e-13    Vitis vinifera
gb|KCW55237.1|  hypothetical protein EUGRSUZ_I01171                   78.2    5e-13    
ref|XP_010100079.1|  hypothetical protein L484_005753                 78.2    5e-13    
ref|XP_006405601.1|  hypothetical protein EUTSA_v10027654mg           78.6    5e-13    
ref|XP_009394893.1|  PREDICTED: putative pentatricopeptide repeat...  78.6    5e-13    
gb|KDO43027.1|  hypothetical protein CISIN_1g0037491mg                76.6    5e-13    
ref|XP_008229891.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    6e-13    
ref|XP_009781997.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    6e-13    
ref|XP_010028496.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    6e-13    
ref|XP_004979592.1|  PREDICTED: protein Rf1, mitochondrial-like       78.2    6e-13    
ref|XP_002267947.3|  PREDICTED: pentatricopeptide repeat-containi...  78.6    6e-13    Vitis vinifera
ref|XP_003533323.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    6e-13    
ref|XP_010104066.1|  hypothetical protein L484_014251                 78.6    6e-13    
ref|XP_010107974.1|  hypothetical protein L484_027566                 78.6    6e-13    
ref|XP_004979523.1|  PREDICTED: protein Rf1, mitochondrial-like       78.2    7e-13    
ref|XP_008449300.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    7e-13    
ref|XP_010445660.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    7e-13    
ref|XP_008223610.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    7e-13    
ref|XP_006423499.1|  hypothetical protein CICLE_v10028181mg           77.8    7e-13    
ref|XP_009350326.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    7e-13    
emb|CDP10983.1|  unnamed protein product                              78.2    7e-13    
gb|KDO82695.1|  hypothetical protein CISIN_1g004470mg                 78.2    7e-13    
gb|KCW88441.1|  hypothetical protein EUGRSUZ_A00828                   77.8    8e-13    
gb|KFK40027.1|  hypothetical protein AALP_AA3G320600                  77.8    8e-13    
ref|XP_008356925.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    8e-13    
ref|XP_010530274.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    8e-13    
ref|XP_009117967.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  77.8    8e-13    
gb|KHN43638.1|  Pentatricopeptide repeat-containing protein, mito...  77.4    8e-13    
ref|XP_009596549.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    8e-13    
gb|KEH23629.1|  PPR containing plant-like protein                     78.2    8e-13    
gb|KDO54847.1|  hypothetical protein CISIN_1g004758mg                 77.4    8e-13    
ref|XP_010520854.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    8e-13    
ref|XP_010044211.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    8e-13    
ref|XP_008457121.1|  PREDICTED: putative pentatricopeptide repeat...  77.8    8e-13    
ref|XP_006845595.1|  hypothetical protein AMTR_s00019p00203030        78.2    9e-13    
ref|XP_010522551.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    9e-13    
gb|KDP27800.1|  hypothetical protein JCGZ_18880                       77.8    9e-13    
ref|XP_008389554.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    9e-13    
gb|KDO43028.1|  hypothetical protein CISIN_1g0037491mg                76.3    1e-12    
ref|XP_009366564.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    1e-12    
ref|XP_008224080.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    1e-12    
emb|CDP04793.1|  unnamed protein product                              77.8    1e-12    
gb|KDO54845.1|  hypothetical protein CISIN_1g004758mg                 77.8    1e-12    
ref|XP_010044200.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    1e-12    
gb|EYU21955.1|  hypothetical protein MIMGU_mgv1a001349mg              77.8    1e-12    
ref|XP_007206472.1|  hypothetical protein PRUPE_ppa027230mg           77.4    1e-12    
ref|XP_010228195.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    1e-12    
ref|XP_010648196.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    1e-12    
ref|XP_002456617.1|  hypothetical protein SORBIDRAFT_03g039460        77.0    1e-12    
gb|EAY94625.1|  hypothetical protein OsI_16402                        77.4    1e-12    
gb|KFK26916.1|  hypothetical protein AALP_AA8G310300                  77.4    1e-12    
emb|CBI34098.3|  unnamed protein product                              77.4    1e-12    
ref|XP_003620129.1|  Pentatricopeptide repeat-containing protein      77.0    1e-12    
ref|XP_010527630.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    1e-12    
ref|XP_006470579.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    1e-12    
ref|XP_011024963.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    1e-12    
gb|KHN05153.1|  Pentatricopeptide repeat-containing protein, mito...  77.4    1e-12    
gb|KFK27898.1|  hypothetical protein AALP_AA8G444400                  77.4    1e-12    
gb|KCW88438.1|  hypothetical protein EUGRSUZ_A00824                   77.4    1e-12    
ref|XP_006858479.1|  hypothetical protein AMTR_s00071p00119440        77.0    1e-12    
ref|XP_006423447.1|  hypothetical protein CICLE_v10030242mg           77.4    1e-12    
ref|XP_006847909.1|  hypothetical protein AMTR_s00029p00111980        77.0    1e-12    
ref|XP_009770050.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    1e-12    
ref|XP_009802105.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    1e-12    
gb|EYU35126.1|  hypothetical protein MIMGU_mgv1a003449mg              77.0    1e-12    
ref|XP_010531712.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    1e-12    
ref|XP_009341580.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.5    1e-12    
ref|XP_010457312.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    1e-12    
ref|XP_007041365.1|  Pentatricopeptide repeat superfamily protein...  76.6    1e-12    
emb|CDY30265.1|  BnaC04g31760D                                        77.0    1e-12    
ref|XP_010531714.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
ref|XP_011015136.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
emb|CDX74435.1|  BnaA04g09540D                                        77.0    2e-12    
ref|XP_010044060.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
ref|XP_007213619.1|  hypothetical protein PRUPE_ppa002121mg           77.0    2e-12    
gb|EPS73753.1|  hypothetical protein M569_01004                       77.0    2e-12    
ref|XP_006826199.1|  hypothetical protein AMTR_s01818p00007440        76.6    2e-12    
ref|XP_010044068.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
ref|XP_010543002.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
ref|XP_010041796.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
ref|XP_002870767.1|  EMB2745                                          77.0    2e-12    
ref|XP_010274547.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
ref|XP_008790623.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
gb|AES76347.2|  pentatricopeptide (PPR) repeat protein                76.6    2e-12    
ref|XP_009342418.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
ref|NP_001053152.1|  Os04g0488500                                     77.0    2e-12    
ref|XP_006282494.1|  hypothetical protein CARUB_v10006484mg           77.0    2e-12    
ref|XP_009413406.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12    
ref|XP_006446275.1|  hypothetical protein CICLE_v10017597mg           77.0    2e-12    
gb|KCW84912.1|  hypothetical protein EUGRSUZ_B01739                   77.0    2e-12    
emb|CAN60904.1|  hypothetical protein VITISV_016343                   76.6    2e-12    
gb|AIU48569.1|  tetratricopeptide repeat-like superfamily protein     76.6    2e-12    
ref|XP_006838717.1|  hypothetical protein AMTR_s00002p00251730        77.0    2e-12    
ref|XP_007049305.1|  Pentatricopeptide repeat-containing protein,...  76.6    2e-12    
emb|CAE02059.2|  OJ991113_30.18                                       76.6    2e-12    
ref|XP_010530464.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12    
ref|XP_011081936.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    2e-12    
gb|EEE61229.1|  hypothetical protein OsJ_15269                        77.0    2e-12    
gb|EMT14890.1|  hypothetical protein F775_06965                       75.1    2e-12    
ref|XP_009335069.1|  PREDICTED: putative pentatricopeptide repeat...  76.3    2e-12    
gb|AIU48578.1|  tetratricopeptide repeat-like superfamily protein     76.3    2e-12    
ref|XP_007224618.1|  hypothetical protein PRUPE_ppa026847mg           76.6    2e-12    
ref|XP_004172273.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12    
ref|XP_006417999.1|  hypothetical protein EUTSA_v10010012mg           76.6    2e-12    
ref|XP_004159605.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12    
gb|AIU48539.1|  tetratricopeptide repeat-like superfamily protein     76.3    2e-12    
ref|XP_004968242.1|  PREDICTED: putative pentatricopeptide repeat...  76.6    2e-12    
ref|XP_004137069.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    2e-12    
ref|XP_010674668.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12    
ref|XP_004143696.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12    
ref|XP_002441764.1|  hypothetical protein SORBIDRAFT_08g002022        76.6    2e-12    
ref|XP_010674677.1|  PREDICTED: putative pentatricopeptide repeat...  76.6    2e-12    
ref|XP_004298529.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12    
ref|XP_002268680.2|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12    
ref|XP_007201996.1|  hypothetical protein PRUPE_ppa024918mg           76.3    2e-12    
ref|XP_004149630.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-12    
ref|XP_010023865.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    3e-12    
ref|XP_007049304.1|  Pentatricopeptide repeat-containing protein,...  76.6    3e-12    
ref|XP_010671777.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
gb|EMT23389.1|  hypothetical protein F775_22313                       76.3    3e-12    
ref|XP_010234498.1|  PREDICTED: protein Rf1, mitochondrial-like       76.6    3e-12    
ref|XP_009614927.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_010531711.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
gb|KDO40553.1|  hypothetical protein CISIN_1g0479322mg                75.9    3e-12    
ref|XP_009802291.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_011019771.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_006485104.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    3e-12    
ref|XP_010906095.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_006447818.1|  hypothetical protein CICLE_v10014235mg           76.3    3e-12    
ref|XP_010678350.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    3e-12    
ref|XP_008464650.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_010671773.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_010681155.1|  PREDICTED: putative pentatricopeptide repeat...  76.3    3e-12    
ref|XP_004500011.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_006469440.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    3e-12    
ref|XP_008670835.1|  PREDICTED: protein Rf1, mitochondrial-like       73.9    3e-12    
ref|XP_001777347.1|  predicted protein                                76.3    3e-12    
gb|KDO50949.1|  hypothetical protein CISIN_1g001966mg                 76.6    3e-12    
ref|XP_006391979.1|  hypothetical protein EUTSA_v10023907mg           75.9    3e-12    
ref|XP_009608961.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_006849567.1|  hypothetical protein AMTR_s00024p00183850        76.3    3e-12    
gb|KCW45150.1|  hypothetical protein EUGRSUZ_L01231                   75.9    3e-12    
ref|XP_009625746.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    3e-12    
ref|XP_009130669.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_006409459.1|  hypothetical protein EUTSA_v10022571mg           76.3    3e-12    
emb|CDX86942.1|  BnaC03g52120D                                        76.3    3e-12    
ref|XP_006658440.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_010040514.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    3e-12    
ref|XP_010038465.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    3e-12    
ref|XP_003620276.1|  Pentatricopeptide repeat-containing protein      75.9    3e-12    
gb|KDP21252.1|  hypothetical protein JCGZ_21723                       76.3    3e-12    
ref|XP_009628783.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    3e-12    
ref|XP_010907418.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_003617758.1|  Pentatricopeptide repeat-containing protein      76.3    3e-12    
gb|KDO51284.1|  hypothetical protein CISIN_1g001797mg                 76.3    3e-12    
ref|XP_009625742.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_006436947.1|  hypothetical protein CICLE_v10033858mg           76.3    3e-12    
ref|XP_004140061.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-12    
ref|XP_010462657.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    3e-12    
ref|XP_006843372.1|  hypothetical protein AMTR_s00053p00089490        75.9    3e-12    
emb|CDY11211.1|  BnaA03g00470D                                        75.9    3e-12    
ref|XP_008464651.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    3e-12    
ref|XP_010320717.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    4e-12    
ref|XP_006854103.1|  hypothetical protein AMTR_s00048p00141020        75.9    4e-12    
gb|KCW84611.1|  hypothetical protein EUGRSUZ_B01443                   75.9    4e-12    
ref|XP_006485103.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    4e-12    
emb|CDY47261.1|  BnaA10g03850D                                        75.9    4e-12    
ref|XP_010091246.1|  hypothetical protein L484_005293                 73.2    4e-12    
ref|XP_009119127.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    4e-12    
ref|XP_004497786.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    4e-12    
ref|XP_008790235.1|  PREDICTED: putative pentatricopeptide repeat...  76.3    4e-12    
ref|XP_004979582.1|  PREDICTED: protein Rf1, mitochondrial-like i...  75.9    4e-12    
gb|KDP31281.1|  hypothetical protein JCGZ_11657                       75.9    4e-12    
ref|XP_003606846.1|  Pentatricopeptide repeat-containing protein      75.9    4e-12    
ref|XP_002324422.2|  hypothetical protein POPTR_0018s08840g           75.9    4e-12    
ref|XP_009760018.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    4e-12    
gb|KEH19381.1|  PPR containing plant-like protein                     75.9    4e-12    
ref|XP_006583904.1|  PREDICTED: protein Rf1, mitochondrial-like i...  75.9    4e-12    
ref|XP_010673746.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    4e-12    
ref|XP_008221377.1|  PREDICTED: putative pentatricopeptide repeat...  75.9    4e-12    
ref|XP_006398652.1|  hypothetical protein EUTSA_v10012778mg           75.9    4e-12    
ref|XP_010673749.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    4e-12    
ref|XP_008451289.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    4e-12    
ref|XP_008790694.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.9    4e-12    
ref|XP_010673748.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    4e-12    
ref|NP_001150085.1|  EMB2745                                          75.1    4e-12    
ref|XP_010102102.1|  hypothetical protein L484_004641                 73.2    4e-12    
ref|XP_008386926.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    4e-12    
ref|XP_006398651.1|  hypothetical protein EUTSA_v10012778mg           75.9    4e-12    
ref|XP_002299984.2|  hypothetical protein POPTR_0001s28320g           75.5    4e-12    
gb|KCW88454.1|  hypothetical protein EUGRSUZ_A00842                   75.5    4e-12    
ref|XP_010554554.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    5e-12    
ref|NP_188886.1|  pentatricopeptide repeat-containing protein         75.5    5e-12    
ref|XP_010673747.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    5e-12    
dbj|BAB01462.1|  unnamed protein product                              75.5    5e-12    
ref|XP_007199097.1|  hypothetical protein PRUPE_ppa020475mg           75.5    5e-12    
ref|XP_004493491.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    5e-12    
ref|XP_010674802.1|  PREDICTED: putative pentatricopeptide repeat...  75.5    5e-12    
ref|XP_006341481.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    5e-12    
ref|XP_007210813.1|  hypothetical protein PRUPE_ppa016961mg           75.5    5e-12    
ref|XP_010673744.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    5e-12    
ref|XP_002438926.1|  hypothetical protein SORBIDRAFT_10g028420        75.9    5e-12    
ref|XP_010322570.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    5e-12    
ref|XP_009139915.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    5e-12    
ref|XP_010919700.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    5e-12    
ref|XP_002446628.1|  hypothetical protein SORBIDRAFT_06g019140        75.5    5e-12    
gb|KHN43025.1|  Pentatricopeptide repeat-containing protein           75.5    5e-12    
gb|KCW88452.1|  hypothetical protein EUGRSUZ_A00840                   75.5    5e-12    
gb|KFK35353.1|  hypothetical protein AALP_AA5G273600                  75.5    5e-12    
ref|XP_009631369.1|  PREDICTED: putative pentatricopeptide repeat...  75.5    5e-12    
ref|XP_010044255.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    5e-12    
ref|XP_010043917.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    6e-12    
gb|ABL85032.1|  auxin efflux carrier                                  75.5    6e-12    
gb|EYU30924.1|  hypothetical protein MIMGU_mgv1a001068mg              75.5    6e-12    
ref|XP_006838109.1|  hypothetical protein AMTR_s00106p00049030        75.5    6e-12    
ref|XP_004173179.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.5    6e-12    
ref|XP_006494535.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    6e-12    
ref|XP_003543970.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    6e-12    
gb|KDO64354.1|  hypothetical protein CISIN_1g042955mg                 75.1    6e-12    
ref|XP_007208672.1|  hypothetical protein PRUPE_ppa023798mg           75.1    6e-12    
ref|XP_003528536.1|  PREDICTED: protein Rf1, mitochondrial-like i...  75.5    6e-12    
ref|XP_006364273.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    6e-12    
ref|XP_010037724.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    6e-12    
ref|XP_008455127.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    6e-12    
ref|XP_011037108.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    6e-12    
ref|XP_002278350.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    6e-12    
gb|KFK37390.1|  hypothetical protein AALP_AA4G251100                  75.1    6e-12    
ref|XP_010674667.1|  PREDICTED: putative pentatricopeptide repeat...  75.1    6e-12    
ref|XP_007216980.1|  hypothetical protein PRUPE_ppa002772mg           75.1    7e-12    
ref|XP_009342743.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.1    7e-12    
ref|XP_007161634.1|  hypothetical protein PHAVU_001G085800g           75.1    7e-12    
ref|XP_009594766.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    7e-12    
ref|XP_008663783.1|  PREDICTED: putative pentatricopeptide repeat...  75.1    7e-12    
ref|XP_010044242.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    7e-12    
ref|XP_004142591.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    7e-12    
gb|KFK37389.1|  hypothetical protein AALP_AA4G251100                  75.1    7e-12    
ref|XP_009360418.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.1    7e-12    
ref|XP_009787430.1|  PREDICTED: putative pentatricopeptide repeat...  75.1    7e-12    
ref|XP_006382722.1|  helicase domain-containing family protein        75.1    7e-12    
gb|KHN38966.1|  Pentatricopeptide repeat-containing protein, mito...  75.1    7e-12    
ref|XP_002516925.1|  pentatricopeptide repeat-containing protein,...  75.1    7e-12    
ref|XP_006446304.1|  hypothetical protein CICLE_v100144562mg          74.7    7e-12    
ref|XP_002864731.1|  pentatricopeptide repeat-containing protein      75.1    7e-12    
ref|XP_005704912.1|  mitochondrial protein translocase, MPT family    75.1    7e-12    
ref|XP_010099493.1|  hypothetical protein L484_000446                 75.1    7e-12    
emb|CBI20053.3|  unnamed protein product                              75.1    7e-12    
ref|XP_008451239.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    7e-12    
ref|XP_008229604.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    8e-12    
ref|XP_004159312.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.1    8e-12    
ref|XP_009118442.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    8e-12    
ref|XP_006596228.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    8e-12    
ref|XP_001776359.1|  predicted protein                                74.7    8e-12    
ref|XP_006282008.1|  hypothetical protein CARUB_v10028236mg           74.7    8e-12    
ref|XP_009352261.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    8e-12    
ref|XP_002309609.2|  pentatricopeptide repeat-containing family p...  75.1    8e-12    
ref|XP_011073190.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    8e-12    
ref|XP_010108616.1|  hypothetical protein L484_000854                 75.1    8e-12    
gb|KGN52123.1|  hypothetical protein Csa_5G611050                     75.1    8e-12    
ref|XP_004135384.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  74.7    8e-12    
ref|XP_002455183.1|  hypothetical protein SORBIDRAFT_03g005716        75.1    8e-12    
emb|CDP13067.1|  unnamed protein product                              74.7    8e-12    
ref|XP_002511099.1|  pentatricopeptide repeat-containing protein,...  75.1    8e-12    
ref|XP_009377786.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    8e-12    
ref|XP_010033877.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    8e-12    



>ref|XP_008356863.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Malus domestica]
Length=531

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/289 (70%), Positives = 234/289 (81%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGFVIYGG +  KSA KAV+FDG+EFHGRVLTVKLDDG R +KDK + RTRW+E
Sbjct  211  TERNAGFGFVIYGGKTAAKSATKAVEFDGMEFHGRVLTVKLDDGSR-LKDKTEERTRWLE  269

Query  642  G---------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G               +S +  RKV++++PENW AVVR FERI KPSR E+G+MV YY R
Sbjct  270  GHDSVEYQSQWHKERENSRKALRKVMDTEPENWQAVVRFFERIKKPSRGEYGLMVKYYAR  329

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRARE FE MR+RGI PTS+ YT+L +AY V RDM+EAL+CVRKM +EGIE+S+VT
Sbjct  330  RGDMHRARETFESMRARGIEPTSHVYTSLIHAYAVGRDMDEALSCVRKMKEEGIEMSLVT  389

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSI VGGFAKVGN EAA+ WF EAKERH TL+A IYGNIIYA CQTCNMDRAE L+R+ME
Sbjct  390  YSIXVGGFAKVGNAEAADFWFKEAKERHTTLNAIIYGNIIYAYCQTCNMDRAEXLVRDME  449

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            E GI API I+HTMMDGYTI  NE+KCL++F+RLKECGFTPSVISYGCL
Sbjct  450  EAGIDAPIDIYHTMMDGYTIXGNEDKCLIVFERLKECGFTPSVISYGCL  498



>ref|XP_006367245.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Solanum tuberosum]
Length=944

 Score =   415 bits (1066),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/289 (72%), Positives = 241/289 (83%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+ N GFGFVIYGGS+ EK+A+KAV+FDGVEFHGRVLTVKLDDGRR MK K + R RW+E
Sbjct  197  TEMNKGFGFVIYGGSTAEKAAMKAVEFDGVEFHGRVLTVKLDDGRR-MKAKTEERRRWVE  255

Query  642  GS---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G                S   FRKVL+++PENW AVV+AFERI KPSRKEFG+MVNYYGR
Sbjct  256  GEDDVEYRSKWHEEREGSRTEFRKVLDTEPENWQAVVQAFERIKKPSRKEFGLMVNYYGR  315

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRARE FEKMR+RGI PT + YTNL +AY V+RDMEEAL+CVR+M DEGIE+S+VT
Sbjct  316  RGDMHRARETFEKMRARGIEPTVHVYTNLIHAYAVARDMEEALSCVRRMKDEGIEMSLVT  375

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            +SI+V GFAK+GN+EAAE WF EAKERH TL+A IYG+IIYANCQTCNMDRAEEL+REME
Sbjct  376  HSILVDGFAKLGNIEAAEQWFKEAKERHPTLNAIIYGSIIYANCQTCNMDRAEELVREME  435

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEGI API I+H MMDGYT   NE+KCL+++DRLKECGFTPSV+SYGCL
Sbjct  436  EEGIDAPIDIYHIMMDGYTSIGNEDKCLIVYDRLKECGFTPSVVSYGCL  484


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 87/185 (47%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + +  +++ Y   GD  +A E F +++  G+    Y Y  L  A   +  M+ AL 
Sbjct  650  RPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDIYTYEALLKACCKAGRMQSALA  709

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C
Sbjct  710  VTKEMSAKNIPRNTYVYNILIDGWARRGDVWEAADLMQQMRQEGVQPDIHTYTSFVNACC  769

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M +A   + EM+  G+   +  + T++ G+      EK L  F+ +K  G  P   
Sbjct  770  KAGDMQKATNTILEMKRVGVKPNVKTYTTLIHGWARASLPEKALKCFEEMKRSGLKPDKA  829

Query  15   SYGCL  1
             Y CL
Sbjct  830  VYHCL  834


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ + + G+  +A ++F+ MR  G +PT   +  L       R ME+A+
Sbjct  579  HRPTSRTFMPIIHAFAKAGEIRKALDVFDMMRRSGCIPTVQTFNALILGLAEKRQMEKAV  638

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   GI  +  TY+ I+ G+A +G+   A  +F   K+    L    Y  ++ A 
Sbjct  639  EVLDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDIYTYEALLKAC  698

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C+   M  A  + +EM  + I     +++ ++DG+    +  +   +  ++++ G  P +
Sbjct  699  CKAGRMQSALAVTKEMSAKNIPRNTYVYNILIDGWARRGDVWEAADLMQQMRQEGVQPDI  758

Query  18   ISY  10
             +Y
Sbjct  759  HTY  761


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE +   G+ P    Y N+  A+    +++ A+ 
Sbjct  510  KHNMKTYSMLINGFINLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMDNIDRAVC  569

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FAK G +  A   F   +      +   +  +I    
Sbjct  570  IVEEMKKERHRPTSRTFMPIIHAFAKAGEIRKALDVFDMMRRSGCIPTVQTFNALILGLA  629

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   GI      + T+MDGY    +  K    F R+K+ G    + 
Sbjct  630  EKRQMEKAVEVLDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDIY  689

Query  15   SYGCL  1
            +Y  L
Sbjct  690  TYEAL  694


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/179 (23%), Positives = 81/179 (45%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +M++ Y   G++ +   ++++++  G  P+   Y  L   Y     + +A      M 
Sbjct  446  YHIMMDGYTSIGNEDKCLIVYDRLKECGFTPSVVSYGCLMNLYIKVGKVSKAFEVSEMMK  505

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              GI+ ++ TYS+++ GF  + +   A   F +           +Y NII A C   N+D
Sbjct  506  LAGIKHNMKTYSMLINGFINLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMDNID  565

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            RA  ++ EM++E        F  ++  +       K L +FD ++  G  P+V ++  L
Sbjct  566  RAVCIVEEMKKERHRPTSRTFMPIIHAFAKAGEIRKALDVFDMMRRSGCIPTVQTFNAL  624



>ref|XP_006445764.1| hypothetical protein CICLE_v10014488mg [Citrus clementina]
 ref|XP_006445765.1| hypothetical protein CICLE_v10014488mg [Citrus clementina]
 gb|ESR59004.1| hypothetical protein CICLE_v10014488mg [Citrus clementina]
 gb|ESR59005.1| hypothetical protein CICLE_v10014488mg [Citrus clementina]
Length=683

 Score =   407 bits (1046),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/288 (70%), Positives = 237/288 (82%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N+GFGFVIY G + EKSA+KAV+FDGVEFHGRVLTVKLDDGRR +K++ + R RW+ G
Sbjct  191  EKNVGFGFVIYDGPAAEKSAMKAVEFDGVEFHGRVLTVKLDDGRR-LKNRAEVRARWVAG  249

Query  639  SSS---------------RNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            ++                R FRK +E+QPENW AVV AFERI KPSR+EFG+MVNYY RR
Sbjct  250  NNGEEFRSTWHKEREWHRREFRKAVETQPENWQAVVSAFERIKKPSRREFGLMVNYYARR  309

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRAR+ FE MR+RGI PT + YTNL +AY V RDMEEAL+CVRKM +EGIE+S+VTY
Sbjct  310  GDMHRARQTFENMRARGIEPTLHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVTY  369

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SIIVGGFAK+GN EAA+HWF EAKERHATL+A IYGNIIYA CQT NM+RAE L+R+MEE
Sbjct  370  SIIVGGFAKMGNAEAADHWFEEAKERHATLNAIIYGNIIYAQCQTRNMERAEALVRDMEE  429

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EGI API I+H MMDGYTI  NEEKCL++F+RLKECGFTPS+ISYGCL
Sbjct  430  EGIDAPIDIYHMMMDGYTIIGNEEKCLIVFERLKECGFTPSIISYGCL  477


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 84/179 (47%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   FE+ + R     +  Y N+ YA   +R+ME A   VR M 
Sbjct  369  YSIIVGGFAKMGNAEAADHWFEEAKERHATLNAIIYGNIIYAQCQTRNMERAEALVRDME  428

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y +++ G+  +GN E     F   KE   T S   YG +I    +   + 
Sbjct  429  EEGIDAPIDIYHMMMDGYTIIGNEEKCLIVFERLKECGFTPSIISYGCLINLYTKIGKVS  488

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +A ++ + M+  GI   +  +  +++G+   ++      +F+ +   G  P V+ Y  +
Sbjct  489  KALDVSKVMKSSGIKHNMKTYSMLINGFLKLKDWANAFAVFEDVMRDGLKPDVVLYNNI  547


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 62/123 (50%), Gaps = 2/123 (2%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    +  ++P+ + F  +++ + R G+  RA E+F  MR  G +PT + +  L    
Sbjct  562  HIVKEMQKERHRPTSRTFMPIIHGFARAGEMKRALEIFHMMRRSGCIPTVHTFNALILGL  621

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
               R ME+A+  + +M   GI  +  TY+ I+ G+A +G+   A  +F   K R+  L  
Sbjct  622  VEKRQMEKAIEILDEMTLAGISPNEHTYTTIMHGYASLGDTGKAFEYF--TKLRNEGLEL  679

Query  228  SIY  220
             ++
Sbjct  680  DVF  682


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 81/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  503  KHNMKTYSMLINGFLKLKDWANAFAVFEDVMRDGLKPDVVLYNNIIRAFCGMGNMDRAIH  562

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G ++ A   F   +      +   +  +I    
Sbjct  563  IVKEMQKERHRPTSRTFMPIIHGFARAGEMKRALEIFHMMRRSGCIPTVHTFNALILGLV  622

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   GI+     + T+M GY    +  K    F +L+  G    V 
Sbjct  623  EKRQMEKAIEILDEMTLAGISPNEHTYTTIMHGYASLGDTGKAFEYFTKLRNEGLELDVF  682

Query  15   S  13
            +
Sbjct  683  T  683



>ref|XP_007010457.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma 
cacao]
 gb|EOY19267.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma 
cacao]
Length=781

 Score =   409 bits (1051),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 203/291 (70%), Positives = 238/291 (82%), Gaps = 20/291 (7%)
 Frame = -2

Query  816  RNMGFGFVIYGGSSP--EKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            RN GFGFVIYGG  P  EKSA+KAV+FDGVEFHGR+LTVKLDDG+R+M +K + R RW+E
Sbjct  189  RNAGFGFVIYGGPPPLAEKSAMKAVEFDGVEFHGRILTVKLDDGKRLM-EKAEERARWVE  247

Query  642  G-----------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            G                  S + FRK+LES+PENW  VV AFERI KP+R+EFG+MVNYY
Sbjct  248  GYQVQDCNNKSKWHQEREGSRKLFRKILESEPENWQKVVTAFERITKPARREFGLMVNYY  307

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
             RRGD HRARE FE+MR+RGI PTS+ YTNL +AY V RDMEEAL+CVRKM +EGIE+++
Sbjct  308  ARRGDMHRARETFERMRARGIEPTSHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMTL  367

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYSI+VGGFAK+GN EAA+HWF EAKERH  L+A IYGNIIYA+CQTCNM+RAE L+RE
Sbjct  368  VTYSILVGGFAKIGNSEAADHWFKEAKERHTPLNAIIYGNIIYAHCQTCNMERAEALVRE  427

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API I+HTMMDGYT+  NEEKCL++F+RLKECGF PSVISYGCL
Sbjct  428  MEEEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLKECGFIPSVISYGCL  478


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 94/193 (49%), Gaps = 0/193 (0%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    +  ++P+ + F  +++ + R G+  RA E+F+ MR  G  PT + +  L    
Sbjct  563  HTVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAWEVFDVMRRSGCSPTVHTFNALILGL  622

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
            T  R ME+A+  + +M   GI  +  TY+ I+ G+A +G+   A  +F + +     +  
Sbjct  623  TEKRQMEKAVEILDEMTLAGISPNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDV  682

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              Y  ++ A C++  M  A  + +EM    I     +++ ++DG+    +  +   +  +
Sbjct  683  YTYEALLKACCKSGRMQSALAVTKEMSARKIPRNTFVYNILVDGWARRGDVWEAADLMQQ  742

Query  48   LKECGFTPSVISY  10
            +K+ G  P + +Y
Sbjct  743  MKQEGVQPDIHTY  755


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 84/176 (48%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + R     +  Y N+ YA+  + +ME A   VR+M 
Sbjct  370  YSILVGGFAKIGNSEAADHWFKEAKERHTPLNAIIYGNIIYAHCQTCNMERAEALVREME  429

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  +GN E     F   KE     S   YG +I    +   + 
Sbjct  430  EEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLKECGFIPSVISYGCLINLYSKIGKVS  489

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME +GI   +  +  +++G+   ++      +F+ L E G  P V+ Y
Sbjct  490  KALEVSKMMECDGIKHNMKTYSMLINGFLKLKDWANAFAIFEDLVEDGLKPDVVLY  545


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 95/201 (47%), Gaps = 3/201 (1%)
 Frame = -2

Query  597  ENWHAVVRAFER--INKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTN  424
            E   A+VR  E   I+ P    +  M++ Y   G++ +   +FE+++  G +P+   Y  
Sbjct  419  ERAEALVREMEEEGIDAPI-DIYHTMMDGYTMIGNEEKCLIVFERLKECGFIPSVISYGC  477

Query  423  LTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH  244
            L   Y+    + +AL   + M  +GI+ ++ TYS+++ GF K+ +   A   F +  E  
Sbjct  478  LINLYSKIGKVSKALEVSKMMECDGIKHNMKTYSMLINGFLKLKDWANAFAIFEDLVEDG  537

Query  243  ATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCL  64
                  +Y NII A C   NMDRA   ++EM +E        F  ++  +       +  
Sbjct  538  LKPDVVLYNNIIRAFCGMGNMDRAIHTVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAW  597

Query  63   LMFDRLKECGFTPSVISYGCL  1
             +FD ++  G +P+V ++  L
Sbjct  598  EVFDVMRRSGCSPTVHTFNAL  618


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  504  KHNMKTYSMLINGFLKLKDWANAFAIFEDLVEDGLKPDVVLYNNIIRAFCGMGNMDRAIH  563

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+  FA+ G +  A   F   +    + +   +  +I    
Sbjct  564  TVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAWEVFDVMRRSGCSPTVHTFNALILGLT  623

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   GI+     + T+M GY    +  K    F +L+  G    V 
Sbjct  624  EKRQMEKAVEILDEMTLAGISPNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDVY  683

Query  15   SYGCL  1
            +Y  L
Sbjct  684  TYEAL  688


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 57/124 (46%), Gaps = 0/124 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A   F K+R+ G+    Y Y  L  A   S  M+ AL  
Sbjct  645  PNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDVYTYEALLKACCKSGRMQSALAV  704

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+   I  +   Y+I+V G+A+ G+V  A     + K+         Y + I A C+
Sbjct  705  TKEMSARKIPRNTFVYNILVDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINACCK  764

Query  192  TCNM  181
              +M
Sbjct  765  AGDM  768



>ref|XP_009762336.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Nicotiana sylvestris]
Length=800

 Score =   408 bits (1049),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 209/291 (72%), Positives = 240/291 (82%), Gaps = 18/291 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGS--SPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRW  649
            T+ N GFGFVIYGGS  + EK+A+KAV+FDGVEFHGRVLTVKLDDGRR MK K + R RW
Sbjct  49   TELNKGFGFVIYGGSISTAEKAAMKAVEFDGVEFHGRVLTVKLDDGRR-MKAKTEERKRW  107

Query  648  MEGS---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            +EG                S R+ RKVL+++PENW AVVRAFERI KPSRKEFG+MVNYY
Sbjct  108  VEGEDDVEYRSKWHEEREGSRRDLRKVLDTEPENWQAVVRAFERIKKPSRKEFGLMVNYY  167

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FEKMR+RGI PT + YTNL +AY V+RDMEEAL+CVR+M DEGIE+S+
Sbjct  168  GRRGDMHRARETFEKMRARGIEPTVHVYTNLIHAYAVARDMEEALSCVRRMKDEGIEMSL  227

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYSI+V GFAK+GN+EAAE WF EAKERH TL+A IYG+IIYANCQT NMDRAEEL+RE
Sbjct  228  VTYSILVDGFAKLGNIEAAERWFKEAKERHPTLNAIIYGSIIYANCQTSNMDRAEELVRE  287

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API I+H MMDGYT   NE+KCL++FDRLKECGF PSV+SYGCL
Sbjct  288  MEEEGIDAPIDIYHIMMDGYTSAGNEDKCLVVFDRLKECGFAPSVVSYGCL  338


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 89/185 (48%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + +  +++ Y   GD  +A E F +++  G+    Y Y  L  A   S  M+ AL 
Sbjct  504  RPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDVYTYEALLKACCKSGRMQSALA  563

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              ++MN + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C
Sbjct  564  VTKEMNAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVQPDIHTYTSFVNACC  623

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M +A   ++EM+  G+   +  + T++ G+      EK L  F+ +K+ G  P   
Sbjct  624  KAGDMQKATNTIQEMKRVGVKPNVKTYTTLIHGWARASLPEKALKCFEEMKKSGLKPDKA  683

Query  15   SYGCL  1
             Y CL
Sbjct  684  VYHCL  688


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/199 (23%), Positives = 94/199 (47%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E++ K    P+ + F  +++ + + G   +A ++F+ MR  G +PT   Y 
Sbjct  417  NMDRALRIVEQMKKERHRPTSRTFIPIIHAFAKAGAIRKALDVFDMMRRSGCIPTVQTYN  476

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L         M++A+  V +M   GI  +  TY+ I+ G+A +G+   A  +F   K+ 
Sbjct  477  ALILGLVEKCQMDKAVEVVDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDE  536

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  537  GLELDVYTYEALLKACCKSGRMQSALAVTKEMNAKNIPRNTFVYNILIDGWARRGDVWEA  596

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + +Y
Sbjct  597  ADLMQQMRQEGVQPDIHTY  615


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE +   G+ P    Y N+  A+    +M+ AL 
Sbjct  364  KHNMKTYSMLINGFIYLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNMDRALR  423

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FAK G +  A   F   +      +   Y  +I    
Sbjct  424  IVEQMKKERHRPTSRTFIPIIHAFAKAGAIRKALDVFDMMRRSGCIPTVQTYNALILGLV  483

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            + C MD+A E++ EM   GI      + T+MDGY    +  K    F R+K+ G    V 
Sbjct  484  EKCQMDKAVEVVDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDVY  543

Query  15   SYGCL  1
            +Y  L
Sbjct  544  TYEAL  548



>ref|XP_004250470.2| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Solanum lycopersicum]
Length=934

 Score =   410 bits (1053),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/289 (72%), Positives = 242/289 (84%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+ N GFGFVIYGGS+ EK+A+KAV+FDGVEFHGRVLTVKLDDGRR MK K + R RW+E
Sbjct  188  TEMNKGFGFVIYGGSTAEKAAMKAVEFDGVEFHGRVLTVKLDDGRR-MKAKTEERRRWVE  246

Query  642  GSS--------------SRN-FRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G                SRN FRKVL+++PENW AVV+AFERI KPSRKEFG+MVNYYGR
Sbjct  247  GEDDVEYRSKWHEEREGSRNSFRKVLDTEPENWQAVVQAFERIKKPSRKEFGLMVNYYGR  306

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRARE FEKMR+RGI PT + YTNL +AY V+RDMEEAL+CVR+M DEGIE+S+VT
Sbjct  307  RGDMHRARETFEKMRARGIEPTVHVYTNLIHAYAVARDMEEALSCVRRMKDEGIEMSLVT  366

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            +SI+V GFAK+GN+EAAE  F EAKER+ TL+A IYG+IIYANCQTCNMDRAEEL+REME
Sbjct  367  HSILVDGFAKLGNIEAAEQCFKEAKERYLTLNAIIYGSIIYANCQTCNMDRAEELVREME  426

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEGI API I+H MMDGYT   NE+KCL++FDRLKECGFTPSV+SYGCL
Sbjct  427  EEGIDAPIDIYHIMMDGYTSIGNEDKCLILFDRLKECGFTPSVVSYGCL  475


 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 87/185 (47%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + +  +++ Y   GD  +A E F +++  G+    Y Y  L  A   +  M+ AL 
Sbjct  641  RPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDIYTYEALLKACCKAGRMQSALA  700

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C
Sbjct  701  VTKEMSAKNIPRNTYVYNILIDGWARRGDVWEAADLMQQMRQEGVQPDIHTYTSFVNACC  760

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M +A   + EM+  G+   +  + T++ G+      EK L  F+ +K  G  P   
Sbjct  761  KAGDMQKATNTILEMKRIGVKPNVKTYTTLIHGWARASLPEKALKCFEEMKRSGLKPDKA  820

Query  15   SYGCL  1
             Y CL
Sbjct  821  VYHCL  825


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/199 (23%), Positives = 93/199 (47%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    VR  E + K    P+ + F  +++ + + G+  +A ++F+ MR  G +PT   + 
Sbjct  554  NIERAVRIVEEMKKERHRPTSRTFMPIIHAFAKAGEIRKALDVFDMMRRSGCIPTVQTFN  613

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L         ME+A+  + +M   GI  +  TY+ I+ G+A +G+   A  +F   K+ 
Sbjct  614  ALILGLVEKLQMEKAVQVLDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDE  673

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C+   M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  674  GLELDIYTYEALLKACCKAGRMQSALAVTKEMSAKNIPRNTYVYNILIDGWARRGDVWEA  733

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + +Y
Sbjct  734  ADLMQQMRQEGVQPDIHTY  752


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE +   G+ P    Y N+  A+    ++E A+ 
Sbjct  501  KHNMKTYSMLINGFINLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNIERAVR  560

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FAK G +  A   F   +      +   +  +I    
Sbjct  561  IVEEMKKERHRPTSRTFMPIIHAFAKAGEIRKALDVFDMMRRSGCIPTVQTFNALILGLV  620

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A ++L EM   GI      + T+MDGY    +  K    F R+K+ G    + 
Sbjct  621  EKLQMEKAVQVLDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDIY  680

Query  15   SYGCL  1
            +Y  L
Sbjct  681  TYEAL  685



>ref|XP_007010456.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY19266.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma 
cacao]
Length=944

 Score =   409 bits (1052),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/291 (70%), Positives = 238/291 (82%), Gaps = 20/291 (7%)
 Frame = -2

Query  816  RNMGFGFVIYGGSSP--EKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            RN GFGFVIYGG  P  EKSA+KAV+FDGVEFHGR+LTVKLDDG+R+M +K + R RW+E
Sbjct  189  RNAGFGFVIYGGPPPLAEKSAMKAVEFDGVEFHGRILTVKLDDGKRLM-EKAEERARWVE  247

Query  642  G-----------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            G                  S + FRK+LES+PENW  VV AFERI KP+R+EFG+MVNYY
Sbjct  248  GYQVQDCNNKSKWHQEREGSRKLFRKILESEPENWQKVVTAFERITKPARREFGLMVNYY  307

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
             RRGD HRARE FE+MR+RGI PTS+ YTNL +AY V RDMEEAL+CVRKM +EGIE+++
Sbjct  308  ARRGDMHRARETFERMRARGIEPTSHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMTL  367

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYSI+VGGFAK+GN EAA+HWF EAKERH  L+A IYGNIIYA+CQTCNM+RAE L+RE
Sbjct  368  VTYSILVGGFAKIGNSEAADHWFKEAKERHTPLNAIIYGNIIYAHCQTCNMERAEALVRE  427

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API I+HTMMDGYT+  NEEKCL++F+RLKECGF PSVISYGCL
Sbjct  428  MEEEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLKECGFIPSVISYGCL  478


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 94/193 (49%), Gaps = 0/193 (0%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    +  ++P+ + F  +++ + R G+  RA E+F+ MR  G  PT + +  L    
Sbjct  563  HTVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAWEVFDVMRRSGCSPTVHTFNALILGL  622

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
            T  R ME+A+  + +M   GI  +  TY+ I+ G+A +G+   A  +F + +     +  
Sbjct  623  TEKRQMEKAVEILDEMTLAGISPNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDV  682

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              Y  ++ A C++  M  A  + +EM    I     +++ ++DG+    +  +   +  +
Sbjct  683  YTYEALLKACCKSGRMQSALAVTKEMSARKIPRNTFVYNILVDGWARRGDVWEAADLMQQ  742

Query  48   LKECGFTPSVISY  10
            +K+ G  P + +Y
Sbjct  743  MKQEGVQPDIHTY  755


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A   F K+R+ G+    Y Y  L  A   S  M+ AL  
Sbjct  645  PNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDVYTYEALLKACCKSGRMQSALAV  704

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+   I  +   Y+I+V G+A+ G+V  A     + K+         Y + I A C+
Sbjct  705  TKEMSARKIPRNTFVYNILVDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINACCK  764

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + ++EM+  G+   +  + T++ G+      EK L  F+ +K  G  P    
Sbjct  765  AGDMLRAMKTIQEMDAIGVKPNVKTYTTLIHGWARASLPEKALKCFEEMKLAGLKPDKAV  824

Query  12   YGCL  1
            Y CL
Sbjct  825  YHCL  828


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 84/176 (48%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + R     +  Y N+ YA+  + +ME A   VR+M 
Sbjct  370  YSILVGGFAKIGNSEAADHWFKEAKERHTPLNAIIYGNIIYAHCQTCNMERAEALVREME  429

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  +GN E     F   KE     S   YG +I    +   + 
Sbjct  430  EEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLKECGFIPSVISYGCLINLYSKIGKVS  489

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME +GI   +  +  +++G+   ++      +F+ L E G  P V+ Y
Sbjct  490  KALEVSKMMECDGIKHNMKTYSMLINGFLKLKDWANAFAIFEDLVEDGLKPDVVLY  545


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 95/201 (47%), Gaps = 3/201 (1%)
 Frame = -2

Query  597  ENWHAVVRAFER--INKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTN  424
            E   A+VR  E   I+ P    +  M++ Y   G++ +   +FE+++  G +P+   Y  
Sbjct  419  ERAEALVREMEEEGIDAPIDI-YHTMMDGYTMIGNEEKCLIVFERLKECGFIPSVISYGC  477

Query  423  LTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH  244
            L   Y+    + +AL   + M  +GI+ ++ TYS+++ GF K+ +   A   F +  E  
Sbjct  478  LINLYSKIGKVSKALEVSKMMECDGIKHNMKTYSMLINGFLKLKDWANAFAIFEDLVEDG  537

Query  243  ATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCL  64
                  +Y NII A C   NMDRA   ++EM +E        F  ++  +       +  
Sbjct  538  LKPDVVLYNNIIRAFCGMGNMDRAIHTVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAW  597

Query  63   LMFDRLKECGFTPSVISYGCL  1
             +FD ++  G +P+V ++  L
Sbjct  598  EVFDVMRRSGCSPTVHTFNAL  618


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  504  KHNMKTYSMLINGFLKLKDWANAFAIFEDLVEDGLKPDVVLYNNIIRAFCGMGNMDRAIH  563

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+  FA+ G +  A   F   +    + +   +  +I    
Sbjct  564  TVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAWEVFDVMRRSGCSPTVHTFNALILGLT  623

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   GI+     + T+M GY    +  K    F +L+  G    V 
Sbjct  624  EKRQMEKAVEILDEMTLAGISPNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDVY  683

Query  15   SYGCL  1
            +Y  L
Sbjct  684  TYEAL  688



>ref|XP_009619247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=946

 Score =   409 bits (1051),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 209/291 (72%), Positives = 239/291 (82%), Gaps = 18/291 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGG--SSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRW  649
            T+ N GFGFVIYGG  S+ EK+A+KAV+FDGVEFHGRVLTVKLDDGRR MK K + R RW
Sbjct  193  TEMNKGFGFVIYGGPSSTAEKAAMKAVEFDGVEFHGRVLTVKLDDGRR-MKAKTEERKRW  251

Query  648  MEGS---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            +EG                S R+ RKVL+++PENW AVVRAFERI KPSRKEFG+MVNYY
Sbjct  252  VEGEDDMEYRSKWHEEREGSRRDLRKVLDTEPENWQAVVRAFERIKKPSRKEFGLMVNYY  311

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FEKMR+RGI PT + YTNL +AY V+RDMEEAL+CVR+M DEGIE+S+
Sbjct  312  GRRGDMHRARETFEKMRARGIEPTVHVYTNLIHAYAVARDMEEALSCVRRMKDEGIEMSL  371

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYSI+V GFAK GN+EAAE WF EAKERH TL+A IYG+IIYANCQT NMDRAEEL+RE
Sbjct  372  VTYSILVDGFAKQGNIEAAERWFKEAKERHPTLNAIIYGSIIYANCQTSNMDRAEELVRE  431

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API I+H MMDGYT   NE+KCL++FDRLKECGF PSV+SYGCL
Sbjct  432  MEEEGIDAPIDIYHIMMDGYTSAGNEDKCLVVFDRLKECGFAPSVVSYGCL  482


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 89/185 (48%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + +  +++ Y   GD  +A E F +++  G+    Y Y  L  A   S  M+ AL 
Sbjct  648  RPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDVYTYEALLKACCKSGRMQSALA  707

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              ++MN + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C
Sbjct  708  VTKEMNAKKIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVEPDIHTYTSFVNACC  767

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M +A   ++EM+  G+   +  + T++ G+      EK L  F+ +K+ G  P   
Sbjct  768  KAGDMQKATNTIQEMKRVGVKPNVKTYTTLIHGWARASLPEKALKCFEEMKKSGLKPDKA  827

Query  15   SYGCL  1
             Y CL
Sbjct  828  VYHCL  832


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 95/199 (48%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E++ K    P+ + F  +++ + + G   +A ++F+ MR  G +PT   Y 
Sbjct  561  NMDRALRIVEQMKKERHRPTSRTFMPIIHAFAKAGAIRKALDVFDMMRRSGCIPTVQTYN  620

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R M++A+  V +M   GI  +  TY+ I+ G+A +G+   A  +F   K+ 
Sbjct  621  ALILGLVEKRQMDKAVEVVDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDE  680

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  681  GLELDVYTYEALLKACCKSGRMQSALAVTKEMNAKKIPRNTFVYNILIDGWARRGDVWEA  740

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + +Y
Sbjct  741  ADLMQQMRQEGVEPDIHTY  759


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE +   G+ P    Y N+  A+    +M+ AL 
Sbjct  508  KHNMKTYSMLINGFIYLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNMDRALR  567

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FAK G +  A   F   +      +   Y  +I    
Sbjct  568  IVEQMKKERHRPTSRTFMPIIHAFAKAGAIRKALDVFDMMRRSGCIPTVQTYNALILGLV  627

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   MD+A E++ EM   GI      + T+MDGY    +  K    F R+K+ G    V 
Sbjct  628  EKRQMDKAVEVVDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDVY  687

Query  15   SYGCL  1
            +Y  L
Sbjct  688  TYEAL  692



>ref|XP_004236808.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X1 [Solanum lycopersicum]
Length=877

 Score =   406 bits (1044),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 204/275 (74%), Positives = 234/275 (85%), Gaps = 3/275 (1%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++NMGFGF+ Y G + EK+A+KAV FDGVEFHGRVLTVKLDDGRR +K+K + R  W E 
Sbjct  151  EKNMGFGFLKYEGPNAEKAAMKAVDFDGVEFHGRVLTVKLDDGRR-LKEKIEERNTWHEA  209

Query  639  SSS--RNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKM  466
                 R+F+KVLE QPENW AVVRAFERI KPSRKEFG+MVNYY RRGD HRARE FEKM
Sbjct  210  KEGPRRDFKKVLEIQPENWQAVVRAFERIKKPSRKEFGLMVNYYARRGDMHRARETFEKM  269

Query  465  RSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNV  286
             +RGI PTS+ YTNL +AY V RDMEEAL CVRKM DEGIE+S+VTYSI++GGFAKVGN+
Sbjct  270  CARGIEPTSHVYTNLVHAYAVGRDMEEALCCVRKMKDEGIELSLVTYSILIGGFAKVGNI  329

Query  285  EAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTM  106
            EAAE WF EAK+R  TL+A IYGNIIYANCQT +MDRAEEL+REMEEEG+ API I+HTM
Sbjct  330  EAAERWFEEAKKRDLTLNAIIYGNIIYANCQTFHMDRAEELVREMEEEGVDAPIDIYHTM  389

Query  105  MDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MDGYT+  NEEKCL++FDRLKECGFTPSV+SYGCL
Sbjct  390  MDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCL  424


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ ALT 
Sbjct  591  PNEYTYTTIMHGYASLGDIEKACEYFSKIKNEGLELDIYTYEALLKACCKSGRMQSALTV  650

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         + + I A C+
Sbjct  651  TKEMSAKSIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVPPDIHTFTSFINACCK  710

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M RA + + EME  GI   +  + T++ G+      EK L  F+++K+ G  P    
Sbjct  711  AGEMQRAMKAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMKQSGLKPDKAV  770

Query  12   YGCL  1
            Y CL
Sbjct  771  YHCL  774


 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + + G+  RA ++F+ MR  G +P+ + + 
Sbjct  503  NLDRALRIVEEMKKERHVPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFN  562

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R ME+A+  +  M   G+  +  TY+ I+ G+A +G++E A  +F + K  
Sbjct  563  ALVLGLVEKRQMEKAVQILDDMLLAGVGPNEYTYTTIMHGYASLGDIEKACEYFSKIKNE  622

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  623  GLELDIYTYEALLKACCKSGRMQSALTVTKEMSAKSIPRNTFVYNILIDGWARRGDVWEA  682

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + ++
Sbjct  683  ADLMQQMRQEGVPPDIHTF  701


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 81/176 (46%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++  + + G+   A   FE+ + R +   +  Y N+ YA   +  M+ A   VR+M 
Sbjct  316  YSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAIIYGNIIYANCQTFHMDRAEELVREME  375

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EG++  +  Y  ++ G+  +GN E     F   KE   T S   YG ++    +   + 
Sbjct  376  EEGVDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCLMNLYIKIGKVS  435

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+   M+  GI   +  +  +M+G+   ++      +F+ +   G  P V+ Y
Sbjct  436  KALEVSEMMKLAGIKHNMKTYSILMNGFINLKDWANAFAIFEDVIRDGLKPDVVLY  491



>ref|XP_007213789.1| hypothetical protein PRUPE_ppa018727m1g, partial [Prunus persica]
 gb|EMJ14988.1| hypothetical protein PRUPE_ppa018727m1g, partial [Prunus persica]
Length=740

 Score =   402 bits (1032),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/289 (68%), Positives = 237/289 (82%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGFVIYGGS+  KSA+KAV+FDGVEFHGRVLTVKLDDGRR +K+K + RTRW+E
Sbjct  205  TERNAGFGFVIYGGSTAAKSAMKAVEFDGVEFHGRVLTVKLDDGRR-LKEKIEERTRWIE  263

Query  642  G---------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G               SS +  RK+++++PENW A+V  FERI KPSR E+G+MV YY R
Sbjct  264  GNDGVEYRSNWHKERDSSRKELRKIMDTEPENWQAIVGFFERIKKPSRGEYGLMVKYYAR  323

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD +RARE FE MR+RGI PTS+ YT+L +AY V RDMEEAL+CVRKM +EG+E+S+VT
Sbjct  324  RGDMYRARETFESMRARGIEPTSHVYTSLIHAYAVGRDMEEALSCVRKMKEEGVEMSLVT  383

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            Y I+VGGFAKVGN EAA+HWF EAKERH TL++ IYGNIIYA CQTCNM+RAE L+R+ME
Sbjct  384  YGIMVGGFAKVGNAEAADHWFKEAKERHTTLNSIIYGNIIYAYCQTCNMNRAEALVRDME  443

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            E GI API I+HTMMDGYT+  NE+KCL++F+RLKECGFTPSVISYGCL
Sbjct  444  EAGIDAPIDIYHTMMDGYTMIGNEDKCLVVFERLKECGFTPSVISYGCL  492


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 86/182 (47%), Gaps = 11/182 (6%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G+ +R  R V E Q E            ++P+ + F  +++ + R G+  RA E+F+ MR
Sbjct  570  GNMNRAVRTVKEMQRER-----------HRPTSRTFMPIIHGFARAGEMRRALEIFDMMR  618

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G +PT + +  L       R ME+A+  + +M   GI     TY+ I+ G+A +G+  
Sbjct  619  MSGCIPTVHTFNALVLGLVEKRQMEKAVEILDEMTLAGISPDEHTYTTIMHGYASLGDTG  678

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             A  +F + +     L    Y  ++ A C+   M  A  + +EM  + I     +++ ++
Sbjct  679  KAFEYFTKLRNEGLELDVYTYEALLKACCKAGRMQSALAVTKEMSAQKIPRNTFVYNILI  738

Query  102  DG  97
            DG
Sbjct  739  DG  740


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 81/176 (46%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +G+MV  + + G+   A   F++ + R     S  Y N+ YAY  + +M  A   VR M 
Sbjct  384  YGIMVGGFAKVGNAEAADHWFKEAKERHTTLNSIIYGNIIYAYCQTCNMNRAEALVRDME  443

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            + GI+  +  Y  ++ G+  +GN +     F   KE   T S   YG +I    +   + 
Sbjct  444  EAGIDAPIDIYHTMMDGYTMIGNEDKCLVVFERLKECGFTPSVISYGCLINLYIKIGKVS  503

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      + + L + G  P ++ Y
Sbjct  504  KALEISKLMESAGIKHNVKTYSMLINGFLKLKDWANAFAVVEDLVKDGLKPDIVLY  559


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 83/179 (46%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  M++ Y   G++ +   +FE+++  G  P+   Y  L   Y     + +AL   + M 
Sbjct  454  YHTMMDGYTMIGNEDKCLVVFERLKECGFTPSVISYGCLINLYIKIGKVSKALEISKLME  513

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              GI+ +V TYS+++ GF K+ +   A     +  +        +Y NII A C   NM+
Sbjct  514  SAGIKHNVKTYSMLINGFLKLKDWANAFAVVEDLVKDGLKPDIVLYNNIITAFCGMGNMN  573

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            RA   ++EM+ E        F  ++ G+       + L +FD ++  G  P+V ++  L
Sbjct  574  RAVRTVKEMQRERHRPTSRTFMPIIHGFARAGEMRRALEIFDMMRMSGCIPTVHTFNAL  632



>ref|XP_006485466.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Citrus sinensis]
Length=948

 Score =   407 bits (1045),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 201/288 (70%), Positives = 237/288 (82%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N+GFGFVIY G + EKSA+KAV+FDGVEFHGRVLTVKLDDGRR +K++ + R RW+ G
Sbjct  191  EKNVGFGFVIYDGPAAEKSAMKAVEFDGVEFHGRVLTVKLDDGRR-LKNRAEVRARWVAG  249

Query  639  SSS---------------RNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            ++                R FRK +E+QPENW AVV AFERI KPSR+EFG+MVNYY RR
Sbjct  250  NNGEEFRSTWHKEREWHRREFRKAVETQPENWQAVVSAFERIKKPSRREFGLMVNYYARR  309

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRAR+ FE MR+RGI PT + YTNL +AY V RDMEEAL+CVRKM +EGIE+S+VTY
Sbjct  310  GDMHRARQTFENMRARGIEPTLHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVTY  369

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SIIVGGFAK+GN EAA+HWF EAKERHATL+A IYGNIIYA CQT NM+RAE L+R+MEE
Sbjct  370  SIIVGGFAKMGNAEAADHWFEEAKERHATLNAIIYGNIIYAQCQTRNMERAEALVRDMEE  429

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EGI API I+H MMDGYTI  NEEKCL++F+RLKECGFTPS+ISYGCL
Sbjct  430  EGIDAPIDIYHMMMDGYTIIGNEEKCLIVFERLKECGFTPSIISYGCL  477


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 94/193 (49%), Gaps = 0/193 (0%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    +  ++P+ + F  +++ + R G+  RA E+F  MR  G +PT + +  L    
Sbjct  562  HIVKEMQKERHRPTSRTFMPIIHGFARAGEMKRALEIFHMMRRSGCIPTVHTFNALILGL  621

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
               R ME+A+  + +M   GI  +  TY+ I+ G+A +G+   A  +F + +     L  
Sbjct  622  VEKRQMEKAIEILDEMTLAGISPNEHTYTTIMHGYASLGDTGKAFEYFTKLRNEGLELDV  681

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  +   +  +
Sbjct  682  FTYEALLKACCKSGRMQSALAVTKEMSAQKIPRNTFVYNILIDGWARRGDVWEAADLMQQ  741

Query  48   LKECGFTPSVISY  10
            +K+ G  P V +Y
Sbjct  742  MKQEGVQPDVHTY  754


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 83/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   FE+ + R     +  Y N+ YA   +R+ME A   VR M 
Sbjct  369  YSIIVGGFAKMGNAEAADHWFEEAKERHATLNAIIYGNIIYAQCQTRNMERAEALVRDME  428

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y +++ G+  +GN E     F   KE   T S   YG +I    +   + 
Sbjct  429  EEGIDAPIDIYHMMMDGYTIIGNEEKCLIVFERLKECGFTPSIISYGCLINLYTKIGKVS  488

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A ++ + M+  GI   +  +  +++G+   ++      +F+ +   G  P V+ Y
Sbjct  489  KALDVSKVMKSSGIKHNMKTYSMLINGFLKLKDWANAFAVFEDVMRDGLKPDVVLY  544


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM+ A   +R+M 
Sbjct  719  YNILIDGWARRGDVWEAADLMQQMKQEGVQPDVHTYTSFINACSKAGDMQSAAKAIREME  778

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            + G++ +V TY+ ++ G+A+    E A   F + K
Sbjct  779  EVGVKPNVKTYTTLIKGWARASLPEKALKCFSDMK  813


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  503  KHNMKTYSMLINGFLKLKDWANAFAVFEDVMRDGLKPDVVLYNNIIRAFCGMGNMDRAIH  562

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G ++ A   F   +      +   +  +I    
Sbjct  563  IVKEMQKERHRPTSRTFMPIIHGFARAGEMKRALEIFHMMRRSGCIPTVHTFNALILGLV  622

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   GI+     + T+M GY    +  K    F +L+  G    V 
Sbjct  623  EKRQMEKAIEILDEMTLAGISPNEHTYTTIMHGYASLGDTGKAFEYFTKLRNEGLELDVF  682

Query  15   SYGCL  1
            +Y  L
Sbjct  683  TYEAL  687



>gb|EYU19828.1| hypothetical protein MIMGU_mgv1a000898mg [Erythranthe guttata]
Length=948

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 207/290 (71%), Positives = 238/290 (82%), Gaps = 18/290 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RNMGFGFVIY GS+ EK+A+KAV+FDGVEF GRVLTVKLDDG RI K K   R +W+EG
Sbjct  195  ERNMGFGFVIYSGSTAEKAAMKAVEFDGVEFRGRVLTVKLDDGNRI-KGKYFDRAKWVEG  253

Query  639  S-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYG  511
                              S  +FRKVLESQPENW AVV +FERI KPSRKEFG++VNYY 
Sbjct  254  KEDDAVEYRSKWHEEREVSRVDFRKVLESQPENWQAVVESFERIKKPSRKEFGLIVNYYA  313

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            RRGD HRAREMFEKMR+RGI PT + YTNL  AY+V RDM+EAL+CVRKM DEGIE+S+V
Sbjct  314  RRGDMHRAREMFEKMRARGIEPTLHVYTNLILAYSVGRDMDEALSCVRKMRDEGIELSLV  373

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
            TYSIIVGGFAK GN+EAAE WF EAKE+  +L+  IYGNIIYANCQT N++RAEEL+REM
Sbjct  374  TYSIIVGGFAKTGNIEAAERWFKEAKEKITSLNGIIYGNIIYANCQTYNLNRAEELIREM  433

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEEGI API I+HTMMDGYT+T+NEEKCL++FDRLKECGFTPSVI+YGCL
Sbjct  434  EEEGIDAPIDIYHTMMDGYTMTQNEEKCLMVFDRLKECGFTPSVITYGCL  483


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  650  PNEHTYTTIMHGYASLGDTGKAFEYFSKLKNEGLELDVYTYEALLKACCKSGRMQSALAV  709

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M  + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C+
Sbjct  710  TKEMRAQNIPRNTFIYNILIDGWARRGDVWEAADLMQQMRQEGVQPDIHTYTSFVNACCK  769

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + ++EME  G+ A +  + +++ G+      EK L  FD +K  G  P   +
Sbjct  770  AGDMTRATKTIQEMEAHGVKANVKTYTSLIHGWARASLPEKALRCFDEMKRAGLKPDKAA  829

Query  12   YGCL  1
            + CL
Sbjct  830  FHCL  833


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/199 (24%), Positives = 95/199 (48%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + R G+  RA ++F+ MR  G +PT   Y 
Sbjct  562  NMDRAIRTVEEMKKERRRPTSRTFMPIIHSFARAGNNRRALDVFDMMRKSGCIPTVQTYN  621

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R M++A+  + ++   GI  +  TY+ I+ G+A +G+   A  +F + K  
Sbjct  622  ALILGLVEKRQMDKAVGILDEILLAGISPNEHTYTTIMHGYASLGDTGKAFEYFSKLKNE  681

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     I++ ++DG+    +  + 
Sbjct  682  GLELDVYTYEALLKACCKSGRMQSALAVTKEMRAQNIPRNTFIYNILIDGWARRGDVWEA  741

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + +Y
Sbjct  742  ADLMQQMRQEGVQPDIHTY  760


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/200 (23%), Positives = 94/200 (47%), Gaps = 4/200 (2%)
 Frame = -2

Query  597  ENWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
            +N    +  F+R+ +    PS   +G ++N Y + G  H+A E+ E M++ GI      Y
Sbjct  456  QNEEKCLMVFDRLKECGFTPSVITYGCLINLYTKIGKVHKAMEISEAMKTAGIKHNLKTY  515

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            + L   + + +D   A +    +  +G++  V+ Y+ IV  F  +GN++ A     E K+
Sbjct  516  SMLINGFIILKDWANAFSVFEDLVSDGLKPDVILYNNIVKAFCGMGNMDRAIRTVEEMKK  575

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
                 ++  +  II++  +  N  RA ++   M + G    +  ++ ++ G    R  +K
Sbjct  576  ERRRPTSRTFMPIIHSFARAGNNRRALDVFDMMRKSGCIPTVQTYNALILGLVEKRQMDK  635

Query  69   CLLMFDRLKECGFTPSVISY  10
             + + D +   G +P+  +Y
Sbjct  636  AVGILDEILLAGISPNEHTY  655


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE + S G+ P    Y N+  A+    +M+ A+ 
Sbjct  509  KHNLKTYSMLINGFIILKDWANAFSVFEDLVSDGLKPDVILYNNIVKAFCGMGNMDRAIR  568

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FA+ GN   A   F   ++     +   Y  +I    
Sbjct  569  TVEEMKKERRRPTSRTFMPIIHSFARAGNNRRALDVFDMMRKSGCIPTVQTYNALILGLV  628

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   MD+A  +L E+   GI+     + T+M GY    +  K    F +LK  G    V 
Sbjct  629  EKRQMDKAVGILDEILLAGISPNEHTYTTIMHGYASLGDTGKAFEYFSKLKNEGLELDVY  688

Query  15   SYGCL  1
            +Y  L
Sbjct  689  TYEAL  693


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 82/179 (46%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  M++ Y    ++ +   +F++++  G  P+   Y  L   YT    + +A+     M 
Sbjct  445  YHTMMDGYTMTQNEEKCLMVFDRLKECGFTPSVITYGCLINLYTKIGKVHKAMEISEAMK  504

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              GI+ ++ TYS+++ GF  + +   A   F +           +Y NI+ A C   NMD
Sbjct  505  TAGIKHNLKTYSMLINGFIILKDWANAFSVFEDLVSDGLKPDVILYNNIVKAFCGMGNMD  564

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            RA   + EM++E        F  ++  +    N  + L +FD +++ G  P+V +Y  L
Sbjct  565  RAIRTVEEMKKERRRPTSRTFMPIIHSFARAGNNRRALDVFDMMRKSGCIPTVQTYNAL  623



>gb|EYU19829.1| hypothetical protein MIMGU_mgv1a000898mg [Erythranthe guttata]
Length=945

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 207/290 (71%), Positives = 238/290 (82%), Gaps = 18/290 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RNMGFGFVIY GS+ EK+A+KAV+FDGVEF GRVLTVKLDDG RI K K   R +W+EG
Sbjct  195  ERNMGFGFVIYSGSTAEKAAMKAVEFDGVEFRGRVLTVKLDDGNRI-KGKYFDRAKWVEG  253

Query  639  S-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYG  511
                              S  +FRKVLESQPENW AVV +FERI KPSRKEFG++VNYY 
Sbjct  254  KEDDAVEYRSKWHEEREVSRVDFRKVLESQPENWQAVVESFERIKKPSRKEFGLIVNYYA  313

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            RRGD HRAREMFEKMR+RGI PT + YTNL  AY+V RDM+EAL+CVRKM DEGIE+S+V
Sbjct  314  RRGDMHRAREMFEKMRARGIEPTLHVYTNLILAYSVGRDMDEALSCVRKMRDEGIELSLV  373

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
            TYSIIVGGFAK GN+EAAE WF EAKE+  +L+  IYGNIIYANCQT N++RAEEL+REM
Sbjct  374  TYSIIVGGFAKTGNIEAAERWFKEAKEKITSLNGIIYGNIIYANCQTYNLNRAEELIREM  433

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEEGI API I+HTMMDGYT+T+NEEKCL++FDRLKECGFTPSVI+YGCL
Sbjct  434  EEEGIDAPIDIYHTMMDGYTMTQNEEKCLMVFDRLKECGFTPSVITYGCL  483


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  647  PNEHTYTTIMHGYASLGDTGKAFEYFSKLKNEGLELDVYTYEALLKACCKSGRMQSALAV  706

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M  + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C+
Sbjct  707  TKEMRAQNIPRNTFIYNILIDGWARRGDVWEAADLMQQMRQEGVQPDIHTYTSFVNACCK  766

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + ++EME  G+ A +  + +++ G+      EK L  FD +K  G  P   +
Sbjct  767  AGDMTRATKTIQEMEAHGVKANVKTYTSLIHGWARASLPEKALRCFDEMKRAGLKPDKAA  826

Query  12   YGCL  1
            + CL
Sbjct  827  FHCL  830


 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 93/199 (47%), Gaps = 7/199 (4%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + R G+  RA ++F+ MR  G +PT   Y 
Sbjct  562  NMDRAIRTVEEMKKERRRPTSRTFMPIIHSFARAGNNRRALDVFDMMRKSGCIPTVQTYN  621

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R   +A+  + ++   GI  +  TY+ I+ G+A +G+   A  +F + K  
Sbjct  622  ALILGLVEKR---QAVGILDEILLAGISPNEHTYTTIMHGYASLGDTGKAFEYFSKLKNE  678

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     I++ ++DG+    +  + 
Sbjct  679  GLELDVYTYEALLKACCKSGRMQSALAVTKEMRAQNIPRNTFIYNILIDGWARRGDVWEA  738

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + +Y
Sbjct  739  ADLMQQMRQEGVQPDIHTY  757


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 93/200 (47%), Gaps = 7/200 (4%)
 Frame = -2

Query  597  ENWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
            +N    +  F+R+ +    PS   +G ++N Y + G  H+A E+ E M++ GI      Y
Sbjct  456  QNEEKCLMVFDRLKECGFTPSVITYGCLINLYTKIGKVHKAMEISEAMKTAGIKHNLKTY  515

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            + L   + + +D   A +    +  +G++  V+ Y+ IV  F  +GN++ A     E K+
Sbjct  516  SMLINGFIILKDWANAFSVFEDLVSDGLKPDVILYNNIVKAFCGMGNMDRAIRTVEEMKK  575

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
                 ++  +  II++  +  N  RA ++   M + G    +  ++ ++ G    R   +
Sbjct  576  ERRRPTSRTFMPIIHSFARAGNNRRALDVFDMMRKSGCIPTVQTYNALILGLVEKR---Q  632

Query  69   CLLMFDRLKECGFTPSVISY  10
             + + D +   G +P+  +Y
Sbjct  633  AVGILDEILLAGISPNEHTY  652


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 82/179 (46%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  M++ Y    ++ +   +F++++  G  P+   Y  L   YT    + +A+     M 
Sbjct  445  YHTMMDGYTMTQNEEKCLMVFDRLKECGFTPSVITYGCLINLYTKIGKVHKAMEISEAMK  504

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              GI+ ++ TYS+++ GF  + +   A   F +           +Y NI+ A C   NMD
Sbjct  505  TAGIKHNLKTYSMLINGFIILKDWANAFSVFEDLVSDGLKPDVILYNNIVKAFCGMGNMD  564

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            RA   + EM++E        F  ++  +    N  + L +FD +++ G  P+V +Y  L
Sbjct  565  RAIRTVEEMKKERRRPTSRTFMPIIHSFARAGNNRRALDVFDMMRKSGCIPTVQTYNAL  623



>ref|XP_011076849.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Sesamum indicum]
Length=951

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 202/290 (70%), Positives = 236/290 (81%), Gaps = 18/290 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RNMGFGFVIY G + EK+A+KAV+FDG+EFHGRVLTVKLD+G+R MK K   R RW+EG
Sbjct  199  ERNMGFGFVIYSGHTAEKAAMKAVEFDGIEFHGRVLTVKLDNGKR-MKGKHSERARWVEG  257

Query  639  S-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYG  511
                              S R FR++LESQPE+W  VV+AFERI KPSRKEFG+MVNYY 
Sbjct  258  KWEDGENYKSKWHEERDGSRREFRRILESQPESWQMVVQAFERIKKPSRKEFGLMVNYYA  317

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            RRGD HRAREMFEKMR+RGI PT + YTNL +AY V RDMEEAL+CVRKM DEGIE+S+V
Sbjct  318  RRGDMHRAREMFEKMRARGIEPTLHVYTNLIHAYAVGRDMEEALSCVRKMRDEGIEMSLV  377

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
            TYSI+VGGFAK+GNVEAAE WF EAKER   L+A IYGNIIYA CQTCN+ RAE L+REM
Sbjct  378  TYSILVGGFAKIGNVEAAELWFKEAKERLTALNAVIYGNIIYAYCQTCNLTRAEALVREM  437

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEEGI API I+HTMMDGY + ++EEKCL++FDRLKECGFTPS+I++GCL
Sbjct  438  EEEGIDAPIDIYHTMMDGYGMIQDEEKCLMVFDRLKECGFTPSIITFGCL  487


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A + F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  654  PNEHTYTTIMHGYASLGDTGKAFQYFSKVKNEGLELDVYAYEALLKACCKSGRMQSALAV  713

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M  + I  +   Y+I++ G+A+ G+V  A     + ++         Y + I A C+
Sbjct  714  TKEMRAQNIPRNTFIYNILIDGWARRGDVWEAADLMQQMRQEGVQPDIHTYTSFINACCK  773

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA   + EME  G+ A +  + T++ G++     EK L  F+ +K+ G  P    
Sbjct  774  AGDMLRAMRTIEEMEAVGVKANVKTYTTLIHGWSRASLPEKALKCFEEMKQAGLNPDKAV  833

Query  12   YGCL  1
            Y CL
Sbjct  834  YHCL  837


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E++ K    P+ + F  +++ + R G+  RA ++F+ MR  G +PT + Y 
Sbjct  566  NMERAIRTVEQMKKERHRPTSRTFMPIIHSFARAGEMRRALDVFDMMRRSGCIPTVHTYN  625

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R ME+A+  + +M   GI  +  TY+ I+ G+A +G+   A  +F + K  
Sbjct  626  ALILGLVEKRQMEKAVGILDEMLLAGISPNEHTYTTIMHGYASLGDTGKAFQYFSKVKNE  685

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     I++ ++DG+    +  + 
Sbjct  686  GLELDVYAYEALLKACCKSGRMQSALAVTKEMRAQNIPRNTFIYNILIDGWARRGDVWEA  745

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + +Y
Sbjct  746  ADLMQQMRQEGVQPDIHTY  764


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 81/176 (46%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + R     +  Y N+ YAY  + ++  A   VR+M 
Sbjct  379  YSILVGGFAKIGNVEAAELWFKEAKERLTALNAVIYGNIIYAYCQTCNLTRAEALVREME  438

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  + + E     F   KE   T S   +G +I    +   + 
Sbjct  439  EEGIDAPIDIYHTMMDGYGMIQDEEKCLMVFDRLKECGFTPSIITFGCLINLYTKIGKVS  498

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+   M++ GI   +  +  +M+G+   ++      +F+ +   G  P VI Y
Sbjct  499  KALEVSDMMKQAGIKHNMKTYSMLMNGFINLKDWANAFSIFEDVIGDGLKPDVILY  554


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 78/185 (42%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE +   G+ P    Y N+  A+    +ME A+ 
Sbjct  513  KHNMKTYSMLMNGFINLKDWANAFSIFEDVIGDGLKPDVILYNNIIRAFCGMGNMERAIR  572

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FA+ G +  A   F   +      +   Y  +I    
Sbjct  573  TVEQMKKERHRPTSRTFMPIIHSFARAGEMRRALDVFDMMRRSGCIPTVHTYNALILGLV  632

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A  +L EM   GI+     + T+M GY    +  K    F ++K  G    V 
Sbjct  633  EKRQMEKAVGILDEMLLAGISPNEHTYTTIMHGYASLGDTGKAFQYFSKVKNEGLELDVY  692

Query  15   SYGCL  1
            +Y  L
Sbjct  693  AYEAL  697



>ref|XP_008231812.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Prunus mume]
Length=953

 Score =   406 bits (1043),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 200/289 (69%), Positives = 237/289 (82%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGFVIYGGS+  KSA+KAV+FDGVEFHGRVLTVKLDDGRR +K+K + RTRW+E
Sbjct  206  TERNAGFGFVIYGGSTAAKSAMKAVEFDGVEFHGRVLTVKLDDGRR-LKEKTEERTRWIE  264

Query  642  G---------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G               SS +  RK+++++PENW AVV  FERI KPSR E+G+MV YY R
Sbjct  265  GNDEVEYRSNWHKERDSSRKELRKIMDTEPENWQAVVGFFERIKKPSRGEYGLMVKYYAR  324

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRARE FE MR+RGI PTS+ YT+L +AY V RDMEEAL+CVRKM +EGIE+S+VT
Sbjct  325  RGDMHRARETFESMRARGIEPTSHLYTSLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVT  384

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSI+VGGFAKVGN EAA+HWF EAKERH  L++ IYGNIIYA CQTCNM+RAE L+R+ME
Sbjct  385  YSIMVGGFAKVGNAEAADHWFKEAKERHTALNSIIYGNIIYAYCQTCNMNRAEALVRDME  444

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            E GI API I+HTMMDGYT+  NE+KCL++F+RLKECGFTPSVISYGCL
Sbjct  445  EAGIDAPIDIYHTMMDGYTMIGNEDKCLVVFERLKECGFTPSVISYGCL  493


 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +++ Y   GD  +A E F K+R+ G+    Y Y  L  A   +  M+ AL  
Sbjct  660  PDEHTYTTIMHGYASLGDTGKAFEYFTKLRNEGLELDVYTYEALLKACCKAGRMQSALAV  719

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A C+
Sbjct  720  TKEMSAQKIPRNTFVYNILIDGWARRGDVWEAADLMQQMKKDGVRPDIHTYTSFINACCK  779

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + + EME  G+   +  + T++ G+      EK    F  +K  G  P    
Sbjct  780  AGDMQRAAKTIEEMEAFGVKPNVKTYTTLIHGWARASLPEKAFRCFKDMKSAGLKPDKAV  839

Query  12   YGCL  1
            Y CL
Sbjct  840  YHCL  843


 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 99/211 (47%), Gaps = 11/211 (5%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G+ +R  R V E Q E            ++P+ + F  +++ + R G+  RA E+F+ MR
Sbjct  571  GNMNRAVRTVKEMQRER-----------HRPTSRTFMPIIHGFARAGEMRRALEIFDMMR  619

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G +PT + +  L       R ME+A+  + +M   GI     TY+ I+ G+A +G+  
Sbjct  620  MSGCIPTVHTFNALVLGLVEKRQMEKAVEILDEMTLAGISPDEHTYTTIMHGYASLGDTG  679

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             A  +F + +     L    Y  ++ A C+   M  A  + +EM  + I     +++ ++
Sbjct  680  KAFEYFTKLRNEGLELDVYTYEALLKACCKAGRMQSALAVTKEMSAQKIPRNTFVYNILI  739

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            DG+    +  +   +  ++K+ G  P + +Y
Sbjct  740  DGWARRGDVWEAADLMQQMKKDGVRPDIHTY  770


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 80/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +MV  + + G+   A   F++ + R     S  Y N+ YAY  + +M  A   VR M 
Sbjct  385  YSIMVGGFAKVGNAEAADHWFKEAKERHTALNSIIYGNIIYAYCQTCNMNRAEALVRDME  444

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            + GI+  +  Y  ++ G+  +GN +     F   KE   T S   YG +I    +   + 
Sbjct  445  EAGIDAPIDIYHTMMDGYTMIGNEDKCLVVFERLKECGFTPSVISYGCLINLYIKIGKVS  504

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      + + L + G  P ++ Y
Sbjct  505  KALEISKLMESAGIKHNVKTYSMLINGFLKLKDWANAFAVVEDLVKDGLKPDIVLY  560


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 83/179 (46%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  M++ Y   G++ +   +FE+++  G  P+   Y  L   Y     + +AL   + M 
Sbjct  455  YHTMMDGYTMIGNEDKCLVVFERLKECGFTPSVISYGCLINLYIKIGKVSKALEISKLME  514

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              GI+ +V TYS+++ GF K+ +   A     +  +        +Y NII A C   NM+
Sbjct  515  SAGIKHNVKTYSMLINGFLKLKDWANAFAVVEDLVKDGLKPDIVLYNNIITAFCGMGNMN  574

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            RA   ++EM+ E        F  ++ G+       + L +FD ++  G  P+V ++  L
Sbjct  575  RAVRTVKEMQRERHRPTSRTFMPIIHGFARAGEMRRALEIFDMMRMSGCIPTVHTFNAL  633



>ref|XP_010673127.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=939

 Score =   402 bits (1033),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 236/288 (82%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RNMGFGFVI+GG + EKSA+KAV+FDGVEFHGRVLTVKLDDGRR +K   + R RW++G
Sbjct  195  ERNMGFGFVIFGGPAAEKSALKAVEFDGVEFHGRVLTVKLDDGRR-LKMLARERERWVQG  253

Query  639  S---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
                            S + FRKV++SQPENW AVVRAFERI KPSRKEFG MV +Y RR
Sbjct  254  GEGREHRSKWHEERDGSRKEFRKVVDSQPENWQAVVRAFERIKKPSRKEFGQMVKFYARR  313

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRARE FE MR+RGI P S+ +T+L +AY V RDMEEAL+CVRKM +EGIE+S+VTY
Sbjct  314  GDMHRARETFESMRARGIEPNSHVFTSLIHAYAVGRDMEEALSCVRKMKEEGIELSLVTY  373

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI+VGGFA++GNVEAA+ WF EAKE+H TL+A +YGNIIYA CQTCNMDRAE L+REMEE
Sbjct  374  SILVGGFARIGNVEAADQWFKEAKEKHTTLNAIVYGNIIYAYCQTCNMDRAEALVREMEE  433

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +GI API I+HTMMDGYT+  +EEKCL++++RLKECGF PSV++YGCL
Sbjct  434  QGIDAPIDIYHTMMDGYTMIGDEEKCLIVYERLKECGFVPSVVTYGCL  481


 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 91/182 (50%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+ + F  +++ + R G+  RA E+F+ MR  G +PT + +  L       R ME+A+ 
Sbjct  577  KPTTRTFMPIIHGFARAGETRRALEIFDMMRRNGCIPTVHTFNALILGLIEKRQMEKAVE  636

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M   G+  +  TY+ I+ G+A  GN   A  +F + KE    L    Y  ++ A C
Sbjct  637  ILDEMALAGVSANEHTYTTIMQGYAAKGNTGKAFEYFTKVKEEGLQLDVYTYEALLKACC  696

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + REM  + I     +++ ++DG+    +  +   +  +++E G  P + 
Sbjct  697  KSGRMQSALAVTREMSAQNIPRNTFVYNILVDGWARRGDVWEAADLLQQMREDGVQPDIH  756

Query  15   SY  10
            +Y
Sbjct  757  TY  758


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 83/172 (48%), Gaps = 0/172 (0%)
 Frame = -2

Query  516  YGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEIS  337
            Y  +G+  +A E F K++  G+    Y Y  L  A   S  M+ AL   R+M+ + I  +
Sbjct  660  YAAKGNTGKAFEYFTKVKEEGLQLDVYTYEALLKACCKSGRMQSALAVTREMSAQNIPRN  719

Query  336  VVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellr  157
               Y+I+V G+A+ G+V  A     + +E         Y + I A C+  +M++A   ++
Sbjct  720  TFVYNILVDGWARRGDVWEAADLLQQMREDGVQPDIHTYTSFINACCKAGDMNKAARTIQ  779

Query  156  emeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EM+  G+   +  + T++ G+  +   EK L  F+ +K  G  P    Y CL
Sbjct  780  EMKAVGVNPNVRTYTTLIHGWARSSLPEKALKCFEEMKLAGLKPDKAVYHCL  831


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 82/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  543  KEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRK  364
            K + M++N + R  D   A  +FE +   G+ P    Y N+  A++   +M+ AL  + +
Sbjct  511  KTYSMLINGFLRLKDWANAFAIFEDVVRDGLKPDVVLYNNIIRAFSGMGNMDRALRIIEQ  570

Query  363  MNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCN  184
            M  E  + +  T+  I+ GFA+ G    A   F   +      +   +  +I    +   
Sbjct  571  MKKERYKPTTRTFMPIIHGFARAGETRRALEIFDMMRRNGCIPTVHTFNALILGLIEKRQ  630

Query  183  MDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGC  4
            M++A E+L EM   G++A    + T+M GY    N  K    F ++KE G    V +Y  
Sbjct  631  MEKAVEILDEMALAGVSANEHTYTTIMQGYAAKGNTGKAFEYFTKVKEEGLQLDVYTYEA  690

Query  3    L  1
            L
Sbjct  691  L  691


 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/176 (22%), Positives = 82/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + R G+   A + F++ + +     +  Y N+ YAY  + +M+ A   VR+M 
Sbjct  373  YSILVGGFARIGNVEAADQWFKEAKEKHTTLNAIVYGNIIYAYCQTCNMDRAEALVREME  432

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++GI+  +  Y  ++ G+  +G+ E     +   KE     S   YG +I    +   + 
Sbjct  433  EQGIDAPIDIYHTMMDGYTMIGDEEKCLIVYERLKECGFVPSVVTYGCLINVYTKAGKVS  492

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+   M+  GI   +  +  +++G+   ++      +F+ +   G  P V+ Y
Sbjct  493  KALEISEMMKSAGIRHNMKTYSMLINGFLRLKDWANAFAIFEDVVRDGLKPDVVLY  548


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 1/112 (1%)
 Frame = -2

Query  585  AVVRAFERINKPSRK-EFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            AV R     N P     + ++V+ + RRGD   A ++ ++MR  G+ P  + YT+   A 
Sbjct  706  AVTREMSAQNIPRNTFVYNILVDGWARRGDVWEAADLLQQMREDGVQPDIHTYTSFINAC  765

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              + DM +A   +++M   G+  +V TY+ ++ G+A+    E A   F E K
Sbjct  766  CKAGDMNKAARTIQEMKAVGVNPNVRTYTTLIHGWARSSLPEKALKCFEEMK  817



>gb|KCW65188.1| hypothetical protein EUGRSUZ_G02683 [Eucalyptus grandis]
Length=964

 Score =   402 bits (1033),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/289 (69%), Positives = 238/289 (82%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T++N GFGFVIYGG +  KSA+KAV+FDGVEFHGRVLTVKLDDGRR  K K + R R++E
Sbjct  213  TEKNAGFGFVIYGGPTAAKSAMKAVEFDGVEFHGRVLTVKLDDGRR-QKAKSEERLRYVE  271

Query  642  GSS--------------SRN-FRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G+               SRN FR+VLE++PENW AVV  FERI KPSR+EFG+MVNYY R
Sbjct  272  GNGGVEFRTKWHEEREMSRNAFRRVLETEPENWQAVVSVFERIKKPSRREFGLMVNYYAR  331

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRARE FE MR+RGI PTS+ YTNL +AY V RDMEEAL+CVRKM +EGIE+S+VT
Sbjct  332  RGDMHRARETFESMRARGIEPTSHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVT  391

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSI+VGGFAK+GN EAAE+WF EA+E HAT++A +YGNIIYA CQTCNMD+AE L+REME
Sbjct  392  YSILVGGFAKIGNAEAAEYWFKEARETHATINARVYGNIIYALCQTCNMDQAEALVREME  451

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEGI API I+HTMMDGYT+  NE KCL++F+RLKECGFTPS+++YGCL
Sbjct  452  EEGIDAPIDIYHTMMDGYTMVGNENKCLVVFERLKECGFTPSIVTYGCL  500


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E+F  MR+ G+    Y Y  L  A   +  M+ AL  
Sbjct  667  PNEHTYTNIMHGYASLGDTGKAFELFTMMRNEGLELDVYTYEALLKACCKAGRMQSALAV  726

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M+   I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A C+
Sbjct  727  TREMSMRRIPRNTFVYNILIDGWARRGDVWEATDLMQQMKKEGVKPDIHTYTSFINACCK  786

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++ +A + + EME  G+   +  + T++ G+    + EK L  F+ +K  G  P    
Sbjct  787  AGDLAKASKTMEEMEALGVKPNVKTYTTLIHGWARASHPEKALKCFEEMKHVGLKPDKAV  846

Query  12   YGCL  1
            Y CL
Sbjct  847  YHCL  850


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 87/183 (48%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++   R G+  RA EMF+ MR  G +PT + Y  L       R ME+A+
Sbjct  595  HRPTSRTFMPIIHGLARAGEIRRALEMFDTMRRSGCIPTVHTYNALILGLVEKRQMEKAV  654

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   GI  +  TY+ I+ G+A +G+   A   F   +     L    Y  ++ A 
Sbjct  655  EILNEMTLAGISPNEHTYTNIMHGYASLGDTGKAFELFTMMRNEGLELDVYTYEALLKAC  714

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C+   M  A  + REM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  715  CKAGRMQSALAVTREMSMRRIPRNTFVYNILIDGWARRGDVWEATDLMQQMKKEGVKPDI  774

Query  18   ISY  10
             +Y
Sbjct  775  HTY  777


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 81/176 (46%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ R       +  Y N+ YA   + +M++A   VR+M 
Sbjct  392  YSILVGGFAKIGNAEAAEYWFKEARETHATINARVYGNIIYALCQTCNMDQAEALVREME  451

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  VGN       F   KE   T S   YG +I    +   + 
Sbjct  452  EEGIDAPIDIYHTMMDGYTMVGNENKCLVVFERLKECGFTPSIVTYGCLINLYTKIGKVS  511

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      +F+ +   G  P V+ Y
Sbjct  512  KALEISKMMEGAGIKHNMKTYSMLINGFLRLKDWANAFAVFEDVISSGLKPDVVLY  567


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + R  D   A  +FE + S G+ P    Y N+  A+    +++ A++
Sbjct  526  KHNMKTYSMLINGFLRLKDWANAFAVFEDVISSGLKPDVVLYNNIVRAFCGMGNIDRAIS  585

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ G A+ G +  A   F   +      +   Y  +I    
Sbjct  586  TVKQMQKERHRPTSRTFMPIIHGLARAGEIRRALEMFDTMRRSGCIPTVHTYNALILGLV  645

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   GI+     +  +M GY    +  K   +F  ++  G    V 
Sbjct  646  EKRQMEKAVEILNEMTLAGISPNEHTYTNIMHGYASLGDTGKAFELFTMMRNEGLELDVY  705

Query  15   SYGCL  1
            +Y  L
Sbjct  706  TYEAL  710



>ref|XP_010067123.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Eucalyptus grandis]
Length=965

 Score =   402 bits (1033),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/289 (69%), Positives = 238/289 (82%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T++N GFGFVIYGG +  KSA+KAV+FDGVEFHGRVLTVKLDDGRR  K K + R R++E
Sbjct  214  TEKNAGFGFVIYGGPTAAKSAMKAVEFDGVEFHGRVLTVKLDDGRR-QKAKSEERLRYVE  272

Query  642  GSS--------------SRN-FRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G+               SRN FR+VLE++PENW AVV  FERI KPSR+EFG+MVNYY R
Sbjct  273  GNGGVEFRTKWHEEREMSRNAFRRVLETEPENWQAVVSVFERIKKPSRREFGLMVNYYAR  332

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRARE FE MR+RGI PTS+ YTNL +AY V RDMEEAL+CVRKM +EGIE+S+VT
Sbjct  333  RGDMHRARETFESMRARGIEPTSHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVT  392

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSI+VGGFAK+GN EAAE+WF EA+E HAT++A +YGNIIYA CQTCNMD+AE L+REME
Sbjct  393  YSILVGGFAKIGNAEAAEYWFKEARETHATINARVYGNIIYALCQTCNMDQAEALVREME  452

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEGI API I+HTMMDGYT+  NE KCL++F+RLKECGFTPS+++YGCL
Sbjct  453  EEGIDAPIDIYHTMMDGYTMVGNENKCLVVFERLKECGFTPSIVTYGCL  501


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E+F  MR+ G+    Y Y  L  A   +  M+ AL  
Sbjct  668  PNEHTYTNIMHGYASLGDTGKAFELFTMMRNEGLELDVYTYEALLKACCKAGRMQSALAV  727

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M+   I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A C+
Sbjct  728  TREMSMRRIPRNTFVYNILIDGWARRGDVWEATDLMQQMKKEGVKPDIHTYTSFINACCK  787

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++ +A + + EME  G+   +  + T++ G+    + EK L  F+ +K  G  P    
Sbjct  788  AGDLAKASKTMEEMEALGVKPNVKTYTTLIHGWARASHPEKALKCFEEMKHVGLKPDKAV  847

Query  12   YGCL  1
            Y CL
Sbjct  848  YHCL  851


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 87/183 (48%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++   R G+  RA EMF+ MR  G +PT + Y  L       R ME+A+
Sbjct  596  HRPTSRTFMPIIHGLARAGEIRRALEMFDTMRRSGCIPTVHTYNALILGLVEKRQMEKAV  655

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   GI  +  TY+ I+ G+A +G+   A   F   +     L    Y  ++ A 
Sbjct  656  EILNEMTLAGISPNEHTYTNIMHGYASLGDTGKAFELFTMMRNEGLELDVYTYEALLKAC  715

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C+   M  A  + REM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  716  CKAGRMQSALAVTREMSMRRIPRNTFVYNILIDGWARRGDVWEATDLMQQMKKEGVKPDI  775

Query  18   ISY  10
             +Y
Sbjct  776  HTY  778


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 81/176 (46%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ R       +  Y N+ YA   + +M++A   VR+M 
Sbjct  393  YSILVGGFAKIGNAEAAEYWFKEARETHATINARVYGNIIYALCQTCNMDQAEALVREME  452

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  VGN       F   KE   T S   YG +I    +   + 
Sbjct  453  EEGIDAPIDIYHTMMDGYTMVGNENKCLVVFERLKECGFTPSIVTYGCLINLYTKIGKVS  512

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      +F+ +   G  P V+ Y
Sbjct  513  KALEISKMMEGAGIKHNMKTYSMLINGFLRLKDWANAFAVFEDVISSGLKPDVVLY  568


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + R  D   A  +FE + S G+ P    Y N+  A+    +++ A++
Sbjct  527  KHNMKTYSMLINGFLRLKDWANAFAVFEDVISSGLKPDVVLYNNIVRAFCGMGNIDRAIS  586

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ G A+ G +  A   F   +      +   Y  +I    
Sbjct  587  TVKQMQKERHRPTSRTFMPIIHGLARAGEIRRALEMFDTMRRSGCIPTVHTYNALILGLV  646

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   GI+     +  +M GY    +  K   +F  ++  G    V 
Sbjct  647  EKRQMEKAVEILNEMTLAGISPNEHTYTNIMHGYASLGDTGKAFELFTMMRNEGLELDVY  706

Query  15   SYGCL  1
            +Y  L
Sbjct  707  TYEAL  711



>ref|XP_002269194.2| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Vitis vinifera]
Length=930

 Score =   400 bits (1028),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 199/286 (70%), Positives = 233/286 (81%), Gaps = 15/286 (5%)
 Frame = -2

Query  816  RNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG-  640
            RN GFGFVIYGG     SA++AV+FDGVEFHGRVLTVKLDDGRR ++ + + R RW++G 
Sbjct  187  RNAGFGFVIYGGPMASGSAMRAVEFDGVEFHGRVLTVKLDDGRR-LRGRSEERARWVQGH  245

Query  639  -------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGD  499
                         SS ++FRKVLE++PENW AVV+AFERI KPSRKEFG+MV YY RRGD
Sbjct  246  GVDQRSKWHEERESSRKDFRKVLETEPENWQAVVQAFERIKKPSRKEFGLMVTYYARRGD  305

Query  498  KHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSI  319
             H AR  FE MR+RGI PTS+ YT+L +AY V RDMEEAL+CVRKM +EGIE+S+VTYSI
Sbjct  306  MHHARGTFESMRARGIEPTSHVYTSLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVTYSI  365

Query  318  IVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEG  139
            +VGGFAK+ + EAA+HWF EAKERH TL+A IYGNIIYA+CQ CNM +AE L+REMEEEG
Sbjct  366  LVGGFAKIADAEAADHWFKEAKERHTTLNAIIYGNIIYAHCQACNMTQAEALVREMEEEG  425

Query  138  IAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            I API I+HTMMDGYTI  NEEKCL++FDRLKECGFTPSVISYGCL
Sbjct  426  IDAPIDIYHTMMDGYTIIGNEEKCLIVFDRLKECGFTPSVISYGCL  471


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  638  PNEHTYTTIMHGYASLGDTGKAFEYFTKLKTEGLELDVYTYEALLKACCKSGRMQSALAV  697

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M+ + I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A C+
Sbjct  698  TREMSSQKIPRNTFVYNILIDGWARRGDVWEAAELMQQMKQEGVQPDIHTYTSFINACCK  757

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + ++EME  G+   I  + T++ G+      EK L  F  +K  G  P    
Sbjct  758  AGDMQRATKTIQEMEVVGVKPNIKTYTTLIHGWARASLPEKALKCFQEMKSAGLKPDKAV  817

Query  12   YGCL  1
            Y CL
Sbjct  818  YHCL  821


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 100/211 (47%), Gaps = 11/211 (5%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G+  R  R V E Q E            ++P+ + F  +++ + R GD  RA E+F+ MR
Sbjct  549  GNMDRAIRTVKEMQKER-----------HRPTTRTFMPIIHGFARSGDMRRALEIFDMMR  597

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G +PT + +  L         ME+A+  + +M+  GI  +  TY+ I+ G+A +G+  
Sbjct  598  WSGCIPTVHTFNALILGLVEKCQMEKAVEILDEMSLAGISPNEHTYTTIMHGYASLGDTG  657

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             A  +F + K     L    Y  ++ A C++  M  A  + REM  + I     +++ ++
Sbjct  658  KAFEYFTKLKTEGLELDVYTYEALLKACCKSGRMQSALAVTREMSSQKIPRNTFVYNILI  717

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            DG+    +  +   +  ++K+ G  P + +Y
Sbjct  718  DGWARRGDVWEAAELMQQMKQEGVQPDIHTY  748


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + R  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  497  KHNMKTYSMLINGFVRLKDWANAFAVFEDVVKDGLKPDVVLYNNIIRAFCGMGNMDRAIR  556

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G++  A   F   +      +   +  +I    
Sbjct  557  TVKEMQKERHRPTTRTFMPIIHGFARSGDMRRALEIFDMMRWSGCIPTVHTFNALILGLV  616

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            + C M++A E+L EM   GI+     + T+M GY    +  K    F +LK  G    V 
Sbjct  617  EKCQMEKAVEILDEMSLAGISPNEHTYTTIMHGYASLGDTGKAFEYFTKLKTEGLELDVY  676

Query  15   SYGCL  1
            +Y  L
Sbjct  677  TYEAL  681


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 83/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + +  D   A   F++ + R     +  Y N+ YA+  + +M +A   VR+M 
Sbjct  363  YSILVGGFAKIADAEAADHWFKEAKERHTTLNAIIYGNIIYAHCQACNMTQAEALVREME  422

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  +GN E     F   KE   T S   YG +I    +   + 
Sbjct  423  EEGIDAPIDIYHTMMDGYTIIGNEEKCLIVFDRLKECGFTPSVISYGCLINLYIKIGKVS  482

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      +F+ + + G  P V+ Y
Sbjct  483  KALEVSKMMEVAGIKHNMKTYSMLINGFVRLKDWANAFAVFEDVVKDGLKPDVVLY  538



>gb|KDP44599.1| hypothetical protein JCGZ_22497 [Jatropha curcas]
Length=960

 Score =   399 bits (1026),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 234/287 (82%), Gaps = 16/287 (6%)
 Frame = -2

Query  816  RNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEGS  637
            RN GFGF+IY GS+ EKSA+KAV+FDGVEFHGR LTVKLDDGRR +K K + R RW+EG 
Sbjct  206  RNAGFGFIIYDGSTAEKSAMKAVEFDGVEFHGRTLTVKLDDGRR-LKTKAEERERWVEGE  264

Query  636  ---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRG  502
                           + + FR+VLE+QPE W AVV AFERI KPSR+E+G+M++YY RRG
Sbjct  265  DGQGFKSKWHEEREGTRKAFRQVLETQPEKWQAVVSAFERIKKPSRREYGLMLSYYARRG  324

Query  501  DKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYS  322
            D HRAR+ FE MR+RGI PTS+ YT+L +AY V RDMEEAL+CVRKM DEG+E+S+VTYS
Sbjct  325  DMHRARQTFESMRARGIEPTSHVYTSLIHAYAVGRDMEEALSCVRKMKDEGVEMSLVTYS  384

Query  321  IIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeE  142
            IIVGGFAK+GN EAA+HWF EAKE H+ +++ IYGNIIYA+CQTCNMD+AE L+REMEE+
Sbjct  385  IIVGGFAKIGNAEAADHWFKEAKETHSNMNSIIYGNIIYAHCQTCNMDKAEALVREMEED  444

Query  141  GIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            GI API I+HTMMDGYT+  NEEKCL +F+RLKECGF PSVISYGCL
Sbjct  445  GIDAPIDIYHTMMDGYTMIGNEEKCLTVFERLKECGFAPSVISYGCL  491


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+R+ G+    Y Y  L  A   S  M+ AL  
Sbjct  658  PNEHTYTTIMHGYAALGDTGKAFEYFTKLRNEGLELDVYTYEALLKACCKSGRMQSALAV  717

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A C+
Sbjct  718  TKEMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQGGVQPDIHTYTSFINACCK  777

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + + EME  G+   +  + T++ G+    + EK L  F+ +K  G  P    
Sbjct  778  AGDMMRATKTMEEMETSGVKPNVKTYTTLIHGWARASHPEKALRCFEEMKLAGLNPDKAV  837

Query  12   YGCL  1
            Y CL
Sbjct  838  YHCL  841


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/186 (23%), Positives = 93/186 (50%), Gaps = 1/186 (1%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER+ +P+ + F  +++ + R G+  RA ++F+ MR  G +PT + +  L         +E
Sbjct  584  ERL-RPTTRTFMPIIHGFARAGEMRRALDIFDMMRWSGCIPTVHTFNALILGLVEKCQIE  642

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +A+  + +M   G+  +  TY+ I+ G+A +G+   A  +F + +     L    Y  ++
Sbjct  643  KAVEILDEMALAGVSPNEHTYTTIMHGYAALGDTGKAFEYFTKLRNEGLELDVYTYEALL  702

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
             A C++  M  A  + +EM  + I     +++ ++DG+    +  +   +  ++K+ G  
Sbjct  703  KACCKSGRMQSALAVTKEMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQGGVQ  762

Query  27   PSVISY  10
            P + +Y
Sbjct  763  PDIHTY  768


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y NL  A+    +ME A+ 
Sbjct  517  KHNMKTYSMLINGFLKLKDWANAFAIFEDVVKHGLKPDVVLYNNLIKAFCGMGNMERAIC  576

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E +  +  T+  I+ GFA+ G +  A   F   +      +   +  +I    
Sbjct  577  MVKEMQKERLRPTTRTFMPIIHGFARAGEMRRALDIFDMMRWSGCIPTVHTFNALILGLV  636

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            + C +++A E+L EM   G++     + T+M GY    +  K    F +L+  G    V 
Sbjct  637  EKCQIEKAVEILDEMALAGVSPNEHTYTTIMHGYAALGDTGKAFEYFTKLRNEGLELDVY  696

Query  15   SYGCL  1
            +Y  L
Sbjct  697  TYEAL  701


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/179 (23%), Positives = 84/179 (47%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ +       S  Y N+ YA+  + +M++A   VR+M 
Sbjct  383  YSIIVGGFAKIGNAEAADHWFKEAKETHSNMNSIIYGNIIYAHCQTCNMDKAEALVREME  442

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++GI+  +  Y  ++ G+  +GN E     F   KE     S   YG +I    +   + 
Sbjct  443  EDGIDAPIDIYHTMMDGYTMIGNEEKCLTVFERLKECGFAPSVISYGCLINLYIKVGKVS  502

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +A E+ + ME  GI   +  +  +++G+   ++      +F+ + + G  P V+ Y  L
Sbjct  503  KALEVSKMMESAGIKHNMKTYSMLINGFLKLKDWANAFAIFEDVVKHGLKPDVVLYNNL  561



>ref|XP_011032910.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Populus euphratica]
Length=946

 Score =   397 bits (1021),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 234/289 (81%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGF+IY G + EKSA+KA +FDG+EFHGRVLTVKLDDGRR +K K + R  W++
Sbjct  187  TERNAGFGFIIYDGPTAEKSAMKAEEFDGMEFHGRVLTVKLDDGRR-LKAKAEERKNWVD  245

Query  642  GS---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G                S++ FR+VL++QPENW AVV AFERI KP+R+EFG+MV YY R
Sbjct  246  GEDEGDYRSKWHEEREGSTKAFRRVLDTQPENWQAVVSAFERIKKPARREFGLMVGYYAR  305

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRAR+ FE MR+RGI P+S+ YT+L +AY V RDMEEAL+CVRKM +EG+E+S+VT
Sbjct  306  RGDMHRARQTFESMRARGIYPSSHVYTSLIHAYAVGRDMEEALSCVRKMKEEGVEMSLVT  365

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSI+VGGFAK+GN EAAEHWF EAKERH  L+A IYG+IIYA CQ+CNMDRAE L+REME
Sbjct  366  YSIVVGGFAKIGNAEAAEHWFKEAKERHTNLNAIIYGSIIYAYCQSCNMDRAESLVREME  425

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEGI API I+HTMMDGYT+  NEEKCL++F RLKECGF PSVISYGCL
Sbjct  426  EEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFKRLKECGFAPSVISYGCL  474


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 94/193 (49%), Gaps = 0/193 (0%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    +  ++P+ + F  +++ + R G+  RA E+F+ MR  G +PT + +  L    
Sbjct  559  HMVKEMQKERHRPTSRTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGL  618

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
               R ME+A+  + +M   G+     TY+ I+ G+A +G+   A  +F + +     L  
Sbjct  619  VEKRQMEKAVEILDEMALAGVSPDEHTYTTIMNGYAALGDTGKAFEYFTKLRNEGLELDV  678

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              Y  ++ A C++  M  A  + REM  + I     +++ ++DG+    +  +   +  +
Sbjct  679  FTYEALLKACCKSGRMQSALAVTREMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQ  738

Query  48   LKECGFTPSVISY  10
            +K+ G  P + +Y
Sbjct  739  MKQEGVQPDIHTY  751


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 84/176 (48%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + R     +  Y ++ YAY  S +M+ A + VR+M 
Sbjct  366  YSIVVGGFAKIGNAEAAEHWFKEAKERHTNLNAIIYGSIIYAYCQSCNMDRAESLVREME  425

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  +GN E     F   KE     S   YG +I    +   + 
Sbjct  426  EEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFKRLKECGFAPSVISYGCLINMYTKMGKVS  485

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      +F+ + + G  P V+ Y
Sbjct  486  KALEVSKMMESAGIKHNMKTYSMLINGFLKLKDWTNAFTVFEDVIKAGLKPDVVLY  541


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  500  KHNMKTYSMLINGFLKLKDWTNAFTVFEDVIKAGLKPDVVLYNNIIKAFCGMGNMDRAIH  559

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G +  A   F   +      +   +  ++    
Sbjct  560  MVKEMQKERHRPTSRTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLV  619

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++     + T+M+GY    +  K    F +L+  G    V 
Sbjct  620  EKRQMEKAVEILDEMALAGVSPDEHTYTTIMNGYAALGDTGKAFEYFTKLRNEGLELDVF  679

Query  15   SYGCL  1
            +Y  L
Sbjct  680  TYEAL  684


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 56/112 (50%), Gaps = 1/112 (1%)
 Frame = -2

Query  585  AVVRAFERINKPSRK-EFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            AV R     N P     + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A 
Sbjct  699  AVTREMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINAC  758

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              + DM  A   +++M   G++ +V TY+ ++ G+A     E A   F E K
Sbjct  759  CKAGDMLRATKTIQEMEALGVKPNVKTYTTLIHGWACASLPEKALRCFEEMK  810



>ref|XP_004135367.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Cucumis sativus]
Length=962

 Score =   397 bits (1020),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 234/288 (81%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN G+GF+IY G + +KSAIKAV+FDGVEFHGRVLTVKLDDGRR +K+K   R RWMEG
Sbjct  206  ERNAGYGFIIYDGLTADKSAIKAVEFDGVEFHGRVLTVKLDDGRR-LKEKTDERARWMEG  264

Query  639  SSS--------------RN-FRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
              S              RN  RKV+E++PENW AVV AFERI KPSRKE+G+MVNYY RR
Sbjct  265  DDSVEYRSHWHEERDKARNGLRKVIETEPENWQAVVSAFERIKKPSRKEYGLMVNYYTRR  324

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRARE FEKMR+RGI P+S+ YTNL +AY V RDMEEAL+CVRKM +EGIE+S+VTY
Sbjct  325  GDMHRARETFEKMRARGIEPSSHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVTY  384

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI+V GFAK GN E+A+HWF EAKE+H++L+A IYGNIIYA CQ CNMD+AE L+REMEE
Sbjct  385  SILVSGFAKTGNAESADHWFQEAKEKHSSLNAIIYGNIIYAYCQRCNMDKAEALVREMEE  444

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EGI API I+HTMMDGYT+  +E+KCLL+F+R KECG  PSVI+YGCL
Sbjct  445  EGIDAPIDIYHTMMDGYTMVGDEDKCLLVFERFKECGLNPSVITYGCL  492


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 92/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            +KP+ + F  +++ + R+G+  +A ++F+ MR  G +PT + Y  L       R ME+A 
Sbjct  587  HKPTTRTFMPIIHGFARKGEMKKALDVFDMMRMSGCIPTVHTYNALILGLVEKRKMEKAE  646

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A +G+   A  +F + ++    L    Y  ++ A 
Sbjct  647  QILDEMTLAGVSPNEHTYTTIMHGYASLGDTGKAFTYFTKLRDEGLQLDVYTYEALLKAC  706

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM  + I     I++ ++DG+    +  +   +  ++K  G  P +
Sbjct  707  CKSGRMQSALAVTKEMSAQNIPRNTFIYNILIDGWARRGDIWEAADLMQQMKREGVQPDI  766

Query  18   ISY  10
             +Y
Sbjct  767  HTY  769


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A   F K+R  G+    Y Y  L  A   S  M+ AL  
Sbjct  659  PNEHTYTTIMHGYASLGDTGKAFTYFTKLRDEGLQLDVYTYEALLKACCKSGRMQSALAV  718

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G++  A     + K          Y + I A  +
Sbjct  719  TKEMSAQNIPRNTFIYNILIDGWARRGDIWEAADLMQQMKREGVQPDIHTYTSFINACSK  778

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + + EM+  G+   +  + T+++G+      EK L  F+ +K  G  P    
Sbjct  779  AGDMQRATKTIEEMKSVGVKPNVKTYTTLINGWARASLPEKALSCFEEMKLSGLKPDRAV  838

Query  12   YGCL  1
            Y CL
Sbjct  839  YHCL  842


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 85/176 (48%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V+ + + G+   A   F++ + +     +  Y N+ YAY    +M++A   VR+M 
Sbjct  384  YSILVSGFAKTGNAESADHWFQEAKEKHSSLNAIIYGNIIYAYCQRCNMDKAEALVREME  443

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  VG+ +     F   KE     S   YG +I    +   + 
Sbjct  444  EEGIDAPIDIYHTMMDGYTMVGDEDKCLLVFERFKECGLNPSVITYGCLINLYAKLGKVS  503

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ +EME  GI   +  +  +++G+   ++      +F+ L + G  P V+ Y
Sbjct  504  KALEVSKEMEHAGIKHNMKTYSMLINGFLKLKDWANAFAIFEDLIKDGIKPDVVLY  559


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 92/206 (45%), Gaps = 7/206 (3%)
 Frame = -2

Query  618  KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTS  439
            K LE   E  HA +       K + K + M++N + +  D   A  +FE +   GI P  
Sbjct  504  KALEVSKEMEHAGI-------KHNMKTYSMLINGFLKLKDWANAFAIFEDLIKDGIKPDV  556

Query  438  YEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE  259
              Y N+  A+     M+ A+  V++M  +  + +  T+  I+ GFA+ G ++ A   F  
Sbjct  557  VLYNNIITAFCGMGKMDRAVCTVKEMQKQRHKPTTRTFMPIIHGFARKGEMKKALDVFDM  616

Query  258  AKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRN  79
             +      +   Y  +I    +   M++AE++L EM   G++     + T+M GY    +
Sbjct  617  MRMSGCIPTVHTYNALILGLVEKRKMEKAEQILDEMTLAGVSPNEHTYTTIMHGYASLGD  676

Query  78   EEKCLLMFDRLKECGFTPSVISYGCL  1
              K    F +L++ G    V +Y  L
Sbjct  677  TGKAFTYFTKLRDEGLQLDVYTYEAL  702



>ref|XP_004308615.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=924

 Score =   395 bits (1015),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 197/294 (67%), Positives = 235/294 (80%), Gaps = 21/294 (7%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGFVIYGG +  KSA+KAV+FDGVEFHGRVL+V+LDDG R +KD+ + R RW+E
Sbjct  165  TERNAGFGFVIYGGPNAAKSAMKAVEFDGVEFHGRVLSVRLDDGGR-LKDRAEERARWIE  223

Query  642  G-------------------SSSRN-FRKVLESQPENWHAVVRAFERINKPSRKEFGMMV  523
                                 SSRN  RKV+E+ PENW AVV  F+RI+KPSR E+G+MV
Sbjct  224  EGDGDGGVEFRARSKWHKERQSSRNALRKVMETAPENWQAVVNTFDRIDKPSRGEYGLMV  283

Query  522  NYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIE  343
             YY RRGD HRARE FE MR+RGI PTS+ YT+L +AY V RDMEEAL+CVRKM DEG+E
Sbjct  284  KYYARRGDMHRARETFESMRARGIEPTSHVYTSLIHAYAVGRDMEEALSCVRKMKDEGVE  343

Query  342  ISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeel  163
            +S+VTYSIIVGGFAKVGN +AA+ WF EAKERH TL+A IYGNI+YA+CQTCNMDRAE L
Sbjct  344  MSLVTYSIIVGGFAKVGNAKAADDWFKEAKERHTTLNAIIYGNIVYAHCQTCNMDRAEAL  403

Query  162  lremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +REMEE GI API I+HTMMDGYT+  +E+KCL++F+RLKECGFTPS+ISYGCL
Sbjct  404  VREMEEAGIDAPIDIYHTMMDGYTMVGDEDKCLIVFERLKECGFTPSIISYGCL  457


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 99/211 (47%), Gaps = 11/211 (5%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G+ +R  R V E Q E            ++P+ + F  +++ + R GD  RA E+F+ MR
Sbjct  535  GNMNRAVRTVKEMQKER-----------HRPTSRTFMPIIHGFARAGDMRRALEIFDMMR  583

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G +PT + +  L       R M++A+  + +M   GI  +  TY+ I+ G+A +G+  
Sbjct  584  MSGCIPTVHTFNALVLGLVEKRQMDKAVEILDEMTLAGICPNQHTYTTIMNGYASLGDTG  643

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             A  +F + +     +    Y  ++ A C+   M  A  + +EM  + I     +++ ++
Sbjct  644  KAFEYFSKLRNDGLEIDVFTYEALLKACCKAGKMQSALAVTKEMSAQKIPRNTFVYNILV  703

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            DG+    +  +   +  ++K  G  P + SY
Sbjct  704  DGWARRGDVWEAADLMQQMKREGVQPDIHSY  734


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 83/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A + F++ + R     +  Y N+ YA+  + +M+ A   VR+M 
Sbjct  349  YSIIVGGFAKVGNAKAADDWFKEAKERHTTLNAIIYGNIVYAHCQTCNMDRAEALVREME  408

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            + GI+  +  Y  ++ G+  VG+ +     F   KE   T S   YG +I    +   + 
Sbjct  409  EAGIDAPIDIYHTMMDGYTMVGDEDKCLIVFERLKECGFTPSIISYGCLINLYVKVGKVS  468

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      + + L + G  P V+ Y
Sbjct  469  KALEVSKRMETTGIKHNMKTYSMLINGFLKLKDWANAFAVIEDLMKDGLKPDVVLY  524


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  + E +   G+ P    Y N+  A+    +M  A+ 
Sbjct  483  KHNMKTYSMLINGFLKLKDWANAFAVIEDLMKDGLKPDVVLYNNIITAFCGMGNMNRAVR  542

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G++  A   F   +      +   +  ++    
Sbjct  543  TVKEMQKERHRPTSRTFMPIIHGFARAGDMRRALEIFDMMRMSGCIPTVHTFNALVLGLV  602

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   MD+A E+L EM   GI      + T+M+GY    +  K    F +L+  G    V 
Sbjct  603  EKRQMDKAVEILDEMTLAGICPNQHTYTTIMNGYASLGDTGKAFEYFSKLRNDGLEIDVF  662

Query  15   SYGCL  1
            +Y  L
Sbjct  663  TYEAL  667


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V+ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A   + +M 
Sbjct  699  YNILVDGWARRGDVWEAADLMQQMKREGVQPDIHSYTSFINACCKAGDMQRAAKTIDEMK  758

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ ++ TY+ ++ G+A+    E A   F + K
Sbjct  759  TFGVKPNIKTYTTLIHGWARASLPEKALRCFKDMK  793



>gb|EPS65574.1| hypothetical protein M569_09203, partial [Genlisea aurea]
Length=826

 Score =   392 bits (1008),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 233/291 (80%), Gaps = 19/291 (7%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RNMGFGFVIY G   EK+A+KAV+FDGV+FHGRVLTV+LD+G+R +K +   R RW++ 
Sbjct  91   ERNMGFGFVIYDGDMAEKAAMKAVEFDGVDFHGRVLTVQLDNGKR-LKGRYADRLRWVQK  149

Query  639  ------------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S R FRKV+ESQPENW AVV+AFERINKPSRKEFG+MVNYY
Sbjct  150  KDDDGHENSRSKWHQDREDSRREFRKVVESQPENWQAVVKAFERINKPSRKEFGLMVNYY  209

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
             RRGD HRARE FEKMRSRGI PT + YTNL +AY V RDMEEAL CV+KM  EGIE+S+
Sbjct  210  ARRGDMHRARETFEKMRSRGIEPTLHVYTNLIHAYAVGRDMEEALLCVKKMKGEGIEMSL  269

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTY+I+VGGFAK+GNVEAAE WF EAKER   ++A IYG++IYA CQ CN++RAE L+RE
Sbjct  270  VTYNILVGGFAKIGNVEAAESWFKEAKERIEVMNAVIYGSMIYAYCQACNLNRAEALVRE  329

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEE+GI AP+ I+HTMMDGYT+ +NEEKCLL+F+RLKECGF PSV++YGCL
Sbjct  330  MEEDGIDAPVDIYHTMMDGYTMIQNEEKCLLVFERLKECGFVPSVVTYGCL  380


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 82/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            F  +++ + R GD  RA E+F+ MR  G +PT   Y  L         ME+++  + +M+
Sbjct  482  FMPIIHSFARAGDMRRALEVFDMMRRSGCIPTVQTYNALILGLVEKGQMEKSVAILDEMS  541

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
               I  +  TY+ I+ G+A  G+   A  +F   K     L    Y  ++ A C++  M 
Sbjct  542  RASIRPNEHTYTTIMHGYASSGDTAKAFEYFSRLKNEGLELDVFTYEALLKACCKSGRMQ  601

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             A  + +EM+   I     I++ ++DG+    +  +   +  +++  G  P + +Y
Sbjct  602  SALAITKEMKARNIPRNTFIYNILIDGWARRGDVWEAADLMQQMRAEGVQPDIHTY  657


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 57/106 (54%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++MR+ G+ P  + YT+   A   + DME A+  V +M 
Sbjct  622  YNILIDGWARRGDVWEAADLMQQMRAEGVQPDIHTYTSFVNACCKAGDMERAVKAVEEME  681

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G++ +V TY+ ++ G+++    E A   F E K        ++Y
Sbjct  682  SVGVKANVKTYTTLIHGWSRAALPEKALKCFEEMKAAGEKPDGAVY  727


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 81/176 (46%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + R  V  +  Y ++ YAY  + ++  A   VR+M 
Sbjct  272  YNILVGGFAKIGNVEAAESWFKEAKERIEVMNAVIYGSMIYAYCQACNLNRAEALVREME  331

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++GI+  V  Y  ++ G+  + N E     F   KE     S   YG +I    +   + 
Sbjct  332  EDGIDAPVDIYHTMMDGYTMIQNEEKCLLVFERLKECGFVPSVVTYGCLINLYTKMGKVS  391

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+   M++ GI   +  +  +++G+   ++      +F+ +   G  P VI Y
Sbjct  392  KALEISDSMKKAGIKHNMKTYSMLINGFIGLKDWANAFSVFEDVIRDGLRPDVILY  447


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 78/185 (42%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE +   G+ P    Y N+  A+    DME A++
Sbjct  406  KHNMKTYSMLINGFIGLKDWANAFSVFEDVIRDGLRPDVILYNNIVKAFCGMGDMERAIS  465

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M       +  T+  I+  FA+ G++  A   F   +      +   Y  +I    
Sbjct  466  IVDEMTRRRQRPTPRTFMPIIHSFARAGDMRRALEVFDMMRRSGCIPTVQTYNALILGLV  525

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M+++  +L EM    I      + T+M GY  + +  K    F RLK  G    V 
Sbjct  526  EKGQMEKSVAILDEMSRASIRPNEHTYTTIMHGYASSGDTAKAFEYFSRLKNEGLELDVF  585

Query  15   SYGCL  1
            +Y  L
Sbjct  586  TYEAL  590



>ref|XP_008446749.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g04810, chloroplastic [Cucumis melo]
Length=982

 Score =   396 bits (1017),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 236/295 (80%), Gaps = 22/295 (7%)
 Frame = -2

Query  822  TDRNMGF------GFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKG  661
            T+RN G       GF+IY G +  KSAIKAV+FDGVEFHGRVLTVKLDDGRR +K+K   
Sbjct  219  TERNAGXXXXXXXGFIIYDGPTAAKSAIKAVEFDGVEFHGRVLTVKLDDGRR-LKEKTNE  277

Query  660  RTRWMEGSSS--------------RN-FRKVLESQPENWHAVVRAFERINKPSRKEFGMM  526
            R RWMEG  S              RN FRKV+E++PENW AVV AF+RI KPSRKE+G+M
Sbjct  278  RARWMEGDDSVEYRSHWHEERDKARNGFRKVIETEPENWQAVVSAFDRIKKPSRKEYGLM  337

Query  525  VNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGI  346
            VNYY RRGD HRARE FEKMR+RGI P+S+ YTNL +AY V RDMEEAL+CVRKM +EGI
Sbjct  338  VNYYARRGDMHRARETFEKMRARGIEPSSHVYTNLIHAYAVGRDMEEALSCVRKMKEEGI  397

Query  345  EISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAee  166
            E+S+VTYSI+VGGFAK+GN E+A+HWF EAKE+H++++A IYGNIIYA CQ CNMDRAE 
Sbjct  398  EMSLVTYSILVGGFAKMGNAESADHWFQEAKEKHSSMNAIIYGNIIYAYCQRCNMDRAEA  457

Query  165  llremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            L+REMEEEGI API I+HTMMDGYT+  +EEKCLL+F+R KECG  PSVI+YGCL
Sbjct  458  LVREMEEEGIDAPIDIYHTMMDGYTMVGDEEKCLLVFERFKECGLNPSVITYGCL  512


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 92/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            +KP+ + F  +++ + R+G+  +A ++F+ MR  G +PT + Y  L       R ME+A 
Sbjct  607  HKPTTRTFMPIIHGFARKGEMKKALDVFDMMRMSGCIPTVHTYNALILGLVEKRKMEKAE  666

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A +G+   A  +F + ++    L    Y  ++ A 
Sbjct  667  QILDEMTLAGVSPNEHTYTTIMHGYASLGDTGKAFAYFTKLRDEGLGLDVYTYEALLKAC  726

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM  + I     I++ ++DG+    +  +   +  ++K  G  P +
Sbjct  727  CKSGRMQSALAVTKEMSAQNIPRNTFIYNILIDGWARRGDVWEAADLMQQMKREGVQPDI  786

Query  18   ISY  10
             +Y
Sbjct  787  HTY  789


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 83/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A   F K+R  G+    Y Y  L  A   S  M+ AL  
Sbjct  679  PNEHTYTTIMHGYASLGDTGKAFAYFTKLRDEGLGLDVYTYEALLKACCKSGRMQSALAV  738

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + K          Y + I A  +
Sbjct  739  TKEMSAQNIPRNTFIYNILIDGWARRGDVWEAADLMQQMKREGVQPDIHTYTSFINACSK  798

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + + EM+  G+   +  + T++ G+      EK L  F+ +K  G  P    
Sbjct  799  AGDMQRATKTIEEMKSVGVKPNVKTYTTLIHGWARASLPEKALSCFEEMKLSGLKPDKAV  858

Query  12   YGCL  1
            Y CL
Sbjct  859  YHCL  862


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + +     +  Y N+ YAY    +M+ A   VR+M 
Sbjct  404  YSILVGGFAKMGNAESADHWFQEAKEKHSSMNAIIYGNIIYAYCQRCNMDRAEALVREME  463

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  VG+ E     F   KE     S   YG +I    +   + 
Sbjct  464  EEGIDAPIDIYHTMMDGYTMVGDEEKCLLVFERFKECGLNPSVITYGCLINLYAKLGKVS  523

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ +EME  GI   +  F  +++G+   ++      +F+ L + G  P V+ Y
Sbjct  524  KALEVSKEMEHAGIKHNMKTFSMLINGFLKLKDWANAFAIFEDLIKDGIKPDVVLY  579


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 92/206 (45%), Gaps = 7/206 (3%)
 Frame = -2

Query  618  KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTS  439
            K LE   E  HA +       K + K F M++N + +  D   A  +FE +   GI P  
Sbjct  524  KALEVSKEMEHAGI-------KHNMKTFSMLINGFLKLKDWANAFAIFEDLIKDGIKPDV  576

Query  438  YEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE  259
              Y N+  A+     M+ A+  V++M  +  + +  T+  I+ GFA+ G ++ A   F  
Sbjct  577  VLYNNIITAFCGMGKMDRAVCTVKEMQKQRHKPTTRTFMPIIHGFARKGEMKKALDVFDM  636

Query  258  AKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRN  79
             +      +   Y  +I    +   M++AE++L EM   G++     + T+M GY    +
Sbjct  637  MRMSGCIPTVHTYNALILGLVEKRKMEKAEQILDEMTLAGVSPNEHTYTTIMHGYASLGD  696

Query  78   EEKCLLMFDRLKECGFTPSVISYGCL  1
              K    F +L++ G    V +Y  L
Sbjct  697  TGKAFAYFTKLRDEGLGLDVYTYEAL  722



>ref|XP_011015622.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Populus euphratica]
Length=1033

 Score =   397 bits (1020),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 234/289 (81%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGF+IY G + EKSA+KA +FDG+EFHGRVLTVKLDDGRR +K K + R  W++
Sbjct  274  TERNAGFGFIIYDGPTAEKSAMKAEEFDGMEFHGRVLTVKLDDGRR-LKAKAEERKNWVD  332

Query  642  GS---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G                S++ FR+VL++QPENW AVV AFERI KP+R+EFG+MV YY R
Sbjct  333  GEDEGDYRSKWHEEREGSTKAFRRVLDTQPENWQAVVSAFERIKKPARREFGLMVGYYAR  392

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRAR+ FE MR+RGI P+S+ YT+L +AY V RDMEEAL+CVRKM +EG+E+S+VT
Sbjct  393  RGDMHRARQTFESMRARGIYPSSHVYTSLIHAYAVGRDMEEALSCVRKMKEEGVEMSLVT  452

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSI+VGGFAK+GN EAAEHWF EAKERH  L+A IYG+IIYA CQ+CNMDRAE L+REME
Sbjct  453  YSIVVGGFAKIGNAEAAEHWFKEAKERHTNLNAIIYGSIIYAYCQSCNMDRAESLVREME  512

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEGI API I+HTMMDGYT+  NEEKCL++F RLKECGF PSVISYGCL
Sbjct  513  EEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFKRLKECGFAPSVISYGCL  561


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 94/193 (49%), Gaps = 0/193 (0%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    +  ++P+ + F  +++ + R G+  RA E+F+ MR  G +PT + +  L    
Sbjct  646  HMVKEMQKERHRPTSRTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGL  705

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
               R ME+A+  + +M   G+     TY+ I+ G+A +G+   A  +F + +     L  
Sbjct  706  VEKRQMEKAVEILDEMALAGVSPDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDV  765

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              Y  ++ A C++  M  A  + REM  + I     +++ ++DG+    +  +   +  +
Sbjct  766  FTYEALLKACCKSGRMQSALAVTREMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQ  825

Query  48   LKECGFTPSVISY  10
            +K+ G  P + +Y
Sbjct  826  MKQEGVQPDIHTY  838


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 84/176 (48%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + R     +  Y ++ YAY  S +M+ A + VR+M 
Sbjct  453  YSIVVGGFAKIGNAEAAEHWFKEAKERHTNLNAIIYGSIIYAYCQSCNMDRAESLVREME  512

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  +GN E     F   KE     S   YG +I    +   + 
Sbjct  513  EEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFKRLKECGFAPSVISYGCLINMYTKMGKVS  572

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      +F+ + + G  P V+ Y
Sbjct  573  KALEVSKMMESAGIKHNMKTYSMLINGFLKLKDWTNAFTVFEDVIKAGLKPDVVLY  628


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  587  KHNMKTYSMLINGFLKLKDWTNAFTVFEDVIKAGLKPDVVLYNNIIKAFCGMGNMDRAIH  646

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G +  A   F   +      +   +  ++    
Sbjct  647  MVKEMQKERHRPTSRTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLV  706

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++     + T+M GY    +  K    F +++  G    V 
Sbjct  707  EKRQMEKAVEILDEMALAGVSPDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDVF  766

Query  15   SYGCL  1
            +Y  L
Sbjct  767  TYEAL  771


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 56/112 (50%), Gaps = 1/112 (1%)
 Frame = -2

Query  585  AVVRAFERINKPSRK-EFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            AV R     N P     + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A 
Sbjct  786  AVTREMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINAC  845

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              + DM  A   +++M   G++ +V TY+ ++ G+A     E A   F E K
Sbjct  846  CKAGDMLRATKTIQEMEALGVKPNVKTYTTLIHGWACASLPEKALRCFEEMK  897



>ref|XP_010262938.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Nelumbo nucifera]
 ref|XP_010262939.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Nelumbo nucifera]
Length=955

 Score =   394 bits (1013),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/288 (68%), Positives = 233/288 (81%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN+G+GF+IYGG +   SA KAV+FDGVEFHGR+LTVKLDDGRR +K +   R RW+ G
Sbjct  192  ERNVGYGFIIYGGPTSANSASKAVEFDGVEFHGRILTVKLDDGRR-LKARSAERARWVAG  250

Query  639  S---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            S               S R FRKVLE++PENW AVV++FE+I KPSR+EFG+++NYY RR
Sbjct  251  SDGTEYRSKWHEERDISRREFRKVLETEPENWQAVVQSFEKIKKPSRREFGLLINYYARR  310

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD H ARE FE+MR+RGI PTS+ YTNL +AY V RDM EAL+C+RKM +EGIE S+VTY
Sbjct  311  GDMHHAREAFERMRARGIEPTSHVYTNLIHAYAVGRDMNEALSCLRKMKEEGIEASLVTY  370

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SIIVGGFAK+G+ EAA+ WF EAKERH TL+A IYGNIIYA+CQTCNMDRAEEL++EMEE
Sbjct  371  SIIVGGFAKIGDAEAADKWFKEAKERHTTLNAIIYGNIIYAHCQTCNMDRAEELVKEMEE  430

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EGI API I+HTMMDGYT   NEEKCL++F+RLKECGF PSVIS GCL
Sbjct  431  EGIDAPIDIYHTMMDGYTNIGNEEKCLIVFERLKECGFRPSVISLGCL  478


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 98/211 (46%), Gaps = 11/211 (5%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G+  R  R V E Q E            ++P+ + F  +++ + + G+  RA ++F  MR
Sbjct  556  GNMDRAIRIVEEMQKEK-----------HRPTSRTFMPIIHGFAKAGEMRRALQVFNMMR  604

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G +PT + +  L       R ME+AL  V +M   G+  +  TY+ I+ G+A  G+  
Sbjct  605  RCGCIPTVHNFNALVLGLVEKRQMEKALEVVDEMLHAGVNPNEHTYTTIMHGYASQGDTG  664

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             A  +F + KE    L    Y  ++ A C++  M  A  + REM  + I     +++ ++
Sbjct  665  KAFEYFTKIKEEGLELDVFSYQALLKACCKSGRMQSALAVTREMSAQKIPRNTFVYNILI  724

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            DG+    +  +   +  ++++    P + +Y
Sbjct  725  DGWARRGDVWEAADLMQQMRQERVLPDIHTY  755


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M+VN + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  504  KHNMKTYSMLVNGFLKLNDWANAFAIFEDVVKTGLKPDVVLYNNIIRAFCGMGNMDRAIR  563

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+ GFAK G +  A   F   +      +   +  ++    
Sbjct  564  IVEEMQKEKHRPTSRTFMPIIHGFAKAGEMRRALQVFNMMRRCGCIPTVHNFNALVLGLV  623

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E++ EM   G+      + T+M GY    +  K    F ++KE G    V 
Sbjct  624  EKRQMEKALEVVDEMLHAGVNPNEHTYTTIMHGYASQGDTGKAFEYFTKIKEEGLELDVF  683

Query  15   SYGCL  1
            SY  L
Sbjct  684  SYQAL  688


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 83/192 (43%), Gaps = 6/192 (3%)
 Frame = -2

Query  570  FERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+     +PS    G ++N Y + G   +A E+ + M S GI      Y+ L   +  
Sbjct  460  FERLKECGFRPSVISLGCLINLYTKIGKVSKALEIGKLMESCGIKHNMKTYSMLVNGFLK  519

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE-AKERHATLSAS  226
              D   A      +   G++  VV Y+ I+  F  +GN++ A     E  KE+H   S +
Sbjct  520  LNDWANAFAIFEDVVKTGLKPDVVLYNNIIRAFCGMGNMDRAIRIVEEMQKEKHRPTSRT  579

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             +  II+   +   M RA ++   M   G    +  F+ ++ G    R  EK L + D +
Sbjct  580  -FMPIIHGFAKAGEMRRALQVFNMMRRCGCIPTVHNFNALVLGLVEKRQMEKALEVVDEM  638

Query  45   KECGFTPSVISY  10
               G  P+  +Y
Sbjct  639  LHAGVNPNEHTY  650


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++MR   ++P  + YT+   A   + DM+ A   V +M 
Sbjct  720  YNILIDGWARRGDVWEAADLMQQMRQERVLPDIHTYTSFINACCKAGDMQRATKTVEEME  779

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G++ +V TY+ ++ G+A+    E A   F + K        ++Y
Sbjct  780  VIGVQPNVKTYTTLIHGWARASLPEKALRCFEDMKSAGLKPDKAVY  825



>ref|XP_002316488.2| hypothetical protein POPTR_0010s24770g [Populus trichocarpa]
 gb|EEF02659.2| hypothetical protein POPTR_0010s24770g [Populus trichocarpa]
Length=947

 Score =   392 bits (1008),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 195/288 (68%), Positives = 231/288 (80%), Gaps = 14/288 (5%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIM------------  679
            T+RN GFGF+IY G    KSA+KA +FDG+EFHGRVLTVKLDDGRR+             
Sbjct  188  TERNAGFGFIIYDGPKAGKSAMKAEEFDGMEFHGRVLTVKLDDGRRLKAKAEERKNWVYG  247

Query  678  KDKKKGRTRWMEG--SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            +D K  R++W E    S++ FRKVL++QPENW AVV AFERI KPSR+EFG+MV YY RR
Sbjct  248  EDGKDYRSKWHEEREGSTKAFRKVLDTQPENWQAVVSAFERIKKPSRREFGLMVGYYARR  307

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRAR+ FE MR+RGI P+S+ YT+L +AY V RDMEEAL+CVRKMN+EGIE+S+VTY
Sbjct  308  GDMHRARQTFESMRARGIDPSSHVYTSLIHAYAVGRDMEEALSCVRKMNEEGIEMSLVTY  367

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI+VGGFAK GN EAA+ WF +AKERH  L+A IYGNIIYA CQ CNMDRAE L+REMEE
Sbjct  368  SIVVGGFAKFGNAEAADCWFKKAKERHTNLNAYIYGNIIYAYCQACNMDRAEALVREMEE  427

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EGI AP+ I+HTMMDGYT+ RNEEKCL++F RLKECGF PSVI+YGCL
Sbjct  428  EGIDAPLDIYHTMMDGYTMIRNEEKCLIVFKRLKECGFAPSVITYGCL  475


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 85/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +++ Y   GD  +A E F KMR+ G+    + Y  L  A   S  M+ AL  
Sbjct  642  PDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDVFTYEALLKACCKSGRMQSALAV  701

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+MN + I  +   Y+I++ G+A+ G++  A     +  +         Y + I A C+
Sbjct  702  TREMNAQKIPRNTFVYNILIDGWARRGDIWEAADLMQQMNQEGVQPDIHTYTSFINACCK  761

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + + EME  G+   +  + T++ G+      EK L  F+ LK  G  P    
Sbjct  762  AGDMLRATKTMEEMEAAGVKPNVKTYTTLIHGWANASLPEKALSCFEELKLAGLKPDKAV  821

Query  12   YGCL  1
            Y CL
Sbjct  822  YHCL  825


 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/182 (24%), Positives = 89/182 (49%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + F  +++ + R G+  RA E+F+ MR  G +PT + +  L       R ME+A+ 
Sbjct  571  RPTSRTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLVEKRKMEKAVE  630

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M   G+     TY+ I+ G+A +G+   A  +F + +     L    Y  ++ A C
Sbjct  631  ILDEMALAGVSPDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDVFTYEALLKACC  690

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + REM  + I     +++ ++DG+    +  +   +  ++ + G  P + 
Sbjct  691  KSGRMQSALAVTREMNAQKIPRNTFVYNILIDGWARRGDIWEAADLMQQMNQEGVQPDIH  750

Query  15   SY  10
            +Y
Sbjct  751  TY  752


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 83/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F+K + R     +Y Y N+ YAY  + +M+ A   VR+M 
Sbjct  367  YSIVVGGFAKFGNAEAADCWFKKAKERHTNLNAYIYGNIIYAYCQACNMDRAEALVREME  426

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  + N E     F   KE     S   YG +I    +   + 
Sbjct  427  EEGIDAPLDIYHTMMDGYTMIRNEEKCLIVFKRLKECGFAPSVITYGCLINMYTKIGKVS  486

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + M+  GI   +  +  +++G+   ++      +F+ + + G  P V+ Y
Sbjct  487  KALEVSKMMKSVGIKHNMKTYSMLINGFLKLKDWTNAFAVFEDVIKDGLKPDVVLY  542


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  501  KHNMKTYSMLINGFLKLKDWTNAFAVFEDVIKDGLKPDVVLYNNIIKAFCGMGNMDRAIH  560

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G +  A   F   +      +   +  ++    
Sbjct  561  MVKEMQKERCRPTSRTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLV  620

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++     + T+M GY    +  K    F +++  G    V 
Sbjct  621  EKRKMEKAVEILDEMALAGVSPDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDVF  680

Query  15   SYGCL  1
            +Y  L
Sbjct  681  TYEAL  685



>gb|KDO43025.1| hypothetical protein CISIN_1g0037492mg, partial [Citrus sinensis]
 gb|KDO43026.1| hypothetical protein CISIN_1g0037492mg, partial [Citrus sinensis]
Length=463

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 223/274 (81%), Gaps = 16/274 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N+GFGFVIY G + EKSA+KAV+FDGVEFHGRVLTVKLDDGRR +K+K + R RW+ G
Sbjct  191  EKNVGFGFVIYDGPAAEKSAMKAVEFDGVEFHGRVLTVKLDDGRR-LKNKAEVRARWVAG  249

Query  639  SSS---------------RNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            ++                R FRK +E+QPENW AVV AFERI KPSR+EFG+MVNYY RR
Sbjct  250  NNGEEFRSTWHKEREWHRREFRKAVETQPENWQAVVSAFERIKKPSRREFGLMVNYYARR  309

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRAR+ FE MR+RGI PT + YTNL +AY V RDMEEAL+CVRKM +EGIE+S+VTY
Sbjct  310  GDMHRARQTFENMRARGIEPTLHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVTY  369

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SIIVGGFAK+GN EAA+HWF EAKERHATL+A IYGNIIYA CQT NM+RAE L+R+MEE
Sbjct  370  SIIVGGFAKMGNAEAADHWFEEAKERHATLNAIIYGNIIYAQCQTRNMERAEALVRDMEE  429

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            EGI API I+H MMDGYTI  NEEKCL++F+RLK
Sbjct  430  EGIDAPIDIYHMMMDGYTIIGNEEKCLIVFERLK  463



>ref|XP_002515794.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF46633.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=924

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 230/289 (80%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGFVIY   + EKSA KAV+FDG+EFHGR+LTVKLDDGRR +K K   R RW+E
Sbjct  200  TERNAGFGFVIYDDKTAEKSATKAVEFDGMEFHGRILTVKLDDGRR-LKAKADERKRWVE  258

Query  642  GS---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G                S + FR+VLE+QPENW  VV AFERI KPSR+E+G+MV+YY R
Sbjct  259  GEDGDDYESKWHEERDGSRKAFRRVLETQPENWQDVVSAFERIKKPSRREYGLMVSYYAR  318

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRAR+ FE MR+RGI PTS+ YT+L +AY V RDMEEAL+C RKM +EG+E+S+VT
Sbjct  319  RGDMHRARQTFESMRARGIEPTSHVYTSLIHAYAVGRDMEEALSCARKMKEEGVEMSLVT  378

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSIIVGGFAK+GN +AA+ WF EAK+RH+ ++A IYGN+IYA CQTCNMD+AE L+REME
Sbjct  379  YSIIVGGFAKIGNADAADRWFKEAKDRHSHMNAIIYGNMIYAYCQTCNMDQAEALVREME  438

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             EGI API I+HTMMDGYT+  NEEKCL +F+RLKECGF PSV+SYGCL
Sbjct  439  GEGIDAPIDIYHTMMDGYTMVGNEEKCLTVFERLKECGFAPSVVSYGCL  487


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+R  G+    Y Y  L  A   S  M+ AL  
Sbjct  654  PNEHTYTTIMHGYAALGDTGKAFEYFTKLRDEGLQLDVYTYEALLKACCKSGRMQSALAV  713

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A C+
Sbjct  714  TKEMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQGGVKPDIHTYTSFINACCK  773

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA +++ EME  G+   +  + T++ G+      EK L  F  +K  G  P    
Sbjct  774  AGDMLRASKMMEEMETSGVKPNVKTYTTLIHGWARASLPEKALRCFQEMKLAGLKPDKAV  833

Query  12   YGCL  1
            Y CL
Sbjct  834  YHCL  837


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 93/183 (51%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ + R G+  RA ++F+ MR  G +PT + +  L       R ME+A+
Sbjct  582  HRPTSRTFMPIIHGFARAGEMKRALDVFDMMRRSGCIPTVHTFNALILGLVEKRQMEKAI  641

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A +G+   A  +F + ++    L    Y  ++ A 
Sbjct  642  EILDEMALAGVSPNEHTYTTIMHGYAALGDTGKAFEYFTKLRDEGLQLDVYTYEALLKAC  701

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM  + I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  702  CKSGRMQSALAVTKEMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQGGVKPDI  761

Query  18   ISY  10
             +Y
Sbjct  762  HTY  764


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 83/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + R     +  Y N+ YAY  + +M++A   VR+M 
Sbjct  379  YSIIVGGFAKIGNADAADRWFKEAKDRHSHMNAIIYGNMIYAYCQTCNMDQAEALVREME  438

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
             EGI+  +  Y  ++ G+  VGN E     F   KE     S   YG +I    +   + 
Sbjct  439  GEGIDAPIDIYHTMMDGYTMVGNEEKCLTVFERLKECGFAPSVVSYGCLINLYAKVGKIS  498

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      +F+ + + G  P V+ Y
Sbjct  499  KALEVSKMMESAGIKHNMKTYSMLINGFLKLKDWANAFAIFEDVVKDGLKPDVVLY  554


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+     M+ A+ 
Sbjct  513  KHNMKTYSMLINGFLKLKDWANAFAIFEDVVKDGLKPDVVLYNNIIRAFCGMGTMDRAIC  572

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G ++ A   F   +      +   +  +I    
Sbjct  573  MVKEMQKERHRPTSRTFMPIIHGFARAGEMKRALDVFDMMRRSGCIPTVHTFNALILGLV  632

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++     + T+M GY    +  K    F +L++ G    V 
Sbjct  633  EKRQMEKAIEILDEMALAGVSPNEHTYTTIMHGYAALGDTGKAFEYFTKLRDEGLQLDVY  692

Query  15   SYGCL  1
            +Y  L
Sbjct  693  TYEAL  697



>ref|XP_010552883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X2 [Tarenaya hassleriana]
Length=801

 Score =   382 bits (981),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 234/296 (79%), Gaps = 23/296 (8%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGF+IYGG +  KSA+KAV+FDGVEFHGRVLTVKLDDG+R +K K + R RW+ 
Sbjct  196  TERNAGFGFIIYGGETAAKSAMKAVEFDGVEFHGRVLTVKLDDGKR-LKTKTEERARWVN  254

Query  642  G---------------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMM  526
            G                      S R F+K++E+ P+NW AVV AFE+I+KPSRKEFG+M
Sbjct  255  GYVDGEEDVKMSHKSSWHQEREGSRRTFKKIIETNPDNWQAVVSAFEKIDKPSRKEFGLM  314

Query  525  VNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGI  346
            V +Y RRGD HRARE FE+MRSRGI PTS+ YT+L +AY V RDMEEAL+CVRKM +E I
Sbjct  315  VKFYARRGDMHRARETFERMRSRGIEPTSHVYTSLIHAYAVGRDMEEALSCVRKMKEEEI  374

Query  345  EISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH-ATLSASIYGNIIYANCQTCNMDRAe  169
            E+S+VTY+I+V GFAKVG  E A+HWF EAKERH  TL+ASIYG+IIYA+CQ CNM+RAE
Sbjct  375  EMSLVTYNILVKGFAKVGKPEDADHWFDEAKERHNKTLNASIYGSIIYAHCQACNMERAE  434

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EL+REMEE+GI API I+H+MMDGYT+  +E KCL++F RLKECGFTP+VISYGCL
Sbjct  435  ELVREMEEQGIDAPIDIYHSMMDGYTMISDENKCLIVFQRLKECGFTPTVISYGCL  490


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/183 (22%), Positives = 86/183 (47%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  ++  + + G+  RA E+F+ MR  G +PT + +  L       R ME+ +
Sbjct  585  HRPTTRTFLPIILGFAKAGEMRRALEVFDMMRRCGCIPTVHTFNALIVGLVEKRQMEKVV  644

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   GI  +  TY+ I+ G+A +G+   A  +F   +     +    Y  ++ A 
Sbjct  645  EVLDEMILAGISPNKHTYTNIMQGYASLGDTGKAFEYFTRLRNDGLEIDVFTYAELLKAC  704

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K     P +
Sbjct  705  CKSGRMQSALAVTKEMNARNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKREEVQPDI  764

Query  18   ISY  10
             +Y
Sbjct  765  RTY  767


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 82/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    D+++   +F++++  G  PT   Y  L   Y     + +AL   R M   G
Sbjct  455  MMDGYTMISDENKCLIVFQRLKECGFTPTVISYGCLINLYIKVGKIPKALEISRTMKSSG  514

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I  ++ TYS+++ GF K+ +   A   F +  +        +Y NII A C   N  RA 
Sbjct  515  INHNLKTYSMMINGFVKLKDWANAFTVFEDMIKDGLKPDVVLYNNIIGAFCGMGNPGRAV  574

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            + ++EM++         F  ++ G+       + L +FD ++ CG  P+V ++  L
Sbjct  575  QTVKEMQKMRHRPTTRTFLPIILGFAKAGEMRRALEVFDMMRRCGCIPTVHTFNAL  630


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 4/191 (2%)
 Frame = -2

Query  570  FERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            F+R+ +    P+   +G ++N Y + G   +A E+   M+S GI      Y+ +   +  
Sbjct  472  FQRLKECGFTPTVISYGCLINLYIKVGKIPKALEISRTMKSSGINHNLKTYSMMINGFVK  531

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
             +D   A T    M  +G++  VV Y+ I+G F  +GN   A     E ++     +   
Sbjct  532  LKDWANAFTVFEDMIKDGLKPDVVLYNNIIGAFCGMGNPGRAVQTVKEMQKMRHRPTTRT  591

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +  II    +   M RA E+   M   G    +  F+ ++ G    R  EK + + D + 
Sbjct  592  FLPIILGFAKAGEMRRALEVFDMMRRCGCIPTVHTFNALIVGLVEKRQMEKVVEVLDEMI  651

Query  42   ECGFTPSVISY  10
              G +P+  +Y
Sbjct  652  LAGISPNKHTY  662


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 57/124 (46%), Gaps = 0/124 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P++  +  ++  Y   GD  +A E F ++R+ G+    + Y  L  A   S  M+ AL  
Sbjct  657  PNKHTYTNIMQGYASLGDTGKAFEYFTRLRNDGLEIDVFTYAELLKACCKSGRMQSALAV  716

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++MN   I  +   Y+I++ G+A+ G+V  A     + K          Y + I A C+
Sbjct  717  TKEMNARNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKREEVQPDIRTYTSFISACCK  776

Query  192  TCNM  181
              +M
Sbjct  777  AGDM  780


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 81/177 (46%), Gaps = 1/177 (1%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSR-GIVPTSYEYTNLTYAYTVSRDMEEALTCVRKM  361
            + ++V  + + G    A   F++ + R      +  Y ++ YA+  + +ME A   VR+M
Sbjct  381  YNILVKGFAKVGKPEDADHWFDEAKERHNKTLNASIYGSIIYAHCQACNMERAEELVREM  440

Query  360  NDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNM  181
             ++GI+  +  Y  ++ G+  + +       F   KE   T +   YG +I    +   +
Sbjct  441  EEQGIDAPIDIYHSMMDGYTMISDENKCLIVFQRLKECGFTPTVISYGCLINLYIKVGKI  500

Query  180  DRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             +A E+ R M+  GI   +  +  M++G+   ++      +F+ + + G  P V+ Y
Sbjct  501  PKALEISRTMKSSGINHNLKTYSMMINGFVKLKDWANAFTVFEDMIKDGLKPDVVLY  557



>emb|CDO99926.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   378 bits (970),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 189/269 (70%), Positives = 222/269 (83%), Gaps = 17/269 (6%)
 Frame = -2

Query  759  IKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEGS----------------SSR  628
            +KAV+FDGVEFHGRVLTVKLDDGRR +K+K + R RW+EG                 S  
Sbjct  1    MKAVEFDGVEFHGRVLTVKLDDGRR-LKEKTEERRRWVEGKEEGQLHRTKWHEEREGSRT  59

Query  627  NFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIV  448
             FR V+E+QPENW AVV AFE+I KPSRKEFG+MV YY RRGD HRARE FE+MR+RGI 
Sbjct  60   EFRNVIETQPENWQAVVTAFEKIKKPSRKEFGLMVKYYARRGDMHRARETFERMRARGIE  119

Query  447  PTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHW  268
            PTS+ YT+L +AY V RDMEEAL+CVRKMNDEG+E+++VTYSI+VGGFAKVGNV+AAE W
Sbjct  120  PTSHVYTSLIHAYAVGRDMEEALSCVRKMNDEGVEVTLVTYSILVGGFAKVGNVDAAEFW  179

Query  267  FLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTI  88
            F EAKERHATL+A IYGNIIYANCQ+ +MDRAE L+REMEE+GI API I+HTMMDGYT+
Sbjct  180  FKEAKERHATLNAIIYGNIIYANCQSGDMDRAEALVREMEEDGIDAPIGIYHTMMDGYTM  239

Query  87   TRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              NE+KCL++F+RLKECGF PSVISYGCL
Sbjct  240  AGNEDKCLVVFERLKECGFPPSVISYGCL  268


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  435  PNEHTYTTIMHGYASVGDIGKAFEYFSKLKNEGLELDVYTYEALLKACCKSGRMQSALAV  494

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M++ GI  +   Y+I++ G+A+ G+V  A     + +          Y + I A C+
Sbjct  495  TKEMSNRGILRNTFVYNILIDGWARRGDVWEAADLMQQMRREGVLPDIHTYTSFINACCK  554

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + + EME  G+   +  + T++ G+      EK L  F+ +K+ G  P    
Sbjct  555  AGDMMRAMKTIEEMEAHGVKPNVKTYTTLIHGWARAALPEKALQCFEDMKQSGLKPDKAV  614

Query  12   YGCL  1
            Y CL
Sbjct  615  YHCL  618


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 92/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ + R G+  RA ++F+ MR  G +PT + +  L       R M++A+
Sbjct  363  HRPTSRTFMPIIHAFARAGELRRALDVFDMMRMSGCIPTVHTFNALIVGLVEKRQMDKAV  422

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   GI  +  TY+ I+ G+A VG++  A  +F + K     L    Y  ++ A 
Sbjct  423  KTLDEMMLAGISPNEHTYTTIMHGYASVGDIGKAFEYFSKLKNEGLELDVYTYEALLKAC  482

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM   GI     +++ ++DG+    +  +   +  +++  G  P +
Sbjct  483  CKSGRMQSALAVTKEMSNRGILRNTFVYNILIDGWARRGDVWEAADLMQQMRREGVLPDI  542

Query  18   ISY  10
             +Y
Sbjct  543  HTY  545


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 6/192 (3%)
 Frame = -2

Query  570  FERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+ +    PS   +G ++N Y + G   +A E+ + M+  GI      Y+ L   +  
Sbjct  250  FERLKECGFPPSVISYGCLMNLYIKIGKVSKALEVSDMMKRAGIKHNMKTYSMLINGFVK  309

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK-ERHATLSAS  226
              D   A      +  +G++  +V Y+ I+G F  +GN++ A     E K ERH   S +
Sbjct  310  LEDWANAFAIFEDVIKDGLKPDIVLYNNIIGAFCGMGNMDRAIRTVEEMKRERHRPTSRT  369

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             +  II+A  +   + RA ++   M   G    +  F+ ++ G    R  +K +   D +
Sbjct  370  -FMPIIHAFARAGELRRALDVFDMMRMSGCIPTVHTFNALIVGLVEKRQMDKAVKTLDEM  428

Query  45   KECGFTPSVISY  10
               G +P+  +Y
Sbjct  429  MLAGISPNEHTY  440


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/176 (22%), Positives = 79/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   F++ + R     +  Y N+ YA   S DM+ A   VR+M 
Sbjct  160  YSILVGGFAKVGNVDAAEFWFKEAKERHATLNAIIYGNIIYANCQSGDMDRAEALVREME  219

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++GI+  +  Y  ++ G+   GN +     F   KE     S   YG ++    +   + 
Sbjct  220  EDGIDAPIGIYHTMMDGYTMAGNEDKCLVVFERLKECGFPPSVISYGCLMNLYIKIGKVS  279

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+   M+  GI   +  +  +++G+    +      +F+ + + G  P ++ Y
Sbjct  280  KALEVSDMMKRAGIKHNMKTYSMLINGFVKLEDWANAFAIFEDVIKDGLKPDIVLY  335


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 79/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  294  KHNMKTYSMLINGFVKLEDWANAFAIFEDVIKDGLKPDIVLYNNIIGAFCGMGNMDRAIR  353

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FA+ G +  A   F   +      +   +  +I    
Sbjct  354  TVEEMKRERHRPTSRTFMPIIHAFARAGELRRALDVFDMMRMSGCIPTVHTFNALIVGLV  413

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   MD+A + L EM   GI+     + T+M GY    +  K    F +LK  G    V 
Sbjct  414  EKRQMDKAVKTLDEMMLAGISPNEHTYTTIMHGYASVGDIGKAFEYFSKLKNEGLELDVY  473

Query  15   SYGCL  1
            +Y  L
Sbjct  474  TYEAL  478



>ref|XP_010552882.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Tarenaya hassleriana]
Length=957

 Score =   382 bits (981),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 234/296 (79%), Gaps = 23/296 (8%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGF+IYGG +  KSA+KAV+FDGVEFHGRVLTVKLDDG+R +K K + R RW+ 
Sbjct  196  TERNAGFGFIIYGGETAAKSAMKAVEFDGVEFHGRVLTVKLDDGKR-LKTKTEERARWVN  254

Query  642  G---------------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMM  526
            G                      S R F+K++E+ P+NW AVV AFE+I+KPSRKEFG+M
Sbjct  255  GYVDGEEDVKMSHKSSWHQEREGSRRTFKKIIETNPDNWQAVVSAFEKIDKPSRKEFGLM  314

Query  525  VNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGI  346
            V +Y RRGD HRARE FE+MRSRGI PTS+ YT+L +AY V RDMEEAL+CVRKM +E I
Sbjct  315  VKFYARRGDMHRARETFERMRSRGIEPTSHVYTSLIHAYAVGRDMEEALSCVRKMKEEEI  374

Query  345  EISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH-ATLSASIYGNIIYANCQTCNMDRAe  169
            E+S+VTY+I+V GFAKVG  E A+HWF EAKERH  TL+ASIYG+IIYA+CQ CNM+RAE
Sbjct  375  EMSLVTYNILVKGFAKVGKPEDADHWFDEAKERHNKTLNASIYGSIIYAHCQACNMERAE  434

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EL+REMEE+GI API I+H+MMDGYT+  +E KCL++F RLKECGFTP+VISYGCL
Sbjct  435  ELVREMEEQGIDAPIDIYHSMMDGYTMISDENKCLIVFQRLKECGFTPTVISYGCL  490


 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P++  +  ++  Y   GD  +A E F ++R+ G+    + Y  L  A   S  M+ AL  
Sbjct  657  PNKHTYTNIMQGYASLGDTGKAFEYFTRLRNDGLEIDVFTYAELLKACCKSGRMQSALAV  716

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++MN   I  +   Y+I++ G+A+ G+V  A     + K          Y + I A C+
Sbjct  717  TKEMNARNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKREEVQPDIRTYTSFISACCK  776

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + +++M+  G+   I  + T++ G+      EK L  ++ +K  G  P    
Sbjct  777  AGDMSRAMKTIQDMKAVGVEPNIKTYTTLIQGWARASLPEKALRCYEEMKMAGLKPDKAV  836

Query  12   YGCL  1
            Y CL
Sbjct  837  YHCL  840


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/183 (22%), Positives = 86/183 (47%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  ++  + + G+  RA E+F+ MR  G +PT + +  L       R ME+ +
Sbjct  585  HRPTTRTFLPIILGFAKAGEMRRALEVFDMMRRCGCIPTVHTFNALIVGLVEKRQMEKVV  644

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   GI  +  TY+ I+ G+A +G+   A  +F   +     +    Y  ++ A 
Sbjct  645  EVLDEMILAGISPNKHTYTNIMQGYASLGDTGKAFEYFTRLRNDGLEIDVFTYAELLKAC  704

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K     P +
Sbjct  705  CKSGRMQSALAVTKEMNARNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKREEVQPDI  764

Query  18   ISY  10
             +Y
Sbjct  765  RTY  767


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 82/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    D+++   +F++++  G  PT   Y  L   Y     + +AL   R M   G
Sbjct  455  MMDGYTMISDENKCLIVFQRLKECGFTPTVISYGCLINLYIKVGKIPKALEISRTMKSSG  514

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I  ++ TYS+++ GF K+ +   A   F +  +        +Y NII A C   N  RA 
Sbjct  515  INHNLKTYSMMINGFVKLKDWANAFTVFEDMIKDGLKPDVVLYNNIIGAFCGMGNPGRAV  574

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            + ++EM++         F  ++ G+       + L +FD ++ CG  P+V ++  L
Sbjct  575  QTVKEMQKMRHRPTTRTFLPIILGFAKAGEMRRALEVFDMMRRCGCIPTVHTFNAL  630


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 4/191 (2%)
 Frame = -2

Query  570  FERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            F+R+ +    P+   +G ++N Y + G   +A E+   M+S GI      Y+ +   +  
Sbjct  472  FQRLKECGFTPTVISYGCLINLYIKVGKIPKALEISRTMKSSGINHNLKTYSMMINGFVK  531

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
             +D   A T    M  +G++  VV Y+ I+G F  +GN   A     E ++     +   
Sbjct  532  LKDWANAFTVFEDMIKDGLKPDVVLYNNIIGAFCGMGNPGRAVQTVKEMQKMRHRPTTRT  591

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +  II    +   M RA E+   M   G    +  F+ ++ G    R  EK + + D + 
Sbjct  592  FLPIILGFAKAGEMRRALEVFDMMRRCGCIPTVHTFNALIVGLVEKRQMEKVVEVLDEMI  651

Query  42   ECGFTPSVISY  10
              G +P+  +Y
Sbjct  652  LAGISPNKHTY  662


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 81/177 (46%), Gaps = 1/177 (1%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSR-GIVPTSYEYTNLTYAYTVSRDMEEALTCVRKM  361
            + ++V  + + G    A   F++ + R      +  Y ++ YA+  + +ME A   VR+M
Sbjct  381  YNILVKGFAKVGKPEDADHWFDEAKERHNKTLNASIYGSIIYAHCQACNMERAEELVREM  440

Query  360  NDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNM  181
             ++GI+  +  Y  ++ G+  + +       F   KE   T +   YG +I    +   +
Sbjct  441  EEQGIDAPIDIYHSMMDGYTMISDENKCLIVFQRLKECGFTPTVISYGCLINLYIKVGKI  500

Query  180  DRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             +A E+ R M+  GI   +  +  M++G+   ++      +F+ + + G  P V+ Y
Sbjct  501  PKALEISRTMKSSGINHNLKTYSMMINGFVKLKDWANAFTVFEDMIKDGLKPDVVLY  557



>ref|XP_004514863.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Cicer arietinum]
Length=947

 Score =   382 bits (980),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 234/289 (81%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGFVIY G + + SA+KAV+FDGVEFHGRVLTVKLDDG+R  K+K   R +W+ 
Sbjct  192  TERNAGFGFVIYEGETADNSAMKAVEFDGVEFHGRVLTVKLDDGKR-WKEKTVEREKWLR  250

Query  642  GS---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G+               S + F+KVLE++PENW AVVR+FERI KP+RKE+G+M+ YY R
Sbjct  251  GNDEKEYRSTWHEERDGSRKEFQKVLETEPENWQAVVRSFERIKKPARKEYGLMIKYYAR  310

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD H AR+ FE MR+RGI P+S+ Y++L +AY V RDMEEAL CV+KM +EGIE+S+VT
Sbjct  311  RGDMHHARQTFESMRARGIEPSSHVYSSLIHAYVVGRDMEEALHCVKKMKEEGIEMSIVT  370

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSIIVGG+AKVGN +AA++WF EAKER  +L+A IYG+IIYA+CQTCNM RAE L+REME
Sbjct  371  YSIIVGGYAKVGNADAADNWFKEAKERLPSLNAVIYGSIIYAHCQTCNMGRAEALVREME  430

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            E+GI API I+HTMMDGYT+  NEEKCL++F+RLKECGF+PSV+SYGCL
Sbjct  431  EQGIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLKECGFSPSVVSYGCL  479


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 95/192 (49%), Gaps = 1/192 (1%)
 Frame = -2

Query  582  VVRAFERI-NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYT  406
            +V+  +R  +K + + +  +++ + R G+  RA E+F+KMR  G +PT + Y  L     
Sbjct  565  IVKQMQRERHKATTRTYLPIIHGFARAGETGRALEIFDKMRRSGCIPTVHTYNALILGLV  624

Query  405  VSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS  226
              R ME+A+  + +MN  G+     TY+ ++ G+A +G+   A  +F   K     +   
Sbjct  625  EKRQMEKAVRILDEMNLAGVSPDEHTYTTLMQGYASLGDTGKAFQYFTILKNNGLEIDVY  684

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             Y  ++ A C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++
Sbjct  685  TYEALLKACCKSGRMQSALAVTKEMSARKIPRNTFVYNILIDGWARRGDVWEAADLMQQM  744

Query  45   KECGFTPSVISY  10
            ++ G  P + +Y
Sbjct  745  RKEGVQPDIHTY  756


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 88/198 (44%), Gaps = 4/198 (2%)
 Frame = -2

Query  582  VVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTY  415
             VR  + +N     P    +  ++  Y   GD  +A + F  +++ G+    Y Y  L  
Sbjct  632  AVRILDEMNLAGVSPDEHTYTTLMQGYASLGDTGKAFQYFTILKNNGLEIDVYTYEALLK  691

Query  414  AYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATL  235
            A   S  M+ AL   ++M+   I  +   Y+I++ G+A+ G+V  A     + ++     
Sbjct  692  ACCKSGRMQSALAVTKEMSARKIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGVQP  751

Query  234  SASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMF  55
                Y + I A C+  +M  A +++ EME  GI   +  + T++ G+      EK L  F
Sbjct  752  DIHTYTSFINACCKAGDMQNATQIIEEMEARGIKPNLKTYTTLIHGWARAAFPEKALRCF  811

Query  54   DRLKECGFTPSVISYGCL  1
            + +K  G  P    Y CL
Sbjct  812  EEMKVAGLKPDRAVYHCL  829


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M+ N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  505  KHNLKTYSMLFNGFMKLKDWANAFSIFEDITKDGLKPDVILYNNIVKAFCGMGNMDRAIC  564

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E  + +  TY  I+ GFA+ G    A   F + +      +   Y  +I    
Sbjct  565  IVKQMQRERHKATTRTYLPIIHGFARAGETGRALEIFDKMRRSGCIPTVHTYNALILGLV  624

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A  +L EM   G++     + T+M GY    +  K    F  LK  G    V 
Sbjct  625  EKRQMEKAVRILDEMNLAGVSPDEHTYTTLMQGYASLGDTGKAFQYFTILKNNGLEIDVY  684

Query  15   SYGCL  1
            +Y  L
Sbjct  685  TYEAL  689


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 89/196 (45%), Gaps = 0/196 (0%)
 Frame = -2

Query  597  ENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            E  H V +  E   + S   + ++V  Y + G+   A   F++ + R     +  Y ++ 
Sbjct  351  EALHCVKKMKEEGIEMSIVTYSIIVGGYAKVGNADAADNWFKEAKERLPSLNAVIYGSII  410

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
            YA+  + +M  A   VR+M ++GI+  +  Y  ++ G+  +GN E     F   KE   +
Sbjct  411  YAHCQTCNMGRAEALVREMEEQGIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLKECGFS  470

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
             S   YG +I    +   + +A E+ R M+  GI   +  +  + +G+   ++      +
Sbjct  471  PSVVSYGCLINLYTKIGKVSKALEISRVMKTVGIKHNLKTYSMLFNGFMKLKDWANAFSI  530

Query  57   FDRLKECGFTPSVISY  10
            F+ + + G  P VI Y
Sbjct  531  FEDITKDGLKPDVILY  546



>ref|XP_006605717.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X2 [Glycine max]
Length=931

 Score =   381 bits (978),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 235/295 (80%), Gaps = 22/295 (7%)
 Frame = -2

Query  822  TDRNMGFGFVIYGG----SSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRT  655
            T+R+ GF FVIY G       +K+A++AV+FDGVEFHGRVLTVKLDDG+R M+++ + + 
Sbjct  172  TERSAGFAFVIYDGVESDDEADKAAMRAVEFDGVEFHGRVLTVKLDDGKR-MRERSEEKA  230

Query  654  RWMEGS-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMM  526
            RW++G+                 S ++F+K+LE+QPENW AVV AFERI KP+RKE+G+M
Sbjct  231  RWLQGNGGDKGEYPSTWHEERDGSRKSFQKILETQPENWQAVVTAFERIKKPARKEYGLM  290

Query  525  VNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGI  346
            V YYGRRGD H AR+ FE MR+RGI P+S+ Y++L +AY V RDMEEAL CVRKM +EGI
Sbjct  291  VKYYGRRGDMHHARQTFESMRARGIEPSSHVYSSLIHAYAVGRDMEEALHCVRKMKEEGI  350

Query  345  EISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAee  166
            E+++VTYSIIVGGFAK+GN +AA+HWF EAKE+  +L+A IYG IIYA+CQ CNMDRAE 
Sbjct  351  EMTIVTYSIIVGGFAKMGNADAADHWFEEAKEKLPSLNAVIYGGIIYAHCQICNMDRAEA  410

Query  165  llremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            L+REMEE+GI API I+HTMMDGYT+  NEEKCL++FDRLKECGF PSVISYGCL
Sbjct  411  LVREMEEQGIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFFPSVISYGCL  465


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 92/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ + R G+  RA E+F+ MR  G +PT + Y  L       R M +A+
Sbjct  560  HRPTTRTFLPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTYNALILGLVEKRQMTKAV  619

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +MN  G+  +  TY+ ++ G+A +G+ E A  +F   +     +    Y  ++ + 
Sbjct  620  AILDEMNVAGVGPNEHTYTTLMQGYASLGDTEKAFQYFTVLRNEGLEIDVYTYEALLKSC  679

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM  + I     +++ ++DG+    +  +   +  ++++ G  P +
Sbjct  680  CKSGRMQSALAVTKEMSAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGLLPDI  739

Query  18   ISY  10
             +Y
Sbjct  740  HTY  742


 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 89/184 (48%), Gaps = 1/184 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++  Y   GD  +A + F  +R+ G+    Y Y  L  +   S  M+ AL  
Sbjct  632  PNEHTYTTLMQGYASLGDTEKAFQYFTVLRNEGLEIDVYTYEALLKSCCKSGRMQSALAV  691

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + I A C+
Sbjct  692  TKEMSAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGLLPDIHTYTSFINACCK  751

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M +A E+++EME  GI   +  + T+++G+      EK L  F+ +K  GF P    
Sbjct  752  AGDM-QATEIIQEMEASGIKPNLKTYTTLINGWARASMPEKALSCFEEMKLAGFKPDKAV  810

Query  12   YGCL  1
            Y CL
Sbjct  811  YHCL  814


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 78/185 (42%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE     G+ P    Y N+  A+    +M+ A+ 
Sbjct  491  KHNMKTYSMLINGFLKLKDWANAFSVFEDFTKDGLKPDVVLYNNIITAFCGMGNMDRAIC  550

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             VR+M  E    +  T+  I+ GFA+ G +  A   F   +      +   Y  +I    
Sbjct  551  MVRQMQKERHRPTTRTFLPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTYNALILGLV  610

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M +A  +L EM   G+      + T+M GY    + EK    F  L+  G    V 
Sbjct  611  EKRQMTKAVAILDEMNVAGVGPNEHTYTTLMQGYASLGDTEKAFQYFTVLRNEGLEIDVY  670

Query  15   SYGCL  1
            +Y  L
Sbjct  671  TYEAL  675


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/176 (22%), Positives = 80/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   FE+ + +     +  Y  + YA+    +M+ A   VR+M 
Sbjct  357  YSIIVGGFAKMGNADAADHWFEEAKEKLPSLNAVIYGGIIYAHCQICNMDRAEALVREME  416

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++GI+  +  Y  ++ G+  +GN E     F   KE     S   YG +I    +   + 
Sbjct  417  EQGIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFFPSVISYGCLINLYTKVGKVS  476

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + M+  GI   +  +  +++G+   ++      +F+   + G  P V+ Y
Sbjct  477  KALEISKMMKMSGIKHNMKTYSMLINGFLKLKDWANAFSVFEDFTKDGLKPDVVLY  532



>ref|XP_011024163.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X2 [Populus euphratica]
Length=944

 Score =   381 bits (979),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/288 (66%), Positives = 228/288 (79%), Gaps = 14/288 (5%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIM------------  679
            T+RN GFGF+IY G    KSA+KA +FDG+EFHGRVLTVKLDDGRR+             
Sbjct  185  TERNAGFGFIIYDGPKAGKSAMKAEEFDGMEFHGRVLTVKLDDGRRLKAKAEERKNWVYG  244

Query  678  KDKKKGRTRWMEGS--SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            +D K  R +W E    S++ FRKVL++QPENW A V AFERI KPSR++FG+M  YY RR
Sbjct  245  EDGKDYRPKWHEEGEGSTKAFRKVLDTQPENWQAGVSAFERIKKPSRRDFGLMGGYYARR  304

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRAR+ FE MR+RG+ P+S+ YT+L +AY V RDME AL+CVRKMN+EGIE+S+VTY
Sbjct  305  GDMHRARQTFESMRARGMDPSSHVYTSLIHAYAVGRDMEGALSCVRKMNEEGIEMSLVTY  364

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI++GGFAK+GN EAA+ WF +AKERH  L+A IYGNIIYA CQ CNMDRAE L+REMEE
Sbjct  365  SIVIGGFAKIGNAEAADSWFKKAKERHTNLNAYIYGNIIYAYCQACNMDRAEALVREMEE  424

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            E I AP+ I+HTMMDGYT+ RNEEKCL++F+RLKECGF PSVISYGCL
Sbjct  425  EDIDAPLDIYHTMMDGYTMIRNEEKCLIVFERLKECGFAPSVISYGCL  472


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 89/182 (49%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   F  +++ + R G+  RA E+F+ MR  G +PT + +  L       R ME+A+ 
Sbjct  568  RPTSHTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLVEKRKMEKAVE  627

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M   G+     TY+ I+ G+A +G+   A  +F + +     L    Y  ++ A C
Sbjct  628  ILDEMALAGVSPDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDVFTYEALLKACC  687

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + REM  + I     +++ ++DG+    +  +   +  ++K+ G  P + 
Sbjct  688  KSGRMQSALAVTREMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIH  747

Query  15   SY  10
            +Y
Sbjct  748  TY  749


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 82/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++  + + G+   A   F+K + R     +Y Y N+ YAY  + +M+ A   VR+M 
Sbjct  364  YSIVIGGFAKIGNAEAADSWFKKAKERHTNLNAYIYGNIIYAYCQACNMDRAEALVREME  423

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +E I+  +  Y  ++ G+  + N E     F   KE     S   YG +I    +   + 
Sbjct  424  EEDIDAPLDIYHTMMDGYTMIRNEEKCLIVFERLKECGFAPSVISYGCLINMYTKIGKVY  483

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + M+  GI   +  +  +++G+   ++      +F+ + + G  P V+ Y
Sbjct  484  KALEVSKMMKSVGIKHNMKTYSMLINGFLKLKDWTNAFAVFEDVIKDGLKPDVVLY  539


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  498  KHNMKTYSMLINGFLKLKDWTNAFAVFEDVIKDGLKPDVVLYNNIIKAFCGMGNMDRAIH  557

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G +  A   F   +      +   +  ++    
Sbjct  558  MVKEMQKERCRPTSHTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLV  617

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++     + T+M GY    +  K    F +++  G    V 
Sbjct  618  EKRKMEKAVEILDEMALAGVSPDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDVF  677

Query  15   SYGCL  1
            +Y  L
Sbjct  678  TYEAL  682


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 1/112 (1%)
 Frame = -2

Query  585  AVVRAFERINKPSRK-EFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            AV R     N P     + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A 
Sbjct  697  AVTREMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINAC  756

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              + DM  A   + +M   G++ +V TY+ ++ G+A     E A   F E K
Sbjct  757  CKAGDMLRATKTMEEMEAAGVKPNVKTYTTLIHGWANASLPEKALSCFEELK  808



>ref|XP_003556878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X1 [Glycine max]
Length=932

 Score =   381 bits (978),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 235/295 (80%), Gaps = 22/295 (7%)
 Frame = -2

Query  822  TDRNMGFGFVIYGG----SSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRT  655
            T+R+ GF FVIY G       +K+A++AV+FDGVEFHGRVLTVKLDDG+R M+++ + + 
Sbjct  172  TERSAGFAFVIYDGVESDDEADKAAMRAVEFDGVEFHGRVLTVKLDDGKR-MRERSEEKA  230

Query  654  RWMEGS-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMM  526
            RW++G+                 S ++F+K+LE+QPENW AVV AFERI KP+RKE+G+M
Sbjct  231  RWLQGNGGDKGEYPSTWHEERDGSRKSFQKILETQPENWQAVVTAFERIKKPARKEYGLM  290

Query  525  VNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGI  346
            V YYGRRGD H AR+ FE MR+RGI P+S+ Y++L +AY V RDMEEAL CVRKM +EGI
Sbjct  291  VKYYGRRGDMHHARQTFESMRARGIEPSSHVYSSLIHAYAVGRDMEEALHCVRKMKEEGI  350

Query  345  EISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAee  166
            E+++VTYSIIVGGFAK+GN +AA+HWF EAKE+  +L+A IYG IIYA+CQ CNMDRAE 
Sbjct  351  EMTIVTYSIIVGGFAKMGNADAADHWFEEAKEKLPSLNAVIYGGIIYAHCQICNMDRAEA  410

Query  165  llremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            L+REMEE+GI API I+HTMMDGYT+  NEEKCL++FDRLKECGF PSVISYGCL
Sbjct  411  LVREMEEQGIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFFPSVISYGCL  465


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++  Y   GD  +A + F  +R+ G+    Y Y  L  +   S  M+ AL  
Sbjct  632  PNEHTYTTLMQGYASLGDTEKAFQYFTVLRNEGLEIDVYTYEALLKSCCKSGRMQSALAV  691

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + I A C+
Sbjct  692  TKEMSAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGLLPDIHTYTSFINACCK  751

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M +A E+++EME  GI   +  + T+++G+      EK L  F+ +K  GF P    
Sbjct  752  AGDMQKATEIIQEMEASGIKPNLKTYTTLINGWARASMPEKALSCFEEMKLAGFKPDKAV  811

Query  12   YGCL  1
            Y CL
Sbjct  812  YHCL  815


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 92/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ + R G+  RA E+F+ MR  G +PT + Y  L       R M +A+
Sbjct  560  HRPTTRTFLPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTYNALILGLVEKRQMTKAV  619

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +MN  G+  +  TY+ ++ G+A +G+ E A  +F   +     +    Y  ++ + 
Sbjct  620  AILDEMNVAGVGPNEHTYTTLMQGYASLGDTEKAFQYFTVLRNEGLEIDVYTYEALLKSC  679

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM  + I     +++ ++DG+    +  +   +  ++++ G  P +
Sbjct  680  CKSGRMQSALAVTKEMSAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGLLPDI  739

Query  18   ISY  10
             +Y
Sbjct  740  HTY  742


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 78/185 (42%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE     G+ P    Y N+  A+    +M+ A+ 
Sbjct  491  KHNMKTYSMLINGFLKLKDWANAFSVFEDFTKDGLKPDVVLYNNIITAFCGMGNMDRAIC  550

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             VR+M  E    +  T+  I+ GFA+ G +  A   F   +      +   Y  +I    
Sbjct  551  MVRQMQKERHRPTTRTFLPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTYNALILGLV  610

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M +A  +L EM   G+      + T+M GY    + EK    F  L+  G    V 
Sbjct  611  EKRQMTKAVAILDEMNVAGVGPNEHTYTTLMQGYASLGDTEKAFQYFTVLRNEGLEIDVY  670

Query  15   SYGCL  1
            +Y  L
Sbjct  671  TYEAL  675


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/176 (22%), Positives = 80/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + + G+   A   FE+ + +     +  Y  + YA+    +M+ A   VR+M 
Sbjct  357  YSIIVGGFAKMGNADAADHWFEEAKEKLPSLNAVIYGGIIYAHCQICNMDRAEALVREME  416

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++GI+  +  Y  ++ G+  +GN E     F   KE     S   YG +I    +   + 
Sbjct  417  EQGIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFFPSVISYGCLINLYTKVGKVS  476

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + M+  GI   +  +  +++G+   ++      +F+   + G  P V+ Y
Sbjct  477  KALEISKMMKMSGIKHNMKTYSMLINGFLKLKDWANAFSVFEDFTKDGLKPDVVLY  532



>ref|XP_007145390.1| hypothetical protein PHAVU_007G234900g [Phaseolus vulgaris]
 gb|ESW17384.1| hypothetical protein PHAVU_007G234900g [Phaseolus vulgaris]
Length=897

 Score =   379 bits (973),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/291 (63%), Positives = 233/291 (80%), Gaps = 19/291 (7%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSS--PEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWM  646
            +RN GF FVIY G     +K+A++AV+FDGVEFHGRVLTVKLDDG+R M++K + R RW+
Sbjct  160  ERNAGFAFVIYDGEDEVADKAAMRAVEFDGVEFHGRVLTVKLDDGKR-MREKSQERARWL  218

Query  645  EGS----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            EG+                S + F+KVLE+QPENW AVV AFE+I KP+RKE+G+MV YY
Sbjct  219  EGNGNKGEHPSSWHEERDGSRKGFQKVLETQPENWQAVVTAFEKIKKPARKEYGLMVKYY  278

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
             RRGD H AR+ FE MR+RGI P+S+ Y++L +AY V RDMEEAL CVRKM +EGIE+++
Sbjct  279  ARRGDMHHARQTFESMRARGIEPSSHVYSSLIHAYAVGRDMEEALHCVRKMKEEGIEMTI  338

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYSI+VGGFA++ N +AA+HWF EAKE   +L+A IYG+IIYA+CQTCNMDRAE L+RE
Sbjct  339  VTYSIVVGGFARMANADAADHWFKEAKEMLPSLNAVIYGSIIYAHCQTCNMDRAEALVRE  398

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEE+GI API I+HTMMDGYT+  NE+KCL++F+RLKECGF+PSV+SYGCL
Sbjct  399  MEEQGIDAPIDIYHTMMDGYTMIGNEQKCLIVFERLKECGFSPSVVSYGCL  449


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ + R G+  RA E+F+ MR  G +PT + Y  L         M +A+
Sbjct  544  HRPTTRTFLPIIHSFARAGEMRRALEVFDMMRRSGCIPTVHTYNALILGLVEKCQMAKAV  603

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +MN  GI  +  TY+ ++ G+A VG+ E A  +F   +     +    Y  ++ A 
Sbjct  604  AILDEMNLAGIRPNEHTYTTLMQGYASVGDTEKAFQYFTALRNEGLEIDVYTYEALLKAC  663

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C+   M  A  + +EM  + I     +++ ++DG+    +  +   +  ++++ G  P +
Sbjct  664  CKAGRMQSALAVTKEMSAKKIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGVRPDI  723

Query  18   ISY  10
             +Y
Sbjct  724  HTY  726


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 88/185 (48%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++  Y   GD  +A + F  +R+ G+    Y Y  L  A   +  M+ AL 
Sbjct  615  RPNEHTYTTLMQGYASVGDTEKAFQYFTALRNEGLEIDVYTYEALLKACCKAGRMQSALA  674

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + I A C
Sbjct  675  VTKEMSAKKIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGVRPDIHTYTSFINACC  734

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M +A E+++EME   I   +  + T+++G+      EK L  F+ +K  G  P   
Sbjct  735  KAGDMQKATEIIQEMEASDIKPNLKTYTTLINGWARASMPEKALSCFEEMKLAGLKPDKA  794

Query  15   SYGCL  1
             Y CL
Sbjct  795  VYHCL  799


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 76/181 (42%), Gaps = 0/181 (0%)
 Frame = -2

Query  543  KEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRK  364
            K + M++N + +  D   A  +FE     G+ P    Y N+  A+    +M+ A+  V++
Sbjct  479  KTYSMLINGFLKLKDWANAFSIFEDFTKDGLKPDVVLYNNIVTAFCGMGNMDRAIQMVKQ  538

Query  363  MNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCN  184
            M  E    +  T+  I+  FA+ G +  A   F   +      +   Y  +I    + C 
Sbjct  539  MQKERHRPTTRTFLPIIHSFARAGEMRRALEVFDMMRRSGCIPTVHTYNALILGLVEKCQ  598

Query  183  MDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGC  4
            M +A  +L EM   GI      + T+M GY    + EK    F  L+  G    V +Y  
Sbjct  599  MAKAVAILDEMNLAGIRPNEHTYTTLMQGYASVGDTEKAFQYFTALRNEGLEIDVYTYEA  658

Query  3    L  1
            L
Sbjct  659  L  659



>gb|KEH41294.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=952

 Score =   380 bits (976),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 231/287 (80%), Gaps = 16/287 (6%)
 Frame = -2

Query  816  RNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEGS  637
            RN GFGFVIY G + E SA+KAV+FDGVEFHG+VLTVKLDDG+R  ++K+  R +W+ G+
Sbjct  199  RNAGFGFVIYEGETAENSAMKAVEFDGVEFHGKVLTVKLDDGKR-WREKRSEREKWLSGN  257

Query  636  ---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRG  502
                           S + F+KVLE++PENW AVVRAFER+NKP+RKE+G+M+ YY RRG
Sbjct  258  DEKEYRSEWHEERDGSRKEFQKVLETEPENWQAVVRAFERVNKPARKEYGLMIKYYARRG  317

Query  501  DKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYS  322
            D H AR+ FE MR+RGI P+S+ Y++L +AY V RDMEEAL CVRKM DEGIE+S+VTYS
Sbjct  318  DMHHARQAFESMRARGIEPSSHVYSSLIHAYAVGRDMEEALNCVRKMKDEGIEMSIVTYS  377

Query  321  IIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeE  142
            IIVGGFAK+GN +AA++WF EAKE   +L+A IYG+IIYA+CQ C M RAE L+REMEE+
Sbjct  378  IIVGGFAKLGNADAADNWFKEAKESLPSLNAVIYGSIIYAHCQACKMGRAEALVREMEEQ  437

Query  141  GIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            GI API I+HTMMDGYT+  NEEKCL++F+RLKECGF+PS++SYGCL
Sbjct  438  GIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLKECGFSPSIVSYGCL  484


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 96/192 (50%), Gaps = 1/192 (1%)
 Frame = -2

Query  582  VVRAFERI-NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYT  406
            +V+  +R  ++ + + F  +++ + R G+  RA E+F+ MR  G +PT + Y  L     
Sbjct  570  IVKQMQRERHRATTRTFLPIIHGFARAGETRRALEIFDTMRRSGCIPTVHTYNALILGLV  629

Query  405  VSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS  226
                ME+AL  + +MN  G+  +  TY+ ++ G+A +G+ E A  +F   K     +   
Sbjct  630  EKCQMEKALQILDEMNLAGVSPNEHTYTTLMQGYASLGDTEKAFQYFTILKNDGLEIDVY  689

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  +   +  ++
Sbjct  690  TYEALLKACCKSGRMQSALAVTKEMSSKKIPRNTFVYNILIDGWARRGDVWEAADLMQQM  749

Query  45   KECGFTPSVISY  10
            ++ G  P + +Y
Sbjct  750  RKEGVQPDIHTY  761


 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++  Y   GD  +A + F  +++ G+    Y Y  L  A   S  M+ AL  
Sbjct  651  PNEHTYTTLMQGYASLGDTEKAFQYFTILKNDGLEIDVYTYEALLKACCKSGRMQSALAV  710

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + I A C+
Sbjct  711  TKEMSSKKIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGVQPDIHTYTSFINACCK  770

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M  A ++++EME  GI   +  + T++ G+      EK L  F+ LK  G  P    
Sbjct  771  AGDMQNATQVIKEMEARGIKPNLKTYTTLIHGWARAAFPEKALKCFEDLKVAGLKPDRAV  830

Query  12   YGCL  1
            Y CL
Sbjct  831  YHCL  834


 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M+ N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  510  KHNMKTYSMLFNGFVKLKDWANAFSVFEDITKDGLKPDVILYNNIVKAFCGMGNMDRAIC  569

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G    A   F   +      +   Y  +I    
Sbjct  570  IVKQMQRERHRATTRTFLPIIHGFARAGETRRALEIFDTMRRSGCIPTVHTYNALILGLV  629

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            + C M++A ++L EM   G++     + T+M GY    + EK    F  LK  G    V 
Sbjct  630  EKCQMEKALQILDEMNLAGVSPNEHTYTTLMQGYASLGDTEKAFQYFTILKNDGLEIDVY  689

Query  15   SYGCL  1
            +Y  L
Sbjct  690  TYEAL  694



>ref|XP_003535211.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Glycine max]
Length=918

 Score =   379 bits (972),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 235/296 (79%), Gaps = 23/296 (8%)
 Frame = -2

Query  822  TDRNMGFGFVIYGG-----SSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGR  658
            T+R+ GF FVIY G     +  +K+A++AV+FDGVEFHGRVLTVKLDDG++ M+++ + R
Sbjct  161  TERSAGFAFVIYDGGEGDETKADKAAMRAVEFDGVEFHGRVLTVKLDDGKK-MRERSEER  219

Query  657  TRWMEGS-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGM  529
             RW++G+                 S ++F+KVLE+QPENW AVV AFERI KP+RKE+G+
Sbjct  220  ARWLQGNGGDKGEYPSTRHKERDGSRKSFQKVLETQPENWQAVVTAFERIKKPARKEYGL  279

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            MV YY RRGD H AR+ FE M++RGI P+S+ Y++L +AY V RDMEEAL CVRKM +EG
Sbjct  280  MVKYYARRGDMHHARQTFESMQARGIEPSSHVYSSLIHAYAVGRDMEEALHCVRKMKEEG  339

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            IE+++VTYSIIVGGFAK+G  +AA+HWF EAKE+  +L+A  YG+IIYA+CQTCNMDRAE
Sbjct  340  IEMTIVTYSIIVGGFAKMGKADAADHWFKEAKEKLPSLNAVTYGSIIYAHCQTCNMDRAE  399

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             L+REME +GI API I+HTMMDGYT+  NEEKCL++FDRLKECGF+PSVISYGCL
Sbjct  400  ALVREMEVQGIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFSPSVISYGCL  455


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/182 (23%), Positives = 91/182 (50%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + F  +++ + R G+  RA E+F+ MR  G +PT + Y  L       R M +A+ 
Sbjct  551  RPTTRTFLPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTYNALILGLVEKRKMAKAVA  610

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +MN  G+  +  TY+ ++ G+A +G+ E A  +F   +     +    Y  ++ + C
Sbjct  611  ILDQMNVAGVGPNEHTYTTLMQGYASLGDTEKAFQYFSVLRNEGLEIDVYTYEALLKSCC  670

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + +EM  + I     +++ ++DG+    +  +   +  ++++ G  P + 
Sbjct  671  KSGRMQSALAVTKEMSAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGVLPDIH  730

Query  15   SY  10
            +Y
Sbjct  731  TY  732


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++  Y   GD  +A + F  +R+ G+    Y Y  L  +   S  M+ AL  
Sbjct  622  PNEHTYTTLMQGYASLGDTEKAFQYFSVLRNEGLEIDVYTYEALLKSCCKSGRMQSALAV  681

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C+
Sbjct  682  TKEMSAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGVLPDIHTYTSFVNACCK  741

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M +A E+++EME  GI   +  + T+++G+      EK L  F+ +K     P   +
Sbjct  742  AGDMQKATEIIQEMEAFGIKPNLKTYTTLINGWARASMPEKALSCFEEMKLAELKPDKAA  801

Query  12   YGCL  1
            Y CL
Sbjct  802  YHCL  805


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 78/185 (42%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE     G+ P    Y N+  A+    +M+ A+ 
Sbjct  481  KHNMKTYSMLINGFLKLKDWANAFSVFEDFTKDGLKPDVVLYNNIITAFCGMSNMDRAIC  540

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G +  A   F   +      +   Y  +I    
Sbjct  541  MVKQMQKERYRPTTRTFLPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTYNALILGLV  600

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M +A  +L +M   G+      + T+M GY    + EK    F  L+  G    V 
Sbjct  601  EKRKMAKAVAILDQMNVAGVGPNEHTYTTLMQGYASLGDTEKAFQYFSVLRNEGLEIDVY  660

Query  15   SYGCL  1
            +Y  L
Sbjct  661  TYEAL  665



>ref|XP_009122568.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Brassica rapa]
Length=940

 Score =   375 bits (962),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 230/293 (78%), Gaps = 24/293 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGF+IY   S EKSA+KAV+FDGVEFHGRVLTVKLDDG+R +K K + R RW+E 
Sbjct  195  EKNAGFGFIIY---STEKSAMKAVEFDGVEFHGRVLTVKLDDGKR-LKTKAEQRARWVEA  250

Query  639  S--------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVN  520
                                 S +  +++L+S  +NW AVV AFE+INKPSR EFG+MV 
Sbjct  251  EGEEEDAKMSSKSSWHQEREGSRKTLQRILDSNGDNWQAVVSAFEKINKPSRTEFGLMVK  310

Query  519  YYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEI  340
            YYGRRGD HRARE FE+MRSRGI PTS  YT+L +AY V RDMEEAL+CVRKM +EGIE+
Sbjct  311  YYGRRGDVHRARETFERMRSRGITPTSRIYTSLIHAYAVGRDMEEALSCVRKMKEEGIEM  370

Query  339  SVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeell  160
            S+VTYS+IVGGF+K GN EAA+ WF EAK  H +L+ASIYG IIYA+CQ CNM+RAEEL+
Sbjct  371  SLVTYSVIVGGFSKAGNAEAADQWFDEAKRIHKSLNASIYGKIIYAHCQACNMERAEELV  430

Query  159  remeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            REMEEEGI API+I+HTMMDGYT+  +E+KCL++F RLKECGFTP+V++YGCL
Sbjct  431  REMEEEGIDAPIAIYHTMMDGYTMVADEKKCLIVFKRLKECGFTPTVVTYGCL  483


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ Y + GD  ++ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  578  HRPTTRTFMPIIHGYAKSGDMRKSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  637

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  638  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLKVDIFTYEALLKAC  697

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  698  CKSGRMQSALAVTKEMSTRNIPRNSFVYNILIDGWARRGDVWEAADLMQQMKKEGVKPDI  757

Query  18   ISY  10
             +Y
Sbjct  758  HTY  760


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +ME A+ 
Sbjct  509  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVNDGMKPDVILYNNIIAAFCGMGNMERAVQ  568

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ G+AK G++  +   F   +      +   +  +I    
Sbjct  569  TVKEMQKLRHRPTTRTFMPIIHGYAKSGDMRKSLEVFDMMRRCGCVPTVHTFNALINGLV  628

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  629  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLKVDIF  688

Query  15   SYGCL  1
            +Y  L
Sbjct  689  TYEAL  693


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   +++M 
Sbjct  725  YNILIDGWARRGDVWEAADLMQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIQEME  784

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G+  ++ TY+ ++ G+A+    E A   + E K        ++Y
Sbjct  785  ALGVRPNIKTYTTLIKGWARASLPEKALSCYEEMKAMGLKPDKAVY  830



>emb|CDX70202.1| BnaA10g25510D [Brassica napus]
Length=939

 Score =   373 bits (958),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/293 (63%), Positives = 230/293 (78%), Gaps = 24/293 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGRVLTVKLDDG+R +K K + R RW+E 
Sbjct  194  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRVLTVKLDDGKR-LKTKAEQRARWVEA  249

Query  639  S--------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVN  520
                                 S +  +++L+S  +NW AVV AFE+INKPSR EFG+MV 
Sbjct  250  EGEEEDAKMSSKSSWHQEREGSRKTLQRILDSNGDNWQAVVSAFEKINKPSRTEFGLMVK  309

Query  519  YYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEI  340
            YYGRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDMEEAL+CVRKM +EGIE+
Sbjct  310  YYGRRGDVHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMEEALSCVRKMKEEGIEM  369

Query  339  SVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeell  160
            S+VTYS+IVGGF+K GN EAA+ WF EAK+ H +L+ASIYG IIYA+CQ CNM+RAEEL+
Sbjct  370  SLVTYSVIVGGFSKAGNAEAADQWFDEAKKIHKSLNASIYGKIIYAHCQACNMERAEELV  429

Query  159  remeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            REMEEEGI API+I+HTMMDGYT+  +E+KCL++F RLKECGFTP+V++YGCL
Sbjct  430  REMEEEGIDAPIAIYHTMMDGYTMVADEKKCLIVFKRLKECGFTPTVVTYGCL  482


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ Y + GD  ++ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  577  HRPTTRTFMPIIHGYAKSGDMRKSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  636

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  637  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLKVDIFTYEALLKAC  696

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  697  CKSGRMQSALAVTKEMSTRNIPRNSFVYNILIDGWARRGDVWEAADLMQQMKKEGVKPDI  756

Query  18   ISY  10
             +Y
Sbjct  757  HTY  759


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +ME A+ 
Sbjct  508  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVNDGMKPDVILYNNIIAAFCGMGNMERAVQ  567

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ G+AK G++  +   F   +      +   +  +I    
Sbjct  568  TVKEMQKLRHRPTTRTFMPIIHGYAKSGDMRKSLEVFDMMRRCGCVPTVHTFNALINGLV  627

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  628  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLKVDIF  687

Query  15   SYGCL  1
            +Y  L
Sbjct  688  TYEAL  692


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   +++M 
Sbjct  724  YNILIDGWARRGDVWEAADLMQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIQEME  783

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G+  ++ TY+ ++ G+A+    E A   + E K        ++Y
Sbjct  784  ALGVRPNIKTYTTLIKGWARASLPEKALSCYEEMKAMGLKPDKAVY  829



>emb|CDY44879.1| BnaC09g50790D [Brassica napus]
Length=943

 Score =   372 bits (955),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/293 (64%), Positives = 228/293 (78%), Gaps = 24/293 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRW---  649
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGRVLTVKLDDG+R +K K + R RW   
Sbjct  194  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRVLTVKLDDGKR-LKTKAEQRARWVEE  249

Query  648  --------MEGSSS---------RNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVN  520
                    M   SS         +  +++L+S  +NW AVV AFE+INKPSR EFG+MV 
Sbjct  250  EGEEEDAKMSSKSSWHQEREGSRKTLQRILDSNGDNWQAVVSAFEKINKPSRTEFGLMVK  309

Query  519  YYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEI  340
            YYGRRGD HRARE FE+MRSRGI PTS  YT+L +AY V RDMEEAL+CVRKM +EGIE+
Sbjct  310  YYGRRGDMHRARETFERMRSRGITPTSRIYTSLIHAYAVGRDMEEALSCVRKMKEEGIEM  369

Query  339  SVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeell  160
            S+VTYS+IVGGF+K GN EAA+ WF EAK  H +L+ASIYG IIYA+CQ CNM+RAE L+
Sbjct  370  SLVTYSVIVGGFSKAGNAEAADQWFDEAKRIHKSLNASIYGKIIYAHCQACNMERAEALV  429

Query  159  remeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            REMEEEGI API+I+HTMMDGYT+  +E+KCL++F RLKECGFTP+V++YGCL
Sbjct  430  REMEEEGIDAPIAIYHTMMDGYTMVADEKKCLIVFKRLKECGFTPTVVTYGCL  482


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ Y + GD  ++ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  577  HRPTTRTFMPIIHGYAKSGDMRKSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  636

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  637  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQSEGLKVDIFTYEALLKAC  696

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  697  CKSGRMQSALAVTKEMSTRNIPRNSFVYNILIDGWARRGDVWEAADLMQQMKKEGVKPDI  756

Query  18   ISY  10
             +Y
Sbjct  757  HTY  759


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +ME A+ 
Sbjct  508  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVNDGMKPDVILYNNIIAAFCGMGNMERAVQ  567

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ G+AK G++  +   F   +      +   +  +I    
Sbjct  568  TVKEMQKLRHRPTTRTFMPIIHGYAKSGDMRKSLEVFDMMRRCGCVPTVHTFNALINGLV  627

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  628  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQSEGLKVDIF  687

Query  15   SYGCL  1
            +Y  L
Sbjct  688  TYEAL  692


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   +++M 
Sbjct  724  YNILIDGWARRGDVWEAADLMQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIQEME  783

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G+  ++ TY+ ++ G+A+    E A   + E K        ++Y
Sbjct  784  ALGVRPNIKTYTTLIKGWARASLPEKALSCYEEMKAMGLKPDKAVY  829



>ref|XP_006398932.1| hypothetical protein EUTSA_v10012596mg [Eutrema salsugineum]
 gb|ESQ40385.1| hypothetical protein EUTSA_v10012596mg [Eutrema salsugineum]
Length=939

 Score =   371 bits (952),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/291 (63%), Positives = 229/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGFVIY     EKSA+KAV+FDGVEFHGRVLTVKLDDG+R +K K + R RW++ 
Sbjct  191  EKNAGFGFVIYAA---EKSAMKAVEFDGVEFHGRVLTVKLDDGKR-LKTKAEQRVRWVQQ  246

Query  639  S------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S +  +++L++  +NW AVV AFE+INKPSR EFG+MV YY
Sbjct  247  GEEDSKMSNKSSWHQERQGSRKTLQRILDTNGDNWQAVVSAFEKINKPSRTEFGLMVKYY  306

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDM+EAL+CVRKM +EGIE+S+
Sbjct  307  GRRGDVHRAREAFERMRARGITPTSRIYTSLIHAYAVGRDMDEALSCVRKMKEEGIEMSL  366

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K GN EAA+HWF EAK +H  L+ASIYG IIYA+CQTCNM+RAE L+RE
Sbjct  367  VTYSVIVGGFSKAGNAEAADHWFDEAKRKHKDLNASIYGKIIYAHCQTCNMERAEALVRE  426

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  427  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLIVFKRLKECGFTPTVVTYGCL  477


 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ Y + GD  ++ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  572  HRPTTRTFMPIIHGYAKSGDMRKSLEIFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  631

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  632  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIFTYEALLKAC  691

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  692  CKSGRMQSALAVTKEMSTRNIPRNSFVYNILIDGWARRGDVWEAADLMQQMKKEGVKPDI  751

Query  18   ISY  10
             +Y
Sbjct  752  HTY  754


 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +M+ A+ 
Sbjct  503  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVNDGLKPDVILYNNIIAAFCGMGNMDRAIQ  562

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ G+AK G++  +   F   +      +   +  +I    
Sbjct  563  TVKEMQKLRHRPTTRTFMPIIHGYAKSGDMRKSLEIFDMMRRCGCVPTVHTFNALINGLV  622

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  623  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIF  682

Query  15   SYGCL  1
            +Y  L
Sbjct  683  TYEAL  687


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   +++M 
Sbjct  719  YNILIDGWARRGDVWEAADLMQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIQEME  778

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G+  ++ TY+ ++ G+A+    E A + + E K        ++Y  ++ +     +M 
Sbjct  779  ALGVRPNIKTYTTLIKGWARASLPEKALNCYEEMKAMGLKPDKAVYHCLMTSLLSRASMA  838

Query  177  RA  172
             A
Sbjct  839  EA  840



>ref|XP_002871115.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47374.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=942

 Score =   369 bits (948),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/291 (63%), Positives = 231/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWM-E  643
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW+ E
Sbjct  205  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVQE  260

Query  642  GS-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            G                  S ++ +++L++  +NW AV+ AFE+INKPSR EFG+MV +Y
Sbjct  261  GEEDAKMSNKSSWHQEREGSRKSLQRILDTNGDNWQAVISAFEKINKPSRTEFGLMVKFY  320

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDMEEAL+CVRKM +EGIE+S+
Sbjct  321  GRRGDMHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMEEALSCVRKMKEEGIEMSL  380

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K GN EAA+HWF EAK  H TL+ASIYG IIYA+CQTCNM+RAE L+RE
Sbjct  381  VTYSVIVGGFSKAGNAEAADHWFDEAKRIHKTLNASIYGKIIYAHCQTCNMERAEALVRE  440

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  441  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLIVFKRLKECGFTPTVVTYGCL  491


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  ++N + + GD  R+ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  586  HRPTTRTFMPIINGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  645

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  646  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIFTYEALLKAC  705

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  706  CKSGRMQSALAVTKEMSARNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKEGVKPDI  765

Query  18   ISY  10
             +Y
Sbjct  766  HTY  768


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M   G+ P    Y N+  A+    +M+ A+ 
Sbjct  517  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVKEGMKPDVILYNNIIAAFCGMGNMDRAIQ  576

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ GFAK G++  +   F   +      +   +  +I    
Sbjct  577  TVKEMQKLRHRPTTRTFMPIINGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLV  636

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  637  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIF  696

Query  15   SYGCL  1
            +Y  L
Sbjct  697  TYEAL  701


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 79/181 (44%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G ++N Y + G   +A E+   M+  G+      Y+ +   +   +D   A   
Sbjct  483  PTVVTYGCLINLYTKVGKISKALEVSRVMKEEGVKHNLKTYSMMINGFVKLKDWANAFAV  542

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M  EG++  V+ Y+ I+  F  +GN++ A     E ++     +   +  II    +
Sbjct  543  FEDMVKEGMKPDVILYNNIIAAFCGMGNMDRAIQTVKEMQKLRHRPTTRTFMPIINGFAK  602

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +M R+ E+   M   G    +  F+ +++G    R  EK + + D +   G + +  +
Sbjct  603  SGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAVEILDEMTLAGVSANEHT  662

Query  12   Y  10
            Y
Sbjct  663  Y  663


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  733  YNILIDGWARRGDVWEAADLIQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIEEME  792

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ ++ TY+ ++ G+A+    E A   + E K
Sbjct  793  ALGVKPNIKTYTTLIKGWARASLPEKALSCYEEMK  827



>ref|XP_010491001.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Camelina sativa]
Length=947

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 231/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW++G
Sbjct  201  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVQG  256

Query  639  S------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S ++ +++ ++  +NW AV+ AFE+INKPSR EFG+MV +Y
Sbjct  257  GEEDAKMSNKSSWHQDREGSRKSLQRIFDTNGDNWQAVISAFEKINKPSRTEFGLMVKFY  316

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDMEEA++CVRKM +EGIE+S+
Sbjct  317  GRRGDMHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMEEAVSCVRKMKEEGIEMSL  376

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K GN EAA+HWF EAK  H TL+ASIYG IIYA+CQTCNM+RAEEL+RE
Sbjct  377  VTYSVIVGGFSKAGNAEAADHWFDEAKRIHKTLNASIYGKIIYAHCQTCNMERAEELVRE  436

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  437  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLIVFKRLKECGFTPTVVTYGCL  487


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  ++N + + GD  R+ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  582  HRPTTRTFMPIINGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  641

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  642  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIFTYEALLKAC  701

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  702  CKSGRMQSALAVTKEMSARNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKEGVKPDI  761

Query  18   ISY  10
             +Y
Sbjct  762  HTY  764


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +M+ A+ 
Sbjct  513  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVNEGMKPDVILYNNIIAAFCGMGNMDRAIQ  572

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ GFAK G++  +   F   +      +   +  +I    
Sbjct  573  TVKEMQKLRHRPTTRTFMPIINGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLV  632

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  633  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIF  692

Query  15   SYGCL  1
            +Y  L
Sbjct  693  TYEAL  697


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 80/181 (44%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G ++N Y + G   +A E+   M+  GI      Y+ +   +   +D   A   
Sbjct  479  PTVVTYGCLINLYTKVGKITKALEVSRTMKEEGIKHNLKTYSMMINGFVKLKDWANAFAV  538

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M +EG++  V+ Y+ I+  F  +GN++ A     E ++     +   +  II    +
Sbjct  539  FEDMVNEGMKPDVILYNNIIAAFCGMGNMDRAIQTVKEMQKLRHRPTTRTFMPIINGFAK  598

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +M R+ E+   M   G    +  F+ +++G    R  EK + + D +   G + +  +
Sbjct  599  SGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAVEILDEMTLAGVSANEHT  658

Query  12   Y  10
            Y
Sbjct  659  Y  659


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  729  YNILIDGWARRGDVWEAADLIQQMKKEGVKPDIHTYTSFISACSKAGDMNRATKTIEEMA  788

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G+  ++ TY+ ++ G+A+    E A + + E K        ++Y
Sbjct  789  ALGVRPNIKTYTTLIKGWARASLPEKALNCYEEMKAMGLKPDKAVY  834



>gb|KHG05816.1| Pentatricopeptide repeat-containing, chloroplastic -like protein 
[Gossypium arboreum]
Length=925

 Score =   368 bits (944),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 221/277 (80%), Gaps = 20/277 (7%)
 Frame = -2

Query  816  RNMGFGFVIYGGSSP--EKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            RN GFGFVIYGG  P  EKSA+KAV+FDGVEF GRVLTVKLDDG R +K K + R RW+E
Sbjct  191  RNAGFGFVIYGGPPPVAEKSALKAVEFDGVEFRGRVLTVKLDDGTR-LKGKAEERARWVE  249

Query  642  -----------------GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S R FRKVL+S+PENW  VV AFERI+KPSR+EFG+MVNYY
Sbjct  250  RYQGQDLSNKSKWHQEREGSRRLFRKVLDSEPENWQKVVFAFERIDKPSRREFGLMVNYY  309

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
             RRGD HRARE FE+MRSRGI PTS+ YTNL +AY V RDMEEAL+CVRKM +EGIEI++
Sbjct  310  ARRGDMHRARETFERMRSRGIEPTSHVYTNLVHAYAVGRDMEEALSCVRKMKEEGIEITL  369

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYSI+V GFAK+GN EAA++WF EAKERH  L+A IYGNI+YA+CQTCNM+RAE L+RE
Sbjct  370  VTYSILVRGFAKIGNSEAADYWFEEAKERHTPLNAIIYGNIVYAHCQTCNMERAEALVRE  429

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            MEEEGI API I+HTMMDGYT+  NEEKCL++F+RLK
Sbjct  430  MEEEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLK  466


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+R+ G+    Y Y  L  A   S  M+ AL  
Sbjct  627  PNEHTYTTIMHGYASLGDTGKAFEYFSKLRNEGLELDVYTYEALLKACCKSGRMQSALAV  686

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M  + I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A C+
Sbjct  687  TKEMAAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINACCK  746

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + ++EM+  GI   +  + T++ G+      EK L  F+ +K  G  P    
Sbjct  747  AGDMLRATKTIQEMDAIGIKPNVKTYTTLIHGWARASLPEKALKCFEEMKLAGLKPDKAV  806

Query  12   YGCL  1
            Y CL
Sbjct  807  YHCL  810


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 96/193 (50%), Gaps = 0/193 (0%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    +  ++P+ + F  +++ + R G+  RA E+F+ MR  G +PT + +  L    
Sbjct  545  HTVKEMQKERHRPTTRTFMPIIHGFARAGEMRRALEVFDMMRRSGCIPTVHTFNALILGL  604

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
            T  R ME+A+  + +M   G+  +  TY+ I+ G+A +G+   A  +F + +     L  
Sbjct  605  TEKRQMEKAVEILDEMTLAGVTPNEHTYTTIMHGYASLGDTGKAFEYFSKLRNEGLELDV  664

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  +   +  +
Sbjct  665  YTYEALLKACCKSGRMQSALAVTKEMAAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQ  724

Query  48   LKECGFTPSVISY  10
            +K+ G  P + +Y
Sbjct  725  MKQEGVQPDIHTY  737


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N Y +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  486  KHNMKTYSMLINGYLKLKDWANAFAIFEDLVKDGLKPDVVLYNNIIQAFCGMGNMDRAIH  545

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G +  A   F   +      +   +  +I    
Sbjct  546  TVKEMQKERHRPTTRTFMPIIHGFARAGEMRRALEVFDMMRRSGCIPTVHTFNALILGLT  605

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G+      + T+M GY    +  K    F +L+  G    V 
Sbjct  606  EKRQMEKAVEILDEMTLAGVTPNEHTYTTIMHGYASLGDTGKAFEYFSKLRNEGLELDVY  665

Query  15   SYGCL  1
            +Y  L
Sbjct  666  TYEAL  670



>ref|XP_006290044.1| hypothetical protein CARUB_v10003679mg [Capsella rubella]
 gb|EOA22942.1| hypothetical protein CARUB_v10003679mg [Capsella rubella]
Length=957

 Score =   368 bits (944),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 185/291 (64%), Positives = 231/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWM-E  643
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW+ E
Sbjct  211  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVQE  266

Query  642  GS-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            G                  S ++ +++L++  +NW AV+ AFE+INKPSR EFG+MV YY
Sbjct  267  GEEDAKMSNKSSWHQEREGSRKSLQRILDTNGDNWQAVISAFEKINKPSRTEFGLMVKYY  326

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDMEEAL+CVRKM +EGIE+S+
Sbjct  327  GRRGDLHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMEEALSCVRKMKEEGIEMSL  386

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K GN EAA+HWF EAK  H TL+ASIYG IIYA+CQ CNM+RAEEL+RE
Sbjct  387  VTYSVIVGGFSKSGNAEAADHWFDEAKRIHKTLNASIYGKIIYAHCQACNMERAEELVRE  446

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  447  MEEEGIDAPIAIYHTMMDGYTMIADEKKGLIVFKRLKECGFTPTVVTYGCL  497


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ + + GD  R+ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  592  HRPTTRTFMPIIHGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  651

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  652  DILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRFQNEGLEVDIFTYEALLKAC  711

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  712  CKSGRMQSALAVTKEMSARNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKDGVKPDI  771

Query  18   ISY  10
             +Y
Sbjct  772  HTY  774


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 81/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G ++N Y + G   +A E+   M+  GI      Y+ +   +   +D   A   
Sbjct  489  PTVVTYGCLINLYTKVGKITKALEVSRTMKEEGIKHNLKTYSMMINGFVKLKDWANAFAV  548

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M +EG++  V+ Y+ I+  F  +GN++ A     E ++     +   +  II+   +
Sbjct  549  FEDMVNEGMKPDVILYNNIIAAFCGMGNMDRAIQTVKEMQKLRHRPTTRTFMPIIHGFAK  608

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +M R+ E+   M   G    +  F+ +++G    R  EK + + D +   G + +  +
Sbjct  609  SGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAVDILDEMTLAGVSANEHT  668

Query  12   Y  10
            Y
Sbjct  669  Y  669


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +M+ A+ 
Sbjct  523  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVNEGMKPDVILYNNIIAAFCGMGNMDRAIQ  582

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ GFAK G++  +   F   +      +   +  +I    
Sbjct  583  TVKEMQKLRHRPTTRTFMPIIHGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLV  642

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A ++L EM   G++A    +  +M GY    +  K    F R +  G    + 
Sbjct  643  EKRQMEKAVDILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRFQNEGLEVDIF  702

Query  15   SYGCL  1
            +Y  L
Sbjct  703  TYEAL  707


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  739  YNILIDGWARRGDVWEAADLIQQMKKDGVKPDIHTYTSFISACSKAGDMNRATKTMEEMA  798

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G++ ++ TY+ ++ G+A+    E A + + E K        ++Y
Sbjct  799  ALGVKPNIKTYTTLIKGWARASLPEKALNCYEEMKAMGLKPDKAVY  844



>ref|XP_010909108.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=905

 Score =   366 bits (939),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 228/288 (79%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN+G+ FVIYGG + E+SA +AV+FDG+EFHGR+LTV+LDDGRR +K + + R RW+ G
Sbjct  168  ERNVGYCFVIYGGPTVEESAARAVEFDGMEFHGRILTVRLDDGRR-LKARSEERARWVAG  226

Query  639  SSSRNFR---------------KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            S  R FR               KVLE+QPENW AVV AFER+ KPSR+E+G+MVNYY RR
Sbjct  227  SDQREFRSKWHEERDNACRIFRKVLETQPENWQAVVSAFERLQKPSRREYGLMVNYYARR  286

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GDKH AR  FE MR+RG+ P+SY YTNL +AY V+RDM+ AL C+ +M  EGIE+++VTY
Sbjct  287  GDKHHARATFESMRARGVEPSSYVYTNLVHAYAVARDMQGALACIEEMKSEGIELTLVTY  346

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI++GGFA VG+ ++A+  F EAK++  +++A IY NIIYA+CQT NM RAE+L+REMEE
Sbjct  347  SILIGGFANVGDAKSADRLFKEAKQKITSMNAIIYSNIIYAHCQTGNMARAEDLVREMEE  406

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EGI API ++HTMMDGYT  RNEEKCL++F+RLKECGFTPSVISYGCL
Sbjct  407  EGIDAPIDLYHTMMDGYTNIRNEEKCLIVFERLKECGFTPSVISYGCL  454


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 89/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++PS + F  ++  +    D  RA E+F+ MR  G VPT   Y  L         ME+A+
Sbjct  549  HRPSARTFRPIIYGFAAARDMKRALEIFDLMRQSGCVPTVETYNVLILGLVRKHQMEKAI  608

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + KM+  GI  +  TY+ ++ G+A  G+   A  +F + KE+   L    Y  ++ A 
Sbjct  609  EVIDKMSLAGITPNEHTYTTVMQGYAADGDTGKAFEYFTKIKEKGLKLDVFTYEALLKAC  668

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + REM  + I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  669  CKSGRMQSALAVTREMSAQKIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQDGVLPDI  728

Query  18   ISY  10
             +Y
Sbjct  729  HTY  731


 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 90/192 (47%), Gaps = 6/192 (3%)
 Frame = -2

Query  570  FERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+ +    PS   +G ++N Y + G   +A E+ + M S GI   S  Y+ L   +  
Sbjct  436  FERLKECGFTPSVISYGCLINLYTKIGKVSKALEVGKMMNSYGIRHNSKTYSMLINGFIQ  495

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE-AKERHATLSAS  226
              D   A +   +M   G++   + Y+II+  F K+GN++ A     +  KERH   SA 
Sbjct  496  LNDYANAFSIFEEMLQSGLKPDAILYNIIINAFCKMGNIDRAIRLVDKMQKERHRP-SAR  554

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             +  IIY      +M RA E+   M + G    +  ++ ++ G       EK + + D++
Sbjct  555  TFRPIIYGFAAARDMKRALEIFDLMRQSGCVPTVETYNVLILGLVRKHQMEKAIEVIDKM  614

Query  45   KECGFTPSVISY  10
               G TP+  +Y
Sbjct  615  SLAGITPNEHTY  626


 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 92/189 (49%), Gaps = 1/189 (1%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E I+ P      MM  Y   R ++ +   +FE+++  G  P+   Y  L   YT    + 
Sbjct  407  EGIDAPIDLYHTMMDGYTNIRNEE-KCLIVFERLKECGFTPSVISYGCLINLYTKIGKVS  465

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +AL   + MN  GI  +  TYS+++ GF ++ +   A   F E  +      A +Y  II
Sbjct  466  KALEVGKMMNSYGIRHNSKTYSMLINGFIQLNDYANAFSIFEEMLQSGLKPDAILYNIII  525

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
             A C+  N+DRA  L+ +M++E        F  ++ G+   R+ ++ L +FD +++ G  
Sbjct  526  NAFCKMGNIDRAIRLVDKMQKERHRPSARTFRPIIYGFAAARDMKRALEIFDLMRQSGCV  585

Query  27   PSVISYGCL  1
            P+V +Y  L
Sbjct  586  PTVETYNVL  594


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 81/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  543  KEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRK  364
            K + M++N + +  D   A  +FE+M   G+ P +  Y  +  A+    +++ A+  V K
Sbjct  484  KTYSMLINGFIQLNDYANAFSIFEEMLQSGLKPDAILYNIIINAFCKMGNIDRAIRLVDK  543

Query  363  MNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCN  184
            M  E    S  T+  I+ GFA   +++ A   F   ++     +   Y  +I    +   
Sbjct  544  MQKERHRPSARTFRPIIYGFAAARDMKRALEIFDLMRQSGCVPTVETYNVLILGLVRKHQ  603

Query  183  MDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGC  4
            M++A E++ +M   GI      + T+M GY    +  K    F ++KE G    V +Y  
Sbjct  604  MEKAIEVIDKMSLAGITPNEHTYTTVMQGYAADGDTGKAFEYFTKIKEKGLKLDVFTYEA  663

Query  3    L  1
            L
Sbjct  664  L  664


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/179 (22%), Positives = 80/179 (45%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++  +   GD   A  +F++ + +     +  Y+N+ YA+  + +M  A   VR+M 
Sbjct  346  YSILIGGFANVGDAKSADRLFKEAKQKITSMNAIIYSNIIYAHCQTGNMARAEDLVREME  405

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  + N E     F   KE   T S   YG +I    +   + 
Sbjct  406  EEGIDAPIDLYHTMMDGYTNIRNEEKCLIVFERLKECGFTPSVISYGCLINLYTKIGKVS  465

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +A E+ + M   GI      +  +++G+    +      +F+ + + G  P  I Y  +
Sbjct  466  KALEVGKMMNSYGIRHNSKTYSMLINGFIQLNDYANAFSIFEEMLQSGLKPDAILYNII  524


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G++P  + YT+   A   + DM+ A   V +M 
Sbjct  696  YNILIDGWARRGDVWEAADLMQQMKQDGVLPDIHTYTSFINACCKAGDMQRATKMVEEME  755

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ +V TY+ ++ G+A+    E A   F E K
Sbjct  756  AAGVKPNVKTYTTLIRGWAQASLPEKALRCFEEMK  790



>ref|XP_010452382.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Camelina sativa]
Length=950

 Score =   367 bits (941),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 183/291 (63%), Positives = 232/291 (80%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWM-E  643
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW+ E
Sbjct  203  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVQE  258

Query  642  GS-----------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            G                  S ++ +++L++  +NW AV+ AFE+INKPSR EFG+MV +Y
Sbjct  259  GEEDAKMSNKSSWHQDREGSRKSLQRILDTNGDNWQAVISAFEKINKPSRTEFGLMVKFY  318

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDM+EA++CVRKM +EGIE+S+
Sbjct  319  GRRGDMHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMDEAVSCVRKMKEEGIEMSL  378

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K GN EAA+HWF EAK  H TL+ASIYG IIYA+CQTCNM+RAEEL+RE
Sbjct  379  VTYSVIVGGFSKAGNAEAADHWFDEAKRIHKTLNASIYGKIIYAHCQTCNMERAEELVRE  438

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  439  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLIVFKRLKECGFTPTVVTYGCL  489


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  ++N + + GD  R+ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  584  HRPTTRTFMPIINGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  643

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  644  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIFTYEALLKAC  703

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  704  CKSGRMQSALAVTKEMSSRNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKEGVKPDI  763

Query  18   ISY  10
             +Y
Sbjct  764  HTY  766


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +M+ A+ 
Sbjct  515  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVNEGMKPDVILYNNIIAAFCGMGNMDRAIQ  574

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ GFAK G++  +   F   +      +   +  +I    
Sbjct  575  TVKEMQKLRHRPTTRTFMPIINGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLV  634

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  635  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIF  694

Query  15   SYGCL  1
            +Y  L
Sbjct  695  TYEAL  699


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 80/181 (44%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G ++N Y + G   +A E+   M+  GI      Y+ +   +   +D   A   
Sbjct  481  PTVVTYGCLINLYTKVGKITKALEVSRTMKEEGIKHNLKTYSMMINGFVKLKDWANAFAV  540

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M +EG++  V+ Y+ I+  F  +GN++ A     E ++     +   +  II    +
Sbjct  541  FEDMVNEGMKPDVILYNNIIAAFCGMGNMDRAIQTVKEMQKLRHRPTTRTFMPIINGFAK  600

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +M R+ E+   M   G    +  F+ +++G    R  EK + + D +   G + +  +
Sbjct  601  SGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAVEILDEMTLAGVSANEHT  660

Query  12   Y  10
            Y
Sbjct  661  Y  661


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  731  YNILIDGWARRGDVWEAADLIQQMKKEGVKPDIHTYTSFISACSKAGDMNRATKTIEEMA  790

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G+  ++ TY+ ++ G+A+    E A + + E K        ++Y
Sbjct  791  ALGVRPNIKTYTTLIKGWARASLPEKALNCYEEMKAMGLKPDKAVY  836



>ref|XP_010423534.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010423535.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X2 [Camelina sativa]
 ref|XP_010423536.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X3 [Camelina sativa]
Length=948

 Score =   367 bits (941),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 230/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW+E 
Sbjct  201  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVEE  256

Query  639  S------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S ++ +++L++  +NW AV+ AFE+INKPSR EFG+MV +Y
Sbjct  257  GEEDAKMSNKSSWHQDREGSRKSLQRILDTNGDNWQAVISAFEKINKPSRTEFGLMVKFY  316

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDMEEA++CVRKM +EGIE+S+
Sbjct  317  GRRGDMHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMEEAVSCVRKMKEEGIEMSL  376

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K GN EAA+HWF EA   H TL+ASIYG IIYA+CQTCNM+RAEEL+RE
Sbjct  377  VTYSVIVGGFSKAGNAEAADHWFDEANRIHKTLNASIYGKIIYAHCQTCNMERAEELVRE  436

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  437  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLIVFKRLKECGFTPTVVTYGCL  487


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  ++N + + GD  R+ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  582  HRPTTRTFMPIINGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAV  641

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  642  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIFTYEALLKAC  701

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  702  CKSGRMQSALAVTKEMSARNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKEGVKPDI  761

Query  18   ISY  10
             +Y
Sbjct  762  HTY  764


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +M+ A+ 
Sbjct  513  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVNEGMKPDVILYNNIIAAFCGMGNMDRAIQ  572

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ GFAK G++  +   F   +      +   +  +I    
Sbjct  573  TVKEMQKLRHRPTTRTFMPIINGFAKSGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLV  632

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  633  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLEVDIF  692

Query  15   SYGCL  1
            +Y  L
Sbjct  693  TYEAL  697


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 80/181 (44%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G ++N Y + G   +A E+   M+  GI      Y+ +   +   +D   A   
Sbjct  479  PTVVTYGCLINLYTKVGKITKALEVSRTMKEEGIKHNLKTYSMMINGFVKLKDWANAFAV  538

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M +EG++  V+ Y+ I+  F  +GN++ A     E ++     +   +  II    +
Sbjct  539  FEDMVNEGMKPDVILYNNIIAAFCGMGNMDRAIQTVKEMQKLRHRPTTRTFMPIINGFAK  598

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +M R+ E+   M   G    +  F+ +++G    R  EK + + D +   G + +  +
Sbjct  599  SGDMRRSLEVFDMMRRCGCVPTVHTFNALINGLVEKRQMEKAVEILDEMTLAGVSANEHT  658

Query  12   Y  10
            Y
Sbjct  659  Y  659


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   +  M 
Sbjct  729  YNILIDGWARRGDVWEAADLIQQMKKEGVKPDIHTYTSFISACSKAGDMNRATKTIEDMA  788

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G+  ++ TY+ ++ G+A+    E A + + E K        ++Y
Sbjct  789  ALGVRPNIKTYTTLIKGWARASLPEKALNCYEEMKAMGLKPDKAVY  834



>gb|KHN12616.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=731

 Score =   360 bits (924),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/270 (64%), Positives = 219/270 (81%), Gaps = 18/270 (7%)
 Frame = -2

Query  759  IKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEGS-----------------SS  631
            ++AV+FDGVEFHGRVLTVKLDDG++ M+++ + R RW++G+                 S 
Sbjct  1    MRAVEFDGVEFHGRVLTVKLDDGKK-MRERSEERARWLQGNGGDKGEYPSTRHKERDGSR  59

Query  630  RNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGI  451
            ++F+KVLE+QPENW AVV AFERI KP+RKE+G+MV YY RRGD H AR+ FE M++RGI
Sbjct  60   KSFQKVLETQPENWQAVVTAFERIKKPARKEYGLMVKYYARRGDMHHARQTFESMQARGI  119

Query  450  VPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEH  271
             P+S+ Y++L +AY V RDMEEAL CVRKM +EGIE+++VTYSIIVGGFAK+G  +AA+H
Sbjct  120  EPSSHVYSSLIHAYAVGRDMEEALHCVRKMKEEGIEMTIVTYSIIVGGFAKMGKADAADH  179

Query  270  WFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYT  91
            WF EAKE+  +L+A  YG+IIYA+CQTCNMDRAE L+REME +GI API I+HTMMDGYT
Sbjct  180  WFKEAKEKLPSLNAVTYGSIIYAHCQTCNMDRAEALVREMEVQGIDAPIDIYHTMMDGYT  239

Query  90   ITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +  NEEKCL++FDRLKECGF+PSVISYGCL
Sbjct  240  MIGNEEKCLIVFDRLKECGFSPSVISYGCL  269


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/182 (23%), Positives = 91/182 (50%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + F  +++ + R G+  RA E+F+ MR  G +PT + Y  L       R M +A+ 
Sbjct  365  RPTTRTFLPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTYNALILGLVEKRKMAKAVA  424

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +MN  G+  +  TY+ ++ G+A +G+ E A  +F   +     +    Y  ++ + C
Sbjct  425  ILDEMNVAGVGPNEHTYTTLMQGYASLGDTEKAFQYFSVLRNEGLEIDVYTYEALLKSCC  484

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + +EM  + I     +++ ++DG+    +  +   +  ++++ G  P + 
Sbjct  485  KSGRMQSALAVTKEMSAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGVLPDIH  544

Query  15   SY  10
            +Y
Sbjct  545  TY  546


 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++  Y   GD  +A + F  +R+ G+    Y Y  L  +   S  M+ AL  
Sbjct  436  PNEHTYTTLMQGYASLGDTEKAFQYFSVLRNEGLEIDVYTYEALLKSCCKSGRMQSALAV  495

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C+
Sbjct  496  TKEMSAKNIPRNTFVYNILIDGWARRGDVWEAADLMQQMRKEGVLPDIHTYTSFVNACCK  555

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M +A E+++EME  GI   +  + T+++G+      EK L  F+ +K     P   +
Sbjct  556  AGDMQKATEIIQEMEAFGIKPNLKTYTTLINGWARASMPEKALSCFEEMKLAELKPDKAA  615

Query  12   YGCL  1
            Y CL
Sbjct  616  YHCL  619


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 78/185 (42%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE     G+ P    Y N+  A+    +M+ A+ 
Sbjct  295  KHNMKTYSMLINGFLKLKDWANAFSVFEDFTKDGLKPDVVLYNNIITAFCGMSNMDRAIC  354

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G +  A   F   +      +   Y  +I    
Sbjct  355  MVKQMQKERYRPTTRTFLPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTYNALILGLV  414

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M +A  +L EM   G+      + T+M GY    + EK    F  L+  G    V 
Sbjct  415  EKRKMAKAVAILDEMNVAGVGPNEHTYTTLMQGYASLGDTEKAFQYFSVLRNEGLEIDVY  474

Query  15   SYGCL  1
            +Y  L
Sbjct  475  TYEAL  479



>ref|XP_008809839.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g04810, chloroplastic [Phoenix dactylifera]
Length=901

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 228/288 (79%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN+G+ FVIYGG + E+SA +AV+FDG+EFHGR+LTV+LDDGRR ++ + + R RW+ G
Sbjct  164  ERNVGYCFVIYGGPTAEESAARAVEFDGMEFHGRILTVRLDDGRR-LRARSEERARWLAG  222

Query  639  SSSRNFR---------------KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            S  R FR               KVLE+QPENW AVV AFERI KPSR+E+G+MVNYY RR
Sbjct  223  SDQREFRSKWHEERDSACRRFRKVLETQPENWQAVVSAFERIQKPSRREYGLMVNYYARR  282

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GDKH AR  FE MR+RGI P+SY +TNL +AY V+RDM+ AL C+ +M  EGIE+++VTY
Sbjct  283  GDKHHARATFENMRARGIEPSSYVFTNLVHAYAVARDMQGALACIEEMKSEGIELTLVTY  342

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI++GGFA VG+ ++A+  F EAK++  +++A IY NIIYA+CQT NM RAE+L+REMEE
Sbjct  343  SILIGGFANVGDSKSADKLFKEAKQKITSMNAIIYSNIIYAHCQTGNMARAEDLVREMEE  402

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EGI API ++HTMMDGYT  RN+EKCL++FDRLKECGF+PSVISYGCL
Sbjct  403  EGIDAPIDLYHTMMDGYTNIRNDEKCLIVFDRLKECGFSPSVISYGCL  450


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 94/199 (47%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  +++ K    PS + F  ++  +   GD  RA E+F+ MR  G VPT   Y 
Sbjct  529  NIDRAIRLLDKMQKERHRPSARTFRPIIYGFAAAGDMKRALEIFDLMRQSGCVPTVETYN  588

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L         ME+A+  + KM+  GI  +  TY+ I+ G+A  G+   A  +F + K +
Sbjct  589  VLILGLVRKHQMEKAIEVIDKMSLAGIPPNEHTYTTIMQGYAADGDTGKAFEYFTKIKVK  648

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + REM  + I     +++ ++DG+    +  + 
Sbjct  649  GLKLDVFTYEALLKACCKSGRMQSALAVTREMSAQKIPRNTFVYNILIDGWARRGDVWEA  708

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++K+ G  P + +Y
Sbjct  709  ADLMQQMKQDGVLPDIHTY  727


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 88/192 (46%), Gaps = 6/192 (3%)
 Frame = -2

Query  570  FERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            F+R+ +    PS   +G ++N Y + G   +A E+ + M S GI   S  Y+ L   +  
Sbjct  432  FDRLKECGFSPSVISYGCLINLYTKIGKVSKALEVGKMMNSYGIRHNSKTYSMLINGFIQ  491

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE-AKERHATLSAS  226
              D     +   +M   G++   + Y+II+  F K+GN++ A     +  KERH   SA 
Sbjct  492  LNDYANGFSIFEEMLQSGLKPDAILYNIIINAFCKMGNIDRAIRLLDKMQKERHRP-SAR  550

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             +  IIY      +M RA E+   M + G    +  ++ ++ G       EK + + D++
Sbjct  551  TFRPIIYGFAAAGDMKRALEIFDLMRQSGCVPTVETYNVLILGLVRKHQMEKAIEVIDKM  610

Query  45   KECGFTPSVISY  10
               G  P+  +Y
Sbjct  611  SLAGIPPNEHTY  622


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 90/189 (48%), Gaps = 1/189 (1%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E I+ P      MM  Y   R D+ +   +F++++  G  P+   Y  L   YT    + 
Sbjct  403  EGIDAPIDLYHTMMDGYTNIRNDE-KCLIVFDRLKECGFSPSVISYGCLINLYTKIGKVS  461

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +AL   + MN  GI  +  TYS+++ GF ++ +       F E  +      A +Y  II
Sbjct  462  KALEVGKMMNSYGIRHNSKTYSMLINGFIQLNDYANGFSIFEEMLQSGLKPDAILYNIII  521

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
             A C+  N+DRA  LL +M++E        F  ++ G+    + ++ L +FD +++ G  
Sbjct  522  NAFCKMGNIDRAIRLLDKMQKERHRPSARTFRPIIYGFAAAGDMKRALEIFDLMRQSGCV  581

Query  27   PSVISYGCL  1
            P+V +Y  L
Sbjct  582  PTVETYNVL  590


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 81/179 (45%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++  +   GD   A ++F++ + +     +  Y+N+ YA+  + +M  A   VR+M 
Sbjct  342  YSILIGGFANVGDSKSADKLFKEAKQKITSMNAIIYSNIIYAHCQTGNMARAEDLVREME  401

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  + N E     F   KE   + S   YG +I    +   + 
Sbjct  402  EEGIDAPIDLYHTMMDGYTNIRNDEKCLIVFDRLKECGFSPSVISYGCLINLYTKIGKVS  461

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +A E+ + M   GI      +  +++G+    +      +F+ + + G  P  I Y  +
Sbjct  462  KALEVGKMMNSYGIRHNSKTYSMLINGFIQLNDYANGFSIFEEMLQSGLKPDAILYNII  520


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G++P  + YT+   A   + DM+ A   V +M 
Sbjct  692  YNILIDGWARRGDVWEAADLMQQMKQDGVLPDIHTYTSFINACCKAGDMQRATKMVEEME  751

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ +V TY+ ++ G+A+    E A   F E K
Sbjct  752  AAGVKPNVKTYTTLIRGWAQASLPEKALRCFGEMK  786



>gb|KFK24918.1| hypothetical protein AALP_AA8G042000 [Arabis alpina]
Length=938

 Score =   364 bits (934),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 181/292 (62%), Positives = 234/292 (80%), Gaps = 23/292 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGFV+Y   + EKSAIKAV+FDGVEFHGRVLTVKLDDG+R +K K + R RW++ 
Sbjct  190  EKNKGFGFVMY---TEEKSAIKAVEFDGVEFHGRVLTVKLDDGKR-LKTKAEQRVRWVQD  245

Query  639  -------------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNY  517
                                S  + ++++++  +NW  VV AFE+INKPSRKEFG+MV +
Sbjct  246  GGEEDVKMLNKSSWHQEREESRMSLQRIIDTNEDNWQVVVSAFEKINKPSRKEFGLMVKF  305

Query  516  YGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEIS  337
            YG+RGD HRAREMFE+MR+RGI PT++ YT+L +AY V +D+EEAL+CVRKM +EGIE+S
Sbjct  306  YGKRGDMHRAREMFERMRARGITPTTHVYTSLIHAYAVGKDIEEALSCVRKMKEEGIEMS  365

Query  336  VVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellr  157
            +VTYS+IV GF+KVGN EAA+HWF EAK ++ TL+ASIYG IIYA+CQT NM+RAEEL+R
Sbjct  366  LVTYSVIVDGFSKVGNAEAADHWFDEAKRKYKTLNASIYGKIIYAHCQTRNMERAEELVR  425

Query  156  emeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EMEEEGI API+I+HTMMDGYT+ R+E+K L++F RLKECGFTP+V++YGCL
Sbjct  426  EMEEEGIDAPIAIYHTMMDGYTMVRDEKKGLIVFKRLKECGFTPTVVTYGCL  477


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 91/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ +G+ GD  R+ E+F+ MR  G +PT + +  L       R ME+A+
Sbjct  572  HRPTTRTFMPIIDGFGKSGDMRRSLEVFDMMRRCGCIPTVHTFNALINGLVEKRQMEKAV  631

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  632  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRHQNEGLEVDVFTYEALLKAC  691

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  692  CKSGRMQSALAVTKEMSTRNIPRNSYVYNILIDGWARRGDVWEAADLMQQMKKEGVKPDI  751

Query  18   ISY  10
             +Y
Sbjct  752  HTY  754


 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 80/172 (47%), Gaps = 0/172 (0%)
 Frame = -2

Query  516  YGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEIS  337
            Y   GD  +A E F + ++ G+    + Y  L  A   S  M+ AL   ++M+   I  +
Sbjct  656  YASVGDTGKAFEYFTRHQNEGLEVDVFTYEALLKACCKSGRMQSALAVTKEMSTRNIPRN  715

Query  336  VVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellr  157
               Y+I++ G+A+ G+V  A     + K+         Y + I A  +  +M+RA + + 
Sbjct  716  SYVYNILIDGWARRGDVWEAADLMQQMKKEGVKPDIHTYTSFISACSKAGDMNRATKTIE  775

Query  156  emeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EME  G+   I  + T++ G+      EK L  ++ +KE G  P    Y CL
Sbjct  776  EMEALGVKPNIKTYTTLIKGWARASLPEKALKCYEEMKEMGLKPDKAVYHCL  827


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  719  YNILIDGWARRGDVWEAADLMQQMKKEGVKPDIHTYTSFISACSKAGDMNRATKTIEEME  778

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G++ ++ TY+ ++ G+A+    E A   + E KE       ++Y  ++ +     +M 
Sbjct  779  ALGVKPNIKTYTTLIKGWARASLPEKALKCYEEMKEMGLKPDKAVYHCLMTSLLSRASMA  838

Query  177  RA  172
             A
Sbjct  839  EA  840


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M + G+ P    Y N+  A+    +M+ A+ 
Sbjct  503  KHNLKTYSMMINGFVKLKDYANAFAVFEDMVNDGLKPDVILYNNIITAFCGMGNMDRAIQ  562

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ GF K G++  +   F   +      +   +  +I    
Sbjct  563  TVKEMQKLRHRPTTRTFMPIIDGFGKSGDMRRSLEVFDMMRRCGCIPTVHTFNALINGLV  622

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F R +  G    V 
Sbjct  623  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRHQNEGLEVDVF  682

Query  15   SYGCL  1
            +Y  L
Sbjct  683  TYEAL  687



>emb|CAB86023.1| putative protein [Arabidopsis thaliana]
Length=880

 Score =   362 bits (930),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 230/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW+E 
Sbjct  204  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVEE  259

Query  639  S------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S ++ +++L++  +NW AV+ AFE+I+KPSR EFG+MV +Y
Sbjct  260  GEEDTKMSNKSSWHQEREGSRKSLQRILDTNGDNWQAVISAFEKISKPSRTEFGLMVKFY  319

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDM+EAL+CVRKM +EGIE+S+
Sbjct  320  GRRGDMHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMDEALSCVRKMKEEGIEMSL  379

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K G+ EAA++WF EAK  H TL+ASIYG IIYA+CQTCNM+RAE L+RE
Sbjct  380  VTYSVIVGGFSKAGHAEAADYWFDEAKRIHKTLNASIYGKIIYAHCQTCNMERAEALVRE  439

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  440  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLVVFKRLKECGFTPTVVTYGCL  490


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 88/183 (48%), Gaps = 3/183 (2%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ Y + GD  R+ E+F+ MR  G VPT + +  L       R   +A+
Sbjct  585  HRPTTRTFMPIIHGYAKSGDMRRSLEVFDMMRRCGCVPTVHTFNGLINGLVEKR---QAV  641

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  642  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLDVDIFTYEALLKAC  701

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  702  CKSGRMQSALAVTKEMSARNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKEGVKPDI  761

Query  18   ISY  10
             +Y
Sbjct  762  HTY  764


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  729  YNILIDGWARRGDVWEAADLIQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIEEME  788

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G++ ++ TY+ ++ G+A+    E A   + E K        ++Y
Sbjct  789  ALGVKPNIKTYTTLIKGWARASLPEKALSCYEEMKAMGIKPDKAVY  834



>ref|NP_568141.2| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
 sp|Q0WMY5.1|PP365_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic; AltName: Full=Maize PPR4 homolog; Short=AtPPR4; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF01515.1| membrane-associated salt-inducible protein-like [Arabidopsis 
thaliana]
 gb|AED90789.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
Length=952

 Score =   362 bits (930),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 230/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW+E 
Sbjct  204  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVEE  259

Query  639  S------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S ++ +++L++  +NW AV+ AFE+I+KPSR EFG+MV +Y
Sbjct  260  GEEDTKMSNKSSWHQEREGSRKSLQRILDTNGDNWQAVISAFEKISKPSRTEFGLMVKFY  319

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDM+EAL+CVRKM +EGIE+S+
Sbjct  320  GRRGDMHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMDEALSCVRKMKEEGIEMSL  379

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K G+ EAA++WF EAK  H TL+ASIYG IIYA+CQTCNM+RAE L+RE
Sbjct  380  VTYSVIVGGFSKAGHAEAADYWFDEAKRIHKTLNASIYGKIIYAHCQTCNMERAEALVRE  439

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  440  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLVVFKRLKECGFTPTVVTYGCL  490


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ Y + GD  R+ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  585  HRPTTRTFMPIIHGYAKSGDMRRSLEVFDMMRRCGCVPTVHTFNGLINGLVEKRQMEKAV  644

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  645  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLDVDIFTYEALLKAC  704

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  705  CKSGRMQSALAVTKEMSARNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKEGVKPDI  764

Query  18   ISY  10
             +Y
Sbjct  765  HTY  767


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 80/181 (44%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G ++N Y + G   +A E+   M+  G+      Y+ +   +   +D   A   
Sbjct  482  PTVVTYGCLINLYTKVGKISKALEVSRVMKEEGVKHNLKTYSMMINGFVKLKDWANAFAV  541

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M  EG++  V+ Y+ I+  F  +GN++ A     E ++     +   +  II+   +
Sbjct  542  FEDMVKEGMKPDVILYNNIISAFCGMGNMDRAIQTVKEMQKLRHRPTTRTFMPIIHGYAK  601

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +M R+ E+   M   G    +  F+ +++G    R  EK + + D +   G + +  +
Sbjct  602  SGDMRRSLEVFDMMRRCGCVPTVHTFNGLINGLVEKRQMEKAVEILDEMTLAGVSANEHT  661

Query  12   Y  10
            Y
Sbjct  662  Y  662


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M   G+ P    Y N+  A+    +M+ A+ 
Sbjct  516  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVKEGMKPDVILYNNIISAFCGMGNMDRAIQ  575

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ G+AK G++  +   F   +      +   +  +I    
Sbjct  576  TVKEMQKLRHRPTTRTFMPIIHGYAKSGDMRRSLEVFDMMRRCGCVPTVHTFNGLINGLV  635

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  636  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLDVDIF  695

Query  15   SYGCL  1
            +Y  L
Sbjct  696  TYEAL  700


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  732  YNILIDGWARRGDVWEAADLIQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIEEME  791

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ ++ TY+ ++ G+A+    E A   + E K
Sbjct  792  ALGVKPNIKTYTTLIKGWARASLPEKALSCYEEMK  826



>dbj|BAB08985.1| membrane-associated salt-inducible protein-like [Arabidopsis 
thaliana]
Length=949

 Score =   362 bits (930),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 230/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW+E 
Sbjct  204  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVEE  259

Query  639  S------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S ++ +++L++  +NW AV+ AFE+I+KPSR EFG+MV +Y
Sbjct  260  GEEDTKMSNKSSWHQEREGSRKSLQRILDTNGDNWQAVISAFEKISKPSRTEFGLMVKFY  319

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDM+EAL+CVRKM +EGIE+S+
Sbjct  320  GRRGDMHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMDEALSCVRKMKEEGIEMSL  379

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K G+ EAA++WF EAK  H TL+ASIYG IIYA+CQTCNM+RAE L+RE
Sbjct  380  VTYSVIVGGFSKAGHAEAADYWFDEAKRIHKTLNASIYGKIIYAHCQTCNMERAEALVRE  439

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  440  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLVVFKRLKECGFTPTVVTYGCL  490


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 88/183 (48%), Gaps = 3/183 (2%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ Y + GD  R+ E+F+ MR  G VPT + +  L       R   +A+
Sbjct  585  HRPTTRTFMPIIHGYAKSGDMRRSLEVFDMMRRCGCVPTVHTFNGLINGLVEKR---QAV  641

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  642  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLDVDIFTYEALLKAC  701

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  702  CKSGRMQSALAVTKEMSARNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKEGVKPDI  761

Query  18   ISY  10
             +Y
Sbjct  762  HTY  764


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  729  YNILIDGWARRGDVWEAADLIQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIEEME  788

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ ++ TY+ ++ G+A+    E A   + E K
Sbjct  789  ALGVKPNIKTYTTLIKGWARASLPEKALSCYEEMK  823



>gb|AAL11611.1|AF424618_1 AT5g04810/MUK11_13 [Arabidopsis thaliana]
Length=950

 Score =   362 bits (929),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 230/291 (79%), Gaps = 22/291 (8%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            ++N GFGF+IY     EKSA+KAV+FDGVEFHGR+LTVKLDDG+R +K K + R RW+E 
Sbjct  202  EKNAGFGFIIYAA---EKSAMKAVEFDGVEFHGRILTVKLDDGKR-LKTKAEQRVRWVEE  257

Query  639  S------------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
                               S ++ +++L++  +NW AV+ AFE+I+KPSR EFG+MV +Y
Sbjct  258  GEEDTKMSNKSSWHQEREGSRKSLQRILDTNGDNWQAVISAFEKISKPSRTEFGLMVKFY  317

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
            GRRGD HRARE FE+MR+RGI PTS  YT+L +AY V RDM+EAL+CVRKM +EGIE+S+
Sbjct  318  GRRGDMHRARETFERMRARGITPTSRIYTSLIHAYAVGRDMDEALSCVRKMKEEGIEMSL  377

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYS+IVGGF+K G+ EAA++WF EAK  H TL+ASIYG IIYA+CQTCNM+RAE L+RE
Sbjct  378  VTYSVIVGGFSKAGHAEAADYWFDEAKRIHKTLNASIYGKIIYAHCQTCNMERAEALVRE  437

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API+I+HTMMDGYT+  +E+K L++F RLKECGFTP+V++YGCL
Sbjct  438  MEEEGIDAPIAIYHTMMDGYTMVADEKKGLVVFKRLKECGFTPTVVTYGCL  488


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ Y + GD  R+ E+F+ MR  G VPT + +  L       R ME+A+
Sbjct  583  HRPTTRTFMPIIHGYAKSGDMRRSLEVFDMMRRCGCVPTVHTFNGLINGLVEKRQMEKAV  642

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A VG+   A  +F   +     +    Y  ++ A 
Sbjct  643  EILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLDVDIFTYEALLKAC  702

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM    I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  703  CKSGRMQSALAVTKEMSARNIPRNSFVYNILIDGWARRGDVWEAADLIQQMKKEGVKPDI  762

Query  18   ISY  10
             +Y
Sbjct  763  HTY  765


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 80/181 (44%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G ++N Y + G   +A E+   M+  G+      Y+ +   +   +D   A   
Sbjct  480  PTVVTYGCLINLYTKVGKISKALEVSRVMKEEGVKHNLKTYSMMINGFVKLKDWANAFAV  539

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M  EG++  V+ Y+ I+  F  +GN++ A     E ++     +   +  II+   +
Sbjct  540  FEDMVKEGMKPDVILYNNIISAFCGMGNMDRAIQTVKEMQKLRHRPTTRTFMPIIHGYAK  599

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +M R+ E+   M   G    +  F+ +++G    R  EK + + D +   G + +  +
Sbjct  600  SGDMRRSLEVFDMMRRCGCVPTVHTFNGLINGLVEKRQMEKAVEILDEMTLAGVSANEHT  659

Query  12   Y  10
            Y
Sbjct  660  Y  660


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + MM+N + +  D   A  +FE M   G+ P    Y N+  A+    +M+ A+ 
Sbjct  514  KHNLKTYSMMINGFVKLKDWANAFAVFEDMVKEGMKPDVILYNNIISAFCGMGNMDRAIQ  573

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M       +  T+  I+ G+AK G++  +   F   +      +   +  +I    
Sbjct  574  TVKEMQKLRHRPTTRTFMPIIHGYAKSGDMRRSLEVFDMMRRCGCVPTVHTFNGLINGLV  633

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++A    +  +M GY    +  K    F RL+  G    + 
Sbjct  634  EKRQMEKAVEILDEMTLAGVSANEHTYTKIMQGYASVGDTGKAFEYFTRLQNEGLDVDIF  693

Query  15   SYGCL  1
            +Y  L
Sbjct  694  TYEAL  698


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A + + DM  A   + +M 
Sbjct  730  YNILIDGWARRGDVWEAADLIQQMKKEGVKPDIHTYTSFISACSKAGDMNRATQTIEEME  789

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ ++ TY+ ++ G+A+    E A   + E K
Sbjct  790  ALGVKPNIKTYTTLIKGWARASLPEKALSCYEEMK  824



>emb|CBI25022.3| unnamed protein product [Vitis vinifera]
Length=927

 Score =   360 bits (925),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 216/286 (76%), Gaps = 37/286 (13%)
 Frame = -2

Query  816  RNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG-  640
            RN GFGF                      FHGRVLTVKLDDGRR ++ + + R RW++G 
Sbjct  187  RNAGFGF----------------------FHGRVLTVKLDDGRR-LRGRSEERARWVQGH  223

Query  639  -------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGD  499
                         SS ++FRKVLE++PENW AVV+AFERI KPSRKEFG+MV YY RRGD
Sbjct  224  GVDQRSKWHEERESSRKDFRKVLETEPENWQAVVQAFERIKKPSRKEFGLMVTYYARRGD  283

Query  498  KHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSI  319
             H AR  FE MR+RGI PTS+ YT+L +AY V RDMEEAL+CVRKM +EGIE+S+VTYSI
Sbjct  284  MHHARGTFESMRARGIEPTSHVYTSLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVTYSI  343

Query  318  IVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEG  139
            +VGGFAK+ + EAA+HWF EAKERH TL+A IYGNIIYA+CQ CNM +AE L+REMEEEG
Sbjct  344  LVGGFAKIADAEAADHWFKEAKERHTTLNAIIYGNIIYAHCQACNMTQAEALVREMEEEG  403

Query  138  IAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            I API I+HTMMDGYTI  NEEKCL++FDRLKECGFTPSVISYGCL
Sbjct  404  IDAPIDIYHTMMDGYTIIGNEEKCLIVFDRLKECGFTPSVISYGCL  449


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  616  PNEHTYTTIMHGYASLGDTGKAFEYFTKLKTEGLELDVYTYEALLKACCKSGRMQSALAV  675

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M+ + I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A C+
Sbjct  676  TREMSSQKIPRNTFVYNILIDGWARRGDVWEAAELMQQMKQEGVQPDIHTYTSFINACCK  735

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + ++EME  G+   I  + T++ G+      EK L  F  +K  G  P    
Sbjct  736  AGDMQRATKTIQEMEVVGVKPNIKTYTTLIHGWARASLPEKALKCFQEMKSAGLKPDKAV  795

Query  12   YGCL  1
            Y CL
Sbjct  796  YHCL  799


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 100/211 (47%), Gaps = 11/211 (5%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G+  R  R V E Q E            ++P+ + F  +++ + R GD  RA E+F+ MR
Sbjct  527  GNMDRAIRTVKEMQKER-----------HRPTTRTFMPIIHGFARSGDMRRALEIFDMMR  575

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G +PT + +  L         ME+A+  + +M+  GI  +  TY+ I+ G+A +G+  
Sbjct  576  WSGCIPTVHTFNALILGLVEKCQMEKAVEILDEMSLAGISPNEHTYTTIMHGYASLGDTG  635

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             A  +F + K     L    Y  ++ A C++  M  A  + REM  + I     +++ ++
Sbjct  636  KAFEYFTKLKTEGLELDVYTYEALLKACCKSGRMQSALAVTREMSSQKIPRNTFVYNILI  695

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            DG+    +  +   +  ++K+ G  P + +Y
Sbjct  696  DGWARRGDVWEAAELMQQMKQEGVQPDIHTY  726


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + R  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  475  KHNMKTYSMLINGFVRLKDWANAFAVFEDVVKDGLKPDVVLYNNIIRAFCGMGNMDRAIR  534

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G++  A   F   +      +   +  +I    
Sbjct  535  TVKEMQKERHRPTTRTFMPIIHGFARSGDMRRALEIFDMMRWSGCIPTVHTFNALILGLV  594

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            + C M++A E+L EM   GI+     + T+M GY    +  K    F +LK  G    V 
Sbjct  595  EKCQMEKAVEILDEMSLAGISPNEHTYTTIMHGYASLGDTGKAFEYFTKLKTEGLELDVY  654

Query  15   SYGCL  1
            +Y  L
Sbjct  655  TYEAL  659


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/176 (24%), Positives = 83/176 (47%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++V  + +  D   A   F++ + R     +  Y N+ YA+  + +M +A   VR+M 
Sbjct  341  YSILVGGFAKIADAEAADHWFKEAKERHTTLNAIIYGNIIYAHCQACNMTQAEALVREME  400

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EGI+  +  Y  ++ G+  +GN E     F   KE   T S   YG +I    +   + 
Sbjct  401  EEGIDAPIDIYHTMMDGYTIIGNEEKCLIVFDRLKECGFTPSVISYGCLINLYIKIGKVS  460

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+ + ME  GI   +  +  +++G+   ++      +F+ + + G  P V+ Y
Sbjct  461  KALEVSKMMEVAGIKHNMKTYSMLINGFVRLKDWANAFAVFEDVVKDGLKPDVVLY  516



>ref|XP_011024162.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X1 [Populus euphratica]
Length=974

 Score =   360 bits (923),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 188/318 (59%), Positives = 228/318 (72%), Gaps = 44/318 (14%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIM------------  679
            T+RN GFGF+IY G    KSA+KA +FDG+EFHGRVLTVKLDDGRR+             
Sbjct  185  TERNAGFGFIIYDGPKAGKSAMKAEEFDGMEFHGRVLTVKLDDGRRLKAKAEERKNWVYG  244

Query  678  KDKKKGRTRWMEGS--SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            +D K  R +W E    S++ FRKVL++QPENW A V AFERI KPSR++FG+M  YY RR
Sbjct  245  EDGKDYRPKWHEEGEGSTKAFRKVLDTQPENWQAGVSAFERIKKPSRRDFGLMGGYYARR  304

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRAR+ FE MR+RG+ P+S+ YT+L +AY V RDME AL+CVRKMN+EGIE+S+VTY
Sbjct  305  GDMHRARQTFESMRARGMDPSSHVYTSLIHAYAVGRDMEGALSCVRKMNEEGIEMSLVTY  364

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYA--------------NC---  196
            SI++GGFAK+GN EAA+ WF +AKERH  L+A IYGNIIYA               C   
Sbjct  365  SIVIGGFAKIGNAEAADSWFKKAKERHTNLNAYIYGNIIYAYWAIVGEFVKSPTPKCNYW  424

Query  195  -------------QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMF  55
                         + CNMDRAE L+REMEEE I AP+ I+HTMMDGYT+ RNEEKCL++F
Sbjct  425  GPSLWGANFIKLLKACNMDRAEALVREMEEEDIDAPLDIYHTMMDGYTMIRNEEKCLIVF  484

Query  54   DRLKECGFTPSVISYGCL  1
            +RLKECGF PSVISYGCL
Sbjct  485  ERLKECGFAPSVISYGCL  502


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 89/182 (49%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   F  +++ + R G+  RA E+F+ MR  G +PT + +  L       R ME+A+ 
Sbjct  598  RPTSHTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLVEKRKMEKAVE  657

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M   G+     TY+ I+ G+A +G+   A  +F + +     L    Y  ++ A C
Sbjct  658  ILDEMALAGVSPDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDVFTYEALLKACC  717

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + REM  + I     +++ ++DG+    +  +   +  ++K+ G  P + 
Sbjct  718  KSGRMQSALAVTREMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIH  777

Query  15   SY  10
            +Y
Sbjct  778  TY  779


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/220 (27%), Positives = 102/220 (46%), Gaps = 4/220 (2%)
 Frame = -2

Query  651  WMEGSSSRNFRKVLES-QPENWHAVVRAFER--INKPSRKEFGMMVNYYGRRGDKHRARE  481
            W       NF K+L++   +   A+VR  E   I+ P      MM  Y   R ++ +   
Sbjct  424  WGPSLWGANFIKLLKACNMDRAEALVREMEEEDIDAPLDIYHTMMDGYTMIRNEE-KCLI  482

Query  480  MFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFA  301
            +FE+++  G  P+   Y  L   YT    + +AL   + M   GI+ ++ TYS+++ GF 
Sbjct  483  VFERLKECGFAPSVISYGCLINMYTKIGKVYKALEVSKMMKSVGIKHNMKTYSMLINGFL  542

Query  300  KVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPIS  121
            K+ +   A   F +  +        +Y NII A C   NMDRA  +++EM++E       
Sbjct  543  KLKDWTNAFAVFEDVIKDGLKPDVVLYNNIIKAFCGMGNMDRAIHMVKEMQKERCRPTSH  602

Query  120  IFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             F  ++ G+       + L +FD ++  G  P+V ++  L
Sbjct  603  TFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNAL  642


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  528  KHNMKTYSMLINGFLKLKDWTNAFAVFEDVIKDGLKPDVVLYNNIIKAFCGMGNMDRAIH  587

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+ GFA+ G +  A   F   +      +   +  ++    
Sbjct  588  MVKEMQKERCRPTSHTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLV  647

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++     + T+M GY    +  K    F +++  G    V 
Sbjct  648  EKRKMEKAVEILDEMALAGVSPDEHTYTTIMHGYAALGDTGKAFEYFTKMRNEGLQLDVF  707

Query  15   SYGCL  1
            +Y  L
Sbjct  708  TYEAL  712


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 1/112 (1%)
 Frame = -2

Query  585  AVVRAFERINKPSRK-EFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            AV R     N P     + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A 
Sbjct  727  AVTREMSAQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINAC  786

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              + DM  A   + +M   G++ +V TY+ ++ G+A     E A   F E K
Sbjct  787  CKAGDMLRATKTMEEMEAAGVKPNVKTYTTLIHGWANASLPEKALSCFEELK  838



>gb|KGN52179.1| hypothetical protein Csa_5G613570 [Cucumis sativus]
Length=943

 Score =   355 bits (911),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/288 (63%), Positives = 218/288 (76%), Gaps = 35/288 (12%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN G+GF+IY G + +KSAIKAV+FDGVEFHGRVLTVKLDDGRR +K+K   R RWMEG
Sbjct  206  ERNAGYGFIIYDGLTADKSAIKAVEFDGVEFHGRVLTVKLDDGRR-LKEKTDERARWMEG  264

Query  639  SSS--------------RN-FRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
              S              RN  RKV+E++PENW AVV AFERI KPSRKE+G+MVNYY RR
Sbjct  265  DDSVEYRSHWHEERDKARNGLRKVIETEPENWQAVVSAFERIKKPSRKEYGLMVNYYARR  324

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD HRARE FEKMR+RGI P+S+ YT                   +KM +EGIE+S+VTY
Sbjct  325  GDMHRARETFEKMRARGIEPSSHVYT-------------------KKMKEEGIEMSLVTY  365

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI+V GFAK GN E+A+HWF EAKE+H++L+A IYGNIIYA CQ CNMD+AE L+REMEE
Sbjct  366  SILVSGFAKTGNAESADHWFQEAKEKHSSLNAIIYGNIIYAYCQRCNMDKAEALVREMEE  425

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EGI API I+HTMMDGYT+  +E+KCLL+F+R KECG  PSVI+YGCL
Sbjct  426  EGIDAPIDIYHTMMDGYTMVGDEDKCLLVFERFKECGLNPSVITYGCL  473


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 92/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            +KP+ + F  +++ + R+G+  +A ++F+ MR  G +PT + Y  L       R ME+A 
Sbjct  568  HKPTTRTFMPIIHGFARKGEMKKALDVFDMMRMSGCIPTVHTYNALILGLVEKRKMEKAE  627

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A +G+   A  +F + ++    L    Y  ++ A 
Sbjct  628  QILDEMTLAGVSPNEHTYTTIMHGYASLGDTGKAFTYFTKLRDEGLQLDVYTYEALLKAC  687

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM  + I     I++ ++DG+    +  +   +  ++K  G  P +
Sbjct  688  CKSGRMQSALAVTKEMSAQNIPRNTFIYNILIDGWARRGDIWEAADLMQQMKREGVQPDI  747

Query  18   ISY  10
             +Y
Sbjct  748  HTY  750


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A   F K+R  G+    Y Y  L  A   S  M+ AL  
Sbjct  640  PNEHTYTTIMHGYASLGDTGKAFTYFTKLRDEGLQLDVYTYEALLKACCKSGRMQSALAV  699

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G++  A     + K          Y + I A  +
Sbjct  700  TKEMSAQNIPRNTFIYNILIDGWARRGDIWEAADLMQQMKREGVQPDIHTYTSFINACSK  759

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + + EM+  G+   +  + T+++G+      EK L  F+ +K  G  P    
Sbjct  760  AGDMQRATKTIEEMKSVGVKPNVKTYTTLINGWARASLPEKALSCFEEMKLSGLKPDRAV  819

Query  12   YGCL  1
            Y CL
Sbjct  820  YHCL  823


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 92/206 (45%), Gaps = 7/206 (3%)
 Frame = -2

Query  618  KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTS  439
            K LE   E  HA +       K + K + M++N + +  D   A  +FE +   GI P  
Sbjct  485  KALEVSKEMEHAGI-------KHNMKTYSMLINGFLKLKDWANAFAIFEDLIKDGIKPDV  537

Query  438  YEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE  259
              Y N+  A+     M+ A+  V++M  +  + +  T+  I+ GFA+ G ++ A   F  
Sbjct  538  VLYNNIITAFCGMGKMDRAVCTVKEMQKQRHKPTTRTFMPIIHGFARKGEMKKALDVFDM  597

Query  258  AKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRN  79
             +      +   Y  +I    +   M++AE++L EM   G++     + T+M GY    +
Sbjct  598  MRMSGCIPTVHTYNALILGLVEKRKMEKAEQILDEMTLAGVSPNEHTYTTIMHGYASLGD  657

Query  78   EEKCLLMFDRLKECGFTPSVISYGCL  1
              K    F +L++ G    V +Y  L
Sbjct  658  TGKAFTYFTKLRDEGLQLDVYTYEAL  683



>ref|XP_006854727.1| hypothetical protein AMTR_s00030p00239430 [Amborella trichopoda]
 gb|ERN16194.1| hypothetical protein AMTR_s00030p00239430 [Amborella trichopoda]
Length=972

 Score =   352 bits (904),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 220/289 (76%), Gaps = 16/289 (6%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            ++RNMG+ FVIYGG +   +A KAV+FDGVEFHGRVLTV+LDDGRR  K K   R RW+ 
Sbjct  198  SERNMGYCFVIYGGPTASNAATKAVEFDGVEFHGRVLTVRLDDGRR-NKAKSDERLRWVL  256

Query  642  GSSSR---------------NFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            GS  +               +FR++L+++PENW AVV +F+RI KPSR+EFG+MVNYY +
Sbjct  257  GSDGKEYRSKWHEEREMLLKDFRRILDTEPENWQAVVSSFQRIKKPSRREFGLMVNYYAK  316

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGDKH AR  FE MR+RGI P+SY YTNL +AY V++DM  A+ CV +M  EG+E+S+ T
Sbjct  317  RGDKHHARATFESMRARGIEPSSYVYTNLVHAYAVAKDMRGAIFCVEEMKAEGLEMSLAT  376

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSI++ GFA +GN + AE WF EAK  H +L+A +Y NIIYA+CQ+ NM RAE++++EME
Sbjct  377  YSILIAGFASIGNADDAEKWFEEAKRTHTSLNAIVYCNIIYAHCQSGNMGRAEDMVKEME  436

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEGI API ++H+MMDGYT  R+E KCL++F RLKECGF+PS+ISYGCL
Sbjct  437  EEGIDAPIDVYHSMMDGYTNVRDEAKCLIVFQRLKECGFSPSIISYGCL  485


 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 89/194 (46%), Gaps = 4/194 (2%)
 Frame = -2

Query  570  FERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            F+R+ +    PS   +G ++N Y + G   +A E+ + M S GIV  S  Y+ L   +  
Sbjct  467  FQRLKECGFSPSIISYGCLINLYTKLGKVSKALEVSKTMESSGIVHNSKTYSMLISGFVQ  526

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
              D   A      M   G++  V+ Y+IIV  F K+GN++ A     E K+     S+  
Sbjct  527  LNDCASAFAIFEDMIKAGLKPDVILYNIIVNAFCKMGNMDRAIRIIEEMKKARHRPSSRT  586

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +  IIY   +  +M RA E +  M   G    +  F+ ++ G    +  EK + M D + 
Sbjct  587  FTPIIYGFAKVGDMKRAIETVDMMRHCGCIPTVETFNVLILGLVQKKQMEKAVAMIDEMS  646

Query  42   ECGFTPSVISYGCL  1
              G TP+  +Y  +
Sbjct  647  LAGLTPNEHTYTTI  660


 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 93/199 (47%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    PS + F  ++  + + GD  RA E  + MR  G +PT   + 
Sbjct  564  NMDRAIRIIEEMKKARHRPSSRTFTPIIYGFAKVGDMKRAIETVDMMRHCGCIPTVETFN  623

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       + ME+A+  + +M+  G+  +  TY+ I+ G+A +G    A  +F + KE 
Sbjct  624  VLILGLVQKKQMEKAVAMIDEMSLAGLTPNEHTYTTIMQGYASLGETRKAFEYFTKIKEE  683

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  684  GLKLDVFSYEALLKACCKSGRMQSALAVTKEMSAQKIPRNTFVYNILIDGWARRGDVWEA  743

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++K+ G  P + +Y
Sbjct  744  ADLIQQMKQEGVNPDIHTY  762


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 59/106 (56%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+  +A + + DM+ A+  V++M 
Sbjct  727  YNILIDGWARRGDVWEAADLIQQMKQEGVNPDIHTYTSFVHACSKAGDMQRAVQTVKEME  786

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G++ ++ TY+ ++ G+A+    E A   F E K        ++Y
Sbjct  787  AVGVKPNIKTYTTLINGWARAALPEKALRCFEEMKAAGLKPDKAVY  832



>ref|XP_007010458.1| Pentatricopeptide repeat-containing protein isoform 3 [Theobroma 
cacao]
 gb|EOY19268.1| Pentatricopeptide repeat-containing protein isoform 3 [Theobroma 
cacao]
Length=915

 Score =   345 bits (884),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 180/291 (62%), Positives = 213/291 (73%), Gaps = 49/291 (17%)
 Frame = -2

Query  816  RNMGFGFVIYGGSSP--EKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            RN GFGFVIYGG  P  EKSA+KAV+FDGVEFHGR+LTVKLDDG+R+M +K + R RW+E
Sbjct  189  RNAGFGFVIYGGPPPLAEKSAMKAVEFDGVEFHGRILTVKLDDGKRLM-EKAEERARWVE  247

Query  642  G-----------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            G                  S + FRK+LES+PENW  VV AFERI KP+R+EFG+MVNYY
Sbjct  248  GYQVQDCNNKSKWHQEREGSRKLFRKILESEPENWQKVVTAFERITKPARREFGLMVNYY  307

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
             RRGD HRARE FE+MR+RGI PTS+ YTNL +AY V RDMEEAL+CVRKM +EGIE+++
Sbjct  308  ARRGDMHRARETFERMRARGIEPTSHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMTL  367

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYSI+VGGFAK+GN +                             QTCNM+RAE L+RE
Sbjct  368  VTYSILVGGFAKIGNSD-----------------------------QTCNMERAEALVRE  398

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEEEGI API I+HTMMDGYT+  NEEKCL++F+RLKECGF PSVISYGCL
Sbjct  399  MEEEGIDAPIDIYHTMMDGYTMIGNEEKCLIVFERLKECGFIPSVISYGCL  449


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 94/193 (49%), Gaps = 0/193 (0%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    +  ++P+ + F  +++ + R G+  RA E+F+ MR  G  PT + +  L    
Sbjct  534  HTVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAWEVFDVMRRSGCSPTVHTFNALILGL  593

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
            T  R ME+A+  + +M   GI  +  TY+ I+ G+A +G+   A  +F + +     +  
Sbjct  594  TEKRQMEKAVEILDEMTLAGISPNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDV  653

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              Y  ++ A C++  M  A  + +EM    I     +++ ++DG+    +  +   +  +
Sbjct  654  YTYEALLKACCKSGRMQSALAVTKEMSARKIPRNTFVYNILVDGWARRGDVWEAADLMQQ  713

Query  48   LKECGFTPSVISY  10
            +K+ G  P + +Y
Sbjct  714  MKQEGVQPDIHTY  726


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A   F K+R+ G+    Y Y  L  A   S  M+ AL  
Sbjct  616  PNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDVYTYEALLKACCKSGRMQSALAV  675

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+   I  +   Y+I+V G+A+ G+V  A     + K+         Y + I A C+
Sbjct  676  TKEMSARKIPRNTFVYNILVDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINACCK  735

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + ++EM+  G+   +  + T++ G+      EK L  F+ +K  G  P    
Sbjct  736  AGDMLRAMKTIQEMDAIGVKPNVKTYTTLIHGWARASLPEKALKCFEEMKLAGLKPDKAV  795

Query  12   YGCL  1
            Y CL
Sbjct  796  YHCL  799


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 95/201 (47%), Gaps = 3/201 (1%)
 Frame = -2

Query  597  ENWHAVVRAFER--INKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTN  424
            E   A+VR  E   I+ P    +  M++ Y   G++ +   +FE+++  G +P+   Y  
Sbjct  390  ERAEALVREMEEEGIDAPI-DIYHTMMDGYTMIGNEEKCLIVFERLKECGFIPSVISYGC  448

Query  423  LTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH  244
            L   Y+    + +AL   + M  +GI+ ++ TYS+++ GF K+ +   A   F +  E  
Sbjct  449  LINLYSKIGKVSKALEVSKMMECDGIKHNMKTYSMLINGFLKLKDWANAFAIFEDLVEDG  508

Query  243  ATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCL  64
                  +Y NII A C   NMDRA   ++EM +E        F  ++  +       +  
Sbjct  509  LKPDVVLYNNIIRAFCGMGNMDRAIHTVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAW  568

Query  63   LMFDRLKECGFTPSVISYGCL  1
             +FD ++  G +P+V ++  L
Sbjct  569  EVFDVMRRSGCSPTVHTFNAL  589


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  475  KHNMKTYSMLINGFLKLKDWANAFAIFEDLVEDGLKPDVVLYNNIIRAFCGMGNMDRAIH  534

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  E    +  T+  I+  FA+ G +  A   F   +    + +   +  +I    
Sbjct  535  TVKEMLKERHRPTTRTFMPIIHAFARAGEMRRAWEVFDVMRRSGCSPTVHTFNALILGLT  594

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   GI+     + T+M GY    +  K    F +L+  G    V 
Sbjct  595  EKRQMEKAVEILDEMTLAGISPNEHTYTTIMHGYASLGDTAKAFGYFTKLRNEGLEIDVY  654

Query  15   SYGCL  1
            +Y  L
Sbjct  655  TYEAL  659



>ref|XP_002310993.2| hypothetical protein POPTR_0008s01830g [Populus trichocarpa]
 gb|EEE88360.2| hypothetical protein POPTR_0008s01830g [Populus trichocarpa]
Length=888

 Score =   333 bits (854),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/289 (60%), Positives = 209/289 (72%), Gaps = 45/289 (16%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+RN GFGF+IY G + EKSA+KA +FDG+EFHGRVLTVKLDDGRR +K K + R  W++
Sbjct  196  TERNAGFGFIIYDGPTAEKSAMKAEEFDGMEFHGRVLTVKLDDGRR-LKAKAEERKNWVD  254

Query  642  GS---------------SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G                S++ FRKVL++QPENW AVV AFERI KP+R+EFG+MV YY R
Sbjct  255  GEDGVDYRSKWHEEREGSTKAFRKVLDTQPENWQAVVSAFERIKKPARREFGLMVGYYAR  314

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRAR+ FE MR RGI P+S+ YT+L +AY V RDMEEAL+CVRKM +EG+E+S+VT
Sbjct  315  RGDMHRARQTFESMRVRGIYPSSHVYTSLIHAYAVGRDMEEALSCVRKMKEEGVEMSLVT  374

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            YSI+VGGFAK+GN +                             Q+CNMDRAE L+REME
Sbjct  375  YSIVVGGFAKIGNAD-----------------------------QSCNMDRAESLVREME  405

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EEGI API I+HTMM+GYT+  NEEKCL++F RLKECGF PSVISYGCL
Sbjct  406  EEGIDAPIDIYHTMMNGYTMIGNEEKCLIVFKRLKECGFAPSVISYGCL  454


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 95/193 (49%), Gaps = 0/193 (0%)
 Frame = -2

Query  588  HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            H V    ++ ++P+ + F  +++ + R G+  RA E+F+ MR  G +PT + +  L    
Sbjct  539  HMVKEMQKKRHRPTSRTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGL  598

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
               R ME+A+  + +M   G+     TY+ I+ G+A +G+   A  +F + +     L  
Sbjct  599  VEKRQMEKAVEILDEMALAGVSPDEHTYTTIMNGYAALGDTGKAFEYFTKLRNEGLELDV  658

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              Y  ++ A C++  M  A  + REM  + I     +++ ++DG+    +  +   +  +
Sbjct  659  FTYEALLKACCKSGRMQSALAVTREMSSQNIPRNTFVYNILIDGWARRGDVWEAADLMQQ  718

Query  48   LKECGFTPSVISY  10
            +K+ G  P + +Y
Sbjct  719  MKQEGVQPDIHTY  731


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  480  KHNMKTYSMLINGFLKLKDWTNAFTVFEDVIKDGLKPDVVLYNNIIKAFCGMGNMDRAIH  539

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M  +    +  T+  I+ GFA+ G +  A   F   +      +   +  ++    
Sbjct  540  MVKEMQKKRHRPTSRTFMPIIHGFARAGEMRRALEIFDMMRRSGCIPTVHTFNALVLGLV  599

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E+L EM   G++     + T+M+GY    +  K    F +L+  G    V 
Sbjct  600  EKRQMEKAVEILDEMALAGVSPDEHTYTTIMNGYAALGDTGKAFEYFTKLRNEGLELDVF  659

Query  15   SYGCL  1
            +Y  L
Sbjct  660  TYEAL  664


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 56/112 (50%), Gaps = 1/112 (1%)
 Frame = -2

Query  585  AVVRAFERINKPSRK-EFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            AV R     N P     + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A 
Sbjct  679  AVTREMSSQNIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINAC  738

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              + DM  A   +++M   G++ +V TY+ ++ G+A     E A   F E K
Sbjct  739  CKAGDMLRATKTIQEMEALGVKPNVKTYTTLIHGWACASLPEKALRCFEEMK  790



>ref|XP_009408751.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=891

 Score =   331 bits (849),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 163/288 (57%), Positives = 223/288 (77%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN+G+ F++YGG + E SA +AV+FDGVEFHGRVLTV+LDDG ++ + +K+ + RW+ G
Sbjct  178  ERNVGYCFLLYGGPTAEDSAARAVEFDGVEFHGRVLTVRLDDGGQV-RARKEEKARWVAG  236

Query  639  SSSRNFR---------------KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            ++ R +R               KVL+++PE+W AVV AF++I KPS  ++ +MV YY RR
Sbjct  237  TNGREYRSKWHEERGNASVRFMKVLDTKPEDWQAVVSAFDKIPKPSLGDYRLMVKYYARR  296

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GDKH AR  FE MR+RGI P    +T+L +AY V+RDM+ AL+CV +M  EGIE++V TY
Sbjct  297  GDKHHARATFESMRARGIEPDERIFTSLVHAYAVARDMQGALSCVGEMKTEGIELTVATY  356

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI++ GFAKV  VE+A+++F+EAK++ A+L+A IY NIIYA+CQ+ NM RAE L+REMEE
Sbjct  357  SILIAGFAKVNAVESADNFFIEAKQKLASLNAIIYSNIIYAHCQSGNMARAEVLVREMEE  416

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +GI API+I+HTMMDGYT  R+E+KCL++F+RLKECGF PSVISYGCL
Sbjct  417  QGIDAPINIYHTMMDGYTNIRDEKKCLIVFERLKECGFAPSVISYGCL  464


 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 96/186 (52%), Gaps = 0/186 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++PS + F  +++ +   G+  RA E+FE MR  G VPT   Y  L +       ME+A+
Sbjct  559  HRPSTRTFLPIIDAFAAAGEMKRALEIFELMRRSGCVPTVEVYNVLIHGLVQKHKMEKAV  618

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + KM+  GI+ S  TY+ I+ G+A  G++  A  +F + KE    L   IY  ++ A 
Sbjct  619  EVIDKMSLAGIKPSKHTYTTIMQGYATDGDIGKAFEYFTKIKEAGLELDVFIYEALLKAC  678

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + REM  + IA    +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  679  CKSGRMQSALAVTREMSAQKIARNSFVYNILIDGWARRGDVWEADDLLQQMKQDGVPPDI  738

Query  18   ISYGCL  1
             +Y  L
Sbjct  739  HTYTSL  744


 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + R  D   A  +FE+M   G+ P    Y N+  A++   + + A+ 
Sbjct  490  KHNHKTYSMLINGFIRLNDFANAFGIFEEMLKLGLKPDVVLYNNIVCAFSKMGNTDRAIQ  549

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M       S  T+  I+  FA  G ++ A   F   +      +  +Y  +I+   
Sbjct  550  IVHEMQKGKHRPSTRTFLPIIDAFAAAGEMKRALEIFELMRRSGCVPTVEVYNVLIHGLV  609

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            Q   M++A E++ +M   GI      + T+M GY    +  K    F ++KE G    V 
Sbjct  610  QKHKMEKAVEVIDKMSLAGIKPSKHTYTTIMQGYATDGDIGKAFEYFTKIKEAGLELDVF  669

Query  15   SYGCL  1
             Y  L
Sbjct  670  IYEAL  674


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 81/191 (42%), Gaps = 4/191 (2%)
 Frame = -2

Query  570  FERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+ +    PS   +G ++N Y + G   +A E+   M   GI      Y+ L   +  
Sbjct  446  FERLKECGFAPSVISYGCLINLYIKIGKVSKALEVSRTMELSGIKHNHKTYSMLINGFIR  505

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
              D   A     +M   G++  VV Y+ IV  F+K+GN + A     E ++     S   
Sbjct  506  LNDFANAFGIFEEMLKLGLKPDVVLYNNIVCAFSKMGNTDRAIQIVHEMQKGKHRPSTRT  565

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +  II A      M RA E+   M   G    + +++ ++ G       EK + + D++ 
Sbjct  566  FLPIIDAFAAAGEMKRALEIFELMRRSGCVPTVEVYNVLIHGLVQKHKMEKAVEVIDKMS  625

Query  42   ECGFTPSVISY  10
              G  PS  +Y
Sbjct  626  LAGIKPSKHTY  636


 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 88/196 (45%), Gaps = 3/196 (2%)
 Frame = -2

Query  582  VVRAFER--INKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            +VR  E   I+ P      MM  Y   R D+ +   +FE+++  G  P+   Y  L   Y
Sbjct  410  LVREMEEQGIDAPINIYHTMMDGYTNIR-DEKKCLIVFERLKECGFAPSVISYGCLINLY  468

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
                 + +AL   R M   GI+ +  TYS+++ GF ++ +   A   F E  +       
Sbjct  469  IKIGKVSKALEVSRTMELSGIKHNHKTYSMLINGFIRLNDFANAFGIFEEMLKLGLKPDV  528

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
             +Y NI+ A  +  N DRA +++ EM++         F  ++D +      ++ L +F+ 
Sbjct  529  VLYNNIVCAFSKMGNTDRAIQIVHEMQKGKHRPSTRTFLPIIDAFAAAGEMKRALEIFEL  588

Query  48   LKECGFTPSVISYGCL  1
            ++  G  P+V  Y  L
Sbjct  589  MRRSGCVPTVEVYNVL  604


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+L  A   +  M  A   + +M 
Sbjct  706  YNILIDGWARRGDVWEADDLLQQMKQDGVPPDIHTYTSLINACCKAGHMPRASKVIEEME  765

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G+  ++ TY+ ++ G+A+    E A   F E K
Sbjct  766  AAGVRPNIKTYTTLIRGWARASLPEKAIECFEEMK  800



>ref|XP_004960011.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X1 [Setaria italica]
 ref|XP_004960012.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X2 [Setaria italica]
Length=893

 Score =   324 bits (831),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/288 (55%), Positives = 218/288 (76%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN+GF F+ YGG  PE +A +AV+ DGVEF G+ LTV+LDDGR+  + + + R RW+EG
Sbjct  153  ERNVGFCFLYYGGDDPESAAERAVEVDGVEFRGKSLTVRLDDGRK-GRARAEERARWVEG  211

Query  639  ---------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
                            + R FR+VLES+PE+W AVV AFERI KPSR+EFG+MV YY +R
Sbjct  212  GERREPRSPWHKGRDEACREFRRVLESRPEDWQAVVSAFERIPKPSRREFGLMVVYYAKR  271

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GDKH AR  FE MR+RGI P ++ +T+L +AY V+RDM  AL+C+ +M  EG+E++VVTY
Sbjct  272  GDKHHARATFENMRARGIEPNAFVFTSLVHAYAVARDMRGALSCIEEMKSEGLELTVVTY  331

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI++ G+AK+ + ++A++ F EAK +   L+  IY NII+A+CQ+ NMDRAEEL+REMEE
Sbjct  332  SILIAGYAKINDAQSADNLFKEAKTKLDNLNGIIYSNIIHAHCQSGNMDRAEELVREMEE  391

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +GI API ++H+MM GYTI ++E+KCL++F+RLKECGF PS+ISYGCL
Sbjct  392  DGIDAPIDVYHSMMHGYTIIQDEKKCLIVFERLKECGFKPSIISYGCL  439


 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 96/199 (48%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R FE++ K    PS + F  ++  +   GD  RA +  + MR  G  PT   Y 
Sbjct  518  NMDRAIRIFEKMQKERMQPSNRTFRPIIEGFAVSGDMKRALDTLDLMRRSGCAPTVMTYN  577

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L +       +E A++ + KM   GI  +  TY+II+ G+A  G++  A  +F + KE 
Sbjct  578  ALIHGLIRKHQVERAVSVLDKMAIAGIAPNEHTYTIIMRGYAAGGDIGKAFEYFTKIKES  637

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L   IY  ++ A C++  M  A  + REM  + I     I++ ++DG+    +  + 
Sbjct  638  GLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEA  697

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++KE G  P++ +Y
Sbjct  698  ADLMKQMKEDGVPPNIHTY  716


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 88/176 (50%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    D+ +   +FE+++  G  P+   Y  L   Y     + +ALT  ++M   G
Sbjct  404  MMHGYTIIQDEKKCLIVFERLKECGFKPSIISYGCLINLYVKIGKVPKALTISKEMESYG  463

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ +  TYS+++ GF  + +   A   F +  +       +IY  +I A C+  NMDRA 
Sbjct  464  IKHNNKTYSMLINGFIHLHDFANAFSIFEDMLKSGLQPDRAIYNLLIEAFCKMGNMDRAI  523

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +  +M++E +      F  +++G+ ++ + ++ L   D ++  G  P+V++Y  L
Sbjct  524  RIFEKMQKERMQPSNRTFRPIIEGFAVSGDMKRALDTLDLMRRSGCAPTVMTYNAL  579


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 85/191 (45%), Gaps = 4/191 (2%)
 Frame = -2

Query  570  FERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+     KPS   +G ++N Y + G   +A  + ++M S GI   +  Y+ L   +  
Sbjct  421  FERLKECGFKPSIISYGCLINLYVKIGKVPKALTISKEMESYGIKHNNKTYSMLINGFIH  480

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
              D   A +    M   G++     Y++++  F K+GN++ A   F + ++     S   
Sbjct  481  LHDFANAFSIFEDMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIRIFEKMQKERMQPSNRT  540

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +  II     + +M RA + L  M   G A  +  ++ ++ G       E+ + + D++ 
Sbjct  541  FRPIIEGFAVSGDMKRALDTLDLMRRSGCAPTVMTYNALIHGLIRKHQVERAVSVLDKMA  600

Query  42   ECGFTPSVISY  10
              G  P+  +Y
Sbjct  601  IAGIAPNEHTY  611


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 79/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  465  KHNNKTYSMLINGFIHLHDFANAFSIFEDMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIR  524

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               KM  E ++ S  T+  I+ GFA  G+++ A       +      +   Y  +I+   
Sbjct  525  IFEKMQKERMQPSNRTFRPIIEGFAVSGDMKRALDTLDLMRRSGCAPTVMTYNALIHGLI  584

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++RA  +L +M   GIA     +  +M GY    +  K    F ++KE G    V 
Sbjct  585  RKHQVERAVSVLDKMAIAGIAPNEHTYTIIMRGYAAGGDIGKAFEYFTKIKESGLKLDVY  644

Query  15   SYGCL  1
             Y  L
Sbjct  645  IYETL  649


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM  A   +++M 
Sbjct  681  YNILIDGWARRGDVWEAADLMKQMKEDGVPPNIHTYTSYINACCKAGDMRRAENVIQEMA  740

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ +V TY+ ++ G+A+V   + A   F E K
Sbjct  741  DVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  775



>ref|NP_001105869.1| pentatricopeptide repeat protein [Zea mays]
 gb|ABF57644.1| pentatricopeptide repeat protein [Zea mays]
Length=886

 Score =   317 bits (813),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 215/288 (75%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN+GF F+ YGG  PE +A +AV+ DGVEF G++LTV+LDDGR+  + + + R RW+E 
Sbjct  146  ERNVGFCFLYYGGDDPEAAAGRAVEVDGVEFRGKLLTVRLDDGRK-GRARAEERARWVEA  204

Query  639  ---------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
                            + R FR+VLES+PE+W AVV AFERI KPSR+EFG+MV YY +R
Sbjct  205  GVVREASSPWHKGREDACREFRRVLESRPEDWQAVVSAFERIPKPSRREFGLMVVYYAKR  264

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GDKH AR  FE MR+RGI P ++ +T+L +AY V+ DM  AL+CV +M  EGIE++VVTY
Sbjct  265  GDKHHARATFENMRARGIEPNAFVFTSLVHAYAVAGDMRGALSCVEEMKSEGIEMTVVTY  324

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI++ G+ K  + ++A++ F EAK +   L+  IY NII+A+CQ+ NMDRAEEL+REMEE
Sbjct  325  SILISGYGKTNDAQSADNLFKEAKTKLDNLNGIIYSNIIHAHCQSGNMDRAEELVREMEE  384

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +GI API ++H+MM GYT+ ++E+KCL++F+RLKECGF P++ISYGCL
Sbjct  385  DGIDAPIDVYHSMMHGYTVVQDEKKCLIVFERLKECGFKPTIISYGCL  432


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 98/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R FER+ K    PS + F  ++  +   GD  RA +  + MR  G  PT   Y 
Sbjct  511  NMDRAIRIFERMQKERMQPSNRTFRPIIEGFAVAGDMKRAFDTLDLMRRSGCAPTVMTYN  570

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L +       +E+A++ + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE 
Sbjct  571  ALIHGLVRKHQVEKAVSVLDKMSIAGIAPNEHTYTIIMRGYAASGDIGKAFEYFTKIKES  630

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L   IY  ++ A C++  M  A  + REM  + I     I++ ++DG+    +  + 
Sbjct  631  GLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEA  690

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++KE G  P++ ++
Sbjct  691  ADLLKQMKEDGIPPNIHTF  709


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/191 (24%), Positives = 83/191 (43%), Gaps = 4/191 (2%)
 Frame = -2

Query  570  FERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+     KP+   +G ++N Y + G   +A  + ++M S GI   +  Y+ L   +  
Sbjct  414  FERLKECGFKPTIISYGCLINLYVKVGKVPKAIAISKEMESHGIKHNNKTYSMLINGFIH  473

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
              D   A +    M   G++     Y+++V  F K+GN++ A   F   ++     S   
Sbjct  474  LHDFANAFSIFEDMIKSGLQPDRAIYNLLVEAFCKMGNMDRAIRIFERMQKERMQPSNRT  533

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +  II       +M RA + L  M   G A  +  ++ ++ G       EK + + D++ 
Sbjct  534  FRPIIEGFAVAGDMKRAFDTLDLMRRSGCAPTVMTYNALIHGLVRKHQVEKAVSVLDKMS  593

Query  42   ECGFTPSVISY  10
              G  P+  +Y
Sbjct  594  IAGIAPNEHTY  604


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  458  KHNNKTYSMLINGFIHLHDFANAFSIFEDMIKSGLQPDRAIYNLLVEAFCKMGNMDRAIR  517

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M  E ++ S  T+  I+ GFA  G+++ A       +      +   Y  +I+   
Sbjct  518  IFERMQKERMQPSNRTFRPIIEGFAVAGDMKRAFDTLDLMRRSGCAPTVMTYNALIHGLV  577

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +++A  +L +M   GIA     +  +M GY  + +  K    F ++KE G    V 
Sbjct  578  RKHQVEKAVSVLDKMSIAGIAPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVY  637

Query  15   SYGCL  1
             Y  L
Sbjct  638  IYETL  642


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  GI P  + +T+   A   + DM+ A   +++M 
Sbjct  674  YNILIDGWARRGDVWEAADLLKQMKEDGIPPNIHTFTSYINACCKAGDMQRAENVIQEMA  733

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ +V T++ ++ G+A+V   + A   F E K
Sbjct  734  DVGLKPNVKTFTTLIKGWARVSLPDRALKCFEEMK  768


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/214 (19%), Positives = 91/214 (43%), Gaps = 35/214 (16%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +++ + + G+  RA E+  +M   GI      Y ++ + YTV +D ++ L    ++ 
Sbjct  359  YSNIIHAHCQSGNMDRAEELVREMEEDGIDAPIDVYHSMMHGYTVVQDEKKCLIVFERLK  418

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAA--------EHWFLEAKERHATL-----------  235
            + G + ++++Y  ++  + KVG V  A         H      + ++ L           
Sbjct  419  ECGFKPTIISYGCLINLYVKVGKVPKAIAISKEMESHGIKHNNKTYSMLINGFIHLHDFA  478

Query  234  ----------------SASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
                              +IY  ++ A C+  NMDRA  +   M++E +      F  ++
Sbjct  479  NAFSIFEDMIKSGLQPDRAIYNLLVEAFCKMGNMDRAIRIFERMQKERMQPSNRTFRPII  538

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +G+ +  + ++     D ++  G  P+V++Y  L
Sbjct  539  EGFAVAGDMKRAFDTLDLMRRSGCAPTVMTYNAL  572



>ref|XP_002447352.1| hypothetical protein SORBIDRAFT_06g033480 [Sorghum bicolor]
 gb|EES11680.1| hypothetical protein SORBIDRAFT_06g033480 [Sorghum bicolor]
Length=888

 Score =   315 bits (807),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/288 (55%), Positives = 214/288 (74%), Gaps = 16/288 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN+GF F+ YGG  PE +A +AV+ DGVEF G+ LTV+LDDGR+  + + + R RW+E 
Sbjct  148  ERNVGFCFLYYGGDDPEAAAARAVEVDGVEFRGKSLTVRLDDGRK-GRARAEERARWVEA  206

Query  639  ---------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
                            + R FR+VLES+PE+W AVV AFERI KPSR+EFG+MV YY +R
Sbjct  207  GVAREARSPWHKGREDACREFRRVLESRPEDWQAVVSAFERIPKPSRREFGLMVVYYAKR  266

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GDKH AR  FE MR+RGI P ++ +T+L +AY V+RDM  AL+CV +M  EG+E++VVTY
Sbjct  267  GDKHHARATFENMRARGIEPNAFVFTSLVHAYAVARDMRGALSCVEEMKSEGLEMTVVTY  326

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            SI++ G+ K  + E+A+  F EAK +   L+  IY NII+A+CQ+ NMDRAEEL+REMEE
Sbjct  327  SILIAGYGKTNDAESADKLFKEAKTKLDNLNGIIYSNIIHAHCQSGNMDRAEELVREMEE  386

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +GI API ++H+MM GYT+ ++E+KCL++F+RLKECGF PS+ISYGCL
Sbjct  387  DGIDAPIDVYHSMMHGYTVAQDEKKCLIVFERLKECGFRPSIISYGCL  434


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R FER+ K    PS + F  ++  +   GD  RA +  + MR  G  PT   Y 
Sbjct  513  NMDRAIRIFERMKKERMQPSNRTFRPIIEGFAVAGDMKRALDTLDLMRRSGCAPTVMTYN  572

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L +       +E A++ + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE 
Sbjct  573  ALIHGLIRKHQVERAVSVLDKMSIAGIAPNEHTYTIIMRGYAASGDIGKAFEYFTKIKES  632

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L   IY  ++ A C++  M  A  + REM  + I     I++ ++DG+    +  + 
Sbjct  633  GLKLDVYIYETLLRACCKSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEA  692

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++KE G  P++ ++
Sbjct  693  ADLMKQMKEDGIPPNIHTF  711


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/191 (24%), Positives = 83/191 (43%), Gaps = 4/191 (2%)
 Frame = -2

Query  570  FERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+     +PS   +G ++N Y + G   +A  + ++M S GI   +  Y+ L   +  
Sbjct  416  FERLKECGFRPSIISYGCLINLYVKIGKVPKALAVSKEMESHGIKHNNKTYSMLINGFIH  475

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
              D   A +    M   G++     Y+++V  F K+GN++ A   F   K+     S   
Sbjct  476  LHDFANAFSIFEDMIKSGLQPDRAIYNLLVEAFCKMGNMDRAIRIFERMKKERMQPSNRT  535

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +  II       +M RA + L  M   G A  +  ++ ++ G       E+ + + D++ 
Sbjct  536  FRPIIEGFAVAGDMKRALDTLDLMRRSGCAPTVMTYNALIHGLIRKHQVERAVSVLDKMS  595

Query  42   ECGFTPSVISY  10
              G  P+  +Y
Sbjct  596  IAGIAPNEHTY  606


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/214 (20%), Positives = 92/214 (43%), Gaps = 35/214 (16%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +++ + + G+  RA E+  +M   GI      Y ++ + YTV++D ++ L    ++ 
Sbjct  361  YSNIIHAHCQSGNMDRAEELVREMEEDGIDAPIDVYHSMMHGYTVAQDEKKCLIVFERLK  420

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAA--------EHWFLEAKERHATL-----------  235
            + G   S+++Y  ++  + K+G V  A         H      + ++ L           
Sbjct  421  ECGFRPSIISYGCLINLYVKIGKVPKALAVSKEMESHGIKHNNKTYSMLINGFIHLHDFA  480

Query  234  ----------------SASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
                              +IY  ++ A C+  NMDRA  +   M++E +      F  ++
Sbjct  481  NAFSIFEDMIKSGLQPDRAIYNLLVEAFCKMGNMDRAIRIFERMKKERMQPSNRTFRPII  540

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +G+ +  + ++ L   D ++  G  P+V++Y  L
Sbjct  541  EGFAVAGDMKRALDTLDLMRRSGCAPTVMTYNAL  574


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  460  KHNNKTYSMLINGFIHLHDFANAFSIFEDMIKSGLQPDRAIYNLLVEAFCKMGNMDRAIR  519

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M  E ++ S  T+  I+ GFA  G+++ A       +      +   Y  +I+   
Sbjct  520  IFERMKKERMQPSNRTFRPIIEGFAVAGDMKRALDTLDLMRRSGCAPTVMTYNALIHGLI  579

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++RA  +L +M   GIA     +  +M GY  + +  K    F ++KE G    V 
Sbjct  580  RKHQVERAVSVLDKMSIAGIAPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVY  639

Query  15   SYGCL  1
             Y  L
Sbjct  640  IYETL  644


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  GI P  + +T+   A   + DM+ A   +++M 
Sbjct  676  YNILIDGWARRGDVWEAADLMKQMKEDGIPPNIHTFTSYINACCKAGDMQRAENVIQEMA  735

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ +V T++ ++ G+AKV   + A   F E K
Sbjct  736  DVGLKPNVKTFTTLIKGWAKVSLPDRALKCFEEMK  770



>ref|NP_001054310.1| Os04g0684500 [Oryza sativa Japonica Group]
 dbj|BAF16224.1| Os04g0684500 [Oryza sativa Japonica Group]
Length=901

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/287 (55%), Positives = 219/287 (76%), Gaps = 14/287 (5%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGR----------RIMKD-  673
            +RN+GF F+ YGG   + +A +AV+ DGV+F GR LTV+LDDGR          R + D 
Sbjct  159  ERNVGFCFLYYGGDDADAAAERAVEVDGVDFRGRSLTVRLDDGRKGRARAEQRARWVNDG  218

Query  672  -KKKGRTRWMEG--SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRG  502
             +++ R+ W EG   + R FR+V+ES+P+NW AVV AFERI KPSR+EFG+M+ YY +RG
Sbjct  219  RRREPRSPWHEGRDEACREFRRVVESRPDNWQAVVSAFERIPKPSRREFGLMIVYYAKRG  278

Query  501  DKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYS  322
            DKH AR  FE MR+RGI P ++ +T+L +AY V+RDM  AL+CV +M  EG+E+++VTYS
Sbjct  279  DKHHARATFENMRARGIEPNAFVFTSLVHAYAVARDMRGALSCVEEMKSEGLELTIVTYS  338

Query  321  IIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeE  142
            I++ GFAK+ + ++A++ F EAK + ++L+  IY NII+A+CQ+ NM+RAEEL+REMEE+
Sbjct  339  ILISGFAKINDSQSADNLFKEAKTKLSSLNGIIYSNIIHAHCQSGNMERAEELVREMEED  398

Query  141  GIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            GI API ++H+MM GYTI +NE KCL++F+RLKECGF PS+ISYGCL
Sbjct  399  GIDAPIDVYHSMMHGYTIIQNENKCLVVFERLKECGFKPSIISYGCL  445


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 90/182 (49%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS + F  ++  Y   GD   A +  + MR  G VPT   Y  L +       ++ A++
Sbjct  541  QPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAVS  600

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE    L   IY  ++ A C
Sbjct  601  VLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVYIYETLLRACC  660

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + REM  + I     I++ ++DG+    +  +   +  ++KE G  P++ 
Sbjct  661  KSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIH  720

Query  15   SY  10
            +Y
Sbjct  721  TY  722


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 87/176 (49%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    ++++   +FE+++  G  P+   Y  L   Y     + +AL+  ++M   G
Sbjct  410  MMHGYTIIQNENKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCG  469

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ +  TYS+++ GF  + +   A   F E          +IY  +I A C+  NMDRA 
Sbjct  470  IKHNNKTYSMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAI  529

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +L +M++E +      F  +++GY +  + +  L   D ++  G  P+V++Y  L
Sbjct  530  CILEKMQKERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNAL  585


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A   + +M 
Sbjct  687  YNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAEKVIEEMV  746

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ +V TY+ ++ G+A+V   + A   F E K
Sbjct  747  DVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  781


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  471  KHNNKTYSMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAIC  530

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E ++ S   +  I+ G+A  G++++A       +      +   Y  +I+   
Sbjct  531  ILEKMQKERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLV  590

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   + RA  +L +M   GI      +  +M GY  + +  K    F ++KE G    V 
Sbjct  591  RKHKVQRAVSVLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVY  650

Query  15   SYGCL  1
             Y  L
Sbjct  651  IYETL  655


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 86/200 (43%), Gaps = 4/200 (2%)
 Frame = -2

Query  597  ENWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
            +N +  +  FER+     KPS   +G ++N Y + G   +A  + ++M S GI   +  Y
Sbjct  418  QNENKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCGIKHNNKTY  477

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            + L   +    D   A     +M   G++     Y++++  F K+GN++ A     + ++
Sbjct  478  SMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQK  537

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
                 S   +  II       +M  A + L  M   G    +  ++ ++ G       ++
Sbjct  538  ERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQR  597

Query  69   CLLMFDRLKECGFTPSVISY  10
             + + D++   G TP+  +Y
Sbjct  598  AVSVLDKMSIAGITPNEHTY  617



>emb|CAJ86163.1| H0913C04.4 [Oryza sativa Indica Group]
 gb|EAY96108.1| hypothetical protein OsI_17985 [Oryza sativa Indica Group]
Length=900

 Score =   313 bits (802),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/287 (54%), Positives = 218/287 (76%), Gaps = 14/287 (5%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGR----------RIMKD-  673
            +RN+GF F+ YGG   + +A +AV+ DGV+F GR LTV+LDDGR          R + D 
Sbjct  158  ERNVGFCFLYYGGDDADAAAERAVEVDGVDFRGRSLTVRLDDGRKGRARAEQRARWVNDG  217

Query  672  -KKKGRTRWMEG--SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRG  502
             +++ R+ W EG   + R FR+V+ES+P+NW AVV AFERI KPSR+EFG+M+ YY +RG
Sbjct  218  RRREPRSPWHEGRDEACREFRRVVESRPDNWQAVVSAFERIPKPSRREFGLMIVYYAKRG  277

Query  501  DKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYS  322
            DKH AR  FE MR+RGI P ++ +T+L +AY V+RDM  AL+CV +M  EG+E+++VTYS
Sbjct  278  DKHHARATFENMRARGIEPNAFVFTSLVHAYAVARDMRGALSCVEEMKSEGLELTIVTYS  337

Query  321  IIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeE  142
            I++ GFAK+ + ++A++ F EAK + ++L+  IY NII+A+CQ+ NM+RAEEL+ EMEE+
Sbjct  338  ILISGFAKINDSQSADNLFKEAKTKLSSLNGIIYSNIIHAHCQSGNMERAEELVCEMEED  397

Query  141  GIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            GI API ++H+MM GYTI +NE KCL++F+RLKECGF PS+ISYGCL
Sbjct  398  GIDAPIDVYHSMMHGYTIIQNENKCLVVFERLKECGFKPSIISYGCL  444


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 90/182 (49%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS + F  ++  Y   GD   A +  + MR  G VPT   Y  L +       ++ A++
Sbjct  540  QPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAVS  599

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE    L   IY  ++ A C
Sbjct  600  VLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVYIYETLLRACC  659

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + REM  + I     I++ ++DG+    +  +   +  ++KE G  P++ 
Sbjct  660  KSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIH  719

Query  15   SY  10
            +Y
Sbjct  720  TY  721


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 87/176 (49%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    ++++   +FE+++  G  P+   Y  L   Y     + +AL+  ++M   G
Sbjct  409  MMHGYTIIQNENKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCG  468

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ +  TYS+++ GF  + +   A   F E          +IY  +I A C+  NMDRA 
Sbjct  469  IKHNNKTYSMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAI  528

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +L +M++E +      F  +++GY +  + +  L   D ++  G  P+V++Y  L
Sbjct  529  CILEKMQKERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNAL  584


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A   + +M 
Sbjct  686  YNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAEKVIEEMV  745

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ +V TY+ ++ G+A+V   + A   F E K
Sbjct  746  DVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  780


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  470  KHNNKTYSMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAIC  529

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E ++ S   +  I+ G+A  G++++A       +      +   Y  +I+   
Sbjct  530  ILEKMQKERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLV  589

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   + RA  +L +M   GI      +  +M GY  + +  K    F ++KE G    V 
Sbjct  590  RKHKVQRAVSVLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVY  649

Query  15   SYGCL  1
             Y  L
Sbjct  650  IYETL  654


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 86/200 (43%), Gaps = 4/200 (2%)
 Frame = -2

Query  597  ENWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
            +N +  +  FER+     KPS   +G ++N Y + G   +A  + ++M S GI   +  Y
Sbjct  417  QNENKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCGIKHNNKTY  476

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            + L   +    D   A     +M   G++     Y++++  F K+GN++ A     + ++
Sbjct  477  SMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQK  536

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
                 S   +  II       +M  A + L  M   G    +  ++ ++ G       ++
Sbjct  537  ERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQR  596

Query  69   CLLMFDRLKECGFTPSVISY  10
             + + D++   G TP+  +Y
Sbjct  597  AVSVLDKMSIAGITPNEHTY  616



>ref|XP_010094357.1| Pentatricopeptide repeat-containing protein [Morus notabilis]
 gb|EXB55868.1| Pentatricopeptide repeat-containing protein [Morus notabilis]
Length=946

 Score =   313 bits (802),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 209/332 (63%), Gaps = 88/332 (27%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            TDRN GFGFV+YGGS+  KSA+KAV+FDGVEFHGRVLTVKLDDGRR +K K + R RW+ 
Sbjct  183  TDRNAGFGFVLYGGSTAAKSAMKAVEFDGVEFHGRVLTVKLDDGRR-LKGKMEERERWIG  241

Query  642  GSSS---------------RNFRKVLESQPENWHAVVRAFERINK---------------  553
            G                  + FRKV+E++PENW AVV AF+RI K               
Sbjct  242  GDDGVEYRSKWHEERDGLRKEFRKVVETEPENWQAVVDAFQRIKKSLVCSLFGLVEVFLR  301

Query  552  ----------------------------PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSR  457
                                        PSR+E+G+MV YY RRGD HRARE FE MR+R
Sbjct  302  VSAVCILAPLFVHLAQLIPFGNSFRQDSPSRREYGLMVKYYARRGDMHRARETFESMRAR  361

Query  456  GIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAA  277
            GI P+S+ Y++L +AY V RDMEEAL+CVRKM +EGIE+S+VTYSIIVGGFAK+GN +  
Sbjct  362  GIEPSSHVYSSLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVTYSIIVGGFAKMGNAD--  419

Query  276  EHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDG  97
                                       QTCN +RAE L+REMEE GI A I I+HTMMDG
Sbjct  420  ---------------------------QTCNTERAEALVREMEEVGIDASIDIYHTMMDG  452

Query  96   YTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            YT+  NE+KCL++F+RLKECGFTPSVISYGCL
Sbjct  453  YTMIGNEDKCLVVFERLKECGFTPSVISYGCL  484


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+R+ G+    + Y  L  A   +  M+ AL  
Sbjct  651  PNEHTYTTIMHGYASLGDTGKAFEYFTKLRNEGLELDVFTYEALLKACCKAGRMQSALAV  710

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+++ I  +   Y+I++ G+A+ G+V  A     + K+         Y + I A  +
Sbjct  711  TKEMSNQKIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDIHTYTSFINACSR  770

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + ++EM+  G+   +  + T+++G+      EK L  FD +K  G  P    
Sbjct  771  AGDMLRATKTIQEMQTFGVKPNVKTYTTLINGWARASVPEKALKCFDEMKLTGLKPDKAV  830

Query  12   YGCL  1
            Y CL
Sbjct  831  YHCL  834


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 91/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++P+ + F  +++ + R G+  RA E+F+ MR  G +PT + +  L       R ME+A+
Sbjct  579  HRPTTRSFMPIIHGFARAGEMRRALEIFDMMRMSGCIPTVHTFNALILGLVEKRQMEKAV  638

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              V +M   G+  +  TY+ I+ G+A +G+   A  +F + +     L    Y  ++ A 
Sbjct  639  EIVDEMTLAGVSPNEHTYTTIMHGYASLGDTGKAFEYFTKLRNEGLELDVFTYEALLKAC  698

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C+   M  A  + +EM  + I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  699  CKAGRMQSALAVTKEMSNQKIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQEGVQPDI  758

Query  18   ISY  10
             +Y
Sbjct  759  HTY  761


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/185 (23%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N + R  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  510  KHNMKTYSMLINGFLRLKDWTNAFAVFEDVIKDGLKPDVVLYNNIIRAFCGMGNMDRAVQ  569

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             ++ M       +  ++  I+ GFA+ G +  A   F   +      +   +  +I    
Sbjct  570  TIKDMQKSRHRPTTRSFMPIIHGFARAGEMRRALEIFDMMRMSGCIPTVHTFNALILGLV  629

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E++ EM   G++     + T+M GY    +  K    F +L+  G    V 
Sbjct  630  EKRQMEKAVEIVDEMTLAGVSPNEHTYTTIMHGYASLGDTGKAFEYFTKLRNEGLELDVF  689

Query  15   SYGCL  1
            +Y  L
Sbjct  690  TYEAL  694



>ref|XP_006653052.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Oryza brachyantha]
Length=901

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/287 (54%), Positives = 220/287 (77%), Gaps = 14/287 (5%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGR----------RIMKD-  673
            +RN+GF F+ YGG   E +A +AV+ DGV+F GR LTV+LDDGR          R + D 
Sbjct  159  ERNLGFCFLYYGGDDAEAAAERAVEVDGVDFRGRSLTVRLDDGRKGRARAEQRERWVDDG  218

Query  672  -KKKGRTRWMEG--SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRG  502
             +++ R+ W E    + R+FR+V+ES+P+NW AVV AFE+I KPSR+EFG+M+ YY +RG
Sbjct  219  RRREARSPWHESRDEACRDFRRVVESRPDNWQAVVSAFEKIPKPSRREFGLMIVYYAKRG  278

Query  501  DKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYS  322
            DKH AR  FE MR+RGI P ++ +T+L +AY V+RDM  AL+C+ +M  EG+E+++VTYS
Sbjct  279  DKHHARATFENMRARGIEPNAFVFTSLVHAYAVARDMRGALSCIEEMKSEGLELTIVTYS  338

Query  321  IIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeE  142
            I++ GFAK+ + ++A++ F EAK +  +L+  IYGNII+A+CQ+ NM+RAEEL+REMEE+
Sbjct  339  ILISGFAKINDAQSADNLFKEAKTKFGSLNGIIYGNIIHAHCQSGNMERAEELVREMEED  398

Query  141  GIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            GI API ++H+MM GYTI +NE+KCL++F+RLKECGF PS+ISYGCL
Sbjct  399  GIDAPIDVYHSMMHGYTIIQNEKKCLMVFERLKECGFKPSIISYGCL  445


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/180 (27%), Positives = 87/180 (48%), Gaps = 0/180 (0%)
 Frame = -2

Query  549  SRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCV  370
            S + F  ++  +   GD   A +  + MR  G  PT   Y  L +       +E A++ +
Sbjct  543  SNRAFRPIIEGFAVAGDMKSALDTLDLMRRSGSAPTVMTYNALIHGLVRKHQVERAISVL  602

Query  369  RKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQT  190
             KM+  GI  +  TY+II+ G+A  G+V  A  +F + KE    L   IY  ++ A C++
Sbjct  603  DKMSIAGITPNEHTYTIIMRGYAANGDVGKAFEYFTKIKEAGLKLDVYIYETLLRACCKS  662

Query  189  CNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
              M  A  + REM  + I     I++ ++DG+    +  +   +  ++K+ G  P++ +Y
Sbjct  663  GRMQSALAVTREMSFQKIPRNTYIYNILIDGWARRGDVWEAEDLMKQMKDDGVPPNIHTY  722


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 86/200 (43%), Gaps = 4/200 (2%)
 Frame = -2

Query  597  ENWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
            +N    +  FER+     KPS   +G +VN Y + G   +A    ++M S GI   +  Y
Sbjct  418  QNEKKCLMVFERLKECGFKPSIISYGCLVNLYVKTGKVAKALSTSKEMESHGIKHNNKTY  477

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            + L   +    D   A     +M   G++     Y++++  F K+GN++ A     + ++
Sbjct  478  SMLINGFIHLHDFANAFAIFEEMIRSGLQPDRTIYNLLIEAFCKMGNMDRAICILEKMQK  537

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
                LS   +  II       +M  A + L  M   G A  +  ++ ++ G       E+
Sbjct  538  ERMQLSNRAFRPIIEGFAVAGDMKSALDTLDLMRRSGSAPTVMTYNALIHGLVRKHQVER  597

Query  69   CLLMFDRLKECGFTPSVISY  10
             + + D++   G TP+  +Y
Sbjct  598  AISVLDKMSIAGITPNEHTY  617


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  471  KHNNKTYSMLINGFIHLHDFANAFAIFEEMIRSGLQPDRTIYNLLIEAFCKMGNMDRAIC  530

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E +++S   +  I+ GFA  G++++A       +   +  +   Y  +I+   
Sbjct  531  ILEKMQKERMQLSNRAFRPIIEGFAVAGDMKSALDTLDLMRRSGSAPTVMTYNALIHGLV  590

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++RA  +L +M   GI      +  +M GY    +  K    F ++KE G    V 
Sbjct  591  RKHQVERAISVLDKMSIAGITPNEHTYTIIMRGYAANGDVGKAFEYFTKIKEAGLKLDVY  650

Query  15   SYGCL  1
             Y  L
Sbjct  651  IYETL  655


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A   + +M 
Sbjct  687  YNILIDGWARRGDVWEAEDLMKQMKDDGVPPNIHTYTSYINACCKAGDMQRAEKVIEEMV  746

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ +V TY+ ++ G+A+V   + A   F E K
Sbjct  747  GVGLKPNVKTYTTLIKGWARVSLPDKALKCFEEMK  781



>gb|EAZ32470.1| hypothetical protein OsJ_16686 [Oryza sativa Japonica Group]
Length=879

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 205/266 (77%), Gaps = 14/266 (5%)
 Frame = -2

Query  756  KAVQFDGVEFHGRVLTVKLDDGR----------RIMKD--KKKGRTRWMEG--SSSRNFR  619
            +AV+ DGV+F GR LTV+LDDGR          R + D  +++ R+ W EG   + R FR
Sbjct  158  RAVEVDGVDFRGRSLTVRLDDGRKGRARAEQRARWVNDGRRREPRSPWHEGRDEACREFR  217

Query  618  KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTS  439
            +V+ES+P+NW AVV AFERI KPSR+EFG+M+ YY +RGDKH AR  FE MR+RGI P +
Sbjct  218  RVVESRPDNWQAVVSAFERIPKPSRREFGLMIVYYAKRGDKHHARATFENMRARGIEPNA  277

Query  438  YEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE  259
            + +T+L +AY V+RDM  AL+CV +M  EG+E+++VTYSI++ GFAK+ + ++A++ F E
Sbjct  278  FVFTSLVHAYAVARDMRGALSCVEEMKSEGLELTIVTYSILISGFAKINDSQSADNLFKE  337

Query  258  AKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRN  79
            AK + ++L+  IY NII+A+CQ+ NM+RAEEL+REMEE+GI API ++H+MM GYTI +N
Sbjct  338  AKTKLSSLNGIIYSNIIHAHCQSGNMERAEELVREMEEDGIDAPIDVYHSMMHGYTIIQN  397

Query  78   EEKCLLMFDRLKECGFTPSVISYGCL  1
            E KCL++F+RLKECGF PS+ISYGCL
Sbjct  398  ENKCLVVFERLKECGFKPSIISYGCL  423


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 90/182 (49%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS + F  ++  Y   GD   A +  + MR  G VPT   Y  L +       ++ A++
Sbjct  519  QPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAVS  578

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE    L   IY  ++ A C
Sbjct  579  VLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVYIYETLLRACC  638

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + REM  + I     I++ ++DG+    +  +   +  ++KE G  P++ 
Sbjct  639  KSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIH  698

Query  15   SY  10
            +Y
Sbjct  699  TY  700


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 87/176 (49%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    ++++   +FE+++  G  P+   Y  L   Y     + +AL+  ++M   G
Sbjct  388  MMHGYTIIQNENKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCG  447

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ +  TYS+++ GF  + +   A   F E          +IY  +I A C+  NMDRA 
Sbjct  448  IKHNNKTYSMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAI  507

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +L +M++E +      F  +++GY +  + +  L   D ++  G  P+V++Y  L
Sbjct  508  CILEKMQKERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNAL  563


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A   + +M 
Sbjct  665  YNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAEKVIEEMV  724

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ +V TY+ ++ G+A+V   + A   F E K
Sbjct  725  DVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  759


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  449  KHNNKTYSMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAIC  508

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E ++ S   +  I+ G+A  G++++A       +      +   Y  +I+   
Sbjct  509  ILEKMQKERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLV  568

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   + RA  +L +M   GI      +  +M GY  + +  K    F ++KE G    V 
Sbjct  569  RKHKVQRAVSVLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVY  628

Query  15   SYGCL  1
             Y  L
Sbjct  629  IYETL  633


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 86/200 (43%), Gaps = 4/200 (2%)
 Frame = -2

Query  597  ENWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
            +N +  +  FER+     KPS   +G ++N Y + G   +A  + ++M S GI   +  Y
Sbjct  396  QNENKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCGIKHNNKTY  455

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            + L   +    D   A     +M   G++     Y++++  F K+GN++ A     + ++
Sbjct  456  SMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQK  515

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
                 S   +  II       +M  A + L  M   G    +  ++ ++ G       ++
Sbjct  516  ERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQR  575

Query  69   CLLMFDRLKECGFTPSVISY  10
             + + D++   G TP+  +Y
Sbjct  576  AVSVLDKMSIAGITPNEHTY  595



>ref|XP_003580849.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Brachypodium distachyon]
 ref|XP_010240631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Brachypodium distachyon]
 ref|XP_010240632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X1 [Brachypodium distachyon]
Length=904

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/290 (53%), Positives = 208/290 (72%), Gaps = 18/290 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQ--FDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWM  646
            +RN GF F+ Y G + E  A        DGV+F GR LTV+LDDGR+  + + + R RW+
Sbjct  162  ERNAGFCFLYYAGDAAEAEAAAGRAAEVDGVDFRGRSLTVRLDDGRK-GRARAEERARWV  220

Query  645  EG---------------SSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYG  511
            +                 + R FR+V+ES+PE+W AVV AFERI KPSR+EFG+M+ YY 
Sbjct  221  DHGRRPEARSPWHQGREEACREFRRVVESRPEDWQAVVSAFERIPKPSRREFGLMIVYYA  280

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            +RGDKH AR  FE MR+RGI P ++ +T+L +AY V+RDM   L+CV +M  EGIE+++V
Sbjct  281  KRGDKHHARATFENMRARGIEPNAFVFTSLVHAYAVARDMRGVLSCVEEMKAEGIELTIV  340

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
            TYSII+ GFAK+ + ++A++ F EAK +   L+  IY NII+A+CQ+ NMDRAEEL+REM
Sbjct  341  TYSIIIAGFAKINDAQSADNLFKEAKAKLGDLNGIIYSNIIHAHCQSGNMDRAEELVREM  400

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EE+GI API  +H+MM GYTI ++E+KCL++F+RLKEC FTPS+ISYGCL
Sbjct  401  EEDGIDAPIDAYHSMMHGYTIIQDEKKCLIVFERLKECCFTPSIISYGCL  450


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E++ K    PS + F  ++  +   GD  RA  + + MR  G  PT   Y 
Sbjct  529  NMDRAIRILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALNILDLMRRSGCAPTVMTYN  588

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L +       +E A++ + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE 
Sbjct  589  ALIHGLIKKNQVERAVSVLNKMSIAGITPNEHTYTIIMRGYAANGDIGKAFEYFTKIKEG  648

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L   IY  ++ A C++  M  A  + REM  + IA    +++ ++DG+    +  + 
Sbjct  649  GLKLDVYIYETLLRACCKSGRMQSALAVTREMSTQKIARNTFVYNILIDGWARRGDVWEA  708

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++KE G  P++ +Y
Sbjct  709  ADLMKQMKEDGVPPNIHTY  727


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 87/176 (49%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    D+ +   +FE+++     P+   Y  L   Y     + +A+   ++M   G
Sbjct  415  MMHGYTIIQDEKKCLIVFERLKECCFTPSIISYGCLINLYIKIGKVTKAIAISKEMESYG  474

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ +  TYS+++ GF  + +   A   F E  +       +IY  +I A C+  NMDRA 
Sbjct  475  IKHNNKTYSMLISGFIHLHDFANAFSIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAI  534

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +L +M++E +      F  +++G+ +  + ++ L + D ++  G  P+V++Y  L
Sbjct  535  RILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALNILDLMRRSGCAPTVMTYNAL  590


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A   + +M 
Sbjct  692  YNILIDGWARRGDVWEAADLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAQKVIEEMA  751

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ ++ TY+ ++ G+AK    + A   F E K
Sbjct  752  DVGLKPNLKTYTTLIKGWAKASLPDRALKSFEEMK  786


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M+++ +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  476  KHNNKTYSMLISGFIHLHDFANAFSIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIR  535

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E ++ S   +  I+ GFA  G+++ A +     +      +   Y  +I+   
Sbjct  536  ILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALNILDLMRRSGCAPTVMTYNALIHGLI  595

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++RA  +L +M   GI      +  +M GY    +  K    F ++KE G    V 
Sbjct  596  KKNQVERAVSVLNKMSIAGITPNEHTYTIIMRGYAANGDIGKAFEYFTKIKEGGLKLDVY  655

Query  15   SYGCL  1
             Y  L
Sbjct  656  IYETL  660



>dbj|BAJ97477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=913

 Score =   292 bits (747),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/293 (51%), Positives = 205/293 (70%), Gaps = 21/293 (7%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQ-----FDGVEFHGRVLTVKLDDGRRIMKDKKKGRT  655
            +RN GF F+ Y  +  E    +A        DGV+F GR LTV+LDDGR+  K + + R 
Sbjct  167  ERNAGFCFLYYADADAEGQGAEAAAERAAEVDGVDFRGRSLTVRLDDGRK-AKARAEDRA  225

Query  654  RWME---------------GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVN  520
            RW++                 + R FR+V+ES+PE+W AVV AFERI KPSR+EFG+M+ 
Sbjct  226  RWVDHGQGKEAPSPWHHGRDEACREFRRVVESRPEDWQAVVSAFERIPKPSRREFGLMIV  285

Query  519  YYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEI  340
            YY +RGDKH AR  FE MR+RGI P ++ +T+L +AY V+RDM  AL+C  +M  EGIE+
Sbjct  286  YYAKRGDKHHARATFENMRARGIEPNAFVFTSLVHAYAVARDMRGALSCTEEMKAEGIEL  345

Query  339  SVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeell  160
            ++VTYSI++ GF K+ + ++A++ F EAK     L+  IY NII+A+CQ+ NMDRAEEL+
Sbjct  346  TIVTYSILISGFGKINDTQSADNLFKEAKTNLGDLNGIIYSNIIHAHCQSGNMDRAEELV  405

Query  159  remeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             EMEE+GI API  +H+MM GYTI ++E+KCL++F+RLKEC FTPS+ISYGCL
Sbjct  406  HEMEEDGIDAPIDAYHSMMHGYTIIQDEKKCLIVFERLKECCFTPSIISYGCL  458


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 98/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E++ K    PS + F  ++  +   GD  RA ++ + MR  G  PT   Y 
Sbjct  537  NMDRAIRILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALDILDLMRRSGCAPTVMTYN  596

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L +       +E A++ + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE 
Sbjct  597  ALIHGLIRKNQVERAVSVLNKMSIAGITPNEHTYTIIMRGYAATGDIAKAFEYFTKIKEG  656

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L   IY  ++ A C++  M  A  + REM  + IA    +++ ++DG+    +  + 
Sbjct  657  GLKLDVYIYETLLRACCKSGRMQSALAVTREMSSQKIARNTFVYNILIDGWARRGDVWEA  716

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++KE G  P++ +Y
Sbjct  717  ADLMKQMKEDGVPPNIHTY  735


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 87/176 (49%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    D+ +   +FE+++     P+   Y  L   Y     + +A+   ++M   G
Sbjct  423  MMHGYTIIQDEKKCLIVFERLKECCFTPSIISYGCLINLYVKIGKVAKAIAISKEMESSG  482

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ +  TYS+++ GF  + +   A   F E  +       +IY  +I A C+  NMDRA 
Sbjct  483  IKHNNKTYSMLISGFIHLHDFTNAFRIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAI  542

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +L +M++E +      F  +++G+ +  + ++ L + D ++  G  P+V++Y  L
Sbjct  543  RILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALDILDLMRRSGCAPTVMTYNAL  598


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A T + +M+
Sbjct  700  YNILIDGWARRGDVWEAADLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAQTVIDEMS  759

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ ++ TY+ ++ G+A+    + A   F E K
Sbjct  760  DVGLKPNLKTYTTLIKGWARASLPDRALKCFEEMK  794


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M+++ +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  484  KHNNKTYSMLISGFIHLHDFTNAFRIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIR  543

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E ++ S   +  I+ GFA  G+++ A       +      +   Y  +I+   
Sbjct  544  ILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALDILDLMRRSGCAPTVMTYNALIHGLI  603

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++RA  +L +M   GI      +  +M GY  T +  K    F ++KE G    V 
Sbjct  604  RKNQVERAVSVLNKMSIAGITPNEHTYTIIMRGYAATGDIAKAFEYFTKIKEGGLKLDVY  663

Query  15   SYGCL  1
             Y  L
Sbjct  664  IYETL  668



>ref|XP_010319289.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X2 [Solanum lycopersicum]
Length=668

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -2

Query  576  RAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSR  397
            R F  + +  RKEFG+MVNYY RRGD HRARE FEKM +RGI PTS+ YTNL +AY V R
Sbjct  24   RLFGLLRESRRKEFGLMVNYYARRGDMHRARETFEKMCARGIEPTSHVYTNLVHAYAVGR  83

Query  396  DMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYG  217
            DMEEAL CVRKM DEGIE+S+VTYSI++GGFAKVGN+EAAE WF EAK+R  TL+A IYG
Sbjct  84   DMEEALCCVRKMKDEGIELSLVTYSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAIIYG  143

Query  216  NIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC  37
            NIIYANCQT +MDRAEEL+REMEEEG+ API I+HTMMDGYT+  NEEKCL++FDRLKEC
Sbjct  144  NIIYANCQTFHMDRAEELVREMEEEGVDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKEC  203

Query  36   GFTPSVISYGCL  1
            GFTPSV+SYGCL
Sbjct  204  GFTPSVVSYGCL  215


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ ALT 
Sbjct  382  PNEYTYTTIMHGYASLGDIEKACEYFSKIKNEGLELDIYTYEALLKACCKSGRMQSALTV  441

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         + + I A C+
Sbjct  442  TKEMSAKSIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVPPDIHTFTSFINACCK  501

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M RA + + EME  GI   +  + T++ G+      EK L  F+++K+ G  P    
Sbjct  502  AGEMQRAMKAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMKQSGLKPDKAV  561

Query  12   YGCL  1
            Y CL
Sbjct  562  YHCL  565


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + + G+  RA ++F+ MR  G +P+ + + 
Sbjct  294  NLDRALRIVEEMKKERHVPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFN  353

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R ME+A+  +  M   G+  +  TY+ I+ G+A +G++E A  +F + K  
Sbjct  354  ALVLGLVEKRQMEKAVQILDDMLLAGVGPNEYTYTTIMHGYASLGDIEKACEYFSKIKNE  413

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  414  GLELDIYTYEALLKACCKSGRMQSALTVTKEMSAKSIPRNTFVYNILIDGWARRGDVWEA  473

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + ++
Sbjct  474  ADLMQQMRQEGVPPDIHTF  492


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 81/176 (46%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++  + + G+   A   FE+ + R +   +  Y N+ YA   +  M+ A   VR+M 
Sbjct  107  YSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAIIYGNIIYANCQTFHMDRAEELVREME  166

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EG++  +  Y  ++ G+  +GN E     F   KE   T S   YG ++    +   + 
Sbjct  167  EEGVDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCLMNLYIKIGKVS  226

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+   M+  GI   +  +  +M+G+   ++      +F+ +   G  P V+ Y
Sbjct  227  KALEVSEMMKLAGIKHNMKTYSILMNGFINLKDWANAFAIFEDVIRDGLKPDVVLY  282



>ref|XP_006367145.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X1 [Solanum tuberosum]
Length=635

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  543  KEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRK  364
            KEFG+MVNYY RR D HRARE FEKM +RGI PTS+ YTNL +AY V RDMEEAL CVRK
Sbjct  2    KEFGLMVNYYARRSDMHRARETFEKMCARGIEPTSHVYTNLIHAYAVGRDMEEALCCVRK  61

Query  363  MNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCN  184
            M DEGIE+S+VTYSI++GGFAKVGN+EAAE WF EAK+R  TL+A IYGNIIYANCQT N
Sbjct  62   MKDEGIELSLVTYSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAIIYGNIIYANCQTFN  121

Query  183  MDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGC  4
            MDRAEEL+REMEEE I API I+HTMMDGYT+  NEEKCL++FDRLKECGFTPSV+SYGC
Sbjct  122  MDRAEELVREMEEEDIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGC  181

Query  3    L  1
            L
Sbjct  182  L  182


 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  349  PNEYTYTTIMHGYASLGDIGKACEYFSKVKNEGLELDIYTYEALLKACCKSGRMQSALMV  408

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         + + I A C+
Sbjct  409  TKEMSAKSIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVPPDIHTFTSFINACCK  468

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA   + EME  GI   +  + T++ G+      EK L  F+++K+ G  P    
Sbjct  469  AGDMQRAMRAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMKQSGLKPDKAV  528

Query  12   YGCL  1
            Y CL
Sbjct  529  YHCL  532


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/199 (22%), Positives = 96/199 (48%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + + G+  RA ++F+ MR  G +P+ + + 
Sbjct  261  NLDRALRIVEEMKKERHMPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFN  320

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R ME+A+  +  M   G+  +  TY+ I+ G+A +G++  A  +F + K  
Sbjct  321  ALVLGLVEKRQMEKAVQILDDMLLAGVSPNEYTYTTIMHGYASLGDIGKACEYFSKVKNE  380

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  381  GLELDIYTYEALLKACCKSGRMQSALMVTKEMSAKSIPRNTFVYNILIDGWARRGDVWEA  440

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + ++
Sbjct  441  ADLMQQMRQEGVPPDIHTF  459


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y   G++ +   +F++++  G  P+   Y  L   Y     + +A      M   G
Sbjct  147  MMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCLMNLYIKIGKVSKAFEVSEMMKLAG  206

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ ++ TYSI++ GF  + +   A   F +           +Y NII A C   N+DRA 
Sbjct  207  IKHNMKTYSILMNGFINLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNLDRAL  266

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             ++ EM++E        F  ++  +       + L +FD ++  G  PSV ++  L
Sbjct  267  RIVEEMKKERHMPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFNAL  322



>ref|XP_010319290.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X3 [Solanum lycopersicum]
Length=629

 Score =   273 bits (697),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            MVNYY RRGD HRARE FEKM +RGI PTS+ YTNL +AY V RDMEEAL CVRKM DEG
Sbjct  1    MVNYYARRGDMHRARETFEKMCARGIEPTSHVYTNLVHAYAVGRDMEEALCCVRKMKDEG  60

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            IE+S+VTYSI++GGFAKVGN+EAAE WF EAK+R  TL+A IYGNIIYANCQT +MDRAE
Sbjct  61   IELSLVTYSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAIIYGNIIYANCQTFHMDRAE  120

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EL+REMEEEG+ API I+HTMMDGYT+  NEEKCL++FDRLKECGFTPSV+SYGCL
Sbjct  121  ELVREMEEEGVDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCL  176


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ ALT 
Sbjct  343  PNEYTYTTIMHGYASLGDIEKACEYFSKIKNEGLELDIYTYEALLKACCKSGRMQSALTV  402

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         + + I A C+
Sbjct  403  TKEMSAKSIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVPPDIHTFTSFINACCK  462

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M RA + + EME  GI   +  + T++ G+      EK L  F+++K+ G  P    
Sbjct  463  AGEMQRAMKAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMKQSGLKPDKAV  522

Query  12   YGCL  1
            Y CL
Sbjct  523  YHCL  526


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + + G+  RA ++F+ MR  G +P+ + + 
Sbjct  255  NLDRALRIVEEMKKERHVPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFN  314

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R ME+A+  +  M   G+  +  TY+ I+ G+A +G++E A  +F + K  
Sbjct  315  ALVLGLVEKRQMEKAVQILDDMLLAGVGPNEYTYTTIMHGYASLGDIEKACEYFSKIKNE  374

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  375  GLELDIYTYEALLKACCKSGRMQSALTVTKEMSAKSIPRNTFVYNILIDGWARRGDVWEA  434

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + ++
Sbjct  435  ADLMQQMRQEGVPPDIHTF  453


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 81/176 (46%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++  + + G+   A   FE+ + R +   +  Y N+ YA   +  M+ A   VR+M 
Sbjct  68   YSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAIIYGNIIYANCQTFHMDRAEELVREME  127

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EG++  +  Y  ++ G+  +GN E     F   KE   T S   YG ++    +   + 
Sbjct  128  EEGVDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCLMNLYIKIGKVS  187

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A E+   M+  GI   +  +  +M+G+   ++      +F+ +   G  P V+ Y
Sbjct  188  KALEVSEMMKLAGIKHNMKTYSILMNGFINLKDWANAFAIFEDVIRDGLKPDVVLY  243



>ref|XP_004171307.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Cucumis sativus]
Length=398

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 153/195 (78%), Gaps = 16/195 (8%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
             +RN G+GF+IY G + +KSAIKAV+FDGVEFHGRVLTVKLDDGRR +K+K   R RWME
Sbjct  205  VERNAGYGFIIYDGLTADKSAIKAVEFDGVEFHGRVLTVKLDDGRR-LKEKTDERARWME  263

Query  642  GSSS--------------RN-FRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGR  508
            G  S              RN  RKV+E++PENW AVV AFERI KPSRKE+G+MVNYY R
Sbjct  264  GDDSVEYRSHWHEERDKARNGLRKVIETEPENWQAVVSAFERIKKPSRKEYGLMVNYYAR  323

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            RGD HRARE FEKMR+RGI P+S+ YTNL +AY V RDMEEAL+CVRKM +EGIE+S+VT
Sbjct  324  RGDMHRARETFEKMRARGIEPSSHVYTNLIHAYAVGRDMEEALSCVRKMKEEGIEMSLVT  383

Query  327  YSIIVGGFAKVGNVE  283
            YSI+VGGFAK GN E
Sbjct  384  YSILVGGFAKTGNAE  398



>ref|XP_009619253.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=640

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            MVNYYGRRGD HRARE FEKMR+RGI PT + YTNL +AY V+RDMEEAL+CVR+M DEG
Sbjct  1    MVNYYGRRGDMHRARETFEKMRARGIEPTVHVYTNLIHAYAVARDMEEALSCVRRMKDEG  60

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            IE+S+VTYSI+V GFAK GN+EAAE WF EAKERH TL+A IYG+IIYANCQT NMDRAE
Sbjct  61   IEMSLVTYSILVDGFAKQGNIEAAERWFKEAKERHPTLNAIIYGSIIYANCQTSNMDRAE  120

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EL+REMEEEGI API I+H MMDGYT   NE+KCL++FDRLKECGF PSV+SYGCL
Sbjct  121  ELVREMEEEGIDAPIDIYHIMMDGYTSAGNEDKCLVVFDRLKECGFAPSVVSYGCL  176


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 89/185 (48%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + +  +++ Y   GD  +A E F +++  G+    Y Y  L  A   S  M+ AL 
Sbjct  342  RPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDVYTYEALLKACCKSGRMQSALA  401

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              ++MN + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C
Sbjct  402  VTKEMNAKKIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVEPDIHTYTSFVNACC  461

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M +A   ++EM+  G+   +  + T++ G+      EK L  F+ +K+ G  P   
Sbjct  462  KAGDMQKATNTIQEMKRVGVKPNVKTYTTLIHGWARASLPEKALKCFEEMKKSGLKPDKA  521

Query  15   SYGCL  1
             Y CL
Sbjct  522  VYHCL  526


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 95/199 (48%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E++ K    P+ + F  +++ + + G   +A ++F+ MR  G +PT   Y 
Sbjct  255  NMDRALRIVEQMKKERHRPTSRTFMPIIHAFAKAGAIRKALDVFDMMRRSGCIPTVQTYN  314

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R M++A+  V +M   GI  +  TY+ I+ G+A +G+   A  +F   K+ 
Sbjct  315  ALILGLVEKRQMDKAVEVVDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDE  374

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  375  GLELDVYTYEALLKACCKSGRMQSALAVTKEMNAKKIPRNTFVYNILIDGWARRGDVWEA  434

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + +Y
Sbjct  435  ADLMQQMRQEGVEPDIHTY  453


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE +   G+ P    Y N+  A+    +M+ AL 
Sbjct  202  KHNMKTYSMLINGFIYLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNMDRALR  261

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FAK G +  A   F   +      +   Y  +I    
Sbjct  262  IVEQMKKERHRPTSRTFMPIIHAFAKAGAIRKALDVFDMMRRSGCIPTVQTYNALILGLV  321

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   MD+A E++ EM   GI      + T+MDGY    +  K    F R+K+ G    V 
Sbjct  322  EKRQMDKAVEVVDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDVY  381

Query  15   SYGCL  1
            +Y  L
Sbjct  382  TYEAL  386



>ref|XP_006367146.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X2 [Solanum tuberosum]
 ref|XP_006367147.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X3 [Solanum tuberosum]
Length=629

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            MVNYY RR D HRARE FEKM +RGI PTS+ YTNL +AY V RDMEEAL CVRKM DEG
Sbjct  1    MVNYYARRSDMHRARETFEKMCARGIEPTSHVYTNLIHAYAVGRDMEEALCCVRKMKDEG  60

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            IE+S+VTYSI++GGFAKVGN+EAAE WF EAK+R  TL+A IYGNIIYANCQT NMDRAE
Sbjct  61   IELSLVTYSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAIIYGNIIYANCQTFNMDRAE  120

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EL+REMEEE I API I+HTMMDGYT+  NEEKCL++FDRLKECGFTPSV+SYGCL
Sbjct  121  ELVREMEEEDIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCL  176


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  343  PNEYTYTTIMHGYASLGDIGKACEYFSKVKNEGLELDIYTYEALLKACCKSGRMQSALMV  402

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         + + I A C+
Sbjct  403  TKEMSAKSIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVPPDIHTFTSFINACCK  462

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA   + EME  GI   +  + T++ G+      EK L  F+++K+ G  P    
Sbjct  463  AGDMQRAMRAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMKQSGLKPDKAV  522

Query  12   YGCL  1
            Y CL
Sbjct  523  YHCL  526


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/199 (22%), Positives = 96/199 (48%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + + G+  RA ++F+ MR  G +P+ + + 
Sbjct  255  NLDRALRIVEEMKKERHMPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFN  314

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R ME+A+  +  M   G+  +  TY+ I+ G+A +G++  A  +F + K  
Sbjct  315  ALVLGLVEKRQMEKAVQILDDMLLAGVSPNEYTYTTIMHGYASLGDIGKACEYFSKVKNE  374

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  375  GLELDIYTYEALLKACCKSGRMQSALMVTKEMSAKSIPRNTFVYNILIDGWARRGDVWEA  434

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + ++
Sbjct  435  ADLMQQMRQEGVPPDIHTF  453


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y   G++ +   +F++++  G  P+   Y  L   Y     + +A      M   G
Sbjct  141  MMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCLMNLYIKIGKVSKAFEVSEMMKLAG  200

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ ++ TYSI++ GF  + +   A   F +           +Y NII A C   N+DRA 
Sbjct  201  IKHNMKTYSILMNGFINLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNLDRAL  260

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             ++ EM++E        F  ++  +       + L +FD ++  G  PSV ++  L
Sbjct  261  RIVEEMKKERHMPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFNAL  316



>ref|XP_010312517.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=635

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            MVNYYGRRGD HRARE FEKMR+RGI PT + YTNL +AY V+RDMEEAL+CVR+M DEG
Sbjct  1    MVNYYGRRGDMHRARETFEKMRARGIEPTVHVYTNLIHAYAVARDMEEALSCVRRMKDEG  60

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            IE+S+VT+SI+V GFAK+GN+EAAE  F EAKER+ TL+A IYG+IIYANCQTCNMDRAE
Sbjct  61   IEMSLVTHSILVDGFAKLGNIEAAEQCFKEAKERYLTLNAIIYGSIIYANCQTCNMDRAE  120

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            EL+REMEEEGI API I+H MMDGYT   NE+KCL++FDRLKECGFTPSV+SYGCL
Sbjct  121  ELVREMEEEGIDAPIDIYHIMMDGYTSIGNEDKCLILFDRLKECGFTPSVVSYGCL  176


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 87/185 (47%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + +  +++ Y   GD  +A E F +++  G+    Y Y  L  A   +  M+ AL 
Sbjct  342  RPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDIYTYEALLKACCKAGRMQSALA  401

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         Y + + A C
Sbjct  402  VTKEMSAKNIPRNTYVYNILIDGWARRGDVWEAADLMQQMRQEGVQPDIHTYTSFVNACC  461

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M +A   + EM+  G+   +  + T++ G+      EK L  F+ +K  G  P   
Sbjct  462  KAGDMQKATNTILEMKRIGVKPNVKTYTTLIHGWARASLPEKALKCFEEMKRSGLKPDKA  521

Query  15   SYGCL  1
             Y CL
Sbjct  522  VYHCL  526


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/199 (23%), Positives = 93/199 (47%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    VR  E + K    P+ + F  +++ + + G+  +A ++F+ MR  G +PT   + 
Sbjct  255  NIERAVRIVEEMKKERHRPTSRTFMPIIHAFAKAGEIRKALDVFDMMRRSGCIPTVQTFN  314

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L         ME+A+  + +M   GI  +  TY+ I+ G+A +G+   A  +F   K+ 
Sbjct  315  ALILGLVEKLQMEKAVQVLDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDE  374

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C+   M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  375  GLELDIYTYEALLKACCKAGRMQSALAVTKEMSAKNIPRNTYVYNILIDGWARRGDVWEA  434

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + +Y
Sbjct  435  ADLMQQMRQEGVQPDIHTY  453


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE +   G+ P    Y N+  A+    ++E A+ 
Sbjct  202  KHNMKTYSMLINGFINLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNIERAVR  261

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+  FAK G +  A   F   +      +   +  +I    
Sbjct  262  IVEEMKKERHRPTSRTFMPIIHAFAKAGEIRKALDVFDMMRRSGCIPTVQTFNALILGLV  321

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A ++L EM   GI      + T+MDGY    +  K    F R+K+ G    + 
Sbjct  322  EKLQMEKAVQVLDEMLLAGIRPNERTYTTIMDGYASLGDTGKAFEYFSRIKDEGLELDIY  381

Query  15   SYGCL  1
            +Y  L
Sbjct  382  TYEAL  386



>emb|CAE03450.1| OSJNBa0088H09.8 [Oryza sativa Japonica Group]
Length=905

 Score =   253 bits (647),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 196/320 (61%), Gaps = 76/320 (24%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGR----------RIMKD-  673
            +RN+GF F+ YGG   + +A +AV+ DGV+F GR LTV+LDDGR          R + D 
Sbjct  159  ERNVGFCFLYYGGDDADAAAERAVEVDGVDFRGRSLTVRLDDGRKGRARAEQRARWVNDG  218

Query  672  -KKKGRTRWMEG--SSSRNFRKVLESQPENWHAVVRAFERINK-----------------  553
             +++ R+ W EG   + R FR+V+ES+P+NW AVV AFERI K                 
Sbjct  219  RRREPRSPWHEGRDEACREFRRVVESRPDNWQAVVSAFERIPKLSGVVSAYFPLCKQSLD  278

Query  552  ----------------PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNL  421
                            PSR+EFG+M+ YY +RGDKH AR  FE MR+RGI P ++ +T+L
Sbjct  279  VLDLTYPFLFKKLLHEPSRREFGLMIVYYAKRGDKHHARATFENMRARGIEPNAFVFTSL  338

Query  420  TYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHA  241
             +AY V+RDM  AL+CV +M  EG+E+++VTYSI++ GFAK+ +                
Sbjct  339  VHAYAVARDMRGALSCVEEMKSEGLELTIVTYSILISGFAKINDSH--------------  384

Query  240  TLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLL  61
                           Q+ NM+RAEEL+REMEE+GI API ++H+MM GYTI +NE KCL+
Sbjct  385  ---------------QSGNMERAEELVREMEEDGIDAPIDVYHSMMHGYTIIQNENKCLV  429

Query  60   MFDRLKECGFTPSVISYGCL  1
            +F+RLKECGF PS+ISYGCL
Sbjct  430  VFERLKECGFKPSIISYGCL  449


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 90/182 (49%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS + F  ++  Y   GD   A +  + MR  G VPT   Y  L +       ++ A++
Sbjct  545  QPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAVS  604

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE    L   IY  ++ A C
Sbjct  605  VLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVYIYETLLRACC  664

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  M  A  + REM  + I     I++ ++DG+    +  +   +  ++KE G  P++ 
Sbjct  665  KSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIH  724

Query  15   SY  10
            +Y
Sbjct  725  TY  726


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 87/176 (49%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y    ++++   +FE+++  G  P+   Y  L   Y     + +AL+  ++M   G
Sbjct  414  MMHGYTIIQNENKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCG  473

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ +  TYS+++ GF  + +   A   F E          +IY  +I A C+  NMDRA 
Sbjct  474  IKHNNKTYSMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAI  533

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +L +M++E +      F  +++GY +  + +  L   D ++  G  P+V++Y  L
Sbjct  534  CILEKMQKERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNAL  589


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A   + +M 
Sbjct  691  YNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAEKVIEEMV  750

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ +V TY+ ++ G+A+V   + A   F E K
Sbjct  751  DVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMK  785


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M++N +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  475  KHNNKTYSMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAIC  534

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E ++ S   +  I+ G+A  G++++A       +      +   Y  +I+   
Sbjct  535  ILEKMQKERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLV  594

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   + RA  +L +M   GI      +  +M GY  + +  K    F ++KE G    V 
Sbjct  595  RKHKVQRAVSVLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVY  654

Query  15   SYGCL  1
             Y  L
Sbjct  655  IYETL  659


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 86/200 (43%), Gaps = 4/200 (2%)
 Frame = -2

Query  597  ENWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
            +N +  +  FER+     KPS   +G ++N Y + G   +A  + ++M S GI   +  Y
Sbjct  422  QNENKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCGIKHNNKTY  481

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            + L   +    D   A     +M   G++     Y++++  F K+GN++ A     + ++
Sbjct  482  SMLINGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQK  541

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
                 S   +  II       +M  A + L  M   G    +  ++ ++ G       ++
Sbjct  542  ERMQPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQR  601

Query  69   CLLMFDRLKECGFTPSVISY  10
             + + D++   G TP+  +Y
Sbjct  602  AVSVLDKMSIAGITPNEHTY  621



>gb|EMT10625.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=824

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/291 (47%), Positives = 186/291 (64%), Gaps = 48/291 (16%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQ---FDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRW  649
            +RN GF F+ Y  +  + +   A +    DGV+F GR LTV+LDDGR+  + + + R RW
Sbjct  109  ERNAGFCFLYYADAEGQAAEAAAERAAEVDGVDFRGRSLTVRLDDGRK-GRARAEDRARW  167

Query  648  ME---------------GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYY  514
            ++                 + R FR+V+ S PE+W AVV AFERI KPSR+EFG+M+ YY
Sbjct  168  VDHGQGKEPPSPWHHGRDEACREFRRVVGSLPEDWQAVVSAFERIPKPSRREFGLMIVYY  227

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
             +RGDKH AR  FE MR+RGI P ++ +T+L +AY V+RDM  AL+CV +M  EGIE+++
Sbjct  228  AKRGDKHHARATFENMRARGIEPNAFVFTSLVHAYAVARDMRGALSCVEEMKAEGIELTI  287

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTYSI++ GF K+ +                               Q+ NMDRAEEL+RE
Sbjct  288  VTYSILISGFGKINDAH-----------------------------QSGNMDRAEELVRE  318

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            MEE+GI API  +H+MM GYTI ++E+KCL++F+RLKEC FTPS+ISYGCL
Sbjct  319  MEEDGIDAPIDAYHSMMHGYTIIQDEKKCLIVFERLKECCFTPSIISYGCL  369


 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E++ K    PS + F  ++  +   GD  RA ++ + MR  G  PT   Y 
Sbjct  448  NMDRAIRILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALDILDLMRRSGCAPTVMTYN  507

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L +       +E A++ + KM   GI  +  TY+II+ G+A  G++  A  +F + KE 
Sbjct  508  ALIHGLIRKNQVERAVSVLNKMYIAGITPNEHTYTIIMRGYAATGDIAKAFEYFTKIKEG  567

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L   IY  ++ A C++  M  A  + REM  + I+    +++ ++DG+    +  + 
Sbjct  568  GLKLDVYIYETLLRACCKSGRMQSALAVTREMSSQKISRNTFVYNILIDGWARRGDVWEA  627

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++KE G  P++ +Y
Sbjct  628  ADLMKQMKEDGVPPNIHTY  646


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 94/196 (48%), Gaps = 3/196 (2%)
 Frame = -2

Query  582  VVRAFER--INKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            +VR  E   I+ P      MM  Y   + D+ +   +FE+++     P+   Y  L   Y
Sbjct  315  LVREMEEDGIDAPIDAYHSMMHGYTIIQ-DEKKCLIVFERLKECCFTPSIISYGCLINLY  373

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
                 + +A+   ++M   GI+ +  TYS+++ GF  + +   A   F E  +       
Sbjct  374  VKIGKVAKAIAISKEMESYGIKHNNKTYSMLISGFIHLHDFTNAFRIFEEMLKSGLQPDR  433

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
            +IY  +I A C+  NMDRA  +L +M++E +      F  +++G+ +  + ++ L + D 
Sbjct  434  AIYNLLIEAFCKMGNMDRAIRILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALDILDL  493

Query  48   LKECGFTPSVISYGCL  1
            ++  G  P+V++Y  L
Sbjct  494  MRRSGCAPTVMTYNAL  509


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M+++ +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  395  KHNNKTYSMLISGFIHLHDFTNAFRIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIR  454

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E ++ S   +  I+ GFA  G+++ A       +      +   Y  +I+   
Sbjct  455  ILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALDILDLMRRSGCAPTVMTYNALIHGLI  514

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++RA  +L +M   GI      +  +M GY  T +  K    F ++KE G    V 
Sbjct  515  RKNQVERAVSVLNKMYIAGITPNEHTYTIIMRGYAATGDIAKAFEYFTKIKEGGLKLDVY  574

Query  15   SYGCL  1
             Y  L
Sbjct  575  IYETL  579


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = -2

Query  558  NKPSRKEF--GMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEE  385
             K SR  F   ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ 
Sbjct  602  QKISRNTFVYNILIDGWARRGDVWEAADLMKQMKEDGVPPNIHTYTSYINACCKAGDMQR  661

Query  384  ALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            A T + +M D G++ ++ TY+ ++ G+A+    + A   F E K
Sbjct  662  AQTVIDEMADVGLKPNLKTYTTLIKGWARASLPDRALKCFEEMK  705



>ref|XP_002978768.1| hypothetical protein SELMODRAFT_109608, partial [Selaginella 
moellendorffii]
 gb|EFJ20215.1| hypothetical protein SELMODRAFT_109608, partial [Selaginella 
moellendorffii]
Length=713

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/276 (43%), Positives = 175/276 (63%), Gaps = 6/276 (2%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN GF FV YG SSP   A+KA + DGVEF G+ L +KLDDGR   K ++KG   + + 
Sbjct  40   ERNKGFCFVYYGSSSPGACALKAAEVDGVEFEGKKLAIKLDDGR---KSRQKGEEEYGDC  96

Query  639  S---SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEK  469
            S   +++ FR+ +E    NWH +V AF+ I+KP  +E+G++V++Y R GDK  AR  FE 
Sbjct  97   SDEPAAQRFRETMEIDAGNWHKIVNAFQVIDKPVLREYGLLVDFYARHGDKVAARATFEA  156

Query  468  MRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGN  289
            MR+  I P  + YT+L +AY  +RDME A+ C  +M  +GI+++   +  I+ G+A  GN
Sbjct  157  MRASHIKPNVHIYTSLIHAYAEARDMEGAVACTEEMLSQGIQLNEAVFCSIISGYASAGN  216

Query  288  VEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHT  109
             EAAEHWF + K  +      +Y +I+ A CQ  NM+  E LL +MEEEG    + ++ T
Sbjct  217  NEAAEHWFEKFKAENLVPGGIVYNSIVQAYCQAGNMETVEALLAQMEEEGFQGNLGLYTT  276

Query  108  MMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +++G+   R+EEKCL  F RLK CG +P+  +YGC+
Sbjct  277  VLNGFAEIRDEEKCLSFFHRLKACGLSPTAATYGCI  312


 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/179 (25%), Positives = 90/179 (50%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            F  +++ Y   G+   A   FEK ++  +VP    Y ++  AY  + +ME     + +M 
Sbjct  204  FCSIISGYASAGNNEAAEHWFEKFKAENLVPGGIVYNSIVQAYCQAGNMETVEALLAQME  263

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EG + ++  Y+ ++ GFA++ + E    +F   K    + +A+ YG I+    +  NM 
Sbjct  264  EEGFQGNLGLYTTVLNGFAEIRDEEKCLSFFHRLKACGLSPTAATYGCIVKLFTKAGNMA  323

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +A ++L EM++ G++    I+  +MDGY    +      +++ +   G  P +++Y  L
Sbjct  324  KALDILEEMDKHGVSPNKMIYAMIMDGYARGGDFTAAFKVWEDMVSAGLKPDIVTYNIL  382


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/181 (24%), Positives = 90/181 (50%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + +  +++ Y + G   +A E+F+++++ G+ P    Y +L      +R ME A   
Sbjct  409  PTIETYTSILDGYVKGGHIQKALEVFDRIKTAGLRPGVVSYNSLLSGLAKARQMENARLM  468

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M   G+  +  +Y+ +  G+A+ G+VE A   F   K+ +  +    YG ++ A C+
Sbjct  469  LDEMLANGVVPNERSYTALTEGYARAGDVEKAFGMFQRMKKENLAIDIVAYGALLKACCK  528

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            +  M RA E+ +++ + G+      + TM+DG+       K   +   +++ GF    I 
Sbjct  529  SGAMQRAVEVFQQITDAGLKHNRITYCTMLDGWARKGELSKARDLLKDMQKHGFHLDTIC  588

Query  12   Y  10
            Y
Sbjct  589  Y  589


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P++  + M+++ Y R GD   A +++E M S G+ P    Y  L +A+  +  M++AL  
Sbjct  339  PNKMIYAMIMDGYARGGDFTAAFKVWEDMVSAGLKPDIVTYNILVHAFCKAGRMDKALGV  398

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +  +    +  ++ TY+ I+ G+ K G+++ A   F   K          Y +++    +
Sbjct  399  LENIQANRLLPTIETYTSILDGYVKGGHIQKALEVFDRIKTAGLRPGVVSYNSLLSGLAK  458

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M+ A  +L EM   G+      +  + +GY    + EK   MF R+K+      +++
Sbjct  459  ARQMENARLMLDEMLANGVVPNERSYTALTEGYARAGDVEKAFGMFQRMKKENLAIDIVA  518

Query  12   YGCL  1
            YG L
Sbjct  519  YGAL  522


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 74/184 (40%), Gaps = 35/184 (19%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G +V  + + G+  +A ++ E+M   G+ P    Y  +   Y    D   A   
Sbjct  304  PTAATYGCIVKLFTKAGNMAKALDILEEMDKHGVSPNKMIYAMIMDGYARGGDFTAAFKV  363

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M   G++  +VTY+I+V  F K G                                 
Sbjct  364  WEDMVSAGLKPDIVTYNILVHAFCKAG---------------------------------  390

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               MD+A  +L  ++   +   I  + +++DGY    + +K L +FDR+K  G  P V+S
Sbjct  391  --RMDKALGVLENIQANRLLPTIETYTSILDGYVKGGHIQKALEVFDRIKTAGLRPGVVS  448

Query  12   YGCL  1
            Y  L
Sbjct  449  YNSL  452


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/184 (20%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + +  +   Y R GD  +A  MF++M+   +      Y  L  A   S  M+ A+  
Sbjct  479  PNERSYTALTEGYARAGDVEKAFGMFQRMKKENLAIDIVAYGALLKACCKSGAMQRAVEV  538

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             +++ D G++ + +TY  ++ G+A+ G +  A     + ++    L    Y + I A  +
Sbjct  539  FQQITDAGLKHNRITYCTMLDGWARKGELSKARDLLKDMQKHGFHLDTICYTSFIKACFR  598

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + + +   E L  M E+ +      + T++ G+    + ++ +  +++ K  G       
Sbjct  599  SGDTEEVTETLAVMREKKLEVNARTYTTLIHGWLAAADPDQAISCYEQAKASGLQLDSAL  658

Query  12   YGCL  1
              CL
Sbjct  659  SNCL  662



>ref|XP_001771925.1| predicted protein [Physcomitrella patens]
 gb|EDQ63186.1| predicted protein [Physcomitrella patens]
Length=831

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 181/290 (62%), Gaps = 17/290 (6%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKD-----------  673
            ++N GF F+ +GG  P  +A +A + DG  F G+ + VK+DDGR                
Sbjct  87   EKNKGFCFLFFGGPDPNAAASRAAELDGANFFGKPMRVKIDDGRWERDRREQRERWIESG  146

Query  672  -KKKGRTRWM--EGSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRG  502
             +++ R+ W      +S+ FR ++E  P++   VV AF+RI KP +++  ++VNYYG+RG
Sbjct  147  AEREPRSDWHVEREKASKGFRNLVEDHPKDARKVVDAFKRIKKPKQRDHTLLVNYYGKRG  206

Query  501  DKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYS  322
            DKH AR  FE MR+ GI P  + YTNL +AY V++D+  A+ CV +M  EG+  +  TYS
Sbjct  207  DKHSARAAFESMRAAGIEPNVHSYTNLIHAYAVAQDLRGAIACVEEMEAEGVSPNAATYS  266

Query  321  IIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeE  142
            +I+ G+ ++G+VEAAE WF  A   +   +  IY NII+A C+  NM+RAE ++  MEE+
Sbjct  267  VIISGYGRLGDVEAAERWFQRALSENWHHNDVIYNNIIHAYCKAGNMERAEAIMTAMEEQ  326

Query  141  GIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK---ECGFTPSVISYGCL  1
            G+ A + +++ +MDGY   R  +KCL +F RLK   E G +P+V+SYGCL
Sbjct  327  GLEATLGLYNMLMDGYVHCRAVDKCLNVFRRLKARTETGLSPTVVSYGCL  376


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 90/185 (49%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K +RK + M+++ Y + GD   A  +FE M + GI P    Y  L  A+  +  M  AL 
Sbjct  402  KHNRKTYSMIIDGYVQLGDTANAFSVFEDMSNAGIKPDGITYNILMNAFCKNGQMNRALE  461

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M       ++ TY+II+ GF K+G++  A     + K      SA+ Y  I++   
Sbjct  462  LLARMESGDCPPTLRTYTIIIDGFMKIGDLRMAFETVRDMKMAGFRPSAATYNVIMHGLA  521

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            Q   MDRA  ++ EM   G+      + T+++GY    +       F+R+KE G  P VI
Sbjct  522  QAGQMDRAASIIDEMVVAGVHPNERSYTTLIEGYACIGDMGLAFKYFNRIKEVGLKPDVI  581

Query  15   SYGCL  1
            +Y  L
Sbjct  582  AYASL  586


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/181 (20%), Positives = 84/181 (46%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + + ++++ + + GD   A E    M+  G  P++  Y  + +    +  M+ A + 
Sbjct  473  PTLRTYTIIIDGFMKIGDLRMAFETVRDMKMAGFRPSAATYNVIMHGLAQAGQMDRAASI  532

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M   G+  +  +Y+ ++ G+A +G++  A  +F   KE         Y +++ A C+
Sbjct  533  IDEMVVAGVHPNERSYTTLIEGYACIGDMGLAFKYFNRIKEVGLKPDVIAYASLLKACCK  592

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M     +  EM   G+     I++ ++DG+    +  +   +  +++  G TP + S
Sbjct  593  AGRMQSTLAITAEMAAAGVPMNNYIYNILLDGWAQRGDMWEASDIMQKMRHEGLTPDIHS  652

Query  12   Y  10
            Y
Sbjct  653  Y  653


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/240 (23%), Positives = 100/240 (42%), Gaps = 30/240 (13%)
 Frame = -2

Query  639  SSSRNFRKVLESQPENWH-------AVVRAFERINKPSRKE-----------------FG  532
            ++ R F++ L    ENWH        ++ A+ +     R E                 + 
Sbjct  280  AAERWFQRALS---ENWHHNDVIYNNIIHAYCKAGNMERAEAIMTAMEEQGLEATLGLYN  336

Query  531  MMVNYYGRRGDKHRAREMFEKMRSR---GIVPTSYEYTNLTYAYTVSRDMEEALTCVRKM  361
            M+++ Y       +   +F ++++R   G+ PT   Y  L   Y+    M++AL    +M
Sbjct  337  MLMDGYVHCRAVDKCLNVFRRLKARTETGLSPTVVSYGCLINLYSKLGKMDKALQISNEM  396

Query  360  NDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNM  181
             D+GI+ +  TYS+I+ G+ ++G+   A   F +            Y  ++ A C+   M
Sbjct  397  EDQGIKHNRKTYSMIIDGYVQLGDTANAFSVFEDMSNAGIKPDGITYNILMNAFCKNGQM  456

Query  180  DRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +RA ELL  ME       +  +  ++DG+    +          +K  GF PS  +Y  +
Sbjct  457  NRALELLARMESGDCPPTLRTYTIIIDGFMKIGDLRMAFETVRDMKMAGFRPSAATYNVI  516


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + +RGD   A ++ +KMR  G+ P  + YT+   A   + DM +A   + +M 
Sbjct  618  YNILLDGWAQRGDMWEASDIMQKMRHEGLTPDIHSYTSFINACCKAGDMLKATETIEQMK  677

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAA  277
             +G++ ++  Y+ ++ G+A     E A
Sbjct  678  QQGVQPNLQAYTTLIHGWASASYPEKA  704



>ref|XP_002984681.1| hypothetical protein SELMODRAFT_30598, partial [Selaginella moellendorffii]
 gb|EFJ14326.1| hypothetical protein SELMODRAFT_30598, partial [Selaginella moellendorffii]
Length=651

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 165/262 (63%), Gaps = 6/262 (2%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN GF FV YG SSP   A+KA + DGVEF G+ L +KLDDGR   K ++KG   + + 
Sbjct  40   ERNKGFCFVYYGSSSPGACALKAAEVDGVEFEGKRLAIKLDDGR---KSRQKGEEEYGDC  96

Query  639  S---SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEK  469
            S   +++ FR+ +E    NWH +V AF+ I+KP  +E+G++V++Y R GDK  AR  FE 
Sbjct  97   SDEPAAQRFRETMEIDAGNWHKIVNAFQVIDKPVLREYGLLVDFYARHGDKVAARATFEA  156

Query  468  MRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGN  289
            MR+  I P  + YT+L +AY  +RDME A+ C  +M  +GI+++   +  I+ G+A  GN
Sbjct  157  MRASHIKPNVHIYTSLIHAYAEARDMEGAVACTEEMLSQGIQLNEAVFCSIISGYASAGN  216

Query  288  VEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHT  109
             EAAEHWF + K  +      +Y +I+ A CQ  NM+  E LL +MEEEG    + ++ T
Sbjct  217  NEAAEHWFEKFKAENLVPGGIVYNSIVQAYCQAGNMETVEALLAQMEEEGFQGNLGLYTT  276

Query  108  MMDGYTITRNEEKCLLMFDRLK  43
            +++G+   R+EEKCL  F RLK
Sbjct  277  VLNGFAEIRDEEKCLSFFHRLK  298


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/211 (25%), Positives = 98/211 (46%), Gaps = 4/211 (2%)
 Frame = -2

Query  621  RKVLESQPENWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRG  454
            R  +  Q  N    +   E ++K    P++  + M+++ Y R GD   A +++E M S G
Sbjct  296  RLKVSPQAGNMAKALDILEEMDKHGVSPNKMIYAMIMDGYARGGDFTAAFKVWEDMVSAG  355

Query  453  IVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAE  274
            + P    Y  L +A+  +  M++AL  +  +    +  ++ TY+ I+ G+ K GN++ A 
Sbjct  356  LKPDIVIYNILVHAFCKAGRMDKALGVLENIEANRLLPTIETYTSILDGYVKGGNIQKAL  415

Query  273  HWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGY  94
              F   K          Y +++    +   M+ A  +L EM   G+     I+  + +GY
Sbjct  416  EVFDRIKTAGLRPGVVSYNSLLSGLAKARQMENARLMLNEMLANGVVPSERIYTALTEGY  475

Query  93   TITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              T + EK   +F R+K+      +++YG L
Sbjct  476  ARTGDVEKAFGVFQRMKKENLAIDIVAYGAL  506


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 89/185 (48%), Gaps = 1/185 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + +  +++ Y + G+  +A E+F+++++ G+ P    Y +L      +R ME A   
Sbjct  393  PTIETYTSILDGYVKGGNIQKALEVFDRIKTAGLRPGVVSYNSLLSGLAKARQMENARLM  452

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M   G+  S   Y+ +  G+A+ G+VE A   F   K+ +  +    YG ++ A C 
Sbjct  453  LNEMLANGVVPSERIYTALTEGYARTGDVEKAFGVFQRMKKENLAIDIVAYGALLKACCN  512

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDG-YTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  M  A E+ +++ + G+      + TM+DG Y      E+   +   ++  G  P  +
Sbjct  513  SGAMHGAAEVFQQITDAGLKHNQITYCTMLDGAYARAGRVEEAEELVSAMERDGTKPDTL  572

Query  15   SYGCL  1
             Y  L
Sbjct  573  IYNSL  577



>ref|XP_006367148.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X4 [Solanum tuberosum]
Length=592

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  VSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS  226
            + RDMEEAL CVRKM DEGIE+S+VTYSI++GGFAKVGN+EAAE WF EAK+R  TL+A 
Sbjct  5    MGRDMEEALCCVRKMKDEGIELSLVTYSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAI  64

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
            IYGNIIYANCQT NMDRAEEL+REMEEE I API I+HTMMDGYT+  NEEKCL++FDRL
Sbjct  65   IYGNIIYANCQTFNMDRAEELVREMEEEDIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRL  124

Query  45   KECGFTPSVISYGCL  1
            KECGFTPSV+SYGCL
Sbjct  125  KECGFTPSVVSYGCL  139


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  306  PNEYTYTTIMHGYASLGDIGKACEYFSKVKNEGLELDIYTYEALLKACCKSGRMQSALMV  365

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         + + I A C+
Sbjct  366  TKEMSAKSIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVPPDIHTFTSFINACCK  425

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA   + EME  GI   +  + T++ G+      EK L  F+++K+ G  P    
Sbjct  426  AGDMQRAMRAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMKQSGLKPDKAV  485

Query  12   YGCL  1
            Y CL
Sbjct  486  YHCL  489


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/199 (22%), Positives = 96/199 (48%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + + G+  RA ++F+ MR  G +P+ + + 
Sbjct  218  NLDRALRIVEEMKKERHMPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFN  277

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R ME+A+  +  M   G+  +  TY+ I+ G+A +G++  A  +F + K  
Sbjct  278  ALVLGLVEKRQMEKAVQILDDMLLAGVSPNEYTYTTIMHGYASLGDIGKACEYFSKVKNE  337

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  338  GLELDIYTYEALLKACCKSGRMQSALMVTKEMSAKSIPRNTFVYNILIDGWARRGDVWEA  397

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + ++
Sbjct  398  ADLMQQMRQEGVPPDIHTF  416


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y   G++ +   +F++++  G  P+   Y  L   Y     + +A      M   G
Sbjct  104  MMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCLMNLYIKIGKVSKAFEVSEMMKLAG  163

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ ++ TYSI++ GF  + +   A   F +           +Y NII A C   N+DRA 
Sbjct  164  IKHNMKTYSILMNGFINLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNLDRAL  223

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             ++ EM++E        F  ++  +       + L +FD ++  G  PSV ++  L
Sbjct  224  RIVEEMKKERHMPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFNAL  279



>ref|XP_010909109.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=858

 Score =   212 bits (540),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/311 (39%), Positives = 171/311 (55%), Gaps = 39/311 (13%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            +RN+G+ FVIYGG + E+SA +AV+FDG+EFHGR+LTV+LDDGRR +K + + R RW+ G
Sbjct  168  ERNVGYCFVIYGGPTVEESAARAVEFDGMEFHGRILTVRLDDGRR-LKARSEERARWVAG  226

Query  639  SSSRNFR---------------KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            S  R FR               KVLE+QPENW AVV AFER+ KPSR+E+G+MVNYY RR
Sbjct  227  SDQREFRSKWHEERDNACRIFRKVLETQPENWQAVVSAFERLQKPSRREYGLMVNYYARR  286

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYT-----------------------NLTYAYTVSRD  394
            GDKH AR  FE MR+RG+ P+SY YT                       N+ YA+  + +
Sbjct  287  GDKHHARATFESMRARGVEPSSYVYTKSADRLFKEAKQKITSMNAIIYSNIIYAHCQTGN  346

Query  393  MEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGN  214
            M  A   VR+M +EGI+  +  Y  ++ G+  + N E     F   KE   T S   YG 
Sbjct  347  MARAEDLVREMEEEGIDAPIDLYHTMMDGYTNIRNEEKCLIVFERLKECGFTPSVISYGC  406

Query  213  IIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECG  34
            +I    +   + +A E+ + M   GI      +  +++G+    +      +F+ + + G
Sbjct  407  LINLYTKIGKVSKALEVGKMMNSYGIRHNSKTYSMLINGFIQLNDYANAFSIFEEMLQSG  466

Query  33   FTPSVISYGCL  1
              P  I Y  +
Sbjct  467  LKPDAILYNII  477


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 89/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            ++PS + F  ++  +    D  RA E+F+ MR  G VPT   Y  L         ME+A+
Sbjct  502  HRPSARTFRPIIYGFAAARDMKRALEIFDLMRQSGCVPTVETYNVLILGLVRKHQMEKAI  561

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + KM+  GI  +  TY+ ++ G+A  G+   A  +F + KE+   L    Y  ++ A 
Sbjct  562  EVIDKMSLAGITPNEHTYTTVMQGYAADGDTGKAFEYFTKIKEKGLKLDVFTYEALLKAC  621

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + REM  + I     +++ ++DG+    +  +   +  ++K+ G  P +
Sbjct  622  CKSGRMQSALAVTREMSAQKIPRNTFVYNILIDGWARRGDVWEAADLMQQMKQDGVLPDI  681

Query  18   ISY  10
             +Y
Sbjct  682  HTY  684


 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 90/192 (47%), Gaps = 6/192 (3%)
 Frame = -2

Query  570  FERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+ +    PS   +G ++N Y + G   +A E+ + M S GI   S  Y+ L   +  
Sbjct  389  FERLKECGFTPSVISYGCLINLYTKIGKVSKALEVGKMMNSYGIRHNSKTYSMLINGFIQ  448

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE-AKERHATLSAS  226
              D   A +   +M   G++   + Y+II+  F K+GN++ A     +  KERH   SA 
Sbjct  449  LNDYANAFSIFEEMLQSGLKPDAILYNIIINAFCKMGNIDRAIRLVDKMQKERHRP-SAR  507

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             +  IIY      +M RA E+   M + G    +  ++ ++ G       EK + + D++
Sbjct  508  TFRPIIYGFAAARDMKRALEIFDLMRQSGCVPTVETYNVLILGLVRKHQMEKAIEVIDKM  567

Query  45   KECGFTPSVISY  10
               G TP+  +Y
Sbjct  568  SLAGITPNEHTY  579


 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 92/189 (49%), Gaps = 1/189 (1%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E I+ P      MM  Y   R ++ +   +FE+++  G  P+   Y  L   YT    + 
Sbjct  360  EGIDAPIDLYHTMMDGYTNIRNEE-KCLIVFERLKECGFTPSVISYGCLINLYTKIGKVS  418

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +AL   + MN  GI  +  TYS+++ GF ++ +   A   F E  +      A +Y  II
Sbjct  419  KALEVGKMMNSYGIRHNSKTYSMLINGFIQLNDYANAFSIFEEMLQSGLKPDAILYNIII  478

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
             A C+  N+DRA  L+ +M++E        F  ++ G+   R+ ++ L +FD +++ G  
Sbjct  479  NAFCKMGNIDRAIRLVDKMQKERHRPSARTFRPIIYGFAAARDMKRALEIFDLMRQSGCV  538

Query  27   PSVISYGCL  1
            P+V +Y  L
Sbjct  539  PTVETYNVL  547


 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 81/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  543  KEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRK  364
            K + M++N + +  D   A  +FE+M   G+ P +  Y  +  A+    +++ A+  V K
Sbjct  437  KTYSMLINGFIQLNDYANAFSIFEEMLQSGLKPDAILYNIIINAFCKMGNIDRAIRLVDK  496

Query  363  MNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCN  184
            M  E    S  T+  I+ GFA   +++ A   F   ++     +   Y  +I    +   
Sbjct  497  MQKERHRPSARTFRPIIYGFAAARDMKRALEIFDLMRQSGCVPTVETYNVLILGLVRKHQ  556

Query  183  MDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGC  4
            M++A E++ +M   GI      + T+M GY    +  K    F ++KE G    V +Y  
Sbjct  557  MEKAIEVIDKMSLAGITPNEHTYTTVMQGYAADGDTGKAFEYFTKIKEKGLKLDVFTYEA  616

Query  3    L  1
            L
Sbjct  617  L  617


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G++P  + YT+   A   + DM+ A   V +M 
Sbjct  649  YNILIDGWARRGDVWEAADLMQQMKQDGVLPDIHTYTSFINACCKAGDMQRATKMVEEME  708

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
              G++ +V TY+ ++ G+A+    E A   F E K
Sbjct  709  AAGVKPNVKTYTTLIRGWAQASLPEKALRCFEEMK  743



>ref|XP_001763946.1| predicted protein [Physcomitrella patens]
 gb|EDQ71350.1| predicted protein [Physcomitrella patens]
Length=727

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/272 (39%), Positives = 175/272 (64%), Gaps = 12/272 (4%)
 Frame = -2

Query  807  GFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEGSSSR  628
            G+ F+ +GG  P  +A++AV+ DG EF+G++L VK+D       +K+K         +S 
Sbjct  45   GYCFLFFGGPDPHSAAMRAVELDGAEFYGKLLRVKVDYRSWQPHEKEK---------ASN  95

Query  627  NFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIV  448
             F+K++E QP+    VV AF+RI+K   +++ ++++YYG+RGDK  AR  FEKMR+ GI 
Sbjct  96   TFKKLIEEQPKEVRKVVNAFKRIDKAVERDYALLIHYYGKRGDKRGARVTFEKMRAAGID  155

Query  447  PTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHW  268
             + + Y NL  AY ++++++ A++CV +M  EGI  +  T+S I+ G+   GNVEAAE W
Sbjct  156  SSVHAYNNLIRAYIMAQNLQGAVSCVEEMEIEGIFPNAATFSAIISGYGSSGNVEAAEKW  215

Query  267  FLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTI  88
            F  +   +   + +IY +II+A C+  NM+RAE L+ +MEE+G+ A + +++ +MDGY  
Sbjct  216  FQRSVSENWNHNVAIYSSIIHAYCKAGNMERAEALVADMEEQGLEATLGLYNILMDGYAR  275

Query  87   TRNEEKCLLMFDRLK---ECGFTPSVISYGCL  1
               E +CL +F +LK   + G +P+ ++YGCL
Sbjct  276  CHIEAQCLNVFHKLKARIDTGLSPTAVTYGCL  307


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 81/183 (44%), Gaps = 0/183 (0%)
 Frame = -2

Query  549  SRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCV  370
            +R  + M+V+ Y + GD   A  +FE M   GI P    Y  L  A+  SR M  A+  +
Sbjct  335  NRNTYSMLVDGYVQLGDFANAFSVFEDMSEAGIEPDWVTYNILLKAFCKSRQMTRAIQLL  394

Query  369  RKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQT  190
             +M   G   ++ TY  I+ GF K G+V  A     E K      +A+ Y  I++   Q 
Sbjct  395  GRMKTRGCSPTIQTYITIIDGFMKTGDVRMAYKTVSEMKLAGCRPNATTYNVIMHNLVQL  454

Query  189  CNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
              +DRA  ++ EME  G+      + T+M G+              R+ E    P +ISY
Sbjct  455  GQIDRAASVIDEMELAGVQPNFRSYTTLMQGFASIGEIGLAFKCLKRVNEITQKPPIISY  514

Query  9    GCL  1
              L
Sbjct  515  ASL  517


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 88/182 (48%), Gaps = 3/182 (2%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSR---GIVPTSYEYTNLTYAYTVSRDMEEALTCVR  367
            + ++++ Y R   + +   +F K+++R   G+ PT+  Y  L   YT    M +AL   +
Sbjct  266  YNILMDGYARCHIEAQCLNVFHKLKARIDTGLSPTAVTYGCLINLYTKLGKMMKALEFCK  325

Query  366  KMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTC  187
            +M  +GI ++  TYS++V G+ ++G+   A   F +  E         Y  ++ A C++ 
Sbjct  326  EMKAQGITLNRNTYSMLVDGYVQLGDFANAFSVFEDMSEAGIEPDWVTYNILLKAFCKSR  385

Query  186  NMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYG  7
             M RA +LL  M+  G +  I  + T++DG+  T +          +K  G  P+  +Y 
Sbjct  386  QMTRAIQLLGRMKTRGCSPTIQTYITIIDGFMKTGDVRMAYKTVSEMKLAGCRPNATTYN  445

Query  6    CL  1
             +
Sbjct  446  VI  447


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            F  +++ + +RGD   A  + +KMR  G  P  + YT+   A   + DM++A   + +M 
Sbjct  549  FNTLLDGWAQRGDMWEAYGIMQKMRQEGFTPDIHSYTSFVNACCKAGDMQKATETIEEMK  608

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
             + ++ ++ TY+I++ G+  V + E A   + E K         +Y  I+
Sbjct  609  QQDLQPNLQTYTILIHGWTSVSHPEKALICYDEMKAAGLIPDKPLYYCIV  658


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/220 (18%), Positives = 92/220 (42%), Gaps = 35/220 (16%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   + ++++   + G   RA  + ++M   G+ P    YT L   +    ++  A  
Sbjct  438  RPNATTYNVIMHNLVQLGQIDRAASVIDEMELAGVQPNFRSYTTLMQGFASIGEIGLAFK  497

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAA---------------------------  277
            C++++N+   +  +++Y+ ++    K G ++ A                           
Sbjct  498  CLKRVNEITQKPPIISYASLLKACCKAGRMQNAIAVTEEMAFAGVPMNNYIFNTLLDGWA  557

Query  276  ------EHWFLEAKERHATLSASI--YGNIIYANCQTCNMDRAeellremeeEGIAAPIS  121
                  E + +  K R    +  I  Y + + A C+  +M +A E + EM+++ +   + 
Sbjct  558  QRGDMWEAYGIMQKMRQEGFTPDIHSYTSFVNACCKAGDMQKATETIEEMKQQDLQPNLQ  617

Query  120  IFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +  ++ G+T   + EK L+ +D +K  G  P    Y C+
Sbjct  618  TYTILIHGWTSVSHPEKALICYDEMKAAGLIPDKPLYYCI  657



>ref|XP_006367149.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X5 [Solanum tuberosum]
 ref|XP_006367150.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like isoform X6 [Solanum tuberosum]
Length=584

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  393  MEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGN  214
            MEEAL CVRKM DEGIE+S+VTYSI++GGFAKVGN+EAAE WF EAK+R  TL+A IYGN
Sbjct  1    MEEALCCVRKMKDEGIELSLVTYSILIGGFAKVGNIEAAERWFEEAKKRDLTLNAIIYGN  60

Query  213  IIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECG  34
            IIYANCQT NMDRAEEL+REMEEE I API I+HTMMDGYT+  NEEKCL++FDRLKECG
Sbjct  61   IIYANCQTFNMDRAEELVREMEEEDIDAPIDIYHTMMDGYTMIGNEEKCLIVFDRLKECG  120

Query  33   FTPSVISYGCL  1
            FTPSV+SYGCL
Sbjct  121  FTPSVVSYGCL  131


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A E F K+++ G+    Y Y  L  A   S  M+ AL  
Sbjct  298  PNEYTYTTIMHGYASLGDIGKACEYFSKVKNEGLELDIYTYEALLKACCKSGRMQSALMV  357

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + ++         + + I A C+
Sbjct  358  TKEMSAKSIPRNTFVYNILIDGWARRGDVWEAADLMQQMRQEGVPPDIHTFTSFINACCK  417

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA   + EME  GI   +  + T++ G+      EK L  F+++K+ G  P    
Sbjct  418  AGDMQRAMRAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMKQSGLKPDKAV  477

Query  12   YGCL  1
            Y CL
Sbjct  478  YHCL  481


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/199 (22%), Positives = 96/199 (48%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E + K    P+ + F  +++ + + G+  RA ++F+ MR  G +P+ + + 
Sbjct  210  NLDRALRIVEEMKKERHMPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFN  269

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L       R ME+A+  +  M   G+  +  TY+ I+ G+A +G++  A  +F + K  
Sbjct  270  ALVLGLVEKRQMEKAVQILDDMLLAGVSPNEYTYTTIMHGYASLGDIGKACEYFSKVKNE  329

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L    Y  ++ A C++  M  A  + +EM  + I     +++ ++DG+    +  + 
Sbjct  330  GLELDIYTYEALLKACCKSGRMQSALMVTKEMSAKSIPRNTFVYNILIDGWARRGDVWEA  389

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++++ G  P + ++
Sbjct  390  ADLMQQMRQEGVPPDIHTF  408


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            M++ Y   G++ +   +F++++  G  P+   Y  L   Y     + +A      M   G
Sbjct  96   MMDGYTMIGNEEKCLIVFDRLKECGFTPSVVSYGCLMNLYIKIGKVSKAFEVSEMMKLAG  155

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ ++ TYSI++ GF  + +   A   F +           +Y NII A C   N+DRA 
Sbjct  156  IKHNMKTYSILMNGFINLKDWANAFAIFEDVIRDGLKPDVVLYNNIIRAFCGMGNLDRAL  215

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             ++ EM++E        F  ++  +       + L +FD ++  G  PSV ++  L
Sbjct  216  RIVEEMKKERHMPNSRTFMPIIHAFAKAGEVRRALDVFDMMRRSGCIPSVHTFNAL  271



>ref|XP_010262940.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X2 [Nelumbo nucifera]
Length=616

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  VSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS  226
            + RDM EAL+C+RKM +EGIE S+VTYSIIVGGFAK+G+ EAA+ WF EAKERH TL+A 
Sbjct  5    IGRDMNEALSCLRKMKEEGIEASLVTYSIIVGGFAKIGDAEAADKWFKEAKERHTTLNAI  64

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
            IYGNIIYA+CQTCNMDRAEEL++EMEEEGI API I+HTMMDGYT   NEEKCL++F+RL
Sbjct  65   IYGNIIYAHCQTCNMDRAEELVKEMEEEGIDAPIDIYHTMMDGYTNIGNEEKCLIVFERL  124

Query  45   KECGFTPSVISYGCL  1
            KECGF PSVIS GCL
Sbjct  125  KECGFRPSVISLGCL  139


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 87/183 (48%), Gaps = 11/183 (6%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G+  R  R V E Q E            ++P+ + F  +++ + + G+  RA ++F  MR
Sbjct  217  GNMDRAIRIVEEMQKEK-----------HRPTSRTFMPIIHGFAKAGEMRRALQVFNMMR  265

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G +PT + +  L       R ME+AL  V +M   G+  +  TY+ I+ G+A  G+  
Sbjct  266  RCGCIPTVHNFNALVLGLVEKRQMEKALEVVDEMLHAGVNPNEHTYTTIMHGYASQGDTG  325

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             A  +F + KE    L    Y  ++ A C++  M  A  + REM  + I     +++ ++
Sbjct  326  KAFEYFTKIKEEGLELDVFSYQALLKACCKSGRMQSALAVTREMSAQKIPRNTFVYNILI  385

Query  102  DGY  94
            DG+
Sbjct  386  DGW  388


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M+VN + +  D   A  +FE +   G+ P    Y N+  A+    +M+ A+ 
Sbjct  165  KHNMKTYSMLVNGFLKLNDWANAFAIFEDVVKTGLKPDVVLYNNIIRAFCGMGNMDRAIR  224

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V +M  E    +  T+  I+ GFAK G +  A   F   +      +   +  ++    
Sbjct  225  IVEEMQKEKHRPTSRTFMPIIHGFAKAGEMRRALQVFNMMRRCGCIPTVHNFNALVLGLV  284

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M++A E++ EM   G+      + T+M GY    +  K    F ++KE G    V 
Sbjct  285  EKRQMEKALEVVDEMLHAGVNPNEHTYTTIMHGYASQGDTGKAFEYFTKIKEEGLELDVF  344

Query  15   SYGCL  1
            SY  L
Sbjct  345  SYQAL  349


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 83/192 (43%), Gaps = 6/192 (3%)
 Frame = -2

Query  570  FERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            FER+     +PS    G ++N Y + G   +A E+ + M S GI      Y+ L   +  
Sbjct  121  FERLKECGFRPSVISLGCLINLYTKIGKVSKALEIGKLMESCGIKHNMKTYSMLVNGFLK  180

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE-AKERHATLSAS  226
              D   A      +   G++  VV Y+ I+  F  +GN++ A     E  KE+H   S +
Sbjct  181  LNDWANAFAIFEDVVKTGLKPDVVLYNNIIRAFCGMGNMDRAIRIVEEMQKEKHRPTSRT  240

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             +  II+   +   M RA ++   M   G    +  F+ ++ G    R  EK L + D +
Sbjct  241  -FMPIIHGFAKAGEMRRALQVFNMMRRCGCIPTVHNFNALVLGLVEKRQMEKALEVVDEM  299

Query  45   KECGFTPSVISY  10
               G  P+  +Y
Sbjct  300  LHAGVNPNEHTY  311


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++MR   ++P  + YT+   A   + DM+ A   V +M 
Sbjct  381  YNILIDGWARRGDVWEAADLMQQMRQERVLPDIHTYTSFINACCKAGDMQRATKTVEEME  440

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
              G++ +V TY+ ++ G+A+    E A   F + K        ++Y
Sbjct  441  VIGVQPNVKTYTTLIHGWARASLPEKALRCFEDMKSAGLKPDKAVY  486



>ref|XP_008363252.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103426950 
[Malus domestica]
Length=724

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/280 (43%), Positives = 155/280 (55%), Gaps = 9/280 (3%)
 Frame = -2

Query  822  TDRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWME  643
            T+ N GFGFVIYGG++  KSA+KAV+FDGVEFHGRVLTVKLDDGRR +KD    R RW+E
Sbjct  410  TELNAGFGFVIYGGTTAAKSAMKAVEFDGVEFHGRVLTVKLDDGRR-LKDXTDERARWLE  468

Query  642  GSSSRNFRKVLESQ------PENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRARE  481
            G     +R     +      PENW AVVR FERINKPSR E+G+MV  Y R+GD HRARE
Sbjct  469  GYDGVXYRSQWHKERESSRXPENWQAVVRVFERINKPSRGEYGLMVKXYARQGDMHRARE  528

Query  480  MFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFA  301
             F  MR+RGI P+S+ YT    A     +M+ A+  VR+M  E    +  T+  I  GFA
Sbjct  529  TFASMRARGIEPSSHVYTRT--AVXGMGNMDRAIRTVREMQRERHRPTSRTFMPIJHGFA  586

Query  300  KVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPIS  121
            + G +  A   F   +      +   +  ++    +   M RA E+L  M   GI     
Sbjct  587  RAGEMRRALEXFDMMRMSGCIPTVHTFNALVLGLVEKRQMQRAVEILDAMTLAGIIPDEH  646

Query  120  IFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             + T+M GY    +  K    F +L+  G    V +Y  L
Sbjct  647  TYTTIMHGYASLGDNGKAFECFTKLRSEGLELDVFTYEAL  686


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 79/182 (43%), Gaps = 11/182 (6%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G+  R  R V E Q E            ++P+ + F  + + + R G+  RA E F+ MR
Sbjct  554  GNMDRAIRTVREMQRER-----------HRPTSRTFMPIJHGFARAGEMRRALEXFDMMR  602

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G +PT + +  L       R M+ A+  +  M   GI     TY+ I+ G+A +G+  
Sbjct  603  MSGCIPTVHTFNALVLGLVEKRQMQRAVEILDAMTLAGIIPDEHTYTTIMHGYASLGDNG  662

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             A   F + +     L    Y  ++ A C+   M  A  +  EM  + I     I++ ++
Sbjct  663  KAFECFTKLRSEGLELDVFTYEALLKACCKAGRMQSALAVTTEMGAKNIPRNTFIYNILI  722

Query  102  DG  97
            DG
Sbjct  723  DG  724



>ref|XP_002994591.1| hypothetical protein SELMODRAFT_138844, partial [Selaginella 
moellendorffii]
 gb|EFJ04342.1| hypothetical protein SELMODRAFT_138844, partial [Selaginella 
moellendorffii]
Length=599

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 127/198 (64%), Gaps = 0/198 (0%)
 Frame = -2

Query  594  NWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTY  415
            NWH +V AF+ I+KP  +E+G++V++Y R GDK  AR  FE MR+  I P  + YT+L +
Sbjct  1    NWHKIVNAFQVIDKPVLREYGLLVDFYARHGDKVAARATFEAMRASHIKPNVHIYTSLIH  60

Query  414  AYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATL  235
            AY  +RDME A+ C  +M  +GI+++   +  I+ G+A  GN EAAEHWF + K  +   
Sbjct  61   AYAEARDMEGAVACTEEMLSQGIQLNEAVFCSIISGYASAGNNEAAEHWFEKFKAENLVP  120

Query  234  SASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMF  55
               +Y +I+ A CQ  NM+  E LL +MEEEG    + ++ T+++G+   R+EEKCL  F
Sbjct  121  GGIVYNSIVQAYCQAGNMETVEALLAQMEEEGFQGNLGLYTTVLNGFAEIRDEEKCLSFF  180

Query  54   DRLKECGFTPSVISYGCL  1
             RLK CG +P+  +YGC+
Sbjct  181  HRLKACGLSPTAATYGCI  198


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/179 (25%), Positives = 89/179 (50%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            F  +++ Y   G+   A   FEK ++  +VP    Y ++  AY  + +ME     + +M 
Sbjct  90   FCSIISGYASAGNNEAAEHWFEKFKAENLVPGGIVYNSIVQAYCQAGNMETVEALLAQME  149

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EG + ++  Y+ ++ GFA++ + E    +F   K    + +A+ YG I+    +  NM 
Sbjct  150  EEGFQGNLGLYTTVLNGFAEIRDEEKCLSFFHRLKACGLSPTAATYGCIVKLFTKAGNMA  209

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +A ++L EM++ G++    I+  +MDGY    +      +++ +   G  P ++ Y  L
Sbjct  210  KALDILEEMDKHGVSPNKMIYAMIMDGYARGGDFTAAFKVWEDMVSAGLKPDIVIYNIL  268


 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/181 (24%), Positives = 92/181 (51%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + +  +++ Y + G+  +A E+F+++++ G+ P    Y +L      +R ME A   
Sbjct  295  PTIETYTSILDGYVKGGNIQKALEVFDRIKTAGLRPGVVSYNSLLSGLAKARQMENARLM  354

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M   G+  +  +Y+ +  G+A+ G+VE A   F   K+ +  +    YG ++ A C+
Sbjct  355  LNEMLANGVVPNERSYTALTEGYARAGDVEKAFGMFQRMKKENLAIDIVAYGALLKACCK  414

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            +  M RA E+ +++ + G+      + TM+DG+       K   + + +++ GF    I 
Sbjct  415  SGAMQRAAEVFQQITDAGLKHNRITYCTMLDGWARKGELSKARDLLNDMQKHGFHLDTIC  474

Query  12   Y  10
            Y
Sbjct  475  Y  475


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P++  + M+++ Y R GD   A +++E M S G+ P    Y  L +A+  +  M++AL  
Sbjct  225  PNKMIYAMIMDGYARGGDFTAAFKVWEDMVSAGLKPDIVIYNILVHAFCKAGRMDKALGV  284

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +  +    +  ++ TY+ I+ G+ K GN++ A   F   K          Y +++    +
Sbjct  285  LENIEANRLLPTIETYTSILDGYVKGGNIQKALEVFDRIKTAGLRPGVVSYNSLLSGLAK  344

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M+ A  +L EM   G+      +  + +GY    + EK   MF R+K+      +++
Sbjct  345  ARQMENARLMLNEMLANGVVPNERSYTALTEGYARAGDVEKAFGMFQRMKKENLAIDIVA  404

Query  12   YGCL  1
            YG L
Sbjct  405  YGAL  408


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (45%), Gaps = 4/114 (4%)
 Frame = -2

Query  594  NWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +  F+RI     +P    +  +++   +      AR M  +M + G+VP    YT
Sbjct  312  NIQKALEVFDRIKTAGLRPGVVSYNSLLSGLAKARQMENARLMLNEMLANGVVPNERSYT  371

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWF  265
             LT  Y  + D+E+A    ++M  E + I +V Y  ++    K G ++ A   F
Sbjct  372  ALTEGYARAGDVEKAFGMFQRMKKENLAIDIVAYGALLKACCKSGAMQRAAEVF  425



>ref|XP_010240633.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic isoform X2 [Brachypodium distachyon]
Length=595

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  VSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS  226
            V+RDM   L+CV +M  EGIE+++VTYSII+ GFAK+ + ++A++ F EAK +   L+  
Sbjct  7    VARDMRGVLSCVEEMKAEGIELTIVTYSIIIAGFAKINDAQSADNLFKEAKAKLGDLNGI  66

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
            IY NII+A+CQ+ NMDRAEEL+REMEE+GI API  +H+MM GYTI ++E+KCL++F+RL
Sbjct  67   IYSNIIHAHCQSGNMDRAEELVREMEEDGIDAPIDAYHSMMHGYTIIQDEKKCLIVFERL  126

Query  45   KECGFTPSVISYGCL  1
            KEC FTPS+ISYGCL
Sbjct  127  KECCFTPSIISYGCL  141


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +R  E++ K    PS + F  ++  +   GD  RA  + + MR  G  PT   Y 
Sbjct  220  NMDRAIRILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALNILDLMRRSGCAPTVMTYN  279

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L +       +E A++ + KM+  GI  +  TY+II+ G+A  G++  A  +F + KE 
Sbjct  280  ALIHGLIKKNQVERAVSVLNKMSIAGITPNEHTYTIIMRGYAANGDIGKAFEYFTKIKEG  339

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L   IY  ++ A C++  M  A  + REM  + IA    +++ ++DG+    +  + 
Sbjct  340  GLKLDVYIYETLLRACCKSGRMQSALAVTREMSTQKIARNTFVYNILIDGWARRGDVWEA  399

Query  66   LLMFDRLKECGFTPSVISY  10
              +  ++KE G  P++ +Y
Sbjct  400  ADLMKQMKEDGVPPNIHTY  418


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 94/196 (48%), Gaps = 3/196 (2%)
 Frame = -2

Query  582  VVRAFER--INKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            +VR  E   I+ P      MM  Y   + D+ +   +FE+++     P+   Y  L   Y
Sbjct  87   LVREMEEDGIDAPIDAYHSMMHGYTIIQ-DEKKCLIVFERLKECCFTPSIISYGCLINLY  145

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
                 + +A+   ++M   GI+ +  TYS+++ GF  + +   A   F E  +       
Sbjct  146  IKIGKVTKAIAISKEMESYGIKHNNKTYSMLISGFIHLHDFANAFSIFEEMLKSGLQPDR  205

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
            +IY  +I A C+  NMDRA  +L +M++E +      F  +++G+ +  + ++ L + D 
Sbjct  206  AIYNLLIEAFCKMGNMDRAIRILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALNILDL  265

Query  48   LKECGFTPSVISYGCL  1
            ++  G  P+V++Y  L
Sbjct  266  MRRSGCAPTVMTYNAL  281


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + RRGD   A ++ ++M+  G+ P  + YT+   A   + DM+ A   + +M 
Sbjct  383  YNILIDGWARRGDVWEAADLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAQKVIEEMA  442

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            D G++ ++ TY+ ++ G+AK    + A   F E K
Sbjct  443  DVGLKPNLKTYTTLIKGWAKASLPDRALKSFEEMK  477


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            K + K + M+++ +    D   A  +FE+M   G+ P    Y  L  A+    +M+ A+ 
Sbjct  167  KHNNKTYSMLISGFIHLHDFANAFSIFEEMLKSGLQPDRAIYNLLIEAFCKMGNMDRAIR  226

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM  E ++ S   +  I+ GFA  G+++ A +     +      +   Y  +I+   
Sbjct  227  ILEKMQKERMQPSNRAFRPIIEGFAVAGDMKRALNILDLMRRSGCAPTVMTYNALIHGLI  286

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++RA  +L +M   GI      +  +M GY    +  K    F ++KE G    V 
Sbjct  287  KKNQVERAVSVLNKMSIAGITPNEHTYTIIMRGYAANGDIGKAFEYFTKIKEGGLKLDVY  346

Query  15   SYGCL  1
             Y  L
Sbjct  347  IYETL  351



>ref|XP_004172167.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like, partial [Cucumis sativus]
Length=564

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -2

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
            +A+HWF EAKE+H++L+A IYGNIIYA CQ CNMD+AE L+REMEEEGI API I+HTMM
Sbjct  1    SADHWFQEAKEKHSSLNAIIYGNIIYAYCQRCNMDKAEALVREMEEEGIDAPIDIYHTMM  60

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            DGYT+  +E+KCLL+F+R KECG  PSVI+YGCL
Sbjct  61   DGYTMVGDEDKCLLVFERFKECGLNPSVITYGCL  94


 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 92/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            +KP+ + F  +++ + R+G+  +A ++F+ MR  G +PT + Y  L       R ME+A 
Sbjct  189  HKPTTRTFMPIIHGFARKGEMKKALDVFDMMRMSGCIPTVHTYNALILGLVEKRKMEKAE  248

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              + +M   G+  +  TY+ I+ G+A +G+   A  +F + ++    L    Y  ++ A 
Sbjct  249  QILDEMTLAGVSPNEHTYTTIMHGYASLGDTGKAFAYFTKLRDEGLQLDVYTYEALLKAC  308

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C++  M  A  + +EM  + I     I++ ++DG+    +  +   +  ++K  G  P +
Sbjct  309  CKSGRMQSALAVTKEMSAQNIPRNTFIYNILIDGWARRGDVWEAADLMQQMKREGVQPDI  368

Query  18   ISY  10
             +Y
Sbjct  369  HTY  371


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y   GD  +A   F K+R  G+    Y Y  L  A   S  M+ AL  
Sbjct  261  PNEHTYTTIMHGYASLGDTGKAFAYFTKLRDEGLQLDVYTYEALLKACCKSGRMQSALAV  320

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M+ + I  +   Y+I++ G+A+ G+V  A     + K          Y + I A  +
Sbjct  321  TKEMSAQNIPRNTFIYNILIDGWARRGDVWEAADLMQQMKREGVQPDIHTYTSFINACSK  380

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M RA + + EM+  G+   +  + T+++G+      EK L  F+ +K  G  P    
Sbjct  381  AGDMQRATKTIEEMKSVGVKPNVKTYTTLINGWARASLPEKALSCFEEMKLSGLKPDRAV  440

Query  12   YGCL  1
            Y CL
Sbjct  441  YHCL  444


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 94/197 (48%), Gaps = 3/197 (2%)
 Frame = -2

Query  585  AVVRAFER--INKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYA  412
            A+VR  E   I+ P    +  M++ Y   GD+ +   +FE+ +  G+ P+   Y  L   
Sbjct  39   ALVREMEEEGIDAPIDI-YHTMMDGYTMVGDEDKCLLVFERFKECGLNPSVITYGCLINL  97

Query  411  YTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLS  232
            Y     + +AL   ++M   GI+ ++ TYS+++ GF K+ +   A   F +  +      
Sbjct  98   YAKLGKVSKALEVSKEMEHAGIKHNMKTYSMLINGFLKLKDWANAFAIFEDLIKDGIKPD  157

Query  231  ASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFD  52
              +Y NII A C    MDRA   ++EM+++        F  ++ G+      +K L +FD
Sbjct  158  VVLYNNIITAFCGMGKMDRAVCTVKEMQKQRHKPTTRTFMPIIHGFARKGEMKKALDVFD  217

Query  51   RLKECGFTPSVISYGCL  1
             ++  G  P+V +Y  L
Sbjct  218  MMRMSGCIPTVHTYNAL  234


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 92/206 (45%), Gaps = 7/206 (3%)
 Frame = -2

Query  618  KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTS  439
            K LE   E  HA +       K + K + M++N + +  D   A  +FE +   GI P  
Sbjct  106  KALEVSKEMEHAGI-------KHNMKTYSMLINGFLKLKDWANAFAIFEDLIKDGIKPDV  158

Query  438  YEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE  259
              Y N+  A+     M+ A+  V++M  +  + +  T+  I+ GFA+ G ++ A   F  
Sbjct  159  VLYNNIITAFCGMGKMDRAVCTVKEMQKQRHKPTTRTFMPIIHGFARKGEMKKALDVFDM  218

Query  258  AKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRN  79
             +      +   Y  +I    +   M++AE++L EM   G++     + T+M GY    +
Sbjct  219  MRMSGCIPTVHTYNALILGLVEKRKMEKAEQILDEMTLAGVSPNEHTYTTIMHGYASLGD  278

Query  78   EEKCLLMFDRLKECGFTPSVISYGCL  1
              K    F +L++ G    V +Y  L
Sbjct  279  TGKAFAYFTKLRDEGLQLDVYTYEAL  304


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 76/160 (48%), Gaps = 0/160 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A   F++ + +     +  Y N+ YAY    +M++A   VR+M +EGI+  +  Y  ++ 
Sbjct  2    ADHWFQEAKEKHSSLNAIIYGNIIYAYCQRCNMDKAEALVREMEEEGIDAPIDIYHTMMD  61

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            G+  VG+ +     F   KE     S   YG +I    +   + +A E+ +EME  GI  
Sbjct  62   GYTMVGDEDKCLLVFERFKECGLNPSVITYGCLINLYAKLGKVSKALEVSKEMEHAGIKH  121

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             +  +  +++G+   ++      +F+ L + G  P V+ Y
Sbjct  122  NMKTYSMLINGFLKLKDWANAFAIFEDLIKDGIKPDVVLY  161



>ref|XP_006367153.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, 
chloroplastic-like [Solanum tuberosum]
Length=253

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 5/92 (5%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRW---  649
            ++NMGFGF+ Y G   EK+A+KAV+FDGVEFHGRVLTVKLDDGRR +K+K + R  W   
Sbjct  149  EKNMGFGFLKYEGPIAEKAAMKAVEFDGVEFHGRVLTVKLDDGRR-LKEKIEERNMWHEA  207

Query  648  MEGSSSRNFRKVLESQPENWHAVVRAFERINK  553
            MEG S R+F+KVLE+QPENW AVV AFERI K
Sbjct  208  MEG-SGRDFKKVLETQPENWQAVVWAFERIKK  238



>gb|KHN14012.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=559

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 108/209 (52%), Gaps = 16/209 (8%)
 Frame = -2

Query  579  VRAFERINKPSRKEFG-----MMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTY  415
            VR F R+ +  R + G     ++V+   RRG+  RA+E+  +M +RG+VPT + Y  L  
Sbjct  156  VRFFRRMVESGRVDIGVQSLTIVVDVLCRRGEVGRAKELMNEMATRGVVPTVFTYNTLLN  215

Query  414  AYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATL  235
            A  V +D E     +  M  EG+  S+VTY+I++  +A  G +  AE  + E  ER+  +
Sbjct  216  ACVVRKDREGVDEILGLMEREGVVASLVTYTILIEWYASSGRIGEAEKVYEEMCERNVEM  275

Query  234  SASIYGNIIYANCQTCN-----------MDRAeellremeeEGIAAPISIFHTMMDGYTI  88
               +Y +++  NC+  N           M+ AE LL EM+ +G+   + IF+TMMDGY  
Sbjct  276  DVYVYTSMMSWNCRAGNVRRAGVCKAGQMEAAEILLEEMQCKGVDLNVVIFNTMMDGYCK  335

Query  87   TRNEEKCLLMFDRLKECGFTPSVISYGCL  1
                ++   + D ++  GF   V +Y  L
Sbjct  336  RGMMDEAFRLQDIMERKGFEADVFTYSIL  364



>gb|EPS59538.1| hypothetical protein M569_15265, partial [Genlisea aurea]
Length=820

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 93/184 (51%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F   ++   + G    A +M  +M SRG+VP ++ Y ++ + +  S  +++AL  
Sbjct  539  PDAVSFSAFIDGLSKAGFVGEAYDMLSRMTSRGLVPNNFAYNSVIFGFCSSGRLDDALKL  598

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M D G+   V+T++II+ GF K G ++ A   ++E ++         Y ++I   C+
Sbjct  599  EREMRDRGLVPDVITFNIIINGFCKQGRMKDAIRAYIEMQQLGFIPDIVTYNSLICGYCK  658

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++  AE +   M+  G A  I+ ++  + GY  +R   + ++MF+ L   G  P  ++
Sbjct  659  QFDLFNAENVANTMQYSGQAPDITTYNIQLHGYCKSRKMNRAIMMFNDLMSDGIAPDTVT  718

Query  12   YGCL  1
            Y  L
Sbjct  719  YNTL  722


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 71/163 (44%), Gaps = 0/163 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A ++   M  +G  P+ Y Y  +   +     +    + +  M   G E  + TY+I++ 
Sbjct  210  ALKLLRDMIGKGPFPSIYVYNMMILGFCRRGSIRIGESMLHVMGKFGCEPDIYTYNILIN  269

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
             +   G    A HW     E     S++ +  +I A C+  N+  A ++   MEE G+  
Sbjct  270  SYCVRGWTWDALHWLRSMLECGCRPSSATFSTLITAFCKEGNIIEARKIFDGMEEMGVLP  329

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
               +++T+MDGY   R   +  ++FD ++  G     +S   L
Sbjct  330  NTVLYNTLMDGYVKAREIGQAKMLFDDMRSKGVAVDGVSLNIL  372



>ref|XP_002975593.1| hypothetical protein SELMODRAFT_103638 [Selaginella moellendorffii]
 gb|EFJ23222.1| hypothetical protein SELMODRAFT_103638 [Selaginella moellendorffii]
Length=471

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 95/185 (51%), Gaps = 1/185 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P   E+ ++++ Y ++G    A  ++E+M S G+ P+ Y Y +L  A+     M+EA+  
Sbjct  41   PDGIEYNILIDGYAKKGRVDEANRLYEEMVSVGLEPSIYTYNSLLNAFCKETKMKEAMEL  100

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNV-EAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + M ++G E  VVTYS I+ G  K G V EA E  F +  ER  + +   Y  +I   C
Sbjct  101  FKTMAEKGFEPDVVTYSTIISGLCKTGKVTEALEMLFHKMIERGCSANTVAYNALINGLC  160

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  N++RA +LL EM  +G       ++T++ G        +    FD +   G++P V+
Sbjct  161  KDENIERAYKLLEEMASKGYVPDNITYNTILSGLCRMGKVSEAKQFFDSMPSRGYSPDVV  220

Query  15   SYGCL  1
            +Y  L
Sbjct  221  AYNGL  225


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/181 (24%), Positives = 82/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +++   R G    A++ F+ M SRG  P    Y  L  A       +EA+  
Sbjct  182  PDNITYNTILSGLCRMGKVSEAKQFFDSMPSRGYSPDVVAYNGLLDALYKEGKTDEAMKL  241

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             + +  +G     VTY+ I+ G A+  N++ AE  F +        + + Y  ++  +C+
Sbjct  242  FKDVIAKGYMPDTVTYNSILLGLARKSNMDEAEEMFKKMVASGCAPNGATYSIVLSGHCR  301

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +D A ++L EM + G    +  ++ ++DG   T   +K   +F  + + G  P ++S
Sbjct  302  AKKVDDAHKVLEEMSKIGAVPDVVTYNILLDGLCKTNLVDKAHELFSTMVDNGCAPDIVS  361

Query  12   Y  10
            Y
Sbjct  362  Y  362


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/190 (25%), Positives = 84/190 (44%), Gaps = 6/190 (3%)
 Frame = -2

Query  552  PSRKEFGMMVNYYG------RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
            PSR     +V Y G      + G    A ++F+ + ++G +P +  Y ++        +M
Sbjct  211  PSRGYSPDVVAYNGLLDALYKEGKTDEAMKLFKDVIAKGYMPDTVTYNSILLGLARKSNM  270

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
            +EA    +KM   G   +  TYSI++ G  +   V+ A     E  +  A      Y  +
Sbjct  271  DEAEEMFKKMVASGCAPNGATYSIVLSGHCRAKKVDDAHKVLEEMSKIGAVPDVVTYNIL  330

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            +   C+T  +D+A EL   M + G A  I  +  +++G   T       ++FDR+ E   
Sbjct  331  LDGLCKTNLVDKAHELFSTMVDNGCAPDIVSYSVVLNGLCKTNKVHDARVLFDRMIERKL  390

Query  30   TPSVISYGCL  1
             P V+++  L
Sbjct  391  VPDVVTFNIL  400


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/171 (23%), Positives = 74/171 (43%), Gaps = 0/171 (0%)
 Frame = -2

Query  513  GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV  334
             R+ +   A EMF+KM + G  P    Y+ +   +  ++ +++A   + +M+  G    V
Sbjct  265  ARKSNMDEAEEMFKKMVASGCAPNGATYSIVLSGHCRAKKVDDAHKVLEEMSKIGAVPDV  324

Query  333  VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellre  154
            VTY+I++ G  K   V+ A   F    +         Y  ++   C+T  +  A  L   
Sbjct  325  VTYNILLDGLCKTNLVDKAHELFSTMVDNGCAPDIVSYSVVLNGLCKTNKVHDARVLFDR  384

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            M E  +   +  F+ +MDG       ++   + D++   G  P  ++Y  L
Sbjct  385  MIERKLVPDVVTFNILMDGLCKAGKLDEAKDLLDQMTCSGCAPDYVAYNTL  435



>gb|EMS45043.1| hypothetical protein TRIUR3_16364 [Triticum urartu]
Length=483

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 101/204 (50%), Gaps = 0/204 (0%)
 Frame = -2

Query  612  LESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYE  433
            L + PE +   ++  +    P  ++F +++  + R GD   AR++F++MR+R + PT   
Sbjct  92   LPTTPEAYAFYLQLLDAGMPPEVRQFNVLMRDFVRFGDLASARKVFDEMRTRSVQPTVVS  151

Query  432  YTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            +  L      +RD++ A    + M   GI   V TYS ++ G +  G +E A   F E +
Sbjct  152  FNTLISGMCRARDLDGADELYKGMAQMGITPDVYTYSALIKGLSSSGRIEDATKMFDEMR  211

Query  252  ERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEE  73
            ER    +A ++  +I A+C+  ++    EL ++M   G+   +  ++ +++G    RN E
Sbjct  212  ERGVKPNAIVFTTLIDAHCKAGDVKAGMELYQDMRARGVMPDLVAYNALLNGLCRARNFE  271

Query  72   KCLLMFDRLKECGFTPSVISYGCL  1
                + + ++  G  P  ++Y  L
Sbjct  272  AAECIVEEMRGTGLKPDKVTYTTL  295


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 83/186 (45%), Gaps = 0/186 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER  KP+   F  +++ + + GD     E+++ MR+RG++P    Y  L      +R+ E
Sbjct  212  ERGVKPNAIVFTTLIDAHCKAGDVKAGMELYQDMRARGVMPDLVAYNALLNGLCRARNFE  271

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
             A   V +M   G++   VTY+ ++ G  K G ++ A     +  +    L    Y  +I
Sbjct  272  AAECIVEEMRGTGLKPDKVTYTTLIDGCCKDGKLDTAMDIKQKMADEEVALDEVTYTALI  331

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
                +      AE +L EM E G+    + +  ++D +    + +    +   ++  G  
Sbjct  332  SGLSKAQRPVDAERILVEMMEAGLEPDNTTYTMVIDAFCRKGDVKTGFKLLKEMQNKGRK  391

Query  27   PSVISY  10
            P V++Y
Sbjct  392  PGVVTY  397



>gb|KDP21342.1| hypothetical protein JCGZ_21813 [Jatropha curcas]
Length=295

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 91/181 (50%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  M++ + + G   +A ++F KM  +G  P    Y+ L   +     ME+A   
Sbjct  78   PDVVTYNTMISGFCKGGQLEKANDLFLKMEEKGRAPDVVTYSALISGFCKEGQMEKANDL  137

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              KM ++G    VVTYS ++ GF K G +E A   FLE +E+  T +   Y  +I   C+
Sbjct  138  FLKMEEKGRAPDVVTYSALISGFCKEGQMEKANDLFLEMEEKGCTPNVVTYSAMINGFCE  197

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +++A +L  EMEE+G    +  +  M++G+      EK   +F  ++E G TP V++
Sbjct  198  EGQLEKANDLFLEMEEKGCTPNVVTYSAMINGFCEEGQLEKANDLFLEMEEKGCTPDVVT  257

Query  12   Y  10
            Y
Sbjct  258  Y  258


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 92/186 (49%), Gaps = 0/186 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E+   P    +  +++ + + G   +A ++F KM  +G  P    Y+ L   +     ME
Sbjct  108  EKGRAPDVVTYSALISGFCKEGQMEKANDLFLKMEEKGRAPDVVTYSALISGFCKEGQME  167

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +A     +M ++G   +VVTYS ++ GF + G +E A   FLE +E+  T +   Y  +I
Sbjct  168  KANDLFLEMEEKGCTPNVVTYSAMINGFCEEGQLEKANDLFLEMEEKGCTPNVVTYSAMI  227

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+   +++A +L  EMEE+G    +  +  M+ G+      EK   +F ++ E G  
Sbjct  228  NGFCEEGQLEKANDLFLEMEEKGCTPDVVTYSAMISGFCNGGQLEKANDLFLKMAEKGCI  287

Query  27   PSVISY  10
            P V++Y
Sbjct  288  PDVVTY  293


 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 90/176 (51%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +M++   ++G   +A ++F +M+  G +P    Y  +   +     +E+A     KM 
Sbjct  48   YNVMIDGLCKQGQLQKANDLFLEMQDHGCIPDVVTYNTMISGFCKGGQLEKANDLFLKME  107

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++G    VVTYS ++ GF K G +E A   FL+ +E+        Y  +I   C+   M+
Sbjct  108  EKGRAPDVVTYSALISGFCKEGQMEKANDLFLKMEEKGRAPDVVTYSALISGFCKEGQME  167

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A +L  EMEE+G    +  +  M++G+      EK   +F  ++E G TP+V++Y
Sbjct  168  KANDLFLEMEEKGCTPNVVTYSAMINGFCEEGQLEKANDLFLEMEEKGCTPNVVTY  223



>ref|XP_010910591.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g61990, mitochondrial-like, partial [Elaeis 
guineensis]
Length=870

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 93/190 (49%), Gaps = 0/190 (0%)
 Frame = -2

Query  579  VRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVS  400
            V   ER   P+   +G +++ Y + GD H A   F++M  RG+ P    YTNL   Y   
Sbjct  419  VEMLERGLLPNTYTYGALIHGYCKSGDMHEAENYFQEMLGRGLKPNDVIYTNLIDGYCKG  478

Query  399  RDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
             D+ +  + +  M + G+   V TYS+++   +K G +E A   F E +E+        Y
Sbjct  479  NDVAKVFSTLHSMLESGVLPDVQTYSVVIHSLSKSGKMEDAFQIFSELQEKGLVPDVYAY  538

Query  219  GNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKE  40
             ++I+  C+  ++++A  L  EM   G+   I I++ ++DG   + + +     F  + +
Sbjct  539  SSLIFGLCKIGDIEQALHLHDEMCGRGVEPNIVIYNALIDGLCKSGDLKSATEFFSIILK  598

Query  39   CGFTPSVISY  10
             G  PS ++Y
Sbjct  599  KGLVPSGVTY  608


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 91/184 (49%), Gaps = 1/184 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  + + ++++   + G    A ++F +++ +G+VP  Y Y++L +      D+E+AL  
Sbjct  498  PDVQTYSVVIHSLSKSGKMEDAFQIFSELQEKGLVPDVYAYSSLIFGLCKIGDIEQALHL  557

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   G+E ++V Y+ ++ G  K G++++A  +F    ++    S   Y  +I  NC 
Sbjct  558  HDEMCGRGVEPNIVIYNALIDGLCKSGDLKSATEFFSIILKKGLVPSGVTYTIMIDGNCN  617

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M  A  L  EM   GI      +  ++ G     N E+ L +F+ + + GF  +V++
Sbjct  618  AREMSEAFRLYDEMLSRGILPEKFTYSALIGGCCKVENLERALELFNEMLQKGFA-TVLT  676

Query  12   YGCL  1
            +  L
Sbjct  677  FNTL  680


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 88/190 (46%), Gaps = 0/190 (0%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
            F R  KP+   +  +++ + R G    A E  +KM  R + P ++ Y +L      +  M
Sbjct  352  FARGLKPNAVIYAAVISGHCREGRIIEACETLDKMTERNVSPDAFCYNSLIIGLCKTGKM  411

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
            EEAL    +M + G+  +  TY  ++ G+ K G++  AE++F E   R    +  IY N+
Sbjct  412  EEALRYFVEMLERGLLPNTYTYGALIHGYCKSGDMHEAENYFQEMLGRGLKPNDVIYTNL  471

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            I   C+  ++ +    L  M E G+   +  +  ++   + +   E    +F  L+E G 
Sbjct  472  IDGYCKGNDVAKVFSTLHSMLESGVLPDVQTYSVVIHSLSKSGKMEDAFQIFSELQEKGL  531

Query  30   TPSVISYGCL  1
             P V +Y  L
Sbjct  532  VPDVYAYSSL  541


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 83/181 (46%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +++N   R G+  +A  + ++M +RG+ P +  Y  +   +     + EA   
Sbjct  323  PNLYTYSVIINGLCRCGESRQAVGLLKEMFARGLKPNAVIYAAVISGHCREGRIIEACET  382

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + KM +  +      Y+ ++ G  K G +E A  +F+E  ER    +   YG +I+  C+
Sbjct  383  LDKMTERNVSPDAFCYNSLIIGLCKTGKMEEALRYFVEMLERGLLPNTYTYGALIHGYCK  442

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +M  AE   +EM   G+     I+  ++DGY    +  K       + E G  P V +
Sbjct  443  SGDMHEAENYFQEMLGRGLKPNDVIYTNLIDGYCKGNDVAKVFSTLHSMLESGVLPDVQT  502

Query  12   Y  10
            Y
Sbjct  503  Y  503


 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 112/262 (43%), Gaps = 3/262 (1%)
 Frame = -2

Query  780  SSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKD-KKKGRTRWMEGSSSRNFRKVLES  604
            S  E   +  VQ   V  H    + K++D  +I  + ++KG    +   SS  F      
Sbjct  490  SMLESGVLPDVQTYSVVIHSLSKSGKMEDAFQIFSELQEKGLVPDVYAYSSLIFGLCKIG  549

Query  603  QPEN-WHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
              E   H       R  +P+   +  +++   + GD   A E F  +  +G+VP+   YT
Sbjct  550  DIEQALHLHDEMCGRGVEPNIVIYNALIDGLCKSGDLKSATEFFSIILKKGLVPSGVTYT  609

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             +      +R+M EA     +M   GI     TYS ++GG  KV N+E A   F E  ++
Sbjct  610  IMIDGNCNAREMSEAFRLYDEMLSRGILPEKFTYSALIGGCCKVENLERALELFNEMLQK  669

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                +   +  +I   C+   +  A  LL+ M ++ I      + T++DG+T     ++ 
Sbjct  670  -GFATVLTFNTLIDGFCKLGKLQEATRLLQVMVDQQILPDNVTYTTLIDGHTKAGKIKEA  728

Query  66   LLMFDRLKECGFTPSVISYGCL  1
              +F  ++E    P+ ++Y  L
Sbjct  729  CQLFSEMQERNLMPNAVTYTSL  750


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++    + G   +A E+  +M   G  P +  Y  +   +   RD++    
Sbjct  252  QPNVVTYNNLIRGVCKMGKMDKAHELLREMIQMGWKPDAITYNVVIEGHIRERDLQGVFR  311

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M  + +  ++ TYS+I+ G  + G    A     E   R    +A IY  +I  +C
Sbjct  312  LLDEMKSKDVSPNLYTYSVIINGLCRCGESRQAVGLLKEMFARGLKPNAVIYAAVISGHC  371

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  A E L +M E  ++     +++++ G   T   E+ L  F  + E G  P+  
Sbjct  372  REGRIIEACETLDKMTERNVSPDAFCYNSLIIGLCKTGKMEEALRYFVEMLERGLLPNTY  431

Query  15   SYGCL  1
            +YG L
Sbjct  432  TYGAL  436


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/190 (21%), Positives = 84/190 (44%), Gaps = 7/190 (4%)
 Frame = -2

Query  576  RAFERINKPSRKEFGMMVNY------YGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTY  415
            RA E  N+  +K F  ++ +      + + G    A  + + M  + I+P +  YT L  
Sbjct  658  RALELFNEMLQKGFATVLTFNTLIDGFCKLGKLQEATRLLQVMVDQQILPDNVTYTTLID  717

Query  414  AYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATL  235
             +T +  ++EA     +M +  +  + VTY+ ++ G ++ GN+  A   F E  ++    
Sbjct  718  GHTKAGKIKEACQLFSEMQERNLMPNAVTYTSLIDGQSRAGNMSEASALFKEMMDKGIKP  777

Query  234  SASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMF  55
                Y ++    C+  N+  A +L   +  +G+     ++  ++ G     +  + L + 
Sbjct  778  DEVTY-HVTXTQCKEGNLVEAFKLQDAVIAKGVQXSSPMYVPLIGGLHRKGDFSEALNLL  836

Query  54   DRLKECGFTP  25
            D ++E G  P
Sbjct  837  DEMQEQGNIP  846


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 85/197 (43%), Gaps = 0/197 (0%)
 Frame = -2

Query  591  WHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYA  412
             ++V+ +F R    +   F ++V+ Y + G    A E+   M+     P+      L   
Sbjct  30   LYSVIDSFARTEGSNSAVFDVLVDTYKKMGMLKEAAEVALLMKDVSFSPSLRCCNALLKD  89

Query  411  YTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLS  232
               +  M+        M+   +   V TY+ ++  + KVG+V++A+  F E K +  + S
Sbjct  90   LLRANLMDLFWKVYDFMSGVPLGHDVYTYTTLISAYFKVGDVDSAKRTFSEMKAKGCSPS  149

Query  231  ASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFD  52
            A  Y  +I   C+   +  A EL  +M  +G+ A    +  +++G    R  ++   +  
Sbjct  150  AVTYNTLITGFCRVGALVDAFELKEDMVRKGLVADGFTYSALINGLCKNRKSKEARQLLG  209

Query  51   RLKECGFTPSVISYGCL  1
             +   G  P +ISY  L
Sbjct  210  EMSLLGQKPDIISYTSL  226



>ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009784743.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009784744.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009784745.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana sylvestris]
Length=864

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 100/224 (45%), Gaps = 35/224 (16%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSY----------------  436
            ER+ KP+   + ++++ Y R+GD  +A  MF++M S GI PT Y                
Sbjct  518  ERLLKPNVVTYSILIDGYFRKGDVDKAGNMFDQMVSSGIAPTDYTFNTIISGLSKAGKMS  577

Query  435  -------------------EYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIV  313
                                Y +L   +    D+  AL   R++ D GI   VVTY+ ++
Sbjct  578  EAKDLLKKIVAGGLLPTCMSYNSLIDGFLKEDDVTSALAVYRELCDTGISPDVVTYTTLI  637

Query  312  GGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIA  133
             GF K  N++ A     E + R   L    Y  +I   C+  +M  A EL  E+ + G++
Sbjct  638  DGFCKSNNIDLALKLLNEMRNREIKLDVIAYAVLIDGFCKRRDMKSASELFDEILQVGLS  697

Query  132  APISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              + ++++M+ G+    N E  L++ DR+   G T  + +Y  L
Sbjct  698  PNLFVYNSMISGFRNVNNMEAALVLHDRMISEGVTCDLETYTTL  741


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 92/176 (52%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            ++ ++ ++G    A+ +++KM   G+VP+   + N+      + +M++AL    K+ +  
Sbjct  461  IIAWFCKKGQMDEAQNVWDKMVDNGVVPSIASFNNMILGNCRNGNMDKALDLFSKLPERL  520

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            ++ +VVTYSI++ G+ + G+V+ A + F +        +   +  II    +   M  A+
Sbjct  521  LKPNVVTYSILIDGYFRKGDVDKAGNMFDQMVSSGIAPTDYTFNTIISGLSKAGKMSEAK  580

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +LL+++   G+      +++++DG+    +    L ++  L + G +P V++Y  L
Sbjct  581  DLLKKIVAGGLLPTCMSYNSLIDGFLKEDDVTSALAVYRELCDTGISPDVVTYTTL  636


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 95/195 (49%), Gaps = 5/195 (3%)
 Frame = -2

Query  594  NWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N  + +  F+++      PS+  + +++    + G+  +A E++ +M+  GI P  Y   
Sbjct  366  NLSSALDLFDKLALYGLTPSQVTYAVLLEGCCKNGNIEKAVEIYRQMKLAGIKPNVYVEN  425

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
            +L   +     ++EA+    +  + G   +V  Y+ I+  F K G ++ A++ + +  + 
Sbjct  426  SLIKGFLSVNLLDEAINVFDEAINSGTA-NVFVYNNIIAWFCKKGQMDEAQNVWDKMVDN  484

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                S + + N+I  NC+  NMD+A +L  ++ E  +   +  +  ++DGY    + +K 
Sbjct  485  GVVPSIASFNNMILGNCRNGNMDKALDLFSKLPERLLKPNVVTYSILIDGYFRKGDVDKA  544

Query  66   LLMFDRLKECGFTPS  22
              MFD++   G  P+
Sbjct  545  GNMFDQMVSSGIAPT  559


 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/179 (22%), Positives = 85/179 (47%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + +R D   A E+F+++   G+ P  + Y ++   +    +ME AL    +M 
Sbjct  668  YAVLIDGFCKRRDMKSASELFDEILQVGLSPNLFVYNSMISGFRNVNNMEAALVLHDRMI  727

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
             EG+   + TY+ ++ G  K G +  A + F E   +        Y  +++  C    ++
Sbjct  728  SEGVTCDLETYTTLIDGLLKDGKIVMASNLFTEMLGKGIMPDDITYTVLVHGLCNKGQVE  787

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A ++L EM ++     + I++T++ GY    N ++   + D + + G  P   +Y  L
Sbjct  788  NAHKVLEEMCKKSTTPNVLIYNTLIAGYFKEGNLQEAFRLHDEMLDKGLKPDDATYDIL  846


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/184 (22%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ + +  D   A  ++ ++   GI P    YT L   +  S +++ AL  
Sbjct  593  PTCMSYNSLIDGFLKEDDVTSALAVYRELCDTGISPDVVTYTTLIDGFCKSNNIDLALKL  652

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M +  I++ V+ Y++++ GF K  ++++A   F E  +   + +  +Y ++I     
Sbjct  653  LNEMRNREIKLDVIAYAVLIDGFCKRRDMKSASELFDEILQVGLSPNLFVYNSMISGFRN  712

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM+ A  L   M  EG+   +  + T++DG            +F  +   G  P  I+
Sbjct  713  VNNMEAALVLHDRMISEGVTCDLETYTTLIDGLLKDGKIVMASNLFTEMLGKGIMPDDIT  772

Query  12   YGCL  1
            Y  L
Sbjct  773  YTVL  776


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 69/163 (42%), Gaps = 0/163 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            AR+++  + SRGI         L  A      MEEA+   ++    GI++    YS+ V 
Sbjct  230  ARDLYADVVSRGICYDCRTVHILMAACLREGKMEEAVQLFKEAKMSGIKLDAGLYSLCVY  289

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
               K  N+  A     E K+     S   Y NII    +  NM  A  L  EM   G   
Sbjct  290  VACKEQNLSFALELLGEMKDMGWVPSEGTYVNIISTCVKQRNMVEALRLKDEMLSNGRPM  349

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             + +   +M GY +  N    L +FD+L   G TPS ++Y  L
Sbjct  350  NLVVATCLMKGYHVQGNLSSALDLFDKLALYGLTPSQVTYAVL  392



>ref|XP_010939783.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Elaeis guineensis]
Length=742

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 90/179 (50%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            F  +++ + ++G    A  + ++M+  GI+P+   Y  L   Y     M+EAL  +R+M 
Sbjct  379  FTTLIDGFAKKGFLDDALLLMKEMKESGILPSVVSYNALINGYCTLGRMDEALEIIREME  438

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
             +G+   VVTYS ++ G+ K G +E A  W  E   +     A  Y ++I   C+   +D
Sbjct  439  GDGLVPDVVTYSTLLSGYCKNGELEMAFQWNQEMVAKGVLPDAITYSSLIRGLCEVRRLD  498

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A EL  +M   G+      + T++DG+    + +K LL+ D + + G  P V++Y  L
Sbjct  499  NAHELFEKMLNLGLHPDEFTYTTLIDGHCKEGDIKKALLLHDEMIKKGILPDVVTYNVL  557


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +VN Y R GD H+A  +  +M  +G+ P    YT+L  A   + ++  A+  
Sbjct  304  PDAITYNTLVNGYCREGDVHKALVLHAEMAQKGVAPNVVTYTSLISAMCKAGNLARAMEF  363

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M + G++++ +T++ ++ GFAK G ++ A     E KE     S   Y  +I   C 
Sbjct  364  AKQMRERGLQLNEITFTTLIDGFAKKGFLDDALLLMKEMKESGILPSVVSYNALINGYCT  423

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               MD A E++REME +G+   +  + T++ GY      E        +   G  P  I+
Sbjct  424  LGRMDEALEIIREMEGDGLVPDVVTYSTLLSGYCKNGELEMAFQWNQEMVAKGVLPDAIT  483

Query  12   YGCL  1
            Y  L
Sbjct  484  YSSL  487


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ + + G    A  + + M  +G+ P    Y  +         ++E    
Sbjct  234  PNVVTYNTLIDGHCKSGKVDSAFGLLKTMHEKGVQPNVVTYNAIINGLCREGRVKETGKL  293

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            V +M  EG     +TY+ +V G+ + G+V  A     E  ++    +   Y ++I A C+
Sbjct  294  VDEMAREGFAPDAITYNTLVNGYCREGDVHKALVLHAEMAQKGVAPNVVTYTSLISAMCK  353

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+ RA E  ++M E G+      F T++DG+      +  LL+   +KE G  PSV+S
Sbjct  354  AGNLARAMEFAKQMRERGLQLNEITFTTLIDGFAKKGFLDDALLLMKEMKESGILPSVVS  413

Query  12   YGCL  1
            Y  L
Sbjct  414  YNAL  417


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 89/189 (47%), Gaps = 0/189 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E+  +P+   +  ++N   R G      ++ ++M   G  P +  Y  L   Y    D+ 
Sbjct  264  EKGVQPNVVTYNAIINGLCREGRVKETGKLVDEMAREGFAPDAITYNTLVNGYCREGDVH  323

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +AL    +M  +G+  +VVTY+ ++    K GN+  A  +  + +ER   L+   +  +I
Sbjct  324  KALVLHAEMAQKGVAPNVVTYTSLISAMCKAGNLARAMEFAKQMRERGLQLNEITFTTLI  383

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
                +   +D A  L++EM+E GI   +  ++ +++GY      ++ L +   ++  G  
Sbjct  384  DGFAKKGFLDDALLLMKEMKESGILPSVVSYNALINGYCTLGRMDEALEIIREMEGDGLV  443

Query  27   PSVISYGCL  1
            P V++Y  L
Sbjct  444  PDVVTYSTL  452


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 7/108 (6%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            RR D   A E+FEKM + G+ P  + YT L   +    D+++AL    +M  +GI   VV
Sbjct  495  RRLDN--AHELFEKMLNLGLHPDEFTYTTLIDGHCKEGDIKKALLLHDEMIKKGILPDVV  552

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTC  187
            TY++++ GF KV   + A+               SI  NI Y     C
Sbjct  553  TYNVLINGFRKVARTKEAKRLLFRLYYEE-----SIPDNIAYDVLMDC  595


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 73/169 (43%), Gaps = 0/169 (0%)
 Frame = -2

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
            R  ++   E    +   G+    Y Y  L   +     ++  L  + +M   G   +VVT
Sbjct  179  RTPRNTIEEFLADISRSGVSLNVYSYNILIRGFCSWGVLDRGLVLLTEMEHAGCSPNVVT  238

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            Y+ ++ G  K G V++A        E+    +   Y  II   C+   +    +L+ EM 
Sbjct  239  YNTLIDGHCKSGKVDSAFGLLKTMHEKGVQPNVVTYNAIINGLCREGRVKETGKLVDEMA  298

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             EG A     ++T+++GY    +  K L++   + + G  P+V++Y  L
Sbjct  299  REGFAPDAITYNTLVNGYCREGDVHKALVLHAEMAQKGVAPNVVTYTSL  347



>ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009615416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009615417.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009615418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=864

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 100/224 (45%), Gaps = 35/224 (16%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSY----------------  436
            ER+ KP+   + ++++ Y R+GD  +A  MF++M S GI PT Y                
Sbjct  518  ERLLKPNVVTYSILIDGYFRKGDVDKAGNMFDQMVSSGIAPTDYTFNTIISGLSKAGKLS  577

Query  435  -------------------EYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIV  313
                                Y +L   +    D+  AL   R++ D GI   VVTY+ ++
Sbjct  578  EAKDLLKKIVAGGLLPTCMSYNSLIDGFLKEDDVTSALAVYRELCDSGISPDVVTYTTLI  637

Query  312  GGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIA  133
             GF K  N++ A     E + R   L    Y  +I   C+  +M  A EL  E+ + G++
Sbjct  638  DGFCKSNNIDLALKMLNEMRNREIKLDVIAYAVLIDGFCKRRDMKSASELFDEILQVGLS  697

Query  132  APISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              + ++++M+ G+    N E  L++ DR+   G T  + +Y  L
Sbjct  698  PNLFVYNSMISGFRNVNNMEAALVLRDRMISEGVTCDLETYTTL  741


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/176 (22%), Positives = 92/176 (52%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            ++ ++ ++G    A+ +++KM   G+VP+   + N+      + +M++AL    K+ +  
Sbjct  461  IIAWFCKKGQMDEAQNVWDKMVDNGVVPSIASFNNMILGNCRNGNMDKALDLFSKLPERL  520

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            ++ +VVTYSI++ G+ + G+V+ A + F +        +   +  II    +   +  A+
Sbjct  521  LKPNVVTYSILIDGYFRKGDVDKAGNMFDQMVSSGIAPTDYTFNTIISGLSKAGKLSEAK  580

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +LL+++   G+      +++++DG+    +    L ++  L + G +P V++Y  L
Sbjct  581  DLLKKIVAGGLLPTCMSYNSLIDGFLKEDDVTSALAVYRELCDSGISPDVVTYTTL  636


 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 95/195 (49%), Gaps = 5/195 (3%)
 Frame = -2

Query  594  NWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N  + +  F+++      PS+  + +++    + G+  +A E++ +M+  GI P  Y   
Sbjct  366  NLSSALDLFDKLALYGLTPSQVTYAVLIEGCCKNGNIEKAVEIYRQMKLAGIKPNVYVEN  425

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
            +L   +     ++EA+    +  + G   +V  Y+ I+  F K G ++ A++ + +  + 
Sbjct  426  SLIKGFLSVNLLDEAMNVFDEAINSGTA-NVFVYNNIIAWFCKKGQMDEAQNVWDKMVDN  484

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                S + + N+I  NC+  NMD+A +L  ++ E  +   +  +  ++DGY    + +K 
Sbjct  485  GVVPSIASFNNMILGNCRNGNMDKALDLFSKLPERLLKPNVVTYSILIDGYFRKGDVDKA  544

Query  66   LLMFDRLKECGFTPS  22
              MFD++   G  P+
Sbjct  545  GNMFDQMVSSGIAPT  559


 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/179 (22%), Positives = 84/179 (47%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + +R D   A E+F+++   G+ P  + Y ++   +    +ME AL    +M 
Sbjct  668  YAVLIDGFCKRRDMKSASELFDEILQVGLSPNLFVYNSMISGFRNVNNMEAALVLRDRMI  727

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
             EG+   + TY+ ++ G  K G +  A   F E   +        Y  +++  C    ++
Sbjct  728  SEGVTCDLETYTTLIDGLLKDGKIVMASDLFTEMLGKGIMPDDITYTVLVHGLCNKGQVE  787

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A ++L EM ++     + I++T++ GY    N ++   + D + + G  P   +Y  L
Sbjct  788  NAHKVLEEMCKKSTTPNVLIYNTLIAGYFKEGNLQEAFRLHDEMLDKGLKPDDATYDIL  846


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 87/187 (47%), Gaps = 6/187 (3%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ + +  D   A  ++ ++   GI P    YT L   +  S +++ AL  
Sbjct  593  PTCMSYNSLIDGFLKEDDVTSALAVYRELCDSGISPDVVTYTTLIDGFCKSNNIDLALKM  652

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M +  I++ V+ Y++++ GF K  ++++A   F E  +   + +  +Y ++I     
Sbjct  653  LNEMRNREIKLDVIAYAVLIDGFCKRRDMKSASELFDEILQVGLSPNLFVYNSMISGFRN  712

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC---GFTPS  22
              NM+ A  L   M  EG+   +  + T++DG      + K ++  D   E    G  P 
Sbjct  713  VNNMEAALVLRDRMISEGVTCDLETYTTLIDGLL---KDGKIVMASDLFTEMLGKGIMPD  769

Query  21   VISYGCL  1
             I+Y  L
Sbjct  770  DITYTVL  776


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 70/163 (43%), Gaps = 0/163 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            AR+++  + SRGI         L  A      MEEA+   ++    GI++    YS+ V 
Sbjct  230  ARDLYADVVSRGICYDCRTVHILMAACLREMKMEEAVRIFKEAKMSGIKLDAGLYSLCVY  289

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
               K  N+  A     E K+R    S   Y NII    +  NM  A  L  EM   G   
Sbjct  290  VACKEQNLSFALELLGEMKDRGWVPSEGTYVNIISTCVKQRNMVEALRLKDEMLSNGHPM  349

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             + +   +M GY +  N    L +FD+L   G TPS ++Y  L
Sbjct  350  NLVVATCLMKGYHVQGNLSSALDLFDKLALYGLTPSQVTYAVL  392


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/232 (24%), Positives = 89/232 (38%), Gaps = 69/232 (30%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL------------------TCVRK  364
            A E+  +M+ RG VP+   Y N+       R+M EAL                  TC+ K
Sbjct  300  ALELLGEMKDRGWVPSEGTYVNIISTCVKQRNMVEALRLKDEMLSNGHPMNLVVATCLMK  359

Query  363  -------------MNDE----GIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE-----  250
                         + D+    G+  S VTY++++ G  K GN+E A   + + K      
Sbjct  360  GYHVQGNLSSALDLFDKLALYGLTPSQVTYAVLIEGCCKNGNIEKAVEIYRQMKLAGIKP  419

Query  249  -----------------------------RHATLSASIYGNIIYANCQTCNMDRAeellr  157
                                            T +  +Y NII   C+   MD A+ +  
Sbjct  420  NVYVENSLIKGFLSVNLLDEAMNVFDEAINSGTANVFVYNNIIAWFCKKGQMDEAQNVWD  479

Query  156  emeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +M + G+   I+ F+ M+ G     N +K L +F +L E    P+V++Y  L
Sbjct  480  KMVDNGVVPSIASFNNMILGNCRNGNMDKALDLFSKLPERLLKPNVVTYSIL  531



>ref|XP_010522744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010522745.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010522746.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010522747.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010522748.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010522749.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010522751.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010522752.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
Length=536

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 91/176 (52%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +++Y  + G    A  +F KM S GIVP    + ++   Y  +  +EE +    +M+
Sbjct  270  YNTIIDYLCKAGHVEGALNLFRKMGSCGIVPNVVTFNSMINGYCTANRVEEGINLFYEMS  329

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G+   VVTYSI++ GF +VGN+ AA+  F++ + +    +   Y  ++   C+    D
Sbjct  330  RRGLVADVVTYSILIQGFYRVGNLGAAQKVFMQMQYKGHRPNLVTYNIVLDGLCKNGKTD  389

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A  L  ++++ GI   I +   MM G       ++ L++F++L + G  P+VI Y
Sbjct  390  KALCLYNKLDKSGIDLDIPLHSCMMHGLCKVGRVDEALILFNKLLDRGVKPNVIMY  445


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/185 (23%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   +  + + +   G    A  + ++M   G  P    ++ L     +   + EAL+
Sbjct  159  KPNVVTYNTLAHGFCIHGKISAALSLVDQMVKEGYKPNVVTFSTLINGLCLEGRVSEALS  218

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M     +  VVT+ I++ G  K  +   A +   + +E H  ++  IY  II   C
Sbjct  219  LFDQMLKMDCQPDVVTFGILINGACKARDYALAMNLLEKMEEMHIEINIVIYNTIIDYLC  278

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +++ A  L R+M   GI   +  F++M++GY      E+ + +F  +   G    V+
Sbjct  279  KAGHVEGALNLFRKMGSCGIVPNVVTFNSMINGYCTANRVEEGINLFYEMSRRGLVADVV  338

Query  15   SYGCL  1
            +Y  L
Sbjct  339  TYSIL  343


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 72/154 (47%), Gaps = 0/154 (0%)
 Frame = -2

Query  471  KMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVG  292
            K+   G  P    Y  L + + +   +  AL+ V +M  EG + +VVT+S ++ G    G
Sbjct  152  KILKLGYKPNVVTYNTLAHGFCIHGKISAALSLVDQMVKEGYKPNVVTFSTLINGLCLEG  211

Query  291  NVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFH  112
             V  A   F +  +         +G +I   C+  +   A  LL +MEE  I   I I++
Sbjct  212  RVSEALSLFDQMLKMDCQPDVVTFGILINGACKARDYALAMNLLEKMEEMHIEINIVIYN  271

Query  111  TMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            T++D      + E  L +F ++  CG  P+V+++
Sbjct  272  TIIDYLCKAGHVEGALNLFRKMGSCGIVPNVVTF  305


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/182 (22%), Positives = 78/182 (43%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   F  ++N     G    A  +F++M      P    +  L      +RD   A+ 
Sbjct  194  KPNVVTFSTLINGLCLEGRVSEALSLFDQMLKMDCQPDVVTFGILINGACKARDYALAMN  253

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM +  IEI++V Y+ I+    K G+VE A + F +        +   + ++I   C
Sbjct  254  LLEKMEEMHIEINIVIYNTIIDYLCKAGHVEGALNLFRKMGSCGIVPNVVTFNSMINGYC  313

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                ++    L  EM   G+ A +  +  ++ G+    N      +F +++  G  P+++
Sbjct  314  TANRVEEGINLFYEMSRRGLVADVVTYSILIQGFYRVGNLGAAQKVFMQMQYKGHRPNLV  373

Query  15   SY  10
            +Y
Sbjct  374  TY  375



>ref|XP_008799867.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic [Phoenix dactylifera]
Length=803

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F  MV+ Y +  + H+A+   +++ S G+ P S  Y +L   Y     + EAL  
Sbjct  599  PDLFTFSTMVDGYCKAKEVHKAKVYLDELVSWGLEPNSVIYNSLIGGYCRDGKISEALNL  658

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M ++GI  + VTYS I+ G   VG VE A++  L+ KE    L+   Y  +I   C+
Sbjct  659  LDEMKNKGIAPTSVTYSTIMHGMCNVGCVEEAKNMILKMKEDGLALNVVTYTTLIGGYCR  718

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               MD A ++L EM   G+A     +  +M GY    N +    + D + + G  P  ++
Sbjct  719  IGQMDEACKVLEEMSASGLAPNKVTYTVLMRGYCEMANYDAAAKLLDEMLDNGIDPDAVT  778

Query  12   YGCL  1
            Y  L
Sbjct  779  YNTL  782


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 81/155 (52%), Gaps = 0/155 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++  Y R G    A  + ++M+++GI PTS  Y+ + +       +EEA  
Sbjct  633  EPNSVIYNSLIGGYCRDGKISEALNLLDEMKNKGIAPTSVTYSTIMHGMCNVGCVEEAKN  692

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM ++G+ ++VVTY+ ++GG+ ++G ++ A     E        +   Y  ++   C
Sbjct  693  MILKMKEDGLALNVVTYTTLIGGYCRIGQMDEACKVLEEMSASGLAPNKVTYTVLMRGYC  752

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYT  91
            +  N D A +LL EM + GI      ++T+M G++
Sbjct  753  EMANYDAAAKLLDEMLDNGIDPDAVTYNTLMSGFS  787


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+      MV      G    A +++ KM  +G    +     L +   VS +M+EA+ 
Sbjct  458  RPNDSLMTSMVKELCENGKHREAIDIWLKMLEKGFGVNTMTSNALIHGLCVSGNMKEAVG  517

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +R M + G+ +  VTY+ ++ G  + G ++     + +  +R        Y  +I+  C
Sbjct  518  LLRAMLERGLALDRVTYNTLISGCCQEGKMDEGFKLWEDMTKRGFKPDIITYNTLIHGLC  577

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                M  A  LL E++ EG+   +  F TM+DGY   +   K  +  D L   G  P+ +
Sbjct  578  NLSRMKEAIGLLDELKNEGLVPDLFTFSTMVDGYCKAKEVHKAKVYLDELVSWGLEPNSV  637

Query  15   SYGCL  1
             Y  L
Sbjct  638  IYNSL  642


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/186 (19%), Positives = 95/186 (51%), Gaps = 2/186 (1%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  +++          A  + +++++ G+VP  + ++ +   Y  ++++ +A  
Sbjct  563  KPDIITYNTLIHGLCNLSRMKEAIGLLDELKNEGLVPDLFTFSTMVDGYCKAKEVHKAKV  622

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + ++   G+E + V Y+ ++GG+ + G +  A +   E K +    ++  Y  I++  C
Sbjct  623  YLDELVSWGLEPNSVIYNSLIGGYCRDGKISEALNLLDEMKNKGIAPTSVTYSTIMHGMC  682

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYT-ITRNEEKCLLMFDRLKECGFTPSV  19
                ++ A+ ++ +M+E+G+A  +  + T++ GY  I + +E C ++ + +   G  P+ 
Sbjct  683  NVGCVEEAKNMILKMKEDGLALNVVTYTTLIGGYCRIGQMDEACKVL-EEMSASGLAPNK  741

Query  18   ISYGCL  1
            ++Y  L
Sbjct  742  VTYTVL  747


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 89/195 (46%), Gaps = 1/195 (1%)
 Frame = -2

Query  582  VVRA-FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYT  406
            ++RA  ER     R  +  +++   + G      +++E M  RG  P    Y  L +   
Sbjct  518  LLRAMLERGLALDRVTYNTLISGCCQEGKMDEGFKLWEDMTKRGFKPDIITYNTLIHGLC  577

Query  405  VSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS  226
                M+EA+  + ++ +EG+   + T+S +V G+ K   V  A+ +  E        ++ 
Sbjct  578  NLSRMKEAIGLLDELKNEGLVPDLFTFSTMVDGYCKAKEVHKAKVYLDELVSWGLEPNSV  637

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
            IY ++I   C+   +  A  LL EM+ +GIA     + T+M G       E+   M  ++
Sbjct  638  IYNSLIGGYCRDGKISEALNLLDEMKNKGIAPTSVTYSTIMHGMCNVGCVEEAKNMILKM  697

Query  45   KECGFTPSVISYGCL  1
            KE G   +V++Y  L
Sbjct  698  KEDGLALNVVTYTTL  712


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 90/190 (47%), Gaps = 3/190 (2%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER   PS K    ++    R  D   A  +FE MR + + P +Y YT L      + ++E
Sbjct  209  ERGLCPSLKTCNFLLASLARSSDCKNACTVFEGMR-QFVFPDAYSYTPLIDVLCKNHEVE  267

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +A+     M   G+  +VVTY++++ G  K   ++ A   F E   R +   + I  NI+
Sbjct  268  KAIKLFSDMESSGVCPTVVTYNVLIDGLCKKRMLDEA-FRFKEKMMRSSVNPSVITFNIL  326

Query  207  YANCQTCN-MDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
                   N     E +L+EMEE GIA    I++T++DG+    +  + L + + +   G 
Sbjct  327  INGLVKSNRFGDVECILKEMEEIGIAPNEFIYNTLIDGHCRMGHCSEALRLKNEMVVKGL  386

Query  30   TPSVISYGCL  1
             P+ ++Y  L
Sbjct  387  QPNSVTYNVL  396



>ref|XP_004301139.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like 
[Fragaria vesca subsp. vesca]
Length=631

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 91/185 (49%), Gaps = 1/185 (1%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   FG++V+ + + G    AR +   M   G+ P  + Y  L Y Y    D+ +A+ 
Sbjct  278  QPNVVTFGILVDAFCKVGALMAARSVVGWMVKFGVAPNMFVYNALIYGYRKVEDVLQAVN  337

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M   GI   VVTYSI++ G   +  VE A +  L+   +    +A  Y ++I   C
Sbjct  338  LTLEMEKYGILPDVVTYSILITGLCSIHRVEDA-YQLLKNIRKGVAANAVTYNSLIDGYC  396

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  NM++A E+  EM + GI   +  F T++D Y   RN E  + ++  +   G  P V+
Sbjct  397  KDRNMEKALEVCSEMTKIGIEPNVITFSTLIDAYCKMRNMEAAMGLYSEMLVKGLLPDVV  456

Query  15   SYGCL  1
            +Y  L
Sbjct  457  AYTAL  461


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/199 (23%), Positives = 92/199 (46%), Gaps = 4/199 (2%)
 Frame = -2

Query  597  ENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            E  +  +   ER ++ SR  FG+++N     G    A  ++  M   G++P +     L 
Sbjct  93   ELVYNALSGLER-SRVSRNVFGVLINALSEMGLVEEALRVYSNM---GVLPATQACNALL  148

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
                    ++        M   G+  S VTY +++ G  + G++  A   F E  ER   
Sbjct  149  DGLVKKGQLDSMWELYNDMESRGLSPSCVTYGVLIKGCCRKGDLLNARKVFDEMPERGIE  208

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
             +  +Y ++I   C    M+ A+ + + M ++G+   +  ++ +MDGY+   +  + L++
Sbjct  209  RTVVVYTSLIRGMCTEGRMEEADSVFQTMRKDGVIPNLWTYNCLMDGYSKVADVRQALVL  268

Query  57   FDRLKECGFTPSVISYGCL  1
            +  L+  G  P+V+++G L
Sbjct  269  YSNLRGDGLQPNVVTFGIL  287


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 102/243 (42%), Gaps = 44/243 (18%)
 Frame = -2

Query  627  NFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIV  448
            N RKV +  PE      R  ER    +   +  ++      G    A  +F+ MR  G++
Sbjct  194  NARKVFDEMPE------RGIER----TVVVYTSLIRGMCTEGRMEEADSVFQTMRKDGVI  243

Query  447  PTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEH-  271
            P  + Y  L   Y+   D+ +AL     +  +G++ +VVT+ I+V  F KVG + AA   
Sbjct  244  PNLWTYNCLMDGYSKVADVRQALVLYSNLRGDGLQPNVVTFGILVDAFCKVGALMAARSV  303

Query  270  --WFLE--AKERHATLSASIYG-----NIIYANCQTCNMDR-------------------  175
              W ++          +A IYG     +++ A   T  M++                   
Sbjct  304  VGWMVKFGVAPNMFVYNALIYGYRKVEDVLQAVNLTLEMEKYGILPDVVTYSILITGLCS  363

Query  174  -----AeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
                     L +   +G+AA    +++++DGY   RN EK L +   + + G  P+VI++
Sbjct  364  IHRVEDAYQLLKNIRKGVAANAVTYNSLIDGYCKDRNMEKALEVCSEMTKIGIEPNVITF  423

Query  9    GCL  1
              L
Sbjct  424  STL  426


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 68/135 (50%), Gaps = 2/135 (1%)
 Frame = -2

Query  495  HRAREMFEKMRS--RGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYS  322
            HR  + ++ +++  +G+   +  Y +L   Y   R+ME+AL    +M   GIE +V+T+S
Sbjct  365  HRVEDAYQLLKNIRKGVAANAVTYNSLIDGYCKDRNMEKALEVCSEMTKIGIEPNVITFS  424

Query  321  IIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeE  142
             ++  + K+ N+EAA   + E   +        Y  +I  + +T N+  A  L +EM E 
Sbjct  425  TLIDAYCKMRNMEAAMGLYSEMLVKGLLPDVVAYTALIDGHFKTGNVKEAYRLSKEMLEA  484

Query  141  GIAAPISIFHTMMDG  97
            G+   +     ++DG
Sbjct  485  GLTPNVFTLSCLVDG  499



>gb|EMT18607.1| hypothetical protein F775_09904 [Aegilops tauschii]
Length=483

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = -2

Query  612  LESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYE  433
            L + PE +   ++  +    P  ++F +++  + R GD   AR++F++MR+RG+ PT   
Sbjct  92   LPTTPEAYAFYLQLLDAGMTPEVRQFNVLMRDFVRLGDLASARKVFDEMRTRGVQPTVVS  151

Query  432  YTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            +  L      +RD++      + M   GI     TYS ++ G +  G +E A   F E +
Sbjct  152  FNTLISGMCRARDLDGVDGLYKGMAQMGITPDAYTYSALIKGLSSSGRMEDATMMFGEMR  211

Query  252  ERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEE  73
            ER    +A ++  +I A+C+  ++    +L ++M   G+   +  ++ +++G    RN E
Sbjct  212  ERGVKPNAIVFTTLIDAHCKDGDVKAGMDLYQDMRARGVMPDLVAYNALVNGLCRARNFE  271

Query  72   KCLLMFDRLKECGFTPSVISYGCL  1
                + + ++  G  P  ++Y  L
Sbjct  272  AAECIVEEMRGTGLKPDKMTYTTL  295


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +VN   R  +   A  + E+MR  G+ P    YT L         ++ A+  
Sbjct  252  PDLVAYNALVNGLCRARNFEAAECIVEEMRGTGLKPDKMTYTTLIDGSCKDGKLDTAMDI  311

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             +KM +E + +  VTY+ ++ G +K G    AE   +E  E       + Y  +I A C+
Sbjct  312  KQKMAEEEVALDEVTYTALISGLSKAGRPVDAERVLVEMMEAGLEPDNTTYTMVIDAFCR  371

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++    +LL+EM+ +G    +  ++ +M G       +   ++ + +   G +P  I+
Sbjct  372  KGDVKTGFKLLKEMQNKGRKPGVVTYNVIMSGLCKLGQLKNADMLLNAMLNIGVSPDDIT  431

Query  12   YGCL  1
            Y  L
Sbjct  432  YNIL  435


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/186 (23%), Positives = 83/186 (45%), Gaps = 0/186 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER  KP+   F  +++ + + GD     ++++ MR+RG++P    Y  L      +R+ E
Sbjct  212  ERGVKPNAIVFTTLIDAHCKDGDVKAGMDLYQDMRARGVMPDLVAYNALVNGLCRARNFE  271

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
             A   V +M   G++   +TY+ ++ G  K G ++ A     +  E    L    Y  +I
Sbjct  272  AAECIVEEMRGTGLKPDKMTYTTLIDGSCKDGKLDTAMDIKQKMAEEEVALDEVTYTALI  331

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
                +      AE +L EM E G+    + +  ++D +    + +    +   ++  G  
Sbjct  332  SGLSKAGRPVDAERVLVEMMEAGLEPDNTTYTMVIDAFCRKGDVKTGFKLLKEMQNKGRK  391

Query  27   PSVISY  10
            P V++Y
Sbjct  392  PGVVTY  397



>ref|XP_009412775.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=1029

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 92/186 (49%), Gaps = 0/186 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER   P+   +G +++++ + GD   A E+ + M +RGI P     T L   Y  S ++ 
Sbjct  548  ERGLSPNVFTYGPLIDWHSKSGDMDGADELLQLMVARGIKPNDVILTILIDGYCKSDNVA  607

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +A +    M   G+   V TYS+++   +K G ++ A   F E +E+  T  A  YG++I
Sbjct  608  KAFSTFHSMLGHGVLPDVQTYSVLIQSLSKSGKIQEAFQAFSELQEKGLTPDAYTYGSLI  667

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
            +  C+T +M +A  L  EM   G+   I  ++ ++DG+  + N       F  +   G  
Sbjct  668  FGLCKTGDMVKAVTLHDEMCARGVEPNIVTYNALIDGFCKSGNINSAKKYFKSVLAKGLV  727

Query  27   PSVISY  10
            P+ ++Y
Sbjct  728  PTSVTY  733


 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 92/184 (50%), Gaps = 1/184 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  + + +++    + G    A + F +++ +G+ P +Y Y +L +    + DM +A+T 
Sbjct  623  PDVQTYSVLIQSLSKSGKIQEAFQAFSELQEKGLTPDAYTYGSLIFGLCKTGDMVKAVTL  682

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   G+E ++VTY+ ++ GF K GN+ +A+ +F     +    ++  Y  +I  NC+
Sbjct  683  HDEMCARGVEPNIVTYNALIDGFCKSGNINSAKKYFKSVLAKGLVPTSVTYTTMIDGNCK  742

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM  A  L  +M   GI+    +++ ++ G     + E+ L +F      GF  +V +
Sbjct  743  AGNMSEAFVLYEQMLSRGISPDKFVYNVLISGCCKAGDMERALHLFSEALPKGFV-TVFT  801

Query  12   YGCL  1
            +  L
Sbjct  802  FNSL  805


 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +M+N +   G+  +A  +  +M   G+ P +  Y+ L         + EA+  
Sbjct  448  PNLYTYSVMINGFCVCGESRQAEVLLMEMHENGLEPNAVIYSTLISGQCKEGRIMEAVQT  507

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + KM D  +      Y+ ++ G  K GN+E A+ +F + +ER  + +   YG +I  + +
Sbjct  508  LDKMADINVPPDTFCYNYLIMGLCKAGNLEEAKKYFTQMQERGLSPNVFTYGPLIDWHSK  567

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + +MD A+ELL+ M   GI     I   ++DGY  + N  K    F  +   G  P V +
Sbjct  568  SGDMDGADELLQLMVARGIKPNDVILTILIDGYCKSDNVAKAFSTFHSMLGHGVLPDVQT  627

Query  12   YGCL  1
            Y  L
Sbjct  628  YSVL  631


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (46%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++    + GD  +A E+ E+M   G  P +  Y  +   Y   R  +EAL 
Sbjct  377  QPNMFTYNSLIRGVCKAGDIDKAHELLEEMDRMGCKPETQTYNLVIEGYFKVRSPQEALR  436

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M    +  ++ TYS+++ GF   G    AE   +E  E     +A IY  +I   C
Sbjct  437  LLEEMKIRNVLPNLYTYSVMINGFCVCGESRQAEVLLMEMHENGLEPNAVIYSTLISGQC  496

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  A + L +M +  +      ++ ++ G     N E+    F +++E G +P+V 
Sbjct  497  KEGRIMEAVQTLDKMADINVPPDTFCYNYLIMGLCKAGNLEEAKKYFTQMQERGLSPNVF  556

Query  15   SYGCL  1
            +YG L
Sbjct  557  TYGPL  561


 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 96/186 (52%), Gaps = 3/186 (2%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  +++ + + G+ + A++ F+ + ++G+VPTS  YT +      + +M EA  
Sbjct  692  EPNIVTYNALIDGFCKSGNINSAKKYFKSVLAKGLVPTSVTYTTMIDGNCKAGNMSEAFV  751

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M   GI      Y++++ G  K G++E A H F EA  +   ++   + +++   C
Sbjct  752  LYEQMLSRGISPDKFVYNVLISGCCKAGDMERALHLFSEALPK-GFVTVFTFNSLVDGFC  810

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRN-EEKCLLMFDRLKECGFTPSV  19
            +   +  A +LL+EM ++ +      +  ++DGY    + EE C L+ + +++    P+ 
Sbjct  811  KLGKLQEATKLLQEMVDKEVMPNNVTYTILIDGYAKAGHLEEACRLLME-MQDRNIEPNC  869

Query  18   ISYGCL  1
            ++Y  L
Sbjct  870  VTYTSL  875


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 77/172 (45%), Gaps = 0/172 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            F  +V+ + + G    A ++ ++M  + ++P +  YT L   Y  +  +EEA   + +M 
Sbjct  802  FNSLVDGFCKLGKLQEATKLLQEMVDKEVMPNNVTYTILIDGYAKAGHLEEACRLLMEMQ  861

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            D  IE + VTY+ ++ G  K+GN  AA   F E            YG +I  +C+  N+ 
Sbjct  862  DRNIEPNCVTYTSLIDGHNKMGNTSAASALFEEMMANGIHPDEITYGVMIQVHCKEENLA  921

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
             A +    +  EG     + +  ++     +    + L M + + E G  PS
Sbjct  922  EAFKFRDAIIAEGKQLSSATYVELLKSLCRSEKFSEALSMLNEMIEKGVKPS  973


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 86/184 (47%), Gaps = 1/184 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  M++   + G+   A  ++E+M SRGI P  + Y  L      + DME AL  
Sbjct  728  PTSVTYTTMIDGNCKAGNMSEAFVLYEQMLSRGISPDKFVYNVLISGCCKAGDMERALHL  787

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +   +G  ++V T++ +V GF K+G ++ A     E  ++    +   Y  +I    +
Sbjct  788  FSEALPKGF-VTVFTFNSLVDGFCKLGKLQEATKLLQEMVDKEVMPNNVTYTILIDGYAK  846

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +++ A  LL EM++  I      + +++DG+    N      +F+ +   G  P  I+
Sbjct  847  AGHLEEACRLLMEMQDRNIEPNCVTYTSLIDGHNKMGNTSAASALFEEMMANGIHPDEIT  906

Query  12   YGCL  1
            YG +
Sbjct  907  YGVM  910


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 88/206 (43%), Gaps = 0/206 (0%)
 Frame = -2

Query  618  KVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTS  439
            K   S P     +V  F R  + +   F ++++ Y R G    A E+   M+     P+ 
Sbjct  146  KTCPSPPSVLDNIVGCFSRDPRSNSAVFSVLIDTYKRAGMLKEAAEVALLMKGGAFAPSL  205

Query  438  YEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE  259
                 L      +  M+        ++   +   V T++I++  + KVGNV+AA++ FLE
Sbjct  206  RCCNALLKDLLRANSMDLFWKVHDFISRAQLGHDVYTFTILIEAYFKVGNVDAAKNVFLE  265

Query  258  AKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRN  79
             +++    SA  Y  +I   C+   +  A +L  EM ++G+AA    +  ++ G      
Sbjct  266  MEQKRCAPSAVTYNTLICGFCRVGALGDAFQLKEEMVKKGLAADNYTYSVLISGLCKNSQ  325

Query  78   EEKCLLMFDRLKECGFTPSVISYGCL  1
              +   + D +   G  P+V  Y  L
Sbjct  326  SIEARKLLDEISVRGLKPNVFIYSSL  351


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/185 (19%), Positives = 79/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  +++   + G    A +  +KM    + P ++ Y  L      + ++EEA  
Sbjct  482  EPNAVIYSTLISGQCKEGRIMEAVQTLDKMADINVPPDTFCYNYLIMGLCKAGNLEEAKK  541

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M + G+  +V TY  ++   +K G+++ A+        R    +  I   +I   C
Sbjct  542  YFTQMQERGLSPNVFTYGPLIDWHSKSGDMDGADELLQLMVARGIKPNDVILTILIDGYC  601

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++ N+ +A      M   G+   +  +  ++   + +   ++    F  L+E G TP   
Sbjct  602  KSDNVAKAFSTFHSMLGHGVLPDVQTYSVLIQSLSKSGKIQEAFQAFSELQEKGLTPDAY  661

Query  15   SYGCL  1
            +YG L
Sbjct  662  TYGSL  666



>ref|XP_010247360.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06920-like 
[Nelumbo nucifera]
Length=901

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 121/267 (45%), Gaps = 16/267 (6%)
 Frame = -2

Query  783  GSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRI---MKDKKKGRTRWMEGSSSRNFRKV  613
            G +P+     ++  DG+   GRV     DD  R+   M D        +  S  RNF K 
Sbjct  473  GCTPDVVTFCSL-IDGLGRQGRV-----DDAYRLFERMLDAGMIANAVVYTSLIRNFFKC  526

Query  612  LESQPENWHAVVRAFERINKPSRKEFGMMVNYYG---RRGDKHRAREMFEKMRSRGIVPT  442
               + E+ H V +  E + +    +  ++  Y     + G+ H+ R +FE++R+RG+VP 
Sbjct  527  --GRKEDGHKVYK--EMVRRGCSPDLTLLNTYMDCVFKAGETHKGRALFEEIRTRGLVPD  582

Query  441  SYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFL  262
               Y+ L +    +    E       M ++G  +  + Y+ ++ GF K G V  A     
Sbjct  583  VRSYSILIHGIVKAGHARETYKLFYAMKEQGYVLDTLAYNTVIDGFCKSGQVNKAYQLLE  642

Query  261  EAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITR  82
            E K +    +   YG++I    +   +D A  L  E + +GI   + ++ +++DG+    
Sbjct  643  EMKAKGHLPTVVTYGSVIDGLAKIDRLDEAYMLFEEAKSKGIEPNVVVYSSLIDGFGKVG  702

Query  81   NEEKCLLMFDRLKECGFTPSVISYGCL  1
              ++  L+ + L + G TP+V ++ CL
Sbjct  703  RIDEAYLIMEELMQKGLTPNVYTWNCL  729


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 81/184 (44%), Gaps = 1/184 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  M+    +      A E+FE+M     VP +Y Y  +   Y  +   +EA   
Sbjct  302  PDDVSYTSMIGVLCKANRLDEAVELFEQMELNRNVPCAYAYNTMIMGYGSAGKFDEAYKL  361

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +  ++G   SV+ Y+ I+    K G  + A   F E K + A  + S Y  +I   C+
Sbjct  362  LERQREKGCIPSVIAYNCILTCLGKKGRFDEAIRIFEEMK-KDAMPNLSTYNILIDMLCR  420

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               ++ A E+   ME  G+   +   + M+D     R  ++   +F+ + E G TP V++
Sbjct  421  AGKLEAAFEIQNSMEAAGLFPNVLTMNIMVDRLCKARKLDEACSIFESMDEKGCTPDVVT  480

Query  12   YGCL  1
            +  L
Sbjct  481  FCSL  484


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 83/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + ++V       +   A  +F +M+  G     + +T L  A+     ++ AL+ 
Sbjct  197  PAFSAYTILVGALAEIHEPDLALTLFHQMQDIGYEGNVHLFTTLVRAFAKEGRIDAALSL  256

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + ++        +V Y++ +  F KVG V+ A  +F E K +        Y ++I   C+
Sbjct  257  LDEIKSNSFSADIVLYNVCIDCFGKVGKVDMAWKFFHEMKAQGLVPDDVSYTSMIGVLCK  316

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +D A EL  +ME          ++TM+ GY      ++   + +R +E G  PSVI+
Sbjct  317  ANRLDEAVELFEQMELNRNVPCAYAYNTMIMGYGSAGKFDEAYKLLERQREKGCIPSVIA  376

Query  12   YGCL  1
            Y C+
Sbjct  377  YNCI  380


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 56/116 (48%), Gaps = 0/116 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  +++ +G+ G    A  + E++  +G+ P  Y +  L  A   + +++EAL 
Sbjct  685  EPNVVVYSSLIDGFGKVGRIDEAYLIMEELMQKGLTPNVYTWNCLLDALVKADEIDEALV  744

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            C + M D     + +TYSI++ G  +V     A  +  E +++    +   Y  II
Sbjct  745  CFQSMKDLKCNPNTITYSIVINGLCRVQRFNKAFVFLQEMQKKGLKANVITYTTII  800


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 85/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +G +++   +      A  +FE+ +S+GI P    Y++L   +     ++EA   
Sbjct  651  PTVVTYGSVIDGLAKIDRLDEAYMLFEEAKSKGIEPNVVVYSSLIDGFGKVGRIDEAYLI  710

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + ++  +G+  +V T++ ++    K   ++ A   F   K+     +   Y  +I   C+
Sbjct  711  MEELMQKGLTPNVYTWNCLLDALVKADEIDEALVCFQSMKDLKCNPNTITYSIVINGLCR  770

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
                ++A   L+EM+++G+ A +  + T++ G     N  +   +F+R +  G  P   S
Sbjct  771  VQRFNKAFVFLQEMQKKGLKANVITYTTIISGLAKAGNIMEASGLFERFQASGGRPDSAS  830

Query  12   YGCL  1
            Y  L
Sbjct  831  YNAL  834


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/203 (21%), Positives = 89/203 (44%), Gaps = 17/203 (8%)
 Frame = -2

Query  579  VRAFERI----NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYA  412
            V  FE++    N P    +  M+  YG  G    A ++ E+ R +G +P+   Y  +   
Sbjct  324  VELFEQMELNRNVPCAYAYNTMIMGYGSAGKFDEAYKLLERQREKGCIPSVIAYNCILTC  383

Query  411  YTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLS  232
                   +EA+    +M  + +  ++ TY+I++    + G +EAA         +++  +
Sbjct  384  LGKKGRFDEAIRIFEEMKKDAMP-NLSTYNILIDMLCRAGKLEAAFEI------QNSMEA  436

Query  231  ASIYGNIIYAN------CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
            A ++ N++  N      C+   +D A  +   M+E+G    +  F +++DG       + 
Sbjct  437  AGLFPNVLTMNIMVDRLCKARKLDEACSIFESMDEKGCTPDVVTFCSLIDGLGRQGRVDD  496

Query  69   CLLMFDRLKECGFTPSVISYGCL  1
               +F+R+ + G   + + Y  L
Sbjct  497  AYRLFERMLDAGMIANAVVYTSL  519



>ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009604240.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009604241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=864

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 92/184 (50%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   F  +++   + G    A+++ +K+ + G++PT   Y +L   +    D+  AL  
Sbjct  558  PTDYTFNTLISGLSKAGKMSEAKDLLKKIVAGGLLPTCMSYNSLLDGFLKEDDVTSALDV  617

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R++ D GI   VVTY+ ++ GF K  N++ A     E + R   L    Y  +I   C+
Sbjct  618  YRELCDNGISPDVVTYTTLIDGFCKSNNIDLALKMLNEMRNREIKLDVIAYAVLIDGFCK  677

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M  A EL  E+ + G++  + ++++M+ G+    N E  L++ DR+   G T  + +
Sbjct  678  RRDMKSASELFDEILQVGLSPNLFVYNSMISGFKNVNNMEAALVLRDRMINEGVTCDLET  737

Query  12   YGCL  1
            Y  L
Sbjct  738  YTTL  741


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/202 (23%), Positives = 100/202 (50%), Gaps = 5/202 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N  + +  F+++ +    P++  + +++    + G+  +A E++ +M+  GI P  Y   
Sbjct  366  NLSSALDLFDKLAEYGLTPNKVTYAVLIEGCCKNGNIEKAVEIYRQMKLAGIKPNVYVEN  425

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
            +L   +     ++EAL    +  + G   +V  Y+ I+  F K G ++ A++ + +  + 
Sbjct  426  SLIKGFLSVNLLDEALNVFDEAINSGTA-NVFAYNSIIAWFCKKGRMDDAQNVWDKMVDN  484

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                S + Y N+I  NC+  NMD+A +L  ++ E  + A +  +  ++DGY    + +K 
Sbjct  485  GVVPSIASYNNMILGNCRNGNMDKALDLFSQLPERQLKANVVTYSILIDGYFRKGDTDKA  544

Query  66   LLMFDRLKECGFTPSVISYGCL  1
              MFD++   G  P+  ++  L
Sbjct  545  RNMFDQMVTSGIAPTDYTFNTL  566


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/179 (22%), Positives = 85/179 (47%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + ++++ + +R D   A E+F+++   G+ P  + Y ++   +    +ME AL    +M 
Sbjct  668  YAVLIDGFCKRRDMKSASELFDEILQVGLSPNLFVYNSMISGFKNVNNMEAALVLRDRMI  727

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            +EG+   + TY+ ++ G  K G +  A   F E   +        Y  +++  C    ++
Sbjct  728  NEGVTCDLETYTTLIDGLLKDGKIVRASDLFTEMLGKGIMPDDITYTVLVHGLCNKGQVE  787

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A ++L EM ++     + I++T++ GY    N ++   + D + + G  P   +Y  L
Sbjct  788  NAHKVLEEMCKKSTTPNVLIYNTLIAGYFKEGNLQEAFRLHDEMLDKGLKPDDATYDIL  846


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/184 (22%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ + +  D   A +++ ++   GI P    YT L   +  S +++ AL  
Sbjct  593  PTCMSYNSLLDGFLKEDDVTSALDVYRELCDNGISPDVVTYTTLIDGFCKSNNIDLALKM  652

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M +  I++ V+ Y++++ GF K  ++++A   F E  +   + +  +Y ++I     
Sbjct  653  LNEMRNREIKLDVIAYAVLIDGFCKRRDMKSASELFDEILQVGLSPNLFVYNSMISGFKN  712

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM+ A  L   M  EG+   +  + T++DG        +   +F  +   G  P  I+
Sbjct  713  VNNMEAALVLRDRMINEGVTCDLETYTTLIDGLLKDGKIVRASDLFTEMLGKGIMPDDIT  772

Query  12   YGCL  1
            Y  L
Sbjct  773  YTVL  776


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 76/173 (44%), Gaps = 6/173 (3%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTN---LTYAYTVSRDMEEALTCVRKMNDEGIEI  340
            R G     R+++  + SRGI    Y+Y     L  A      MEEA+   ++    GI++
Sbjct  223  RHGMIGVVRDLYTDVVSRGIC---YDYRTVHILMSACLREGKMEEAVKLFKEAKMSGIKL  279

Query  339  SVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeell  160
                YS+ V    K  N+  A     E K+R    S   Y N+I    +  NM  A  L 
Sbjct  280  DAGLYSLCVYVACKEQNLGFALELLGEMKDRGWVPSEGTYVNMISTCVKQRNMVEALRLK  339

Query  159  remeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             EM   G    + +  ++M GY +  N    L +FD+L E G TP+ ++Y  L
Sbjct  340  DEMLSNGHPMNLVVSTSLMKGYHVQGNLSSALDLFDKLAEYGLTPNKVTYAVL  392


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 80/160 (50%), Gaps = 1/160 (1%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A E+  +M+ RG VP+   Y N+       R+M EAL    +M   G  +++V  + ++ 
Sbjct  300  ALELLGEMKDRGWVPSEGTYVNMISTCVKQRNMVEALRLKDEMLSNGHPMNLVVSTSLMK  359

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            G+   GN+ +A   F +  E   T +   Y  +I   C+  N+++A E+ R+M+  GI  
Sbjct  360  GYHVQGNLSSALDLFDKLAEYGLTPNKVTYAVLIEGCCKNGNIEKAVEIYRQMKLAGIKP  419

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             + + ++++ G+      ++ L +FD     G T +V +Y
Sbjct  420  NVYVENSLIKGFLSVNLLDEALNVFDEAINSG-TANVFAY  458



>ref|XP_006394512.1| hypothetical protein EUTSA_v10005336mg [Eutrema salsugineum]
 gb|ESQ31798.1| hypothetical protein EUTSA_v10005336mg [Eutrema salsugineum]
Length=665

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   FG +V+ + +  +   AR +F  M   G+ P  Y Y  L +   +S +M EA+  
Sbjct  308  PNVVIFGTLVDGFCKAHELVAARSLFVHMAKFGVDPNLYVYNCLIHGQCISGNMLEAMAL  367

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M    +   V TY+I++ G      +  A+  F   K+     S++ Y ++I+  C+
Sbjct  368  SSEMQSFNLSPDVFTYTILINGLCTEDRLTEADRLFQRMKKERIFPSSATYNSLIHGYCR  427

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM++A +L  EM   GI   I  F T++DGY   RN +  + ++  +   G  P V++
Sbjct  428  EYNMEKALDLCSEMTASGIEPNIITFSTLIDGYCKVRNIKAAMGLYSEMTIKGIVPDVVT  487

Query  12   YGCL  1
            Y  L
Sbjct  488  YTAL  491


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 73/153 (48%), Gaps = 0/153 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    + +++N          A  +F++M+   I P+S  Y +L + Y    +ME+AL  
Sbjct  378  PDVFTYTILINGLCTEDRLTEADRLFQRMKKERIFPSSATYNSLIHGYCREYNMEKALDL  437

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   GIE +++T+S ++ G+ KV N++AA   + E   +        Y  +I A+ +
Sbjct  438  CSEMTASGIEPNIITFSTLIDGYCKVRNIKAAMGLYSEMTIKGIVPDVVTYTALIDAHFK  497

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGY  94
              N + A  L   M + GI      F  ++DG+
Sbjct  498  EANKNEAVRLYSNMLDAGIHPNDHTFACLVDGF  530


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   + + +    R      A +MFE M+  G++P  Y Y  +   Y  +  + +A T
Sbjct  237  KPNVYIYTIFIRDLCRENKMEEAEKMFELMKKHGVIPNLYTYGAIIGGYCKTGKLRQAYT  296

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              +++    +  +VV +  +V GF K   + AA   F+   +     +  +Y  +I+  C
Sbjct  297  LYKEILVAELLPNVVIFGTLVDGFCKAHELVAARSLFVHMAKFGVDPNLYVYNCLIHGQC  356

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
             + NM  A  L  EM+   ++  +  +  +++G        +   +F R+K+    PS  
Sbjct  357  ISGNMLEAMALSSEMQSFNLSPDVFTYTILINGLCTEDRLTEADRLFQRMKKERIFPSSA  416

Query  15   SYGCL  1
            +Y  L
Sbjct  417  TYNSL  421


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 73/170 (43%), Gaps = 0/170 (0%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            ++G   +   + ++M S GI P  Y YT           MEEA      M   G+  ++ 
Sbjct  217  KQGFSSKKEILLDEMTSSGIKPNVYIYTIFIRDLCRENKMEEAEKMFELMKKHGVIPNLY  276

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
            TY  I+GG+ K G +  A   + E        +  I+G ++   C+   +  A  L   M
Sbjct  277  TYGAIIGGYCKTGKLRQAYTLYKEILVAELLPNVVIFGTLVDGFCKAHELVAARSLFVHM  336

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             + G+   + +++ ++ G  I+ N  + + +   ++    +P V +Y  L
Sbjct  337  AKFGVDPNLYVYNCLIHGQCISGNMLEAMALSSEMQSFNLSPDVFTYTIL  386



>gb|KCW88461.1| hypothetical protein EUGRSUZ_A00848, partial [Eucalyptus grandis]
Length=552

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 94/184 (51%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + F ++V+ Y + G    A  + ++M   G +P+S+ Y  L   Y +   M+ A+  
Sbjct  266  PNVRTFTVLVDAYCKEGMLVEAEAIVDQMIQLGQMPSSFIYNTLMNGYCLHNRMDNAMEV  325

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +  M + G    VV+YS ++ G+ KV  V+ ++  F E  +R        Y  ++Y  CQ
Sbjct  326  LNLMVERGCSPDVVSYSTLINGYCKVKRVDKSKMLFQEMLQRGLIPDVMTYSTLVYGFCQ  385

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N++ AEEL+ EM+   ++        ++DG   T+  +K +++  ++++  F P +++
Sbjct  386  VGNLEAAEELINEMQSCNLSPNHYTLSALLDGLCKTQQIDKAMILLRKMEDTKFAPDIVT  445

Query  12   YGCL  1
            Y  L
Sbjct  446  YTIL  449


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 87/187 (47%), Gaps = 10/187 (5%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +  ++N Y        A E+   M  RG  P    Y+ L   Y   + ++++   
Sbjct  301  PSSFIYNTLMNGYCLHNRMDNAMEVLNLMVERGCSPDVVSYSTLINGYCKVKRVDKSKML  360

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE-----RHATLSASIYGNII  208
             ++M   G+   V+TYS +V GF +VGN+EAAE    E +       H TLSA + G   
Sbjct  361  FQEMLQRGLIPDVMTYSTLVYGFCQVGNLEAAEELINEMQSCNLSPNHYTLSALLDG---  417

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+T  +D+A  LLR+ME+   A  I  +  +++G       +    +F+ L   G  
Sbjct  418  --LCKTQQIDKAMILLRKMEDTKFAPDIVTYTILINGMCNAGKLDDAKGLFNCLHAQGLQ  475

Query  27   PSVISYG  7
            P V +YG
Sbjct  476  PDVWTYG  482


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 85/188 (45%), Gaps = 0/188 (0%)
 Frame = -2

Query  564  RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEE  385
            ++ KP    +  +++     G    A  + ++M SR I P    Y +L +        ++
Sbjct  157  KVIKPDVVTYNSLIHGLCNAGQLEYALALLKEMTSRAIQPDLPTYNSLVHCLCNLGQWKD  216

Query  384  ALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIY  205
            A   + KM   GIE  VVTY++++ G    G +  A+       +     +   +  ++ 
Sbjct  217  ATVLLEKMTKAGIEPDVVTYTLVIQGVCNSGQLTEAQRLLSHMVQSRVMPNVRTFTVLVD  276

Query  204  ANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTP  25
            A C+   +  AE ++ +M + G      I++T+M+GY +    +  + + + + E G +P
Sbjct  277  AYCKEGMLVEAEAIVDQMIQLGQMPSSFIYNTLMNGYCLHNRMDNAMEVLNLMVERGCSP  336

Query  24   SVISYGCL  1
             V+SY  L
Sbjct  337  DVVSYSTL  344



>ref|XP_010044295.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63130, 
mitochondrial-like [Eucalyptus grandis]
Length=579

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 94/184 (51%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + F ++V+ Y + G    A  + ++M   G +P+S+ Y  L   Y +   M+ A+  
Sbjct  266  PNVRTFTVLVDAYCKEGMLVEAEAIVDQMIQLGQMPSSFIYNTLMNGYCLHNRMDNAMEV  325

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +  M + G    VV+YS ++ G+ KV  V+ ++  F E  +R        Y  ++Y  CQ
Sbjct  326  LNLMVERGCSPDVVSYSTLINGYCKVKRVDKSKMLFQEMLQRGLIPDVMTYSTLVYGFCQ  385

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N++ AEEL+ EM+   ++        ++DG   T+  +K +++  ++++  F P +++
Sbjct  386  VGNLEAAEELINEMQSCNLSPNHYTLSALLDGLCKTQQIDKAMILLRKMEDTKFAPDIVT  445

Query  12   YGCL  1
            Y  L
Sbjct  446  YTIL  449


 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 87/187 (47%), Gaps = 10/187 (5%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +  ++N Y        A E+   M  RG  P    Y+ L   Y   + ++++   
Sbjct  301  PSSFIYNTLMNGYCLHNRMDNAMEVLNLMVERGCSPDVVSYSTLINGYCKVKRVDKSKML  360

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE-----RHATLSASIYGNII  208
             ++M   G+   V+TYS +V GF +VGN+EAAE    E +       H TLSA + G   
Sbjct  361  FQEMLQRGLIPDVMTYSTLVYGFCQVGNLEAAEELINEMQSCNLSPNHYTLSALLDG---  417

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+T  +D+A  LLR+ME+   A  I  +  +++G       +    +F+ L   G  
Sbjct  418  --LCKTQQIDKAMILLRKMEDTKFAPDIVTYTILINGMCNAGKLDDAKGLFNCLHAQGLQ  475

Query  27   PSVISYG  7
            P V +YG
Sbjct  476  PDVWTYG  482


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 85/188 (45%), Gaps = 0/188 (0%)
 Frame = -2

Query  564  RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEE  385
            ++ KP    +  +++     G    A  + ++M SR I P    Y +L +        ++
Sbjct  157  KVIKPDVVTYNSLIHGLCNAGQLEYALALLKEMTSRAIQPDLPTYNSLVHCLCNLGQWKD  216

Query  384  ALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIY  205
            A   + KM   GIE  VVTY++++ G    G +  A+       +     +   +  ++ 
Sbjct  217  ATVLLEKMTKAGIEPDVVTYTLVIQGVCNSGQLTEAQRLLSHMVQSRVMPNVRTFTVLVD  276

Query  204  ANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTP  25
            A C+   +  AE ++ +M + G      I++T+M+GY +    +  + + + + E G +P
Sbjct  277  AYCKEGMLVEAEAIVDQMIQLGQMPSSFIYNTLMNGYCLHNRMDNAMEVLNLMVERGCSP  336

Query  24   SVISYGCL  1
             V+SY  L
Sbjct  337  DVVSYSTL  344



>ref|XP_010276196.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial [Nelumbo nucifera]
Length=1024

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 98/187 (52%), Gaps = 0/187 (0%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
             ER  +PS   +G  V+ + + G+   A + F +M S G++P    YT L   +  +  +
Sbjct  535  MERGLRPSAFTYGAFVHGHSKAGELQDANKYFSEMLSHGLIPNDIIYTALIDGHCKAGSI  594

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
            EEA +  + M ++G+   + TYS+I+ G ++ G ++ A   FLE +E+       IY  +
Sbjct  595  EEAFSTFQGMLEQGVLPDLKTYSVIISGLSRNGKIQEAMRVFLELQEKGLVPDTFIYSAL  654

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            I    +   +++A +L  EM  +GI   I I+++++DG   + + E+   +F+ +   G 
Sbjct  655  ISGFSKQGEIEKAFQLHDEMCGKGIEPNIIIYNSLIDGLCKSNDIERARNLFNSISTKGL  714

Query  30   TPSVISY  10
             P+ ++Y
Sbjct  715  APNNVTY  721


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/199 (26%), Positives = 90/199 (45%), Gaps = 7/199 (4%)
 Frame = -2

Query  576  RAFERIN-------KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            RAFE ++       KP    + ++VN   R GD  RA  + E+M + G+ P +  YT L 
Sbjct  421  RAFELLDDMKRKNLKPRLVTYSVIVNGLCRSGDFTRANGVLEEMAAEGLKPNAVVYTTLI  480

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
              Y     +EEA + +  MN++ +      Y+ ++ G  K G +  A+ +  E  ER   
Sbjct  481  TGYIREGRLEEARSVLNGMNEKAVPPDAFCYNTLIVGLCKAGKMVDAKEYLDEMMERGLR  540

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
             SA  YG  ++ + +   +  A +   EM   G+     I+  ++DG+    + E+    
Sbjct  541  PSAFTYGAFVHGHSKAGELQDANKYFSEMLSHGLIPNDIIYTALIDGHCKAGSIEEAFST  600

Query  57   FDRLKECGFTPSVISYGCL  1
            F  + E G  P + +Y  +
Sbjct  601  FQGMLEQGVLPDLKTYSVI  619


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 84/166 (51%), Gaps = 0/166 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  K + ++++   R G    A  +F +++ +G+VP ++ Y+ L   ++   ++E+A   
Sbjct  611  PDLKTYSVIISGLSRNGKIQEAMRVFLELQEKGLVPDTFIYSALISGFSKQGEIEKAFQL  670

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M  +GIE +++ Y+ ++ G  K  ++E A + F     +    +   Y ++I   C+
Sbjct  671  HDEMCGKGIEPNIIIYNSLIDGLCKSNDIERARNLFNSISTKGLAPNNVTYTSMIDGYCK  730

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMF  55
            + N+  A  L  EM   GI   + +++ ++DG     N EK L +F
Sbjct  731  SSNVTEAFRLFNEMPSLGIPPDVFVYNALIDGCCKEDNMEKALELF  776


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/195 (26%), Positives = 87/195 (45%), Gaps = 0/195 (0%)
 Frame = -2

Query  585  AVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYT  406
             +V   E+   PS   + +++    R G    A E+ + M  +G+ P +Y YT L     
Sbjct  250  VLVEMSEKGCNPSVVTYNVIIGGLCRTGALDEALELKKSMAEKGLAPDAYTYTMLINGLC  309

Query  405  VSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS  226
                 EEA   ++ M++ G  +  V Y  ++ GF + G+VE A     E       L  S
Sbjct  310  KENRFEEAKLILKDMSEMGRNLDHVPYMALIDGFMRKGDVEEAFKVRDEMTLHGIQLDLS  369

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
            +Y  +I   C+  NM +A EL+ EM   G+      + +++DGY    N  +   + D +
Sbjct  370  MYNMLIQGVCKVGNMGKAHELVNEMIGNGLKPDSITYTSLIDGYCRELNMGRAFELLDDM  429

Query  45   KECGFTPSVISYGCL  1
            K     P +++Y  +
Sbjct  430  KRKNLKPRLVTYSVI  444


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 75/177 (42%), Gaps = 0/177 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + M++    + G+  +A E+  +M   G+ P S  YT+L   Y    +M  A   +  M 
Sbjct  371  YNMLIQGVCKVGNMGKAHELVNEMIGNGLKPDSITYTSLIDGYCRELNMGRAFELLDDMK  430

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
             + ++  +VTYS+IV G  + G+   A     E        +A +Y  +I    +   ++
Sbjct  431  RKNLKPRLVTYSVIVNGLCRSGDFTRANGVLEEMAAEGLKPNAVVYTTLITGYIREGRLE  490

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYG  7
             A  +L  M E+ +      ++T++ G              D + E G  PS  +YG
Sbjct  491  EARSVLNGMNEKAVPPDAFCYNTLIVGLCKAGKMVDAKEYLDEMMERGLRPSAFTYG  547


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/182 (21%), Positives = 83/182 (46%), Gaps = 0/182 (0%)
 Frame = -2

Query  564  RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEE  385
            R++  + + F ++++ + + G    A  + ++M  +GI+P     T +      +  ME+
Sbjct  781  RMDFATTRSFNILIDGFCKIGKLQEASTLLKEMIDKGIMPDHVTCTTVIDWLCKAGKMED  840

Query  384  ALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIY  205
            A      M ++ +  + VTY+ ++ G+ K+GN+  A + F E   +   L    Y  +I 
Sbjct  841  AHRLFLGMQEKNLMPNAVTYTSLIHGYNKMGNMTEAFNLFQEMITKGIKLDEITYSVMIK  900

Query  204  ANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTP  25
                  N   A +L  E   +GI    ++++ ++D     +N  + L + + + E G  P
Sbjct  901  HCYDARNSVEALKLEDESLVKGIPMSSTVYNVLIDNLCKKKNFSEALKLLNEMGERGLKP  960

Query  24   SV  19
             +
Sbjct  961  KL  962


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 82/169 (49%), Gaps = 0/169 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            ++++  + G    A  +F  M+ + ++P +  YT+L + Y    +M EA    ++M  +G
Sbjct  828  VIDWLCKAGKMEDAHRLFLGMQEKNLMPNAVTYTSLIHGYNKMGNMTEAFNLFQEMITKG  887

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I++  +TYS+++       N   A     E+  +   +S+++Y  +I   C+  N   A 
Sbjct  888  IKLDEITYSVMIKHCYDARNSVEALKLEDESLVKGIPMSSTVYNVLIDNLCKKKNFSEAL  947

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
            +LL EM E G+   +S   +++ G+    N +K + +   +    + PS
Sbjct  948  KLLNEMGERGLKPKLSTCSSLVCGFHGMGNLDKAMEVLKSMVRFHWVPS  996



>ref|XP_006494534.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic-like isoform X2 [Citrus sinensis]
Length=437

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 97/190 (51%), Gaps = 0/190 (0%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
            F  + KP    +  +++   + G   +A+E+F +M+   I P    Y +L + +  + D 
Sbjct  52   FGVVCKPDAVTYTTIIDGLCKEGFVDKAKELFLQMKDENINPDVVTYNSLIHGFCYANDW  111

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
             EA   + +M D+G++ +VVT+++I+    K G ++ A        +R    +A +Y  +
Sbjct  112  NEANCLLIEMMDQGVQPNVVTFNVIMDELCKNGKMDEASRLLDLMIQRGVRPNAFVYSTL  171

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            I   C T  +DRA EL   M+  G    +  ++T+++GY  T++ E+ L ++  +   G 
Sbjct  172  IDGFCLTGEIDRARELFVSMDINGCMHNVVTYNTLINGYCKTKDVEESLNLYSEMLSKGI  231

Query  30   TPSVISYGCL  1
             P+V++Y  L
Sbjct  232  RPTVVTYNTL  241


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 79/182 (43%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  +++ +   G+  RARE+F  M   G +     Y  L   Y  ++D+EE+L 
Sbjct  162  RPNAFVYSTLIDGFCLTGEIDRARELFVSMDINGCMHNVVTYNTLINGYCKTKDVEESLN  221

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M  +GI  +VVTY+ +  G  ++  VE A   F E +        S Y   I   C
Sbjct  222  LYSEMLSKGIRPTVVTYNTLFHGLFEIHQVEHALKLFDEMQHSDVAAETSTYNTFIDGLC  281

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  A EL R +        I  +  ++DG       E    +F  L   G  P+V+
Sbjct  282  KNGYIVEAAELFRTLRVLKCELGIEAYSCLIDGLCKIGKLETAWELFQSLPRVGLMPNVV  341

Query  15   SY  10
            +Y
Sbjct  342  TY  343



>ref|XP_011085593.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Sesamum indicum]
 ref|XP_011085601.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Sesamum indicum]
 ref|XP_011085605.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Sesamum indicum]
 ref|XP_011085613.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Sesamum indicum]
Length=902

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F   ++   + G    A +MF KM S+G+VP ++ Y +L   +     + EAL  
Sbjct  581  PDAVAFSAFIDGLAKGGFVEEAYDMFLKMTSKGLVPNNFAYNSLISGFCNCGKLNEALKL  640

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M + G+    +TY+II+ GF K G +++A   ++E +    T     Y  +I   C+
Sbjct  641  EMEMRERGLLPDRLTYNIIIKGFCKQGRMKSATETYIEMQRHGFTPDIVTYNTLISGYCR  700

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M  AE L   M   G    ++ ++  + GY  ++   + ++MFD L   G  P  ++
Sbjct  701  QFDMLNAEYLANTMLSSGWDPDVTTYNIQIHGYCRSQRMNRAIMMFDELISTGIVPDTVT  760

Query  12   YGCL  1
            Y  L
Sbjct  761  YNTL  764


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 87/192 (45%), Gaps = 4/192 (2%)
 Frame = -2

Query  594  NW-HAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            NW H +V   E    PS   F  ++N + + G+   AR++F+ M+  G+ P +  Y  L 
Sbjct  324  NWVHLMV---ESGCNPSPATFSTIINAFCKEGNIAEARKIFDGMQEIGVFPNTALYNALM  380

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
              Y  +R++  A     +M  +G+    VT++I+  G  K G  E  E            
Sbjct  381  DGYVKAREIGLANMLYEEMRSKGVAPDSVTFNILAAGHYKYGKEEDGEQLLRNLSMIGLV  440

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
              +S+    I   C    +D A ELL  M E+G+   +  F++++  Y     E+K   +
Sbjct  441  PDSSLSDISIGGLCWAGRLDEALELLENMLEKGVPVSVIAFNSLIVAYGKAGLEDKAFEV  500

Query  57   FDRLKECGFTPS  22
            ++ + + G TPS
Sbjct  501  YNIMVKFGLTPS  512


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/185 (21%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS     +++    R G      +++  M  +G +P+ Y Y  +   +     +    +
Sbjct  230  RPSVSAICVLLKLLLRFGYCGSVWKLYRDMVCKGPIPSIYIYNMMILGFCRRGCIRIGES  289

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M   G E  V TY+I++  +   G    A +W     E     S + +  II A C
Sbjct  290  LLYVMQKFGCEPDVHTYNILINAYCVRGWTLDALNWVHLMVESGCNPSPATFSTIINAFC  349

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  N+  A ++   M+E G+    ++++ +MDGY   R      ++++ ++  G  P  +
Sbjct  350  KEGNIAEARKIFDGMQEIGVFPNTALYNALMDGYVKAREIGLANMLYEEMRSKGVAPDSV  409

Query  15   SYGCL  1
            ++  L
Sbjct  410  TFNIL  414



>gb|EYU35805.1| hypothetical protein MIMGU_mgv1a021716mg, partial [Erythranthe 
guttata]
Length=647

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 91/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +G++++    RGD  +AR +F++M  RG+ PT   YT L        DM EA   
Sbjct  197  PSEVTYGILIDASCGRGDIKKARMLFDEMTQRGLKPTVVIYTTLIRGLCAESDMSEAEIV  256

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   G+  ++ TY+ ++ G+AK+ +++    ++ E  +R    +   Y  +IY  C+
Sbjct  257  FARMRGSGVVPNLYTYNALMDGYAKMVSIDKVHKFYYEMLDRGVLPNFITYSILIYLLCK  316

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            T  +         M +  +   + I++ ++DG+    +      M+  +++ G +P V++
Sbjct  317  TGEIWAFRSYFVHMVKLNVVPNVYIYNCLLDGFCEGGDLSAATDMYSEMEKFGISPDVVT  376

Query  12   YGCL  1
            YG L
Sbjct  377  YGVL  380


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +++    + G+    R  F  M    +VP  Y Y  L   +    D+  A   
Sbjct  302  PNFITYSILIYLLCKTGEIWAFRSYFVHMVKLNVVPNVYIYNCLLDGFCEGGDLSAATDM  361

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   GI   VVTY +++ G+ ++G VE AE+ F + KE     ++ +Y  +I   C+
Sbjct  362  YSEMEKFGISPDVVTYGVLMKGYCRIGRVEDAENLFRKMKETELVANSVVYNTLIDGYCK  421

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M++A  +  +M E+G+   I  F T+++GY    +    + ++  +   G+ P V++
Sbjct  422  KGSMEKAVGICTQMTEKGLKPDIVTFCTLINGYCKVGDLGAAMGLYYEMAIKGYKPDVVA  481

Query  12   YGCL  1
            Y  L
Sbjct  482  YTSL  485


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 84/189 (44%), Gaps = 0/189 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            +R  KP+   +  ++       D   A  +F +MR  G+VP  Y Y  L   Y     ++
Sbjct  227  QRGLKPTVVIYTTLIRGLCAESDMSEAEIVFARMRGSGVVPNLYTYNALMDGYAKMVSID  286

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            +      +M D G+  + +TYSI++    K G + A   +F+   + +   +  IY  ++
Sbjct  287  KVHKFYYEMLDRGVLPNFITYSILIYLLCKTGEIWAFRSYFVHMVKLNVVPNVYIYNCLL  346

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+  ++  A ++  EME+ GI+  +  +  +M GY      E    +F ++KE    
Sbjct  347  DGFCEGGDLSAATDMYSEMEKFGISPDVVTYGVLMKGYCRIGRVEDAENLFRKMKETELV  406

Query  27   PSVISYGCL  1
             + + Y  L
Sbjct  407  ANSVVYNTL  415


 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 72/152 (47%), Gaps = 0/152 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +G+++  Y R G    A  +F KM+   +V  S  Y  L   Y     ME+A+  
Sbjct  372  PDVVTYGVLMKGYCRIGRVEDAENLFRKMKETELVANSVVYNTLIDGYCKKGSMEKAVGI  431

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G++  +VT+  ++ G+ KVG++ AA   + E   +        Y ++I  + +
Sbjct  432  CTQMTEKGLKPDIVTFCTLINGYCKVGDLGAAMGLYYEMAIKGYKPDVVAYTSLIDGHFK  491

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDG  97
                D A +L +EM + GI   +     ++DG
Sbjct  492  NGYTDAALQLYKEMMDAGIYPNVFTISCVVDG  523


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ +   GD   A +M+ +M   GI P    Y  L   Y     +E+A   
Sbjct  337  PNVYIYNCLLDGFCEGGDLSAATDMYSEMEKFGISPDVVTYGVLMKGYCRIGRVEDAENL  396

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             RKM +  +  + V Y+ ++ G+ K G++E A     +  E+        +  +I   C+
Sbjct  397  FRKMKETELVANSVVYNTLIDGYCKKGSMEKAVGICTQMTEKGLKPDIVTFCTLINGYCK  456

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++  A  L  EM  +G    +  + +++DG+      +  L ++  + + G  P+V +
Sbjct  457  VGDLGAAMGLYYEMAIKGYKPDVVAYTSLIDGHFKNGYTDAALQLYKEMMDAGIYPNVFT  516

Query  12   YGCL  1
              C+
Sbjct  517  ISCV  520



>ref|XP_010922654.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
 ref|XP_010922655.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
 ref|XP_010922656.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
 ref|XP_010922657.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
Length=845

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F  M++ Y +  + H+A+    ++ S G+ P S  Y +L   Y     + EA   
Sbjct  599  PDLFTFSTMIDGYCKAKEVHKAKVYLNELASWGLEPNSVIYNSLIGGYCRDGKISEASNL  658

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M ++GI  + VTYS ++ G   VGNVE A++  L+ +E    L+   Y  +I   C+
Sbjct  659  LDEMKNKGIVPTSVTYSTLMHGMCNVGNVEEAKNLILKMREDGLALNVVTYTTLICGYCR  718

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               MD A ++L EM   G+A     +  +M GY    N +    + D + + G  P  ++
Sbjct  719  IGQMDEAIKVLEEMHASGLAPNKVTYTVLMHGYCEMANYDAAAKLLDEMLDNGIAPDAVT  778

Query  12   YGCL  1
            Y  L
Sbjct  779  YNTL  782


 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 95/185 (51%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++  Y R G    A  + ++M+++GIVPTS  Y+ L +      ++EEA  
Sbjct  633  EPNSVIYNSLIGGYCRDGKISEASNLLDEMKNKGIVPTSVTYSTLMHGMCNVGNVEEAKN  692

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM ++G+ ++VVTY+ ++ G+ ++G ++ A     E        +   Y  +++  C
Sbjct  693  LILKMREDGLALNVVTYTTLICGYCRIGQMDEAIKVLEEMHASGLAPNKVTYTVLMHGYC  752

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  N D A +LL EM + GIA     ++T+M G++     E+   + D + + G     +
Sbjct  753  EMANYDAAAKLLDEMLDNGIAPDAVTYNTLMSGFSKEGRMEEAFKISDYMTQKGAVLDEV  812

Query  15   SYGCL  1
            SY  L
Sbjct  813  SYTTL  817


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+      MV      G  H A +++ ++  +G    +     L Y   VS +M+EA+ 
Sbjct  458  RPNDSLMTSMVKKLCENGKHHEAIDIWLELLVKGFGVNTMASNALIYGLCVSGNMKEAVG  517

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +R M ++G+ +  VTY+ ++ G  KVG ++       +  +R        Y  +I+  C
Sbjct  518  LLRAMLEKGLALDRVTYNTLISGCCKVGKMDEGYKLREDMIKRGFNPDIITYNTLIHGLC  577

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                M  A  LL E++ EG+   +  F TM+DGY   +   K  +  + L   G  P+ +
Sbjct  578  NLGRMQEAIGLLHELKNEGLVPDLFTFSTMIDGYCKAKEVHKAKVYLNELASWGLEPNSV  637

Query  15   SYGCL  1
             Y  L
Sbjct  638  IYNSL  642


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/184 (18%), Positives = 91/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +++     G    A  +  ++++ G+VP  + ++ +   Y  ++++ +A   
Sbjct  564  PDIITYNTLIHGLCNLGRMQEAIGLLHELKNEGLVPDLFTFSTMIDGYCKAKEVHKAKVY  623

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + ++   G+E + V Y+ ++GG+ + G +  A +   E K +    ++  Y  +++  C 
Sbjct  624  LNELASWGLEPNSVIYNSLIGGYCRDGKISEASNLLDEMKNKGIVPTSVTYSTLMHGMCN  683

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N++ A+ L+ +M E+G+A  +  + T++ GY      ++ + + + +   G  P+ ++
Sbjct  684  VGNVEEAKNLILKMREDGLALNVVTYTTLICGYCRIGQMDEAIKVLEEMHASGLAPNKVT  743

Query  12   YGCL  1
            Y  L
Sbjct  744  YTVL  747


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 82/182 (45%), Gaps = 0/182 (0%)
 Frame = -2

Query  546  RKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVR  367
            R  +  +++   + G      ++ E M  RG  P    Y  L +       M+EA+  + 
Sbjct  531  RVTYNTLISGCCKVGKMDEGYKLREDMIKRGFNPDIITYNTLIHGLCNLGRMQEAIGLLH  590

Query  366  KMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTC  187
            ++ +EG+   + T+S ++ G+ K   V  A+ +  E        ++ IY ++I   C+  
Sbjct  591  ELKNEGLVPDLFTFSTMIDGYCKAKEVHKAKVYLNELASWGLEPNSVIYNSLIGGYCRDG  650

Query  186  NMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYG  7
             +  A  LL EM+ +GI      + T+M G     N E+   +  +++E G   +V++Y 
Sbjct  651  KISEASNLLDEMKNKGIVPTSVTYSTLMHGMCNVGNVEEAKNLILKMREDGLALNVVTYT  710

Query  6    CL  1
             L
Sbjct  711  TL  712



>gb|EPS68486.1| hypothetical protein M569_06282 [Genlisea aurea]
Length=543

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 90/182 (49%), Gaps = 1/182 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+++ + M+++ + R G   +  E+ ++MRS G+ P    Y  L    T   +  +AL  
Sbjct  331  PNQRTYNMLIDLHCRAGMMDKGFELLDEMRSFGVSPCVVTYNILIAGCTRFGNSSKALDL  390

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            VR+M + GI  + VTY+I++  FA+  ++E A H F + +   A +    YG +I   C 
Sbjct  391  VREMEEGGISPTEVTYTILIHFFAQCNDMENALHVFSQMQSSDAVIDVCTYGVLINGWCN  450

Query  192  TCNMDRAeel-lremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
              NM  A +L     E  G+     I+ TM+ GY    +  K L +   + E G  P++ 
Sbjct  451  QGNMKEASKLFKAMSETRGVEPNDVIYSTMIFGYCRQGSSYKALKLLIEMTEKGMAPNIA  510

Query  15   SY  10
            SY
Sbjct  511  SY  512


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 96/179 (54%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++N + R G K  A E++ +M+S GI+P  + Y  +  AY+   +M EA   + +M 
Sbjct  231  YTVLINGFFREGLKKDALELYRRMKSEGIMPDLHTYNTMMNAYSRDGEMREAYDLLHEMR  290

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            + GI  +VVTY+I++ GF ++  + +A    +E +      +   Y  +I  +C+   MD
Sbjct  291  ESGIASNVVTYNILIKGFCRLRRIRSANESVMEMRRCGLNPNQRTYNMLIDLHCRAGMMD  350

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +  ELL EM   G++  +  ++ ++ G T   N  K L +   ++E G +P+ ++Y  L
Sbjct  351  KGFELLDEMRSFGVSPCVVTYNILIAGCTRFGNSSKALDLVREMEEGGISPTEVTYTIL  409



>ref|XP_010096308.1| hypothetical protein L484_021054 [Morus notabilis]
 gb|EXB63783.1| hypothetical protein L484_021054 [Morus notabilis]
Length=749

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/199 (26%), Positives = 98/199 (49%), Gaps = 0/199 (0%)
 Frame = -2

Query  597  ENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            E  H +V+   R   P    +  +++ Y   GD  +  ++ E+M+ + + P +Y Y+++ 
Sbjct  272  EAHHLLVQMELRGCIPDVVSYSTIISRYCHVGDLQKVLKLIEEMKVKRLKPNAYTYSSIV  331

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
            +    +  + EA   +R+M  +G+    V Y+ ++ GF K+GNV AA   F E + R   
Sbjct  332  FLLCKTGKLFEAEKVLREMTTQGVIPDNVVYTTLIDGFCKLGNVSAACWLFDEMQRRKID  391

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
                 Y  II+  CQ   M  A++L  EM  +G+      +  ++DGY  +   +K   +
Sbjct  392  PDFITYTTIIHGFCQAGKMAEADKLFGEMVTKGLEPDEVTYTALIDGYCKSGEVKKAFSI  451

Query  57   FDRLKECGFTPSVISYGCL  1
             + + + G TP++++Y  L
Sbjct  452  HNDMVQMGLTPNIVTYTAL  470


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 88/185 (48%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P    +  +++ Y + G+  +A  +   M   G+ P    YT L        +++ A  
Sbjct  426  EPDEVTYTALIDGYCKSGEVKKAFSIHNDMVQMGLTPNIVTYTALADGLCKQGEVDTANE  485

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +++M  +G++++V TY+ IV G  K+GN+  AE    E K          Y  ++ A C
Sbjct  486  LLQEMCLKGLQLNVCTYNTIVNGLCKLGNIIEAEKLMEEMKVAGPHPDTFTYTTLMDAYC  545

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +T  M +A  LL+EM + G+   +  F+ +M+G+ ++   E    +   + E G  P+  
Sbjct  546  KTGKMPKAYRLLQEMLDGGLQPTVVTFNVLMNGFCMSGMLEDGNKLLKWMLEKGIMPNAT  605

Query  15   SYGCL  1
            +Y  L
Sbjct  606  TYNSL  610


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 85/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +++ + + G    A ++F +M ++G+ P    YT L   Y  S ++++A + 
Sbjct  392  PDFITYTTIIHGFCQAGKMAEADKLFGEMVTKGLEPDEVTYTALIDGYCKSGEVKKAFSI  451

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M   G+  ++VTY+ +  G  K G V+ A     E   +   L+   Y  I+   C+
Sbjct  452  HNDMVQMGLTPNIVTYTALADGLCKQGEVDTANELLQEMCLKGLQLNVCTYNTIVNGLCK  511

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+  AE+L+ EM+  G       + T+MD Y  T    K   +   + + G  P+V++
Sbjct  512  LGNIIEAEKLMEEMKVAGPHPDTFTYTTLMDAYCKTGKMPKAYRLLQEMLDGGLQPTVVT  571

Query  12   YGCL  1
            +  L
Sbjct  572  FNVL  575


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/179 (25%), Positives = 88/179 (49%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +VN   + G+   A ++ E+M+  G  P ++ YT L  AY  +  M +A   +++M 
Sbjct  502  YNTIVNGLCKLGNIIEAEKLMEEMKVAGPHPDTFTYTTLMDAYCKTGKMPKAYRLLQEML  561

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            D G++ +VVT+++++ GF   G +E          E+    +A+ Y +++       NM 
Sbjct  562  DGGLQPTVVTFNVLMNGFCMSGMLEDGNKLLKWMLEKGIMPNATTYNSLMKQYSIRNNMR  621

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A E+ REM   G++   + ++ ++ G+   RN ++   +   +   GF  +  SY  L
Sbjct  622  TATEIYREMCSTGVSPDDNTYNILIRGHCKARNMKEAEFLRREMVGKGFALTASSYNAL  680



>ref|XP_010529910.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010529911.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 95/197 (48%), Gaps = 3/197 (2%)
 Frame = -2

Query  591  WHAVVRAFERINK---PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNL  421
            W A     E I K   P+   +  ++N + R+     A +MF  M ++G  P    + ++
Sbjct  348  WEAEELYEEMIQKGLVPNTITYTSLINGFCRQNRLGEAEQMFNYMVTKGCFPNRVTFNSM  407

Query  420  TYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHA  241
               Y  +  ++E +    +M+  G+++  +TY+I++ GF +VGN++AA+  F E      
Sbjct  408  INGYCKANRVKEGMNLFYEMSQRGLDVDSITYNILIQGFYRVGNLDAAQKLFREMHYNRH  467

Query  240  TLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLL  61
              +   Y  ++   C+    D A  L  ++++ GI   IS  + MM G       ++  +
Sbjct  468  HPNLITYSILLDGLCKNGKTDEALGLYNKLQKSGIDLHISSHNIMMHGLCKVGRVDEVFV  527

Query  60   MFDRLKECGFTPSVISY  10
             FDRL E G  P+VI+Y
Sbjct  528  FFDRLLEKGVRPNVITY  544


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/184 (21%), Positives = 80/184 (43%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+R  F  M+N Y +         +F +M  RG+   S  Y  L   +    +++ A   
Sbjct  399  PNRVTFNSMINGYCKANRVKEGMNLFYEMSQRGLDVDSITYNILIQGFYRVGNLDAAQKL  458

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M+      +++TYSI++ G  K G  + A   + + ++    L  S +  +++  C+
Sbjct  459  FREMHYNRHHPNLITYSILLDGLCKNGKTDEALGLYNKLQKSGIDLHISSHNIMMHGLCK  518

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +D        + E+G+   +  ++ M+ G     +  +   +  ++KE G  P  ++
Sbjct  519  VGRVDEVFVFFDRLLEKGVRPNVITYNIMISGLCGKGSLYEVEKVIGKMKEDGCFPDAVT  578

Query  12   YGCL  1
            Y  L
Sbjct  579  YNAL  582



>gb|EYU21818.1| hypothetical protein MIMGU_mgv1a0008301mg, partial [Erythranthe 
guttata]
Length=828

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 93/189 (49%), Gaps = 0/189 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER   PS   F  ++N   R GD  ++  + E M +RGI P+   YT +   Y      E
Sbjct  432  ERNLPPSAYTFSAIINELSRTGDLEKSNLLLENMSARGIAPSVAIYTTIVKGYVKEAKFE  491

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EA+  +  M ++GI   V  Y+ ++ G +K+  +E A   F+E +++    ++  +G +I
Sbjct  492  EAMAILDGMWEKGISPDVFCYNSVIMGLSKLRRMEEARTCFVEMRKKGLIPNSYTFGGLI  551

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
                +  NM+ AE    EM ++GIA  +  + +++DG     N  +   +F+R+ E    
Sbjct  552  NGYIEIGNMEFAESYFMEMLDQGIAPDLYNYTSIIDGLCKNGNLTEAFSIFNRMLEQNLL  611

Query  27   PSVISYGCL  1
            P+V  Y  L
Sbjct  612  PNVHIYSVL  620


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 90/186 (48%), Gaps = 0/186 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER   P    +  ++N + + GD   A E+   M +RGI      Y  + +    + +ME
Sbjct  327  ERGLNPDHNIYTALINGFMKEGDVDGAFEIKNTMVARGIKLNLVTYNAILHGLCKAGEME  386

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
             A+  + +M + GI+  + TY+ ++  ++K G V+      +   ER+   SA  +  II
Sbjct  387  RAVNLINEMIEMGIKPEIQTYNYLIEAYSKEGTVDKVSEVLVWMNERNLPPSAYTFSAII  446

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
                +T +++++  LL  M   GIA  ++I+ T++ GY      E+ + + D + E G +
Sbjct  447  NELSRTGDLEKSNLLLENMSARGIAPSVAIYTTIVKGYVKEAKFEEAMAILDGMWEKGIS  506

Query  27   PSVISY  10
            P V  Y
Sbjct  507  PDVFCY  512


 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 89/182 (49%), Gaps = 0/182 (0%)
 Frame = -2

Query  576  RAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSR  397
            R  E+   P+   + +++    + G    A  +F K    G+V   Y YT+L   +    
Sbjct  604  RMLEQNLLPNVHIYSVLIISLSKNGKLVEAMRIFSKFSDTGLVADVYTYTSLVSGFCKQG  663

Query  396  DMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYG  217
             M EA     +M+ +GI  ++VTY+ ++GGF K G +E A+  F    ++    +   Y 
Sbjct  664  SMVEAFRIHDEMSKKGINPNIVTYNALIGGFFKSGEIERAKELFGGLSDKGLMPNKVTYA  723

Query  216  NIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC  37
             +I   C+  N++ A  LL EM  +G+   + +++++++G     + E+ L +FD + E 
Sbjct  724  TMIDGFCKAENLEEAFGLLEEMSSKGVPPDVFVYNSLVNGCCKKGDMERALSLFDGMVEK  783

Query  36   GF  31
            G 
Sbjct  784  GI  785


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/163 (24%), Positives = 78/163 (48%), Gaps = 0/163 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            AR  F +MR +G++P SY +  L   Y    +ME A +   +M D+GI   +  Y+ I+ 
Sbjct  528  ARTCFVEMRKKGLIPNSYTFGGLINGYIEIGNMEFAESYFMEMLDQGIAPDLYNYTSIID  587

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            G  K GN+  A   F    E++   +  IY  +I +  +   +  A  +  +  + G+ A
Sbjct  588  GLCKNGNLTEAFSIFNRMLEQNLLPNVHIYSVLIISLSKNGKLVEAMRIFSKFSDTGLVA  647

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +  + +++ G+    +  +   + D + + G  P++++Y  L
Sbjct  648  DVYTYTSLVSGFCKQGSMVEAFRIHDEMSKKGINPNIVTYNAL  690


 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/173 (25%), Positives = 87/173 (50%), Gaps = 1/173 (1%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            +V+ + ++G    A  + ++M  +GI P    Y  L   +  S ++E A      ++D+G
Sbjct  655  LVSGFCKQGSMVEAFRIHDEMSKKGINPNIVTYNALIGGFFKSGEIERAKELFGGLSDKG  714

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            +  + VTY+ ++ GF K  N+E A     E   +       +Y +++   C+  +M+RA 
Sbjct  715  LMPNKVTYATMIDGFCKAENLEEAFGLLEEMSSKGVPPDVFVYNSLVNGCCKKGDMERAL  774

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             L   M E+GIA+ I  F+TM+DG+  + N  + + +   + +    P+ +++
Sbjct  775  SLFDGMVEKGIAS-IHTFNTMIDGFCKSGNLSRAVDLVKEMVDRQIMPNHVTF  826


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   FG ++N Y   G+   A   F +M  +GI P  Y YT++      + ++ EA + 
Sbjct  542  PNSYTFGGLINGYIEIGNMEFAESYFMEMLDQGIAPDLYNYTSIIDGLCKNGNLTEAFSI  601

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++ +  +V  YS+++   +K G +  A   F +  +         Y +++   C+
Sbjct  602  FNRMLEQNLLPNVHIYSVLIISLSKNGKLVEAMRIFSKFSDTGLVADVYTYTSLVSGFCK  661

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M  A  +  EM ++GI   I  ++ ++ G+  +   E+   +F  L + G  P+ ++
Sbjct  662  QGSMVEAFRIHDEMSKKGINPNIVTYNALIGGFFKSGEIERAKELFGGLSDKGLMPNKVT  721

Query  12   YGCL  1
            Y  +
Sbjct  722  YATM  725


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/189 (24%), Positives = 83/189 (44%), Gaps = 0/189 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER  +P+   + ++V      GD   A E+   M  +G+VP +Y Y      +   +   
Sbjct  257  ERGCEPNVIAYNVVVRGLCGIGDFDEALELKTTMAEKGLVPDNYTYAIFIDGFCQHKRTS  316

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EA   + +M + G+      Y+ ++ GF K G+V+ A         R   L+   Y  I+
Sbjct  317  EAKLILEQMCERGLNPDHNIYTALINGFMKEGDVDGAFEIKNTMVARGIKLNLVTYNAIL  376

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
            +  C+   M+RA  L+ EM E GI   I  ++ +++ Y+     +K   +   + E    
Sbjct  377  HGLCKAGEMERAVNLINEMIEMGIKPEIQTYNYLIEAYSKEGTVDKVSEVLVWMNERNLP  436

Query  27   PSVISYGCL  1
            PS  ++  +
Sbjct  437  PSAYTFSAI  445


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 77/170 (45%), Gaps = 0/170 (0%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            + G+  RA  +  +M   GI P    Y  L  AY+    +++    +  MN+  +  S  
Sbjct  381  KAGEMERAVNLINEMIEMGIKPEIQTYNYLIEAYSKEGTVDKVSEVLVWMNERNLPPSAY  440

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
            T+S I+   ++ G++E +         R    S +IY  I+    +    + A  +L  M
Sbjct  441  TFSAIINELSRTGDLEKSNLLLENMSARGIAPSVAIYTTIVKGYVKEAKFEEAMAILDGM  500

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             E+GI+  +  +++++ G +  R  E+    F  +++ G  P+  ++G L
Sbjct  501  WEKGISPDVFCYNSVIMGLSKLRRMEEARTCFVEMRKKGLIPNSYTFGGL  550



>ref|XP_010315244.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315245.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315253.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315256.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315257.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315260.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315261.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315262.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315263.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315265.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
Length=767

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 85/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++N   + G+ HRA E F+++ +RG+ P    YT L   ++    M EA   
Sbjct  355  PDVVTYTSLINSMCKTGNLHRAMEFFDQLHARGLYPNDRTYTTLIVGFSQQGLMNEAYKL  414

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M   G   S+VTY+ ++ G   VG +E A     E ++R        Y  II   C+
Sbjct  415  LNEMISNGFSPSIVTYNALINGHCAVGRMEDALRVTQEMEQRRLVPDVVTYSTIISGFCR  474

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
             C ++RA  + ++M E+G+   +  + +++ G    R   +   +F  +   G  P   +
Sbjct  475  NCGLERAFCVKQQMVEKGVLPDVITYSSLIQGLCEQRRLTEAFELFQEMFRVGLQPDKFT  534

Query  12   YGCL  1
            Y  L
Sbjct  535  YTTL  538


 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 84/190 (44%), Gaps = 4/190 (2%)
 Frame = -2

Query  579  VRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVS  400
            VR+ E    PS   +  ++N   R G      E+ E+MR +G++P    Y  L   Y   
Sbjct  280  VRSLE----PSVVTYNAIINGLCREGRMKETSEILEEMRGKGLMPDEVTYNTLVNGYCRE  335

Query  399  RDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
             +  +AL    +M   G+   VVTY+ ++    K GN+  A  +F +   R    +   Y
Sbjct  336  GNFHQALVLHSEMLRNGLSPDVVTYTSLINSMCKTGNLHRAMEFFDQLHARGLYPNDRTY  395

Query  219  GNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKE  40
              +I    Q   M+ A +LL EM   G +  I  ++ +++G+      E  L +   +++
Sbjct  396  TTLIVGFSQQGLMNEAYKLLNEMISNGFSPSIVTYNALINGHCAVGRMEDALRVTQEMEQ  455

Query  39   CGFTPSVISY  10
                P V++Y
Sbjct  456  RRLVPDVVTY  465


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 78/168 (46%), Gaps = 0/168 (0%)
 Frame = -2

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            G    A++ ++ M   G+ P  Y Y  +        +++++L    +M   G   +VVTY
Sbjct  196  GSFELAQKFYDDMVQSGVSPNVYTYNIMIRGLCAKGELQKSLVVFNEMEKNGCLRNVVTY  255

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            + I+GG+ K+G V+ A       + R    S   Y  II   C+   M    E+L EM  
Sbjct  256  NTIIGGYCKIGKVDEAVKLLKLMQVRSLEPSVVTYNAIINGLCREGRMKETSEILEEMRG  315

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +G+      ++T+++GY    N  + L++   +   G +P V++Y  L
Sbjct  316  KGLMPDEVTYNTLVNGYCREGNFHQALVLHSEMLRNGLSPDVVTYTSL  363


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/184 (21%), Positives = 80/184 (43%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +M+     +G+  ++  +F +M   G +     Y  +   Y     ++EA+  
Sbjct  215  PNVYTYNIMIRGLCAKGELQKSLVVFNEMEKNGCLRNVVTYNTIIGGYCKIGKVDEAVKL  274

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            ++ M    +E SVVTY+ I+ G  + G ++       E + +        Y  ++   C+
Sbjct  275  LKLMQVRSLEPSVVTYNAIINGLCREGRMKETSEILEEMRGKGLMPDEVTYNTLVNGYCR  334

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N  +A  L  EM   G++  +  + ++++    T N  + +  FD+L   G  P+  +
Sbjct  335  EGNFHQALVLHSEMLRNGLSPDVVTYTSLINSMCKTGNLHRAMEFFDQLHARGLYPNDRT  394

Query  12   YGCL  1
            Y  L
Sbjct  395  YTTL  398



>ref|XP_003563115.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g11690-like, partial [Brachypodium distachyon]
Length=464

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   + ++V  + R G+  RAR +FE+M ++GI      Y  L       R M++A  
Sbjct  159  EPNLYTYNILVGEWCRTGEFERARLLFEEMPAKGITRNVVSYNTLIAGLCRYRKMKDATQ  218

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M  EGI  SVVT++++V G+ K G +  A H+  + +      SA  Y  +I   C
Sbjct  219  LLELMRREGIRPSVVTFNLLVDGYGKAGKMSNALHFSNQMRMAGYQPSAVTYNALIAGFC  278

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M RA     +M+E G+A     +  ++D +    + +K   MF  +++ G    V 
Sbjct  279  RARDMIRANRAFSDMKERGLAPTKVTYTILIDAFARENDMDKAFEMFAGMEKAGLEVDVR  338

Query  15   SYGCL  1
            +YG L
Sbjct  339  TYGVL  343


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 83/175 (47%), Gaps = 0/175 (0%)
 Frame = -2

Query  525  VNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGI  346
            V+ Y R GD   A+ +F+ M   G+ P    +T L + Y +    E+ L    KM   GI
Sbjct  99   VHGYCRSGDVAEAQRVFDVMPRLGLTPNEVTFTALIHGYFIHGRREKGLALFEKMRIGGI  158

Query  345  EISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAee  166
            E ++ TY+I+VG + + G  E A   F E   +  T +   Y  +I   C+   M  A +
Sbjct  159  EPNLYTYNILVGEWCRTGEFERARLLFEEMPAKGITRNVVSYNTLIAGLCRYRKMKDATQ  218

Query  165  llremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            LL  M  EGI   +  F+ ++DGY         L   ++++  G+ PS ++Y  L
Sbjct  219  LLELMRREGIRPSVVTFNLLVDGYGKAGKMSNALHFSNQMRMAGYQPSAVTYNAL  273


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 89/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS   F ++V+ YG+ G    A     +MR  G  P++  Y  L   +  +RDM  A  
Sbjct  229  RPSVVTFNLLVDGYGKAGKMSNALHFSNQMRMAGYQPSAVTYNALIAGFCRARDMIRANR  288

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
                M + G+  + VTY+I++  FA+  +++ A   F   ++    +    YG +++A C
Sbjct  289  AFSDMKERGLAPTKVTYTILIDAFARENDMDKAFEMFAGMEKAGLEVDVRTYGVLVHALC  348

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
               NM  A +L + + E+G+     I+  ++ GY    +  K + +   +++ GF P+  
Sbjct  349  MEGNMKDARKLFQSIGEKGLQVGNVIYDMLIYGYGREGSSYKAMKLIMEMRKKGFVPNSA  408

Query  15   SYG  7
            SYG
Sbjct  409  SYG  411


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 72/163 (44%), Gaps = 0/163 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A ++ E MR  GI P+   +  L   Y  +  M  AL    +M   G + S VTY+ ++ 
Sbjct  216  ATQLLELMRREGIRPSVVTFNLLVDGYGKAGKMSNALHFSNQMRMAGYQPSAVTYNALIA  275

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            GF +  ++  A   F + KER    +   Y  +I A  +  +MD+A E+   ME+ G+  
Sbjct  276  GFCRARDMIRANRAFSDMKERGLAPTKVTYTILIDAFARENDMDKAFEMFAGMEKAGLEV  335

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             +  +  ++    +  N +    +F  + E G     + Y  L
Sbjct  336  DVRTYGVLVHALCMEGNMKDARKLFQSIGEKGLQVGNVIYDML  378



>ref|XP_007208650.1| hypothetical protein PRUPE_ppa020258mg [Prunus persica]
 gb|EMJ09849.1| hypothetical protein PRUPE_ppa020258mg [Prunus persica]
Length=397

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 94/197 (48%), Gaps = 0/197 (0%)
 Frame = -2

Query  591  WHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYA  412
            +  +V+  E +  P+   +  +++   + GD  RA+++F KM   G+V   Y YT+L   
Sbjct  15   FELLVQLEEMVLSPNVVIYSTLIDGCCKNGDLERAKKIFGKMEELGLVANQYTYTSLIDG  74

Query  411  YTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLS  232
                   ++      KM   G+  +V TY+ ++      G +  A   F E +ER    +
Sbjct  75   LFKKGHKKDGFELYDKMKSNGVVPNVCTYNCLINECCNDGKMSRALELFDEMRERGVACN  134

Query  231  ASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFD  52
               Y  +I   C+   M  AE+   +M  EGI+     F+T++DG+      +K L +FD
Sbjct  135  VVAYNTVICGLCREIRMWEAEKFFNQMIREGISPNTVTFNTLIDGFCNLGKLDKALSLFD  194

Query  51   RLKECGFTPSVISYGCL  1
            +LK  G +PS+++Y  L
Sbjct  195  QLKSNGQSPSLVTYNVL  211


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/181 (23%), Positives = 85/181 (47%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   F  +++ +   G   +A  +F++++S G  P+   Y  L   +  +++       
Sbjct  168  PNTVTFNTLIDGFCNLGKLDKALSLFDQLKSNGQSPSLVTYNVLIQGFARAQNSAGVADL  227

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            VR+MND G+  S VTY+I++    + G++E A   F   ++         YG +I+  C 
Sbjct  228  VREMNDRGVSPSKVTYTILIDALVRSGDMERAFQIFFSMEKAGMVPDTHTYGVLIHGLCM  287

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M  A +L + + +  +     I++ M+ GY    +  + L +   +++    P+V S
Sbjct  288  KGDMKEASKLFKSISDTHLEPNDVIYNMMIHGYCKEGSSYRALRLLKEMRKNRMIPNVAS  347

Query  12   Y  10
            Y
Sbjct  348  Y  348


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 84/190 (44%), Gaps = 9/190 (5%)
 Frame = -2

Query  543  KEFGMMVNYYG---------RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
            +E G++ N Y          ++G K    E+++KM+S G+VP    Y  L         M
Sbjct  57   EELGLVANQYTYTSLIDGLFKKGHKKDGFELYDKMKSNGVVPNVCTYNCLINECCNDGKM  116

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
              AL    +M + G+  +VV Y+ ++ G  +   +  AE +F +      + +   +  +
Sbjct  117  SRALELFDEMRERGVACNVVAYNTVICGLCREIRMWEAEKFFNQMIREGISPNTVTFNTL  176

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            I   C    +D+A  L  +++  G +  +  ++ ++ G+   +N      +   + + G 
Sbjct  177  IDGFCNLGKLDKALSLFDQLKSNGQSPSLVTYNVLIQGFARAQNSAGVADLVREMNDRGV  236

Query  30   TPSVISYGCL  1
            +PS ++Y  L
Sbjct  237  SPSKVTYTIL  246


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 82/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++N     G   RA E+F++MR RG+      Y  +         M EA   
Sbjct  98   PNVCTYNCLINECCNDGKMSRALELFDEMRERGVACNVVAYNTVICGLCREIRMWEAEKF  157

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M  EGI  + VT++ ++ GF  +G ++ A   F + K    + S   Y  +I    +
Sbjct  158  FNQMIREGISPNTVTFNTLIDGFCNLGKLDKALSLFDQLKSNGQSPSLVTYNVLIQGFAR  217

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N     +L+REM + G++     +  ++D    + + E+   +F  +++ G  P   +
Sbjct  218  AQNSAGVADLVREMNDRGVSPSKVTYTILIDALVRSGDMERAFQIFFSMEKAGMVPDTHT  277

Query  12   YGCL  1
            YG L
Sbjct  278  YGVL  281


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS+  + ++++   R GD  RA ++F  M   G+VP ++ Y  L +   +  DM+EA   
Sbjct  238  PSKVTYTILIDALVRSGDMERAFQIFFSMEKAGMVPDTHTYGVLIHGLCMKGDMKEASKL  297

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             + ++D  +E + V Y++++ G+ K G+   A     E ++     + + Y + I   C 
Sbjct  298  FKSISDTHLEPNDVIYNMMIHGYCKEGSSYRALRLLKEMRKNRMIPNVASYSSTIGVLCN  357


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 74/160 (46%), Gaps = 0/160 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A + F +M   GI P +  +  L   +     +++AL+   ++   G   S+VTY++++ 
Sbjct  154  AEKFFNQMIREGISPNTVTFNTLIDGFCNLGKLDKALSLFDQLKSNGQSPSLVTYNVLIQ  213

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            GFA+  N         E  +R  + S   Y  +I A  ++ +M+RA ++   ME+ G+  
Sbjct  214  GFARAQNSAGVADLVREMNDRGVSPSKVTYTILIDALVRSGDMERAFQIFFSMEKAGMVP  273

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
                +  ++ G  +  + ++   +F  + +    P+ + Y
Sbjct  274  DTHTYGVLIHGLCMKGDMKEASKLFKSISDTHLEPNDVIY  313



>ref|XP_010275891.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 
[Nelumbo nucifera]
Length=586

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 90/188 (48%), Gaps = 1/188 (1%)
 Frame = -2

Query  585  AVVRAFERIN-KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            ++    +R N +P    + +++N YG+   +  A  +FE+M   G+ PT   Y  L  A+
Sbjct  297  SIYDQMQRANIQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVKPTRKAYNILLDAF  356

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
             +S  +EEA T  + M  +     + +Y+ ++  +    ++E AE +F   K+     + 
Sbjct  357  AISGMVEEARTIFKSMRRDKCMPDLCSYTTMLSAYVNASDMEGAEKFFRRLKQDGFEPNV  416

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              YG +I    +  N+D+  E   EM  +GI A  +IF T+MD Y    +    L+ F  
Sbjct  417  VTYGTLIKGYAKMNNLDKMMEKYEEMRIQGIEANQTIFTTIMDAYGKNTDFGSALIWFKE  476

Query  48   LKECGFTP  25
            +  CGF P
Sbjct  477  MGNCGFPP  484


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 87/185 (47%), Gaps = 3/185 (2%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP +K F MM+  Y + G   +AR++F KM  RG+  ++  Y +L    +   + +E  +
Sbjct  241  KPDQKMFHMMIYMYRKAGKYEKARKIFAKMSERGVPQSTVTYNSLM---SFETNYKEVSS  297

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M    I+  VV+Y++++  + K    E A   F E  +     +   Y  ++ A  
Sbjct  298  IYDQMQRANIQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVKPTRKAYNILLDAFA  357

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
             +  ++ A  + + M  +     +  + TM+  Y    + E     F RLK+ GF P+V+
Sbjct  358  ISGMVEEARTIFKSMRRDKCMPDLCSYTTMLSAYVNASDMEGAEKFFRRLKQDGFEPNVV  417

Query  15   SYGCL  1
            +YG L
Sbjct  418  TYGTL  422


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/209 (24%), Positives = 93/209 (44%), Gaps = 11/209 (5%)
 Frame = -2

Query  603  QPENWHAVVRAFERINKP-----SRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTS  439
            Q + W+ V    E +        S  +F M++  YG++G+ ++A  +   M  +G  P+ 
Sbjct  112  QLKKWNLVSEILEWLRTQHWWEFSEMDFLMLITAYGKQGEFNKAERLLSYMNKKGYPPSV  171

Query  438  YEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWF--  265
              +T L  AY       +A T  R+M   G E S +TY II+  F +      AE  F  
Sbjct  172  ISHTALMEAYGRGGQYNKAETMFRRMQTSGPEPSALTYQIILKIFVEGDKFREAEAIFET  231

Query  264  -LEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTI  88
             L+ K         ++  +IY   +    ++A ++  +M E G+      ++++M   T 
Sbjct  232  LLDDKISPLKPDQKMFHMMIYMYRKAGKYEKARKIFAKMSERGVPQSTVTYNSLMSFET-  290

Query  87   TRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              N ++   ++D+++     P V+SY  L
Sbjct  291  --NYKEVSSIYDQMQRANIQPDVVSYALL  317



>ref|XP_010274884.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Nelumbo nucifera]
 ref|XP_010274885.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Nelumbo nucifera]
 ref|XP_010274886.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g19290 [Nelumbo nucifera]
Length=955

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 84/169 (50%), Gaps = 4/169 (2%)
 Frame = -2

Query  588  HAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNL  421
            H  +  ++++ +    P+     +MVN Y + G  H+A +  +KM   G  P +    +L
Sbjct  209  HTAIHVYDQMIRAGIIPNVFTCTIMVNAYCKDGKVHKAIDFVKKMEGMGFEPNAVTCHSL  268

Query  420  TYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHA  241
               Y    DME A      M+D+GI  +VVTY++++ G+ K G +  AE  FL  KE   
Sbjct  269  INGYVNLGDMEGAWQIFGMMSDKGISCNVVTYTLLIKGYCKQGKMREAEEVFLRMKEESL  328

Query  240  TLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGY  94
                 +YG +I   CQT  +D A  +  EM   G+   + I +++++GY
Sbjct  329  VADELVYGILINGYCQTGKIDDAVRIRDEMLSLGLEMNLFICNSLINGY  377


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 90/181 (50%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++N     G+ + A ++  +M ++G+VP    Y  L      SR+++ A+  
Sbjct  750  PDNFTYCTLINGCSAAGNVNEAFDIRNEMVAKGLVPNITTYNALINGLCKSRNLDRAVRL  809

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              K++ +G+  +VVT++ ++ G+ KVG++  A     +  E     S   Y  +I   C+
Sbjct  810  FHKLHLKGLTPNVVTFNTLIDGYCKVGDINEALKLKDKMVEVGIVPSFITYSALINGLCK  869

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M+ A +LL +M  EG+   I  + T++ G    R+ ++   + D ++  G +  ++S
Sbjct  870  QGDMEAAAKLLDQMAVEGVDPNIVTYCTLVQGCIRFRDLKQVSNLNDEMQVRGLSSGIVS  929

Query  12   Y  10
            +
Sbjct  930  H  930


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 72/170 (42%), Gaps = 35/170 (21%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            + G    AR +F  +  RG VP ++ Y  L    + + ++ EA     +M  +G+  ++ 
Sbjct  729  KSGKVAEARRVFSALLQRGFVPDNFTYCTLINGCSAAGNVNEAFDIRNEMVAKGLVPNIT  788

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
            TY+ ++ G                                    C++ N+DRA  L  ++
Sbjct  789  TYNALINGL-----------------------------------CKSRNLDRAVRLFHKL  813

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              +G+   +  F+T++DGY    +  + L + D++ E G  PS I+Y  L
Sbjct  814  HLKGLTPNVVTFNTLIDGYCKVGDINEALKLKDKMVEVGIVPSFITYSAL  863



>ref|XP_002314524.2| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEF00695.2| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=472

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 96/188 (51%), Gaps = 0/188 (0%)
 Frame = -2

Query  564  RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEE  385
            R + P    +  ++N Y   G+  +  ++ ++M+ +G+ P  Y Y ++      S  +++
Sbjct  6    RGDAPDVVSYSTVINGYCLGGELQKVLKLIQEMQMKGLKPNLYTYNSIILLLCKSGKVDD  65

Query  384  ALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIY  205
            A   +R+M ++GI    V Y+ ++ GF K+GN++AA   F E +++        Y  +I 
Sbjct  66   AERVLREMINQGIVPDTVVYTTLIDGFCKLGNIQAAYKLFDEMEKQRIVPDFIAYTAVIC  125

Query  204  ANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTP  25
              C+   M  A+++  +M   G+      + T++DGY  +   EK   + +++ + G TP
Sbjct  126  GLCRCGKMMEADKVFNKMFSRGVEPDEVTYTTLIDGYCKSGEMEKAFSLHNQMVQSGLTP  185

Query  24   SVISYGCL  1
            +V++Y  L
Sbjct  186  NVVTYTAL  193


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 95/202 (47%), Gaps = 4/202 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N  A  + F+ + K    P    +  ++    R G    A ++F KM SRG+ P    YT
Sbjct  97   NIQAAYKLFDEMEKQRIVPDFIAYTAVICGLCRCGKMMEADKVFNKMFSRGVEPDEVTYT  156

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L   Y  S +ME+A +   +M   G+  +VVTY+ +  G  K+G V+ A     E   +
Sbjct  157  TLIDGYCKSGEMEKAFSLHNQMVQSGLTPNVVTYTALADGLCKLGQVDTANELLHEMCGK  216

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L+   Y +++   C++ N+ +A +L+ EME  G+      F T+MD Y  T    K 
Sbjct  217  GLQLNICTYNSLVNGLCKSGNIRQAVKLMEEMEVAGMYPDTITFTTLMDAYCKTGEMVKA  276

Query  66   LLMFDRLKECGFTPSVISYGCL  1
              +   + + G  P+VI++  L
Sbjct  277  HELLREMLDRGLQPTVITFNVL  298


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 87/176 (49%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +VN   + G+  +A ++ E+M   G+ P +  +T L  AY  + +M +A   +R+M 
Sbjct  225  YNSLVNGLCKSGNIRQAVKLMEEMEVAGMYPDTITFTTLMDAYCKTGEMVKAHELLREML  284

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            D G++ +V+T+++++ GF   G +E  E       E+    + + Y +++   C   NM 
Sbjct  285  DRGLQPTVITFNVLMNGFCMSGMLEDGERLLAWMLEKGIMPNTTTYNSLMKQYCIRNNMR  344

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
               E+ + M   G+    + ++ ++ G+   RN ++   +   + E GF  +  SY
Sbjct  345  CTTEIYKGMCARGVMPDSNTYNILIKGHCKARNMKEAWFLHKEMAEKGFNLTASSY  400


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 89/192 (46%), Gaps = 0/192 (0%)
 Frame = -2

Query  576  RAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSR  397
            + F R  +P    +  +++ Y + G+  +A  +  +M   G+ P    YT L        
Sbjct  142  KMFSRGVEPDEVTYTTLIDGYCKSGEMEKAFSLHNQMVQSGLTPNVVTYTALADGLCKLG  201

Query  396  DMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYG  217
             ++ A   + +M  +G+++++ TY+ +V G  K GN+  A     E +          + 
Sbjct  202  QVDTANELLHEMCGKGLQLNICTYNSLVNGLCKSGNIRQAVKLMEEMEVAGMYPDTITFT  261

Query  216  NIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC  37
             ++ A C+T  M +A ELLREM + G+   +  F+ +M+G+ ++   E    +   + E 
Sbjct  262  TLMDAYCKTGEMVKAHELLREMLDRGLQPTVITFNVLMNGFCMSGMLEDGERLLAWMLEK  321

Query  36   GFTPSVISYGCL  1
            G  P+  +Y  L
Sbjct  322  GIMPNTTTYNSL  333


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/192 (24%), Positives = 89/192 (46%), Gaps = 3/192 (2%)
 Frame = -2

Query  567  ERINK---PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSR  397
            E IN+   P    +  +++ + + G+   A ++F++M  + IVP    YT +        
Sbjct  72   EMINQGIVPDTVVYTTLIDGFCKLGNIQAAYKLFDEMEKQRIVPDFIAYTAVICGLCRCG  131

Query  396  DMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYG  217
             M EA     KM   G+E   VTY+ ++ G+ K G +E A     +  +   T +   Y 
Sbjct  132  KMMEADKVFNKMFSRGVEPDEVTYTTLIDGYCKSGEMEKAFSLHNQMVQSGLTPNVVTYT  191

Query  216  NIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC  37
             +    C+   +D A ELL EM  +G+   I  ++++++G   + N  + + + + ++  
Sbjct  192  ALADGLCKLGQVDTANELLHEMCGKGLQLNICTYNSLVNGLCKSGNIRQAVKLMEEMEVA  251

Query  36   GFTPSVISYGCL  1
            G  P  I++  L
Sbjct  252  GMYPDTITFTTL  263



>ref|XP_004294524.1| PREDICTED: pentatricopeptide repeat-containing protein At4g11690-like 
[Fragaria vesca subsp. vesca]
Length=569

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            + GD  RA +MF KM   G+V   Y YT L          +E      KM   G+  +  
Sbjct  212  KNGDLERAEKMFCKMGEVGLVANQYTYTVLIDGMFKKGRSKEGFELYEKMKINGVVPNTR  271

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
            TYS ++ G  K G + +A   F E +ER    +   Y  II   CQ   +  AE  + EM
Sbjct  272  TYSCLISGLCKDGKMSSALELFDEMRERGMACNVVTYNIIIGGLCQEMRVWEAERFVNEM  331

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            + +GI+  +  F+T++DG+      +K + +FD+LK  G +PS+++Y  L
Sbjct  332  KRDGISPSVVTFNTLIDGFCGIGKLDKAMSLFDQLKSSGQSPSLVTYNVL  381


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 84/186 (45%), Gaps = 9/186 (5%)
 Frame = -2

Query  540  EFGMMVNYYG---------RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E G++ N Y          ++G      E++EKM+  G+VP +  Y+ L         M 
Sbjct  228  EVGLVANQYTYTVLIDGMFKKGRSKEGFELYEKMKINGVVPNTRTYSCLISGLCKDGKMS  287

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
             AL    +M + G+  +VVTY+II+GG  +   V  AE +  E K    + S   +  +I
Sbjct  288  SALELFDEMRERGMACNVVTYNIIIGGLCQEMRVWEAERFVNEMKRDGISPSVVTFNTLI  347

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C    +D+A  L  +++  G +  +  ++ ++ G+   RN      +   ++  G  
Sbjct  348  DGFCGIGKLDKAMSLFDQLKSSGQSPSLVTYNVLIRGFAKARNSTGVTDLLREMENRGMA  407

Query  27   PSVISY  10
            PS ++Y
Sbjct  408  PSKVTY  413


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 86/181 (48%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   F  +++ +   G   +A  +F++++S G  P+   Y  L   +  +R+       
Sbjct  338  PSVVTFNTLIDGFCGIGKLDKAMSLFDQLKSSGQSPSLVTYNVLIRGFAKARNSTGVTDL  397

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +R+M + G+  S VTY+I++    +  ++E A H F   ++         YG +I+  C 
Sbjct  398  LREMENRGMAPSKVTYTIVIDALVRSDDMERAFHVFSSMEKSGLMPDVYTYGVLIHGLCM  457

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM  A +LL+ M +  +     IF+ M+ GY    +  + L +   +++ G  P+V S
Sbjct  458  KGNMIEASKLLQSMSDSNLEPNDVIFNIMIHGYCKEGSSYRALRLLKEMRKKGMVPNVAS  517

Query  12   Y  10
            Y
Sbjct  518  Y  518


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + +  +++   + G    A E+F++MR RG+      Y  +         + EA   
Sbjct  268  PNTRTYSCLISGLCKDGKMSSALELFDEMRERGMACNVVTYNIIIGGLCQEMRVWEAERF  327

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            V +M  +GI  SVVT++ ++ GF  +G ++ A   F + K    + S   Y  +I    +
Sbjct  328  VNEMKRDGISPSVVTFNTLIDGFCGIGKLDKAMSLFDQLKSSGQSPSLVTYNVLIRGFAK  387

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N     +LLREME  G+A     +  ++D    + + E+   +F  +++ G  P V +
Sbjct  388  ARNSTGVTDLLREMENRGMAPSKVTYTIVIDALVRSDDMERAFHVFSSMEKSGLMPDVYT  447

Query  12   YGCL  1
            YG L
Sbjct  448  YGVL  451


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/184 (21%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   + +++  + +  +     ++  +M +RG+ P+   YT +  A   S DME A   
Sbjct  373  PSLVTYNVLIRGFAKARNSTGVTDLLREMENRGMAPSKVTYTIVIDALVRSDDMERAFHV  432

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M   G+   V TY +++ G    GN+  A        + +   +  I+  +I+  C+
Sbjct  433  FSSMEKSGLMPDVYTYGVLIHGLCMKGNMIEASKLLQSMSDSNLEPNDVIFNIMIHGYCK  492

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +  RA  LL+EM ++G+   ++ + + +   +     E+  ++   + E    PS+  
Sbjct  493  EGSSYRALRLLKEMRKKGMVPNVASYSSTIGVMSNDGKWEEAEMLLKGMMESDLKPSISL  552

Query  12   YGCL  1
            Y  +
Sbjct  553  YNII  556



>ref|XP_010541010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like 
[Tarenaya hassleriana]
 ref|XP_010541011.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like 
[Tarenaya hassleriana]
Length=674

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 99/199 (50%), Gaps = 6/199 (3%)
 Frame = -2

Query  591  WHAVVRAFE-----RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            W  V R        +IN P+   F ++++   + G    A E+ E+M   G+VP +  Y 
Sbjct  386  WDDVARLLSEMVEMKIN-PNVVTFSVLIDALCKEGKFLEAEELCEEMIQSGLVPNTVTYN  444

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
            ++   Y  +  + E +    +M+  G+    +TYSI++ GF +VG ++AA+  FLE + +
Sbjct  445  SMINGYCKANRVGEGMNLFYEMSRRGLVADTITYSILIQGFYRVGKLDAAQKLFLEMQCK  504

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                +   Y  ++   C+    ++A  L  ++E+ GI   IS  + +M G       ++ 
Sbjct  505  GHHPNLVTYSILLDGLCKNGKTEKALGLYNDLEKSGIELHISSHNVIMHGLCKVGRVDEA  564

Query  66   LLMFDRLKECGFTPSVISY  10
            L++F+RL + G  P VI+Y
Sbjct  565  LILFNRLLDKGVKPDVITY  583


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/189 (24%), Positives = 82/189 (43%), Gaps = 7/189 (4%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   +  + +     G    A  + ++M   G  P    YT L + + +   +  AL+
Sbjct  191  KPNVITYNTLAHGLCIHGKISVALSLVDQMVKEGYKPNVVTYTILVHGFCIQGKISAALS  250

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS----IYGNII  208
             V +M  EG + +VVTY+ ++ GF     +  A        E   T+        Y  +I
Sbjct  251  LVDQMVKEGYQPNVVTYNTLINGFCLESRISEALSLL---DEMMLTMDCQPDIVTYAVVI  307

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+  + D A  LL +MEE  I   + I++ ++D      + +  L +F +++  G  
Sbjct  308  KGVCKLGDYDLALNLLMKMEEMRIDVNVIIYNMIIDCLCKAGHMDDALNLFGKMENVGIV  367

Query  27   PSVISYGCL  1
            P V++Y  L
Sbjct  368  PDVVTYTSL  376



>gb|KGN51232.1| hypothetical protein Csa_5G496480 [Cucumis sativus]
Length=658

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 91/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   FG +++   R+GD  RA+EMF++MR +GIVPT   YT L         +EEA + 
Sbjct  193  PSVITFGTLIDGCCRQGDLLRAQEMFDEMRVKGIVPTVIVYTILIRGLCSDNKIEEAESM  252

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R M + G+  +V TY+ ++ G+ K+ N + A   + +            +G +I   C+
Sbjct  253  HRAMREVGVYPNVYTYNTLMDGYCKLANAKQALRLYQDMLGEGLVPDVVTFGILIDGLCK  312

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M  A  L   M +  +   I+++++++D Y    +  + + +F  L+    +P V +
Sbjct  313  FGEMKAARNLFVNMIKFSVTPNIAVYNSLIDAYCKVGDVSEAMALFLELERFEVSPDVFT  372

Query  12   YGCL  1
            Y  L
Sbjct  373  YSIL  376


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 87/182 (48%), Gaps = 2/182 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    FG++++   + G+   AR +F  M    + P    Y +L  AY    D+ EA+  
Sbjct  298  PDVVTFGILIDGLCKFGEMKAARNLFVNMIKFSVTPNIAVYNSLIDAYCKVGDVSEAMAL  357

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI-YGNIIYANC  196
              ++    +   V TYSI++ G   V   E A + F E   +   L+ S+ Y ++I   C
Sbjct  358  FLELERFEVSPDVFTYSILIRGLCSVSRTEEAGNIF-EKMTKEGILANSVTYNSLIDGCC  416

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   MD+A E+  +M E G+   +  F T++DGY   RN +  + ++  +     +P V+
Sbjct  417  KEGKMDKALEICSQMTENGVEPNVITFSTLIDGYCKIRNLQAAMGIYSEMVIKSLSPDVV  476

Query  15   SY  10
            +Y
Sbjct  477  TY  478


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 65/131 (50%), Gaps = 0/131 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A  +FEKM   GI+  S  Y +L         M++AL    +M + G+E +V+T+S ++ 
Sbjct  389  AGNIFEKMTKEGILANSVTYNSLIDGCCKEGKMDKALEICSQMTENGVEPNVITFSTLID  448

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            G+ K+ N++AA   + E   +  +     Y  +I  +C+  +M  A +L  +M + GI  
Sbjct  449  GYCKIRNLQAAMGIYSEMVIKSLSPDVVTYTAMIDGHCKYGSMKEALKLYSDMLDNGITP  508

Query  129  PISIFHTMMDG  97
                   ++DG
Sbjct  509  NCYTISCLLDG  519


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/184 (22%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y + GD   A  +F ++    + P  + Y+ L          EEA   
Sbjct  333  PNIAVYNSLIDAYCKVGDVSEAMALFLELERFEVSPDVFTYSILIRGLCSVSRTEEAGNI  392

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              KM  EGI  + VTY+ ++ G  K G ++ A     +  E     +   +  +I   C+
Sbjct  393  FEKMTKEGILANSVTYNSLIDGCCKEGKMDKALEICSQMTENGVEPNVITFSTLIDGYCK  452

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+  A  +  EM  + ++  +  +  M+DG+    + ++ L ++  + + G TP+  +
Sbjct  453  IRNLQAAMGIYSEMVIKSLSPDVVTYTAMIDGHCKYGSMKEALKLYSDMLDNGITPNCYT  512

Query  12   YGCL  1
              CL
Sbjct  513  ISCL  516


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 97/232 (42%), Gaps = 10/232 (4%)
 Frame = -2

Query  684  IMKDKKKGRTRWMEGSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            ++  K     R++     +N  K    +P  +HA   AF  +++    +F    N YG  
Sbjct  81   LVGSKLLSHARYLLNDLVQNLVK--SHKP--YHACQLAFSELSRLKSSKFT--PNVYGEL  134

Query  504  GDKHRAREMFEKMRSR----GIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEIS  337
                   E+ E+  S     G   T      L Y    +   E       +M   G+  S
Sbjct  135  IIVLCKMELVEEALSMYHKVGAALTIQACNVLLYVLVKTGRFELLWRIYEEMISNGLSPS  194

Query  336  VVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellr  157
            V+T+  ++ G  + G++  A+  F E + +    +  +Y  +I   C    ++ AE + R
Sbjct  195  VITFGTLIDGCCRQGDLLRAQEMFDEMRVKGIVPTVIVYTILIRGLCSDNKIEEAESMHR  254

Query  156  emeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             M E G+   +  ++T+MDGY    N ++ L ++  +   G  P V+++G L
Sbjct  255  AMREVGVYPNVYTYNTLMDGYCKLANAKQALRLYQDMLGEGLVPDVVTFGIL  306



>ref|XP_004167903.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like 
[Cucumis sativus]
Length=645

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 91/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   FG +++   R+GD  RA+EMF++MR +GIVPT   YT L         +EEA + 
Sbjct  180  PSVITFGTLIDGCCRQGDLLRAQEMFDEMRVKGIVPTVIVYTILIRGLCSDNKIEEAESM  239

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R M + G+  +V TY+ ++ G+ K+ N + A   + +            +G +I   C+
Sbjct  240  HRAMREVGVYPNVYTYNTLMDGYCKLANAKQALRLYQDMLGEGLVPDVVTFGILIDGLCK  299

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M  A  L   M +  +   I+++++++D Y    +  + + +F  L+    +P V +
Sbjct  300  FGEMKAARNLFVNMIKFSVTPNIAVYNSLIDAYCKVGDVSEAMALFLELERFEVSPDVFT  359

Query  12   YGCL  1
            Y  L
Sbjct  360  YSIL  363


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 87/182 (48%), Gaps = 2/182 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    FG++++   + G+   AR +F  M    + P    Y +L  AY    D+ EA+  
Sbjct  285  PDVVTFGILIDGLCKFGEMKAARNLFVNMIKFSVTPNIAVYNSLIDAYCKVGDVSEAMAL  344

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI-YGNIIYANC  196
              ++    +   V TYSI++ G   V   E A + F E   +   L+ S+ Y ++I   C
Sbjct  345  FLELERFEVSPDVFTYSILIRGLCSVSRTEEAGNIF-EKMTKEGILANSVTYNSLIDGCC  403

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   MD+A E+  +M E G+   +  F T++DGY   RN +  + ++  +     +P V+
Sbjct  404  KEGKMDKALEICSQMTENGVEPNVITFSTLIDGYCKIRNLQAAMGIYSEMVIKSLSPDVV  463

Query  15   SY  10
            +Y
Sbjct  464  TY  465


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 65/132 (49%), Gaps = 0/132 (0%)
 Frame = -2

Query  492  RAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIV  313
             A  +FEKM   GI+  S  Y +L         M++AL    +M + G+E +V+T+S ++
Sbjct  375  EAGNIFEKMTKEGILANSVTYNSLIDGCCKEGKMDKALEICSQMTENGVEPNVITFSTLI  434

Query  312  GGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIA  133
             G+ K+ N++AA   + E   +  +     Y  +I  +C+  +M  A +L  +M + GI 
Sbjct  435  DGYCKIRNLQAAMGIYSEMVIKSLSPDVVTYTAMIDGHCKYGSMKEALKLYSDMLDNGIT  494

Query  132  APISIFHTMMDG  97
                    ++DG
Sbjct  495  PNCYTISCLLDG  506


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/184 (22%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y + GD   A  +F ++    + P  + Y+ L          EEA   
Sbjct  320  PNIAVYNSLIDAYCKVGDVSEAMALFLELERFEVSPDVFTYSILIRGLCSVSRTEEAGNI  379

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              KM  EGI  + VTY+ ++ G  K G ++ A     +  E     +   +  +I   C+
Sbjct  380  FEKMTKEGILANSVTYNSLIDGCCKEGKMDKALEICSQMTENGVEPNVITFSTLIDGYCK  439

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+  A  +  EM  + ++  +  +  M+DG+    + ++ L ++  + + G TP+  +
Sbjct  440  IRNLQAAMGIYSEMVIKSLSPDVVTYTAMIDGHCKYGSMKEALKLYSDMLDNGITPNCYT  499

Query  12   YGCL  1
              CL
Sbjct  500  ISCL  503


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 97/232 (42%), Gaps = 10/232 (4%)
 Frame = -2

Query  684  IMKDKKKGRTRWMEGSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRR  505
            ++  K     R++     +N  K    +P  +HA   AF  +++    +F    N YG  
Sbjct  68   LVGSKLLSHARYLLNDLVQNLVK--SHKP--YHACQLAFSELSRLKSSKFT--PNVYGEL  121

Query  504  GDKHRAREMFEKMRSR----GIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEIS  337
                   E+ E+  S     G   T      L Y    +   E       +M   G+  S
Sbjct  122  IIVLCKMELVEEALSMYHKVGAALTIQACNVLLYVLVKTGRFELLWRIYEEMISNGLSPS  181

Query  336  VVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellr  157
            V+T+  ++ G  + G++  A+  F E + +    +  +Y  +I   C    ++ AE + R
Sbjct  182  VITFGTLIDGCCRQGDLLRAQEMFDEMRVKGIVPTVIVYTILIRGLCSDNKIEEAESMHR  241

Query  156  emeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             M E G+   +  ++T+MDGY    N ++ L ++  +   G  P V+++G L
Sbjct  242  AMREVGVYPNVYTYNTLMDGYCKLANAKQALRLYQDMLGEGLVPDVVTFGIL  293



>ref|XP_007044407.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
 gb|EOY00239.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
Length=750

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++N Y + G   +   + E+M+++G+ P  Y Y ++ Y    + ++ EA   
Sbjct  288  PDVVSYSTIINGYCQAGKLPKVLRLIEEMQAKGLKPNPYTYNSIIYLLCKAGNVAEAEKV  347

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +R+M ++G+E   V Y+ ++GGF K+GN+ +A     E + +        Y +II   CQ
Sbjct  348  LREMMNQGMEPDRVVYTTLIGGFCKLGNIPSAYRLLNEMQGQKIFPDVLTYTSIICGFCQ  407

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            T  M  A  + +EM   G+      +  ++DGY      ++   + + +   G  P+V++
Sbjct  408  TGKMTEASNVFQEMLGIGLEPDEVTYTALIDGYCKAGAMKEAFSLHNEMVHMGLIPNVVT  467

Query  12   YGCL  1
            Y  L
Sbjct  468  YTAL  471


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 90/185 (49%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  +VN   + G+   A ++ E M   G+ P ++ YT L  AY  + +M++A  
Sbjct  497  QPNIFTYNSLVNGLCKAGNIAHAIKLMEDMEIAGLHPDAFTYTTLMDAYCKTGEMDKAYD  556

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             ++KM D G++ ++VT+++++ GF   G +E  E       E+    +A+ Y  ++   C
Sbjct  557  LLKKMLDRGLQPTLVTFNVLMNGFCMSGMLEDGERLLKWMLEKGIMPNATTYNTLMKQYC  616

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
               NM     + + M  +G+    + ++ ++ G+   RN ++   +   +   GF  +  
Sbjct  617  IRNNMRATTAMYKGMCAQGVMPDGNTYNILIKGHCKARNMKEAWFLHREMIGKGFNLTAS  676

Query  15   SYGCL  1
            SY  L
Sbjct  677  SYNVL  681


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++  + + G    A  +F++M   G+ P    YT L   Y  +  M+EA + 
Sbjct  393  PDVLTYTSIICGFCQTGKMTEASNVFQEMLGIGLEPDEVTYTALIDGYCKAGAMKEAFSL  452

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   G+  +VVTY+ +  G  K G V+ A     E   R    +   Y +++   C+
Sbjct  453  HNEMVHMGLIPNVVTYTALADGLCKRGEVDTANELLHEMCGRGLQPNIFTYNSLVNGLCK  512

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+  A +L+ +ME  G+      + T+MD Y  T   +K   +  ++ + G  P++++
Sbjct  513  AGNIAHAIKLMEDMEIAGLHPDAFTYTTLMDAYCKTGEMDKAYDLLKKMLDRGLQPTLVT  572

Query  12   YGCL  1
            +  L
Sbjct  573  FNVL  576


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 86/187 (46%), Gaps = 4/187 (2%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P R  +  ++  + + G+   A  +  +M+ + I P    YT++   +  +  M EA  
Sbjct  357  EPDRVVYTTLIGGFCKLGNIPSAYRLLNEMQGQKIFPDVLTYTSIICGFCQTGKMTEASN  416

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI--YGNIIYA  202
              ++M   G+E   VTY+ ++ G+ K G ++ A  + L  +  H  L  ++  Y  +   
Sbjct  417  VFQEMLGIGLEPDEVTYTALIDGYCKAGAMKEA--FSLHNEMVHMGLIPNVVTYTALADG  474

Query  201  NCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
             C+   +D A ELL EM   G+   I  ++++++G     N    + + + ++  G  P 
Sbjct  475  LCKRGEVDTANELLHEMCGRGLQPNIFTYNSLVNGLCKAGNIAHAIKLMEDMEIAGLHPD  534

Query  21   VISYGCL  1
              +Y  L
Sbjct  535  AFTYTTL  541



>ref|XP_010239993.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Brachypodium distachyon]
Length=394

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/204 (24%), Positives = 102/204 (50%), Gaps = 1/204 (0%)
 Frame = -2

Query  612  LESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYE  433
            L S PE +   ++  +    P  + F +++  + R G+   AR++F++MR R + PT   
Sbjct  4    LPSTPEAYTFYLQLLDAGMAPETRLFNVLMRDFVRLGELVSARKVFDEMR-RSVQPTVVT  62

Query  432  YTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            +  L      +RD++      ++M+D G++  V TY  ++ GF + G +E A   F E +
Sbjct  63   FNTLISGMCRARDLDAVDGLYKEMSDVGVKPDVYTYGALIKGFCRTGRMENAVKMFNEMR  122

Query  252  ERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEE  73
            +     +A ++  +I A+C+  N++   +L ++M   G+   +  ++ +++G    RN +
Sbjct  123  DTGVNPNAVVFTTLIDAHCKEGNVNAGMDLYQDMRVRGVMPDLVAYNALVNGLCRARNLK  182

Query  72   KCLLMFDRLKECGFTPSVISYGCL  1
                + + +K  G  P  ++Y  L
Sbjct  183  AAESIVEEMKNAGLKPDKVTYTTL  206


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (44%), Gaps = 0/128 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +G ++  + R G    A +MF +MR  G+ P +  +T L  A+    ++   + 
Sbjct  92   KPDVYTYGALIKGFCRTGRMENAVKMFNEMRDTGVNPNAVVFTTLIDAHCKEGNVNAGMD  151

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              + M   G+   +V Y+ +V G  +  N++AAE    E K          Y  +I   C
Sbjct  152  LYQDMRVRGVMPDLVAYNALVNGLCRARNLKAAESIVEEMKNAGLKPDKVTYTTLIDGCC  211

Query  195  QTCNMDRA  172
            +   +D A
Sbjct  212  KDGKLDMA  219


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +VN   R  +   A  + E+M++ G+ P    YT L         ++ A+  
Sbjct  163  PDLVAYNALVNGLCRARNLKAAESIVEEMKNAGLKPDKVTYTTLIDGCCKDGKLDMAMDI  222

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             +KM ++ + +  VTY+ ++ G +K G    AE    E  E       + Y  +I A C+
Sbjct  223  KQKMAEKEVSLDEVTYTALISGLSKAGRPVDAERVLREMMEAALEPDNTTYTMVIDAFCR  282

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++    +LL+EM+ +G    +  ++ +M+G       +   ++   +   G +P  I+
Sbjct  283  KGDVKTGFKLLKEMQNKGKKPGVVTYNVIMNGLCKLGQMKNADMLLHAMLNIGVSPDDIT  342

Query  12   YGCL  1
            Y  L
Sbjct  343  YNIL  346



>gb|EYU28680.1| hypothetical protein MIMGU_mgv1a019615mg [Erythranthe guttata]
Length=697

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/234 (24%), Positives = 106/234 (45%), Gaps = 3/234 (1%)
 Frame = -2

Query  702  LDDGRRIMKDKKKGRTRWMEGSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMV  523
            LDD R++  DK       +   S   F   L  +P+     ++ F  I  P    +  ++
Sbjct  188  LDDARKVF-DKMLNYGVVLSLDSCNMFLSRLSKEPDGPKMSLKVFCCI--PDAVSYSTVI  244

Query  522  NYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIE  343
            N Y  +G+ +    + E M+ +G+ P ++ + ++      S  + +A   +R+M  +GI 
Sbjct  245  NGYCNQGELNSGLNVVENMQQKGLKPNAFTFNSIILLLCKSGKVLDAEKVLREMISQGIF  304

Query  342  ISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeel  163
                 Y+ ++ GF+K+GN  +A   + E + R+       Y  +I   CQ   +  A+ L
Sbjct  305  PDNAVYTTLIDGFSKIGNTASASRMYDEIQSRNIIPDVITYTALICGFCQNGKVAEADHL  364

Query  162  lremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              EM   G+ A    + T++DGY      EK   + + + + G  P+V++Y  L
Sbjct  365  FYEMLNIGLKADEFTYTTLIDGYCKAGEIEKAFSLHNEMIQVGLIPNVVTYTAL  418


 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 95/187 (51%), Gaps = 6/187 (3%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++  + + G    A  +F +M + G+    + YT L   Y  + ++E+A + 
Sbjct  340  PDVITYTALICGFCQNGKVAEADHLFYEMLNIGLKADEFTYTTLIDGYCKAGEIEKAFSL  399

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   G+  +VVTY+ +V G  K G+V+ A     E  E+   L+   +  ++   C+
Sbjct  400  HNEMIQVGLIPNVVTYTALVDGLCKKGDVDTANELLHEMCEKGLVLNIYTWNALLNGLCK  459

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCL---LMFDRLKECGFTPS  22
            + N+++A +L+++ME   I   +  + T+MD Y   +N E  +   L+ + LK+ G  P+
Sbjct  460  SGNIEQAVKLMKDMEVAKIGPDVYTYTTLMDAY--CKNGEMVMAHQLLHEMLKK-GIKPT  516

Query  21   VISYGCL  1
            V+++  L
Sbjct  517  VVTFNVL  523


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 88/176 (50%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            ++N   + G+  +A ++ + M    I P  Y YT L  AY  + +M  A   + +M  +G
Sbjct  453  LLNGLCKSGNIEQAVKLMKDMEVAKIGPDVYTYTTLMDAYCKNGEMVMAHQLLHEMLKKG  512

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            I+ +VVT+++++ GF   G +E  +       E+    +++ Y ++I  +C   +M  A 
Sbjct  513  IKPTVVTFNVLMNGFCMSGMLEDGQKLLNWMLEKGIMPNSTTYNSLIKQHCVRNDMRSAT  572

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            E+ R M  +G+    + ++ ++ G+   RN ++   +   + E GF  +V +Y  L
Sbjct  573  EVYRGMYNQGVTPDENTYNILIRGHCKMRNMKEAWFLHKEMVEKGFNLTVETYNAL  628


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 58/118 (49%), Gaps = 4/118 (3%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   F +++N +   G     +++   M  +GI+P S  Y +L   + V  DM  A  
Sbjct  514  KPTVVTFNVLMNGFCMSGMLEDGQKLLNWMLEKGIMPNSTTYNSLIKQHCVRNDMRSATE  573

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFL--EAKERHATLSASIYGNII  208
              R M ++G+     TY+I++ G  K+ N++ A  WFL  E  E+   L+   Y  +I
Sbjct  574  VYRGMYNQGVTPDENTYNILIRGHCKMRNMKEA--WFLHKEMVEKGFNLTVETYNALI  629



>ref|XP_010435859.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
isoform X1 [Camelina sativa]
 ref|XP_010435860.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
isoform X2 [Camelina sativa]
Length=746

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +  +++   + G+ +RA E  E+MR RG+ P    YT L   ++    M EA   
Sbjct  342  PSVITYTSLIHSMCKAGNMNRATEFLEQMRVRGLCPNERTYTTLVDGFSQKGYMNEAYRV  401

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +++M D G   S+VTY+ +V G    GN+E A     + KE+  T     Y  ++   C+
Sbjct  402  LKEMIDNGFSPSIVTYNALVNGHCVAGNMEDAIAVLEDMKEKGLTPDVVSYSTVLSGFCR  461

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + ++D A  + REM E+GI      + +++ G+   R  ++   ++D +   G  P   +
Sbjct  462  SYDVDEALRVKREMVEKGIKPDTVTYSSLIQGFCEQRRTKEACDLYDEMLRAGLPPDEFT  521

Query  12   YGCL  1
            Y  L
Sbjct  522  YTAL  525


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/184 (23%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + +  +V+ + ++G  + A  + ++M   G  P+   Y  L   + V+ +ME+A+  
Sbjct  377  PNERTYTTLVDGFSQKGYMNEAYRVLKEMIDNGFSPSIVTYNALVNGHCVAGNMEDAIAV  436

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +  M ++G+   VV+YS ++ GF +  +V+ A     E  E+        Y ++I   C+
Sbjct  437  LEDMKEKGLTPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKPDTVTYSSLIQGFCE  496

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
                  A +L  EM   G+      +  +++ Y +  + EK L + + +   G  P V++
Sbjct  497  QRRTKEACDLYDEMLRAGLPPDEFTYTALINAYCMEGDLEKALQLHNEMVVKGVLPDVVT  556

Query  12   YGCL  1
            Y  L
Sbjct  557  YSVL  560


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/229 (23%), Positives = 101/229 (44%), Gaps = 21/229 (9%)
 Frame = -2

Query  624  FRKVLESQPE----NWHAVVRAF-------------ERINK----PSRKEFGMMVNYYGR  508
            F+++LESQ       ++ ++R F             ER+ K    P+   +  +++ Y +
Sbjct  192  FKEMLESQVSPNVFTYNILIRGFCFAGNIDVALGFFERMEKKGCLPNVVTYNTLIDGYCK  251

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
                    E+   M  +G+ P    Y  +         M+E    + +MN +G  +  VT
Sbjct  252  LRKIDDGFELLRSMALKGLEPNLISYNVVINGLCREGRMKETSFVLTEMNKKGYSLDEVT  311

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            Y+ ++ G+ K GN   A     E      + S   Y ++I++ C+  NM+RA E L +M 
Sbjct  312  YNTLIKGYCKEGNFHQALVMHAEMLRHGLSPSVITYTSLIHSMCKAGNMNRATEFLEQMR  371

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              G+      + T++DG++      +   +   + + GF+PS+++Y  L
Sbjct  372  VRGLCPNERTYTTLVDGFSQKGYMNEAYRVLKEMIDNGFSPSIVTYNAL  420


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 83/183 (45%), Gaps = 0/183 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   + +++N   R G       +  +M  +G       Y  L   Y    +  +AL 
Sbjct  271  EPNLISYNVVINGLCREGRMKETSFVLTEMNKKGYSLDEVTYNTLIKGYCKEGNFHQALV  330

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M   G+  SV+TY+ ++    K GN+  A  +  + + R    +   Y  ++    
Sbjct  331  MHAEMLRHGLSPSVITYTSLIHSMCKAGNMNRATEFLEQMRVRGLCPNERTYTTLVDGFS  390

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            Q   M+ A  +L+EM + G +  I  ++ +++G+ +  N E  + + + +KE G TP V+
Sbjct  391  QKGYMNEAYRVLKEMIDNGFSPSIVTYNALVNGHCVAGNMEDAIAVLEDMKEKGLTPDVV  450

Query  15   SYG  7
            SY 
Sbjct  451  SYS  453


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/179 (23%), Positives = 88/179 (49%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  ++  Y + G+ H+A  M  +M   G+ P+   YT+L ++   + +M  A   + +M 
Sbjct  312  YNTLIKGYCKEGNFHQALVMHAEMLRHGLSPSVITYTSLIHSMCKAGNMNRATEFLEQMR  371

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G+  +  TY+ +V GF++ G +  A     E  +   + S   Y  ++  +C   NM+
Sbjct  372  VRGLCPNERTYTTLVDGFSQKGYMNEAYRVLKEMIDNGFSPSIVTYNALVNGHCVAGNME  431

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A  +L +M+E+G+   +  + T++ G+  + + ++ L +   + E G  P  ++Y  L
Sbjct  432  DAIAVLEDMKEKGLTPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKPDTVTYSSL  490


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  ++  +  +     A +++++M   G+ P  + YT L  AY +  D+E+AL 
Sbjct  481  KPDTVTYSSLIQGFCEQRRTKEACDLYDEMLRAGLPPDEFTYTALINAYCMEGDLEKALQ  540

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M  +G+   VVTYS+++ G  K      A+   L+     +  S   Y  +I  NC
Sbjct  541  LHNEMVVKGVLPDVVTYSVLINGLNKQARTREAKRLLLKLFYEDSVPSDVTYHTLI-ENC  599



>ref|XP_010541012.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010541013.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010541014.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X1 [Tarenaya hassleriana]
Length=674

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 99/199 (50%), Gaps = 6/199 (3%)
 Frame = -2

Query  591  WHAVVRAFE-----RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            W  V R        +IN P+   F ++++   + G    A E+ E+M   G+VP ++ Y 
Sbjct  386  WDDVARLLSEMVEMKIN-PNVVTFSVLIDALCKEGKFLEAEELCEEMIQSGLVPNTFTYN  444

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
            ++   Y  +  + E +    +M+  G+    +TY+I++ GF +VG ++AA+  FLE + +
Sbjct  445  SMINGYCKANRVGEGMNLFYEMSRRGLVADTITYNILIQGFYRVGKLDAAQKLFLEMQCK  504

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                    Y  ++   C+    ++A  L  ++E+ GI   IS  + +M G       ++ 
Sbjct  505  GHHPDLVTYSILLDGLCKNGKTEKALGLYNDLEKSGIELRISSHNVIMHGLCKVGRVDEA  564

Query  66   LLMFDRLKECGFTPSVISY  10
            L++F+RL + G  P VI+Y
Sbjct  565  LILFNRLLDKGVKPDVITY  583


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/189 (24%), Positives = 83/189 (44%), Gaps = 7/189 (4%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   +  + + +  +G+   A  + ++M   G  P    YT L +   +   +  AL+
Sbjct  191  KPNVITYNTLAHGFCIQGNISVALSLVDQMVKEGYKPNVVTYTILVHGLCIQGKISAALS  250

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS----IYGNII  208
             V +M  EG E +VVT++ ++ GF     +  A        E   T+        Y  +I
Sbjct  251  LVDQMVKEGYEPNVVTFTTLINGFCLESRISEALSLL---DEMMLTMDCQPDVVTYAVVI  307

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+  + D A  LL +MEE  I   + I+  ++D        +  L +F ++ + G  
Sbjct  308  NGVCKLGDYDLALTLLMKMEEMRIEVNVIIYSMIIDCLCKAGRIDDALNLFGKMGDVGIV  367

Query  27   PSVISYGCL  1
            P+V++Y  L
Sbjct  368  PNVVTYTSL  376



>ref|XP_004140820.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Cucumis sativus]
Length=590

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  + + +++N + + G    A+ +F ++R RG+ PT+  +  L      SR+++E    
Sbjct  221  PKVQYYNILINKFCKEGSIRDAKLIFNEIRKRGLRPTTVSFNTLINGLCKSRNLDEGFRL  280

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             + M +  I   V TYS+++ G  K G ++ AE  F E ++R    +   +  +I   C+
Sbjct  281  KKTMEENRIYPDVFTYSVLIHGLCKEGRLDVAEQLFDEMQQRGLRPNGITFTALIDGQCR  340

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            +  +D A     +M   G+   + +++T+++G     +  K   + D ++  G  P  I+
Sbjct  341  SRRIDSAMNTYHQMLTMGVKPDLVMYNTLLNGLCKVGDVNKARKLVDEMRMVGMKPDKIT  400

Query  12   YGCL  1
            Y  L
Sbjct  401  YTTL  404


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 88/185 (48%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  ++N   + GD ++AR++ ++MR  G+ P    YT L   Y    D+E A+ 
Sbjct  360  KPDLVMYNTLLNGLCKVGDVNKARKLVDEMRMVGMKPDKITYTTLIDGYCKEGDLESAME  419

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              + MN+EG+ +  V ++ ++ GF + G V  AE    E  E       + Y  +I   C
Sbjct  420  IRKGMNEEGVVLDNVAFTALISGFCRDGRVRDAERTLREMVEAGMKPDDATYTMVIDGYC  479

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  N+    +LL+EM+  G    +  ++ +M+G       +   ++ + +   G TP  I
Sbjct  480  KKGNVKMGFKLLKEMQINGHKPGVITYNVLMNGLCKQGQMKNANMLLEAMLNLGVTPDDI  539

Query  15   SYGCL  1
            +Y  L
Sbjct  540  TYNIL  544



>gb|EMS53207.1| Protein Rf1, mitochondrial [Triticum urartu]
Length=728

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + F +++N Y +RG    A  MFE MR +G+ P  + Y  +  +      M+ AL  
Sbjct  305  PNHRIFNILINAYAKRGLMDAAMHMFEVMRQQGVNPDVFSYQIVMDSLCKMGRMDAALDK  364

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+   +V Y  +V G    G+ E A+    EA  R    ++  +  +I   C+
Sbjct  365  FNQMVNQGVSPDIVVYRCLVLGSCSHGDFEKAKELISEAVNRGLCSNSVFFYPVINDLCK  424

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  A+++   +   G    + +++++MDGY +    E+ L + D +K  G  P   +
Sbjct  425  EGKVKEAQDMFDFIVGIGQRPDVIMYNSLMDGYCLVGKVEEALRVLDAMKSAGLQPDAFT  484

Query  12   YGCL  1
            YG L
Sbjct  485  YGIL  488


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 82/177 (46%), Gaps = 0/177 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +++N   + G+  +A  +F  M   G+ P    YT++  A +  R M++A   
Sbjct  130  PNVFSYSIVINGCFKEGEVDKACNLFHGMIQLGVQPNVAIYTSIIDALSKCRAMDKAEVV  189

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +++M D+GIE ++ TY+ ++ G++  G  +AA   F E        +A    + + + C+
Sbjct  190  LQQMVDQGIEPNIRTYTTLIHGYSASGQWKAAVRVFKEMASVGVLPNAVTLNSFMDSLCK  249

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
                  A  +   M  +G    +  + TM+ GY      +    +F+ + + G  P+
Sbjct  250  HRRTKEARVIFDSMAAKGQKPDVVSYSTMLSGYVKEGCFDDMTCLFNSMLQNGVVPN  306


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 68/154 (44%), Gaps = 0/154 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P    +G+++N Y + G       +F +M   G+ PT+  Y  + +    S     A  
Sbjct  479  QPDAFTYGILLNGYCKIGKIADGLSLFREMSLNGVKPTTIMYNIILHGLFFSGRTVSAKE  538

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
                MN+ GI + V TY+I++ G  K    + A   F + +  +  ++  I   +I A  
Sbjct  539  IFHTMNESGIPVGVDTYNIVLSGLCKNNCTDEAIELFKKLRAMNVKINVIILNTMISAMF  598

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGY  94
            +T  ++ A++L   +   G+   +  +  MM  +
Sbjct  599  KTRRIEEAKDLFATISAIGLVPSVVTYSVMMTNF  632


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/170 (23%), Positives = 78/170 (46%), Gaps = 6/170 (4%)
 Frame = -2

Query  591  WHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHR----AREMFEKMRSRGIVPTSYEYTN  424
            W A VR F+ +         + +N +     KHR    AR +F+ M ++G  P    Y+ 
Sbjct  218  WKAAVRVFKEMASVGVLPNAVTLNSFMDSLCKHRRTKEARVIFDSMAAKGQKPDVVSYST  277

Query  423  LTYAYTVSRDMEEALTCV-RKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
            +   Y V     + +TC+   M   G+  +   ++I++  +AK G ++AA H F   +++
Sbjct  278  MLSGY-VKEGCFDDMTCLFNSMLQNGVVPNHRIFNILINAYAKRGLMDAAMHMFEVMRQQ  336

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDG  97
                    Y  ++ + C+   MD A +   +M  +G++  I ++  ++ G
Sbjct  337  GVNPDVFSYQIVMDSLCKMGRMDAALDKFNQMVNQGVSPDIVVYRCLVLG  386



>gb|KGN57460.1| hypothetical protein Csa_3G188330 [Cucumis sativus]
Length=529

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  + + +++N + + G    A+ +F ++R RG+ PT+  +  L      SR+++E    
Sbjct  235  PKVQYYNILINKFCKEGSIRDAKLIFNEIRKRGLRPTTVSFNTLINGLCKSRNLDEGFRL  294

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             + M +  I   V TYS+++ G  K G ++ AE  F E ++R    +   +  +I   C+
Sbjct  295  KKTMEENRIYPDVFTYSVLIHGLCKEGRLDVAEQLFDEMQQRGLRPNGITFTALIDGQCR  354

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            +  +D A     +M   G+   + +++T+++G     +  K   + D ++  G  P  I+
Sbjct  355  SRRIDSAMNTYHQMLTMGVKPDLVMYNTLLNGLCKVGDVNKARKLVDEMRMVGMKPDKIT  414

Query  12   YGCL  1
            Y  L
Sbjct  415  YTTL  418


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  ++N   + GD ++AR++ ++MR  G+ P    YT L   Y    D+E A+ 
Sbjct  374  KPDLVMYNTLLNGLCKVGDVNKARKLVDEMRMVGMKPDKITYTTLIDGYCKEGDLESAME  433

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNV  286
              + MN+EG+ +  V ++ ++ G  K  N+
Sbjct  434  IRKGMNEEGVVLDNVAFTALISGQMKNANM  463



>ref|XP_009411130.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=715

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 98/187 (52%), Gaps = 2/187 (1%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   +  +++  GR G   + + ++ +M SRG+VPT   Y+ L  AY+ +R  E+AL 
Sbjct  326  KPNVVIYNTLLDSMGRAGRPWQVKTIYREMSSRGLVPTRATYSALLRAYSKARYAEDALG  385

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI--YGNIIYA  202
              ++MN+ G+E++V+ Y++++   A +G+V+ A   F + KE        I  Y ++I A
Sbjct  386  VYKQMNERGMELNVILYNMLLSMCADIGSVDEAVEIFRKMKELPDGCRPDIWSYSSLITA  445

Query  201  NCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
             C +  +  AE LL +M E G    I +  +++  Y   +  +  +   D+L E G  P 
Sbjct  446  YCCSGKVSEAEGLLDDMLEAGFQPNIFVLTSLIQCYGKAQMTDSVVKSLDKLLELGIRPD  505

Query  21   VISYGCL  1
                GCL
Sbjct  506  DRFCGCL  512



>ref|XP_007048893.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOX93050.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=582

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/194 (25%), Positives = 95/194 (49%), Gaps = 4/194 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N+  V + ++++ +    P    + +++N YG+   +  A  +FE+M   GI PT   Y 
Sbjct  330  NYKEVSKIYDQMQRAGLRPDVVSYALLINAYGKARREEEALAVFEEMLDAGIRPTHKSYN  389

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L  A+ +S  +E+A T  + M  +G    + +Y+ ++  +    N+E AE++F   K+ 
Sbjct  390  ILLDAFAISGMVEQARTVFKSMRRDGYTPDICSYTTMLLAYVNASNLEGAENFFKRLKQD  449

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                +   YG ++    +  N+++  E   EM+  GI A  +IF T+MD Y   R+    
Sbjct  450  GLQPNVVTYGTLMKGYAKVNNLEKMMETYEEMQLNGIKANQTIFTTLMDAYGKNRDFGSA  509

Query  66   LLMFDRLKECGFTP  25
            ++ +  ++  G  P
Sbjct  510  VIWYKEMESSGVPP  523


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 86/185 (46%), Gaps = 3/185 (2%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP +K F MM+  Y + G   +AR++F  M  RG+  ++  Y +L    T   + +E   
Sbjct  280  KPDQKMFHMMIYMYKKAGSYEKARKLFALMAERGVKQSTVTYNSLM---TFETNYKEVSK  336

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M   G+   VV+Y++++  + K    E A   F E  +     +   Y  ++ A  
Sbjct  337  IYDQMQRAGLRPDVVSYALLINAYGKARREEEALAVFEEMLDAGIRPTHKSYNILLDAFA  396

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
             +  +++A  + + M  +G    I  + TM+  Y    N E     F RLK+ G  P+V+
Sbjct  397  ISGMVEQARTVFKSMRRDGYTPDICSYTTMLLAYVNASNLEGAENFFKRLKQDGLQPNVV  456

Query  15   SYGCL  1
            +YG L
Sbjct  457  TYGTL  461


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 86/186 (46%), Gaps = 6/186 (3%)
 Frame = -2

Query  549  SRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCV  370
            S  +F M++  YG++GD ++A  +   M  +G  P+   +T L  AY        A    
Sbjct  174  SEMDFIMLITAYGKQGDFNKAERIMSFMNKKGYAPSVVSHTALMEAYGRGGRYNNAEAIF  233

Query  369  RKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWF---LEAKERHATLSASIYGNIIYAN  199
            R+M   G E S +TY II+    +    + AE  F   L+ ++        ++  +IY  
Sbjct  234  RRMQSSGPEPSALTYQIILKILVEGKKFKEAEEVFETVLDKEKSPLKPDQKMFHMMIYMY  293

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
             +  + ++A +L   M E G+      ++++M   T   N ++   ++D+++  G  P V
Sbjct  294  KKAGSYEKARKLFALMAERGVKQSTVTYNSLM---TFETNYKEVSKIYDQMQRAGLRPDV  350

Query  18   ISYGCL  1
            +SY  L
Sbjct  351  VSYALL  356



>ref|XP_006483272.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, 
mitochondrial-like isoform X1 [Citrus sinensis]
 ref|XP_006483273.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, 
mitochondrial-like isoform X2 [Citrus sinensis]
 ref|XP_006483274.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, 
mitochondrial-like isoform X3 [Citrus sinensis]
Length=751

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F +M+N Y   G+  R  ++ E+M+ +G+ P  Y Y ++      +  + EA T 
Sbjct  289  PDVVSFSIMINGYCYLGELQRVLKLIEEMQIKGLKPNPYTYNSIVRLLCKTSKVVEAETI  348

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +R+M ++GI    V Y+ ++ GF K+GNV AA   F E +  +       Y  II   C 
Sbjct  349  LREMMNQGIVPDNVIYTTLIDGFCKMGNVAAAYRLFDEMRGLNIIPDLLTYTAIICGFCL  408

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            T  M  A++L  EM   G+     ++  ++DGY      +K   + + + +   TP+V++
Sbjct  409  TGKMVEAKKLFHEMLGRGLEPDEIVYTALIDGYCKAGEMKKAFSLHNNMVQMRLTPNVVT  468

Query  12   YGCL  1
            Y  L
Sbjct  469  YTAL  472


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/204 (25%), Positives = 100/204 (49%), Gaps = 3/204 (1%)
 Frame = -2

Query  612  LESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYE  433
            +E+  E  H + R   ++N  +   +  +VN   + G+  +A ++ E M   G  P ++ 
Sbjct  482  IETANELLHEMCRKGLQLNIYT---YNSIVNGLCKAGNILQAVKLMEDMEVAGFHPDTFT  538

Query  432  YTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAK  253
            YT +  AY  S +M +A   +R M D+G++ SVVT+++++ GF   G +E  E       
Sbjct  539  YTTIMDAYCKSGEMVKAHELLRDMLDKGLQPSVVTFNVLMNGFCMSGMIEDGEKLLKWML  598

Query  252  ERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEE  73
            E+    +A+ Y  +I  +C   +M    ++ + M  +GI    + ++ ++ G+   RN +
Sbjct  599  EKGLKPNAATYNPLIKQHCLRNDMRTTAKIYKGMCAQGITPDGNTYNILLQGHCKARNMK  658

Query  72   KCLLMFDRLKECGFTPSVISYGCL  1
            +   +   + + GF  +  SY  L
Sbjct  659  EAWFLHKEMVQKGFNLTTSSYNAL  682


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 83/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++  +   G    A+++F +M  RG+ P    YT L   Y  + +M++A + 
Sbjct  394  PDLLTYTAIICGFCLTGKMVEAKKLFHEMLGRGLEPDEIVYTALIDGYCKAGEMKKAFSL  453

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M    +  +VVTY+ +  G  K G +E A     E   +   L+   Y +I+   C+
Sbjct  454  HNNMVQMRLTPNVVTYTALADGLCKSGEIETANELLHEMCRKGLQLNIYTYNSIVNGLCK  513

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+ +A +L+ +ME  G       + T+MD Y  +    K   +   + + G  PSV++
Sbjct  514  AGNILQAVKLMEDMEVAGFHPDTFTYTTIMDAYCKSGEMVKAHELLRDMLDKGLQPSVVT  573

Query  12   YGCL  1
            +  L
Sbjct  574  FNVL  577


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 97/220 (44%), Gaps = 17/220 (8%)
 Frame = -2

Query  618  KVLESQPENWHAVVRAFERINK-----------------PSRKEFGMMVNYYGRRGDKHR  490
            K L+  P  ++++VR   + +K                 P    +  +++ + + G+   
Sbjct  320  KGLKPNPYTYNSIVRLLCKTSKVVEAETILREMMNQGIVPDNVIYTTLIDGFCKMGNVAA  379

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A  +F++MR   I+P    YT +   + ++  M EA     +M   G+E   + Y+ ++ 
Sbjct  380  AYRLFDEMRGLNIIPDLLTYTAIICGFCLTGKMVEAKKLFHEMLGRGLEPDEIVYTALID  439

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            G+ K G ++ A        +   T +   Y  +    C++  ++ A ELL EM  +G+  
Sbjct  440  GYCKAGEMKKAFSLHNNMVQMRLTPNVVTYTALADGLCKSGEIETANELLHEMCRKGLQL  499

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             I  ++++++G     N  + + + + ++  GF P   +Y
Sbjct  500  NIYTYNSIVNGLCKAGNILQAVKLMEDMEVAGFHPDTFTY  539



>emb|CBI32450.3| unnamed protein product [Vitis vinifera]
Length=851

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 92/185 (50%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + +  +++ + R+G  + A  +  +M   G  P+   Y    + + V   MEEAL 
Sbjct  182  RPNERTYTTLIDGFSRQGLLNEAYRILNEMTESGFSPSVVTYNAFIHGHCVLERMEEALG  241

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M ++G+   VV+YS I+ GF + G ++ A     E  E+  +  A  Y ++I   C
Sbjct  242  VVQEMVEKGLAPDVVSYSTIISGFCRKGELDRAFQMKQEMVEKGVSPDAVTYSSLIQGLC  301

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  A +L +EM + G+      + T+++ Y +  +  K L + D +   GF P  +
Sbjct  302  EMRRLTEACDLSQEMLDMGLPPDEFTYTTLINAYCVEGDLNKALHLHDEMIHKGFLPDAV  361

Query  15   SYGCL  1
            +Y  L
Sbjct  362  TYSVL  366


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/202 (23%), Positives = 92/202 (46%), Gaps = 0/202 (0%)
 Frame = -2

Query  606  SQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            S  E W  +     +   P    +  ++N Y + G+ H+A  +  +M   G+ P+   YT
Sbjct  95   SMKEAWEILEEMGYKGFTPDEVTYNTLLNGYCKEGNFHQALVIHAEMVRNGVSPSVVTYT  154

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L  +   +R++  A+    +M   G+  +  TY+ ++ GF++ G +  A     E  E 
Sbjct  155  ALINSMCKARNLNRAMEFFDQMRIRGLRPNERTYTTLIDGFSRQGLLNEAYRILNEMTES  214

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
              + S   Y   I+ +C    M+ A  +++EM E+G+A  +  + T++ G+      ++ 
Sbjct  215  GFSPSVVTYNAFIHGHCVLERMEEALGVVQEMVEKGLAPDVVSYSTIISGFCRKGELDRA  274

Query  66   LLMFDRLKECGFTPSVISYGCL  1
              M   + E G +P  ++Y  L
Sbjct  275  FQMKQEMVEKGVSPDAVTYSSL  296


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   + +++N   R G    A E+ E+M  +G  P    Y  L   Y    +  +AL 
Sbjct  77   QPNLISYNVIINGLCREGSMKEAWEILEEMGYKGFTPDEVTYNTLLNGYCKEGNFHQALV  136

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M   G+  SVVTY+ ++    K  N+  A  +F + + R    +   Y  +I    
Sbjct  137  IHAEMVRNGVSPSVVTYTALINSMCKARNLNRAMEFFDQMRIRGLRPNERTYTTLIDGFS  196

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++ A  +L EM E G +  +  ++  + G+ +    E+ L +   + E G  P V+
Sbjct  197  RQGLLNEAYRILNEMTESGFSPSVVTYNAFIHGHCVLERMEEALGVVQEMVEKGLAPDVV  256

Query  15   SYGCL  1
            SY  +
Sbjct  257  SYSTI  261


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/181 (24%), Positives = 82/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y + G    A  + + M S+G+ P    Y  +         M+EA   
Sbjct  43   PNVVTYNTLIDAYCKMGRIDEAFGLLKSMSSKGMQPNLISYNVIINGLCREGSMKEAWEI  102

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M  +G     VTY+ ++ G+ K GN   A     E      + S   Y  +I + C+
Sbjct  103  LEEMGYKGFTPDEVTYNTLLNGYCKEGNFHQALVIHAEMVRNGVSPSVVTYTALINSMCK  162

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N++RA E   +M   G+      + T++DG++      +   + + + E GF+PSV++
Sbjct  163  ARNLNRAMEFFDQMRIRGLRPNERTYTTLIDGFSRQGLLNEAYRILNEMTESGFSPSVVT  222

Query  12   Y  10
            Y
Sbjct  223  Y  223


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 74/156 (47%), Gaps = 1/156 (1%)
 Frame = -2

Query  468  MRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGN  289
            +RSR + P  Y Y  L   +    ++++ L C  +M   G   +VVTY+ ++  + K+G 
Sbjct  2    IRSR-VSPNVYTYNILIRGFCSVGELQKGLGCFGEMERNGCLPNVVTYNTLIDAYCKMGR  60

Query  288  VEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHT  109
            ++ A         +    +   Y  II   C+  +M  A E+L EM  +G       ++T
Sbjct  61   IDEAFGLLKSMSSKGMQPNLISYNVIINGLCREGSMKEAWEILEEMGYKGFTPDEVTYNT  120

Query  108  MMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +++GY    N  + L++   +   G +PSV++Y  L
Sbjct  121  LLNGYCKEGNFHQALVIHAEMVRNGVSPSVVTYTAL  156



>ref|XP_011009008.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, 
mitochondrial [Populus euphratica]
 ref|XP_011009010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, 
mitochondrial [Populus euphratica]
Length=748

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 4/202 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N  A  + F+ + K    P    + +++    R G    A ++F KM SRG+ P    YT
Sbjct  373  NIQAAYKLFDEMEKQRIVPDFIAYTVVICGLFRCGKMMEADKVFNKMFSRGVEPDEVTYT  432

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L   Y  S +ME+A +   +M   G+  +VVTY+ +  G  K+G V+ A     E   +
Sbjct  433  TLIDGYCKSGEMEKAFSLHNQMVQSGLTPNVVTYTALADGLCKLGQVDTANELLHEMCGK  492

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L+   Y +++   C++ N+ +A +L+ EME  G+ A    F T+MD Y  T    K 
Sbjct  493  GLQLNICTYNSLVNGLCKSGNIRQAVKLMEEMEVAGMHADTITFTTLMDAYCKTGEMVKA  552

Query  66   LLMFDRLKECGFTPSVISYGCL  1
              +   + + G  P+V+++  L
Sbjct  553  HELLREMLDRGLQPTVVTFNVL  574


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 94/188 (50%), Gaps = 0/188 (0%)
 Frame = -2

Query  564  RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEE  385
            R + P    +  ++N Y   G+  +  ++ ++M+ +G+ P  Y Y ++      S  +++
Sbjct  282  RGDAPDVVSYSTVINGYCLGGELQKVLKLIQEMQMKGLKPNLYTYNSIILLLCKSGKVDD  341

Query  384  ALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIY  205
            A   +R+M ++ I    V Y+ ++ GF K+GN++AA   F E +++        Y  +I 
Sbjct  342  AERVLREMINQRIVPDTVVYTTLIDGFCKLGNIQAAYKLFDEMEKQRIVPDFIAYTVVIC  401

Query  204  ANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTP  25
               +   M  A+++  +M   G+      + T++DGY  +   EK   + +++ + G TP
Sbjct  402  GLFRCGKMMEADKVFNKMFSRGVEPDEVTYTTLIDGYCKSGEMEKAFSLHNQMVQSGLTP  461

Query  24   SVISYGCL  1
            +V++Y  L
Sbjct  462  NVVTYTAL  469


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 88/177 (50%), Gaps = 0/177 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +VN   + G+  +A ++ E+M   G+   +  +T L  AY  + +M +A   +R+M 
Sbjct  501  YNSLVNGLCKSGNIRQAVKLMEEMEVAGMHADTITFTTLMDAYCKTGEMVKAHELLREML  560

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            D G++ +VVT+++++ GF   G +E  E       E+    + + Y +++  +C   NM 
Sbjct  561  DRGLQPTVVTFNVLMNGFCMSGMLEDGERLLAWMLEKGIMPNTTTYNSLMKQHCIRNNMR  620

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYG  7
             A E+ + M   G+    + ++ ++ G+   RN ++   +   + E GF  +  SY 
Sbjct  621  GATEIYKGMCARGVMPDSNTYNILIKGHCKARNMKEAWFLHKEMAEKGFNLTASSYN  677


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 89/192 (46%), Gaps = 0/192 (0%)
 Frame = -2

Query  576  RAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSR  397
            + F R  +P    +  +++ Y + G+  +A  +  +M   G+ P    YT L        
Sbjct  418  KMFSRGVEPDEVTYTTLIDGYCKSGEMEKAFSLHNQMVQSGLTPNVVTYTALADGLCKLG  477

Query  396  DMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYG  217
             ++ A   + +M  +G+++++ TY+ +V G  K GN+  A     E +          + 
Sbjct  478  QVDTANELLHEMCGKGLQLNICTYNSLVNGLCKSGNIRQAVKLMEEMEVAGMHADTITFT  537

Query  216  NIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC  37
             ++ A C+T  M +A ELLREM + G+   +  F+ +M+G+ ++   E    +   + E 
Sbjct  538  TLMDAYCKTGEMVKAHELLREMLDRGLQPTVVTFNVLMNGFCMSGMLEDGERLLAWMLEK  597

Query  36   GFTPSVISYGCL  1
            G  P+  +Y  L
Sbjct  598  GIMPNTTTYNSL  609



>emb|CDM84948.1| unnamed protein product [Triticum aestivum]
Length=347

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 91/183 (50%), Gaps = 0/183 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS   F ++V+ YG+ G    A     ++R+ G  P +  Y  L   +  +RD+  A  
Sbjct  112  RPSIVTFNLLVDGYGKAGQMSNAVHFSNQIRAAGYQPNTLTYNALIAGFCRARDIARANR  171

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
                M + G+  + VTY+I++   A+ G+++ A   F + ++    +    YG +++A C
Sbjct  172  AFSDMKERGLTPTNVTYTILIDALARGGDMDKAFEMFADMEKAGLEVDVRTYGVLVHALC  231

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                M  A +L + MEE+G+ A   I+  M+ GY    N  K + +   +++ G  P++ 
Sbjct  232  MEGKMKDARKLFQSMEEKGVKANGVIYDMMIFGYGREGNSYKAMKLITEMRKNGLVPNIA  291

Query  15   SYG  7
            SYG
Sbjct  292  SYG  294


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 86/185 (46%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   + ++V  + R G+   AR +F++M  +G+   +  Y  L         M++A  
Sbjct  42   EPNIYTYNVLVGEWCRTGEFEGARRLFDEMPVKGVARNAVSYNTLIAGLCRHGKMKDAAR  101

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M  EGI  S+VT++++V G+ K G +  A H+  + +      +   Y  +I   C
Sbjct  102  LLEMMRKEGIRPSIVTFNLLVDGYGKAGQMSNAVHFSNQIRAAGYQPNTLTYNALIAGFC  161

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  ++ RA     +M+E G+      +  ++D      + +K   MF  +++ G    V 
Sbjct  162  RARDIARANRAFSDMKERGLTPTNVTYTILIDALARGGDMDKAFEMFADMEKAGLEVDVR  221

Query  15   SYGCL  1
            +YG L
Sbjct  222  TYGVL  226


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 71/156 (46%), Gaps = 0/156 (0%)
 Frame = -2

Query  468  MRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGN  289
            M   G+ P    +T L + + V    +E      +M   G+E ++ TY+++VG + + G 
Sbjct  1    MPRLGLAPNEVTFTALIHGHFVRGRRDEGFALFEEMRRGGVEPNIYTYNVLVGEWCRTGE  60

Query  288  VEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHT  109
             E A   F E   +    +A  Y  +I   C+   M  A  LL  M +EGI   I  F+ 
Sbjct  61   FEGARRLFDEMPVKGVARNAVSYNTLIAGLCRHGKMKDAARLLEMMRKEGIRPSIVTFNL  120

Query  108  MMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            ++DGY         +   ++++  G+ P+ ++Y  L
Sbjct  121  LVDGYGKAGQMSNAVHFSNQIRAAGYQPNTLTYNAL  156



>ref|XP_008451225.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Cucumis melo]
Length=569

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 97/185 (52%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   + ++++   + G +  A E+FE+M+++G++P    Y++L + +  +R  EE+  
Sbjct  183  KPNVFNYNIIIDGLCKVGREDEANELFEEMKAQGMIPNVISYSSLIHGFCCARKWEESKR  242

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M D+G++   VT+S+++    K G V  A+  F    +R       IY +++   C
Sbjct  243  LFDEMVDQGVQPDKVTFSVLIDTLCKEGKVIEAKKLFEVMIQRGIVPDLFIYSSLMEGFC  302

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
               +++ A EL   M  +G    +  +  +++GY  T   E+ + +++ +   G  P+VI
Sbjct  303  MVGDLNSARELFVSMPSKGCEPDVISYTVLINGYCKTLKVEEAMKLYNEMLLVGKRPNVI  362

Query  15   SYGCL  1
            +YG L
Sbjct  363  TYGAL  367


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 78/165 (47%), Gaps = 0/165 (0%)
 Frame = -2

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD + ARE+F  M S+G  P    YT L   Y  +  +EEA+    +M   G   +V+TY
Sbjct  305  GDLNSARELFVSMPSKGCEPDVISYTVLINGYCKTLKVEEAMKLYNEMLLVGKRPNVITY  364

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
              ++ G    G V  A+  F   K R  + ++ IYG I+   C+   +  A +L  E++ 
Sbjct  365  GALLTGLFLAGKVGDAKKLFSAMKARGISANSHIYGIILDGLCKNGCLFEAMKLFTELKS  424

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
                  I  +  ++DG       E    +F++L + G  P+V++Y
Sbjct  425  YNFKLDIETYSCLIDGLCKEGKLETAWELFEKLSQEGLQPNVVTY  469


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 77/166 (46%), Gaps = 6/166 (4%)
 Frame = -2

Query  480  MFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFA  301
            ++ KMR  G+ P++     L         + EAL  +  +   G   +VVTY+ ++ G  
Sbjct  62   LYNKMRLAGLSPSAITLNILVNCLCNVNRVSEALAGMAGLLRRGYIPNVVTYTTLIKGLC  121

Query  300  KVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeel----lremeeEGIA  133
                +  A   FL  ++   T +   YG ++   CQT N++ A +L    L +  + GI 
Sbjct  122  MEHRISEATRLFLRMQKLGCTPNVVTYGTLVKGLCQTGNVNIALKLHQEMLNDTSQYGIN  181

Query  132  APISIF--HTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
               ++F  + ++DG      E++   +F+ +K  G  P+VISY  L
Sbjct  182  CKPNVFNYNIIIDGLCKVGREDEANELFEEMKAQGMIPNVISYSSL  227


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/154 (23%), Positives = 73/154 (47%), Gaps = 0/154 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +G ++      G    A+++F  M++RGI   S+ Y  +      +  + EA+ 
Sbjct  358  RPNVITYGALLTGLFLAGKVGDAKKLFSAMKARGISANSHIYGIILDGLCKNGCLFEAMK  417

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               ++     ++ + TYS ++ G  K G +E A   F +  +     +   Y  +I+  C
Sbjct  418  LFTELKSYNFKLDIETYSCLIDGLCKEGKLETAWELFEKLSQEGLQPNVVTYSIMIHGLC  477

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGY  94
            +   +D+A  L+++ME  G    I  ++T+M G+
Sbjct  478  REGQVDKANVLIQKMETNGCNPNIITYNTLMRGF  511



>ref|XP_007217681.1| hypothetical protein PRUPE_ppa021203mg [Prunus persica]
 gb|EMJ18880.1| hypothetical protein PRUPE_ppa021203mg [Prunus persica]
Length=368

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 97/187 (52%), Gaps = 0/187 (0%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
             ER  +P+   +  +++ Y  RG+   AR++F+ M S+G++   + Y+ L   Y   + M
Sbjct  143  IERDIQPNTVTYNSLMDGYCLRGEMSEARKVFKLMLSKGLMVDVFNYSTLINGYCKRKMM  202

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
            +EA+T +R+M+ +G+  + VTYS +V G  KVG +  A+  F E ++         Y  +
Sbjct  203  DEAMTLLREMSRKGLVPNTVTYSTLVDGCCKVGKLGDAQKLFSEMQDCGQLPDVQTYAVL  262

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            +   C+   +  A +L +EME + + A I I+  +++G  I    E    +F  L   G 
Sbjct  263  LDGLCKNRQLSTAIQLFKEMEGKKLDADIVIYSILIEGLCIAEKFESAWELFFGLSSRGL  322

Query  30   TPSVISY  10
             P+V +Y
Sbjct  323  QPNVRTY  329


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/185 (21%), Positives = 78/185 (42%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  ++    +      A  +  +M S+GI P    YT+L +        +EA  
Sbjct  43   KPGLVVYNTIIGSLCKDKLVDDALNLLSEMMSKGIAPNVITYTSLIHGVCKLGKWKEAKG  102

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M  + +   V T+S++V    K G V  AE       ER    +   Y +++   C
Sbjct  103  LLNEMVSKNVFPDVCTFSVLVDTLCKEGMVGEAEGVVKMMIERDIQPNTVTYNSLMDGYC  162

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                M  A ++ + M  +G+   +  + T+++GY   +  ++ + +   +   G  P+ +
Sbjct  163  LRGEMSEARKVFKLMLSKGLMVDVFNYSTLINGYCKRKMMDEAMTLLREMSRKGLVPNTV  222

Query  15   SYGCL  1
            +Y  L
Sbjct  223  TYSTL  227



>ref|XP_008228917.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, 
mitochondrial [Prunus mume]
 ref|XP_008228918.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, 
mitochondrial [Prunus mume]
 ref|XP_008228920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, 
mitochondrial [Prunus mume]
Length=742

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/275 (23%), Positives = 118/275 (43%), Gaps = 13/275 (5%)
 Frame = -2

Query  819  DRNMGFGFVIYGGSSPEKSAIKAVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEG  640
            D+ + +G VI   S      + +  FDG+E   +      + G             W   
Sbjct  205  DKLLSYGLVISVDSCNLFLTLLSSTFDGIEMAIKFFNEYYEVG-----------VHWNTA  253

Query  639  SSSRNFRKV--LESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKM  466
            S +     +  L    E  H +++   R   P    +  +++ Y   G+  +  ++ E+M
Sbjct  254  SYNIIIHSLCRLGKIKEAHHLLLQMELRGCIPDVVSYSTLISRYCYDGELQKVLKLIEEM  313

Query  465  RSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNV  286
            + +G+ P +Y Y ++      +  + EA   +R+M   G+    V Y+ ++ GF K+GN+
Sbjct  314  KIKGLKPNAYTYNSIILLLCKTGKLSEAEVILREMMALGVLPDNVVYTTLIDGFCKMGNI  373

Query  285  EAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTM  106
            +AA   F E + R        Y  II+  CQT  M  A+ L  EM   G+      +  +
Sbjct  374  QAACRLFDEMRLRKVIPDYITYTAIIHGFCQTGKMAEADNLFHEMVSRGLEPDEVTYTAL  433

Query  105  MDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +DGY      ++   + +++   G +P+V++Y  L
Sbjct  434  IDGYCKVGEMKEAFSLHNQMVSMGLSPNVVTYTAL  468


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 95/202 (47%), Gaps = 4/202 (2%)
 Frame = -2

Query  594  NWHAVVRAFE--RINK--PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N  A  R F+  R+ K  P    +  +++ + + G    A  +F +M SRG+ P    YT
Sbjct  372  NIQAACRLFDEMRLRKVIPDYITYTAIIHGFCQTGKMAEADNLFHEMVSRGLEPDEVTYT  431

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L   Y    +M+EA +   +M   G+  +VVTY+ +  G  K G V+ A     E   +
Sbjct  432  ALIDGYCKVGEMKEAFSLHNQMVSMGLSPNVVTYTALADGLCKQGEVDIANELLQEMCRK  491

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
               L+   Y +I+   C++ N+ +AE+L+ +M+  G       + T+MD Y   R   K 
Sbjct  492  GLQLNVFTYNSIVNGLCKSGNIAQAEKLMEQMQVAGPHPDTVTYTTLMDAYCKIREMAKA  551

Query  66   LLMFDRLKECGFTPSVISYGCL  1
              +   + + G  P+V+++  L
Sbjct  552  HNVLREMLDRGLQPTVVTFNVL  573


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 87/179 (49%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +VN   + G+  +A ++ E+M+  G  P +  YT L  AY   R+M +A   +R+M 
Sbjct  500  YNSIVNGLCKSGNIAQAEKLMEQMQVAGPHPDTVTYTTLMDAYCKIREMAKAHNVLREML  559

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            D G++ +VVT+++++ GF   G +E  E       E+    +A  Y +++   C   NM 
Sbjct  560  DRGLQPTVVTFNVLMNGFCMSGMLEDGERLLKWMLEKGIVPNAGTYNSLMKQYCIRNNMR  619

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
               ++ R M   G+    + ++ ++ G+   RN ++   +   +   GF P+   Y  L
Sbjct  620  TTTDMYRSMCAGGVMPDNNSYNILIKGHCKARNMKEAWFLHKEMAGKGFIPTASCYSAL  678



>emb|CBI21003.3| unnamed protein product [Vitis vinifera]
Length=837

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 95/185 (51%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   + ++++   ++GD  +A ++F++M S  I PT + +  +         M EA  
Sbjct  496  KPNVVTYSILIDGNFKKGDSEKALDLFDQMLSLNIAPTDFTFNTIINGLCKVGQMSEARD  555

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             ++   +EG   S +TY+ IV GF K GN+++A   + E  E   + +   Y ++I   C
Sbjct  556  KLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSLINGFC  615

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  +D A +   EM E+G+   ++ +  ++DG+   R+ E    +F  L E G +P+ I
Sbjct  616  KSNRIDLALKTRDEMREKGLELDVTAYSALIDGFCKRRDMESAQDLFFELLEVGLSPNRI  675

Query  15   SYGCL  1
             Y  +
Sbjct  676  VYNSM  680


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 84/169 (50%), Gaps = 0/169 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   F  ++N   + G    AR+  +     G +P+   Y ++   +    +++ AL  
Sbjct  532  PTDFTFNTIINGLCKVGQMSEARDKLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAV  591

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M + G+  +VVTY+ ++ GF K   ++ A     E +E+   L  + Y  +I   C+
Sbjct  592  YREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKTRDEMREKGLELDVTAYSALIDGFCK  651

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
              +M+ A++L  E+ E G++    ++++M+ G+    N E  L+ + ++
Sbjct  652  RRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRDLNNMEAALVWYKKM  700


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 86/179 (48%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +M+++  + G    A  + + M ++G+VP    Y ++   +    +M+ A +    M 
Sbjct  432  YNIMMSWLCKGGKMDEACSLLDNMVNQGMVPNVVSYNDMILGHCRKGNMDMASSVFSDML  491

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
               ++ +VVTYSI++ G  K G+ E A   F +    +   +   +  II   C+   M 
Sbjct  492  ARDLKPNVVTYSILIDGNFKKGDSEKALDLFDQMLSLNIAPTDFTFNTIINGLCKVGQMS  551

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A + L+   EEG       +++++DG+    N +  L ++  + E G +P+V++Y  L
Sbjct  552  EARDKLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSL  610


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/178 (24%), Positives = 88/178 (49%), Gaps = 0/178 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER  K     + +++    ++ + +   E+ E+M+ RG VP+   +T++  A     +M 
Sbjct  248  ERGVKLDAGAYSIIIQAVCKKPNSNLGLELLEEMKERGWVPSEATFTSVIVACVAQGNMV  307

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EAL    +M + G  +++V  + ++ G+   GN+++A + F +  E     +   Y  +I
Sbjct  308  EALRLKEEMINCGKPMNLVVATSLMKGYCAQGNLDSALNLFNKITEDGLFPNKVTYSVLI  367

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECG  34
               C + N+++A EL  +M+  GI   +   ++++ GY      E+   +FD   +CG
Sbjct  368  EGCCNSGNIEKASELYTQMKLNGIPPSVFNVNSLLRGYLKAPLWEEASKLFDEAVDCG  425


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 88/187 (47%), Gaps = 6/187 (3%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +  +V+ + + G+   A  ++ +M   G+ P    YT+L   +  S  ++ AL  
Sbjct  567  PSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKT  626

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+E+ V  YS ++ GF K  ++E+A+  F E  E   + +  +Y ++I     
Sbjct  627  RDEMREKGLELDVTAYSALIDGFCKRRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRD  686

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC---GFTPS  22
              NM+ A    ++M  + I   +  + T++DG      E + +   D   E    G  P 
Sbjct  687  LNNMEAALVWYKKMINDRIPCDLGTYTTLIDGLL---KEGRLVFASDLYMEMLSKGIVPD  743

Query  21   VISYGCL  1
            +I++  L
Sbjct  744  IITFHVL  750


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 85/179 (47%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +++ + +R D   A+++F ++   G+ P    Y ++   +    +ME AL   +KM 
Sbjct  642  YSALIDGFCKRRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRDLNNMEAALVWYKKMI  701

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++ I   + TY+ ++ G  K G +  A   ++E   +        +  ++   C    ++
Sbjct  702  NDRIPCDLGTYTTLIDGLLKEGRLVFASDLYMEMLSKGIVPDIITFHVLVNGLCNKGQLE  761

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A ++L EM+ + +   + I++T++ GY    N ++   + D + + G  P  ++Y  L
Sbjct  762  NARKILEEMDRKNMTPSVLIYNTLIAGYFREGNLKEAFTLHDEMLDRGLVPDDVTYDIL  820


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 73/170 (43%), Gaps = 0/170 (0%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            RR      R+++ KM  RGI    +    +  A      +EEA    R+  + G+++   
Sbjct  197  RRNMIGELRDLYNKMVLRGIYGDHFTVHVMVRACLKEGRVEEAEEYFRETKERGVKLDAG  256

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
             YSII+    K  N         E KER    S + + ++I A     NM  A  L  EM
Sbjct  257  AYSIIIQAVCKKPNSNLGLELLEEMKERGWVPSEATFTSVIVACVAQGNMVEALRLKEEM  316

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
               G    + +  ++M GY    N +  L +F+++ E G  P+ ++Y  L
Sbjct  317  INCGKPMNLVVATSLMKGYCAQGNLDSALNLFNKITEDGLFPNKVTYSVL  366


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 80/184 (43%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  M+  + R+G+   A  +F  M +R + P    Y+ L        D E+AL  
Sbjct  462  PNVVSYNDMILGHCRKGNMDMASSVFSDMLARDLKPNVVTYSILIDGNFKKGDSEKALDL  521

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M    I  +  T++ I+ G  KVG +  A        E     S   Y +I+    +
Sbjct  522  FDQMLSLNIAPTDFTFNTIINGLCKVGQMSEARDKLKNFLEEGFIPSCMTYNSIVDGFIK  581

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+D A  + REM E G++  +  + ++++G+  +   +  L   D ++E G    V +
Sbjct  582  EGNIDSALAVYREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKTRDEMREKGLELDVTA  641

Query  12   YGCL  1
            Y  L
Sbjct  642  YSAL  645



>ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X3 [Vitis vinifera]
Length=1204

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 95/185 (51%), Gaps = 0/185 (0%)
 Frame = -2

Query  555   KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
             KP+   + ++++   ++GD  +A ++F++M S  I PT + +  +         M EA  
Sbjct  863   KPNVVTYSILIDGNFKKGDSEKALDLFDQMLSLNIAPTDFTFNTIINGLCKVGQMSEARD  922

Query  375   CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              ++   +EG   S +TY+ IV GF K GN+++A   + E  E   + +   Y ++I   C
Sbjct  923   KLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSLINGFC  982

Query  195   QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
             ++  +D A +   EM E+G+   ++ +  ++DG+   R+ E    +F  L E G +P+ I
Sbjct  983   KSNRIDLALKTRDEMREKGLELDVTAYSALIDGFCKRRDMESAQDLFFELLEVGLSPNRI  1042

Query  15    SYGCL  1
              Y  +
Sbjct  1043  VYNSM  1047


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 84/169 (50%), Gaps = 0/169 (0%)
 Frame = -2

Query  552   PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
             P+   F  ++N   + G    AR+  +     G +P+   Y ++   +    +++ AL  
Sbjct  899   PTDFTFNTIINGLCKVGQMSEARDKLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAV  958

Query  372   VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              R+M + G+  +VVTY+ ++ GF K   ++ A     E +E+   L  + Y  +I   C+
Sbjct  959   YREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKTRDEMREKGLELDVTAYSALIDGFCK  1018

Query  192   TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
               +M+ A++L  E+ E G++    ++++M+ G+    N E  L+ + ++
Sbjct  1019  RRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRDLNNMEAALVWYKKM  1067


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 86/179 (48%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +M+++  + G    A  + + M ++G+VP    Y ++   +    +M+ A +    M 
Sbjct  799  YNIMMSWLCKGGKMDEACSLLDNMVNQGMVPNVVSYNDMILGHCRKGNMDMASSVFSDML  858

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
               ++ +VVTYSI++ G  K G+ E A   F +    +   +   +  II   C+   M 
Sbjct  859  ARDLKPNVVTYSILIDGNFKKGDSEKALDLFDQMLSLNIAPTDFTFNTIINGLCKVGQMS  918

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A + L+   EEG       +++++DG+    N +  L ++  + E G +P+V++Y  L
Sbjct  919  EARDKLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSL  977


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 85/168 (51%), Gaps = 0/168 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++    ++ + +   E+ E+M+ RG VP+   +T++  A     +M EAL    +M 
Sbjct  625  YSIIIQAVCKKPNSNLGLELLEEMKERGWVPSEATFTSVIVACVAQGNMVEALRLKEEMI  684

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            + G  +++V  + ++ G+   GN+++A + F +  E     +   Y  +I   C + N++
Sbjct  685  NCGKPMNLVVATSLMKGYCAQGNLDSALNLFNKITEDGLFPNKVTYSVLIEGCCNSGNIE  744

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECG  34
            +A EL  +M+  GI   +   ++++ GY      E+   +FD   +CG
Sbjct  745  KASELYTQMKLNGIPPSVFNVNSLLRGYLKAPLWEEASKLFDEAVDCG  792


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 88/187 (47%), Gaps = 6/187 (3%)
 Frame = -2

Query  552   PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
             PS   +  +V+ + + G+   A  ++ +M   G+ P    YT+L   +  S  ++ AL  
Sbjct  934   PSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKT  993

Query  372   VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               +M ++G+E+ V  YS ++ GF K  ++E+A+  F E  E   + +  +Y ++I     
Sbjct  994   RDEMREKGLELDVTAYSALIDGFCKRRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRD  1053

Query  192   TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC---GFTPS  22
               NM+ A    ++M  + I   +  + T++DG      E + +   D   E    G  P 
Sbjct  1054  LNNMEAALVWYKKMINDRIPCDLGTYTTLIDGLL---KEGRLVFASDLYMEMLSKGIVPD  1110

Query  21    VISYGCL  1
             +I++  L
Sbjct  1111  IITFHVL  1117


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 85/179 (47%), Gaps = 0/179 (0%)
 Frame = -2

Query  537   FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
             +  +++ + +R D   A+++F ++   G+ P    Y ++   +    +ME AL   +KM 
Sbjct  1009  YSALIDGFCKRRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRDLNNMEAALVWYKKMI  1068

Query  357   DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
             ++ I   + TY+ ++ G  K G +  A   ++E   +        +  ++   C    ++
Sbjct  1069  NDRIPCDLGTYTTLIDGLLKEGRLVFASDLYMEMLSKGIVPDIITFHVLVNGLCNKGQLE  1128

Query  177   RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              A ++L EM+ + +   + I++T++ GY    N ++   + D + + G  P  ++Y  L
Sbjct  1129  NARKILEEMDRKNMTPSVLIYNTLIAGYFREGNLKEAFTLHDEMLDRGLVPDDVTYDIL  1187


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 73/170 (43%), Gaps = 0/170 (0%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            RR      R+++ KM  RGI    +    +  A      +EEA    R+  + G+++   
Sbjct  564  RRNMIGELRDLYNKMVLRGIYGDHFTVHVMVRACLKEGRVEEAEEYFRETKERGVKLDAG  623

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
             YSII+    K  N         E KER    S + + ++I A     NM  A  L  EM
Sbjct  624  AYSIIIQAVCKKPNSNLGLELLEEMKERGWVPSEATFTSVIVACVAQGNMVEALRLKEEM  683

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
               G    + +  ++M GY    N +  L +F+++ E G  P+ ++Y  L
Sbjct  684  INCGKPMNLVVATSLMKGYCAQGNLDSALNLFNKITEDGLFPNKVTYSVL  733


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 80/184 (43%), Gaps = 0/184 (0%)
 Frame = -2

Query  552   PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
             P+   +  M+  + R+G+   A  +F  M +R + P    Y+ L        D E+AL  
Sbjct  829   PNVVSYNDMILGHCRKGNMDMASSVFSDMLARDLKPNVVTYSILIDGNFKKGDSEKALDL  888

Query  372   VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               +M    I  +  T++ I+ G  KVG +  A        E     S   Y +I+    +
Sbjct  889   FDQMLSLNIAPTDFTFNTIINGLCKVGQMSEARDKLKNFLEEGFIPSCMTYNSIVDGFIK  948

Query  192   TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               N+D A  + REM E G++  +  + ++++G+  +   +  L   D ++E G    V +
Sbjct  949   EGNIDSALAVYREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKTRDEMREKGLELDVTA  1008

Query  12    YGCL  1
             Y  L
Sbjct  1009  YSAL  1012



>ref|XP_010931310.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
 ref|XP_010931311.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
 ref|XP_010931312.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
 ref|XP_010931313.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
 ref|XP_010931314.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
 ref|XP_010931315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, 
chloroplastic-like [Elaeis guineensis]
Length=824

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F  +++ Y R  + H+A+   +++ S G+ P S  Y +L   Y+    + EA   
Sbjct  583  PDLFTFSTIIDGYCRAKEVHKAKVYLKELASWGLEPNSVIYNSLIGGYSRDGKIAEASNL  642

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M  +GIE + VTY  ++ G   VG VE A+++ ++ KE    L+   Y  +I   C+
Sbjct  643  LDEMKSKGIEPTSVTYCTLMHGMCDVGRVEEAKNFIVKMKEDGLELNVVSYTTLIDGYCK  702

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               MD A +++ EM   G+A     +  +M GY    N +    + D + + G  P  I+
Sbjct  703  IGQMDEASKVIEEMHASGLAPNKVTYTILMRGYCNMANYDAAAKLLDEMLDNGIVPDAIT  762

Query  12   YGCL  1
            Y  L
Sbjct  763  YNTL  766


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 89/185 (48%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++  Y R G    A  + ++M+S+GI PTS  Y  L +       +EEA  
Sbjct  617  EPNSVIYNSLIGGYSRDGKIAEASNLLDEMKSKGIEPTSVTYCTLMHGMCDVGRVEEAKN  676

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM ++G+E++VV+Y+ ++ G+ K+G ++ A     E        +   Y  ++   C
Sbjct  677  FIVKMKEDGLELNVVSYTTLIDGYCKIGQMDEASKVIEEMHASGLAPNKVTYTILMRGYC  736

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
               N D A +LL EM + GI      ++T+M G+      E+   + DR+ +       +
Sbjct  737  NMANYDAAAKLLDEMLDNGIVPDAITYNTLMSGFCKEGRMEEAFKISDRMTQENMVLDEV  796

Query  15   SYGCL  1
            SY  L
Sbjct  797  SYTTL  801


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 93/190 (49%), Gaps = 3/190 (2%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER   PS K     ++   R  D   AR +F++MR + +V  +Y YT +      + +++
Sbjct  193  ERGLCPSLKTCNFFLSSLARANDCKNARMVFDRMR-QFVVLDAYSYTPVIDVLCKNHEVD  251

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EA+T   +M   GI  +VVTY++++ G  K    + A   F E   R +   + +  N++
Sbjct  252  EAITLFSEMESAGIRPTVVTYNVLIDGLCKKRWFDVA-FCFKEKMVRSSVKPSVVTFNVL  310

Query  207  YANCQTCN-MDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
                  CN    AE +L+EM+E  IA    I++T++DG+       + L + D +   G 
Sbjct  311  INGLVKCNRFGDAESVLKEMDEMSIAPNEFIYNTLIDGHCRMGQSSEALNLRDEMVAKGM  370

Query  30   TPSVISYGCL  1
             P+ ++Y  L
Sbjct  371  EPNSVTYNAL  380


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/185 (17%), Positives = 91/185 (49%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  +++     G       +  ++++ G+VP  + ++ +   Y  ++++ +A  
Sbjct  547  KPDIITYNTLIHGLCNLGRMEETIGLLHELKNEGLVPDLFTFSTIIDGYCRAKEVHKAKV  606

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             ++++   G+E + V Y+ ++GG+++ G +  A +   E K +    ++  Y  +++  C
Sbjct  607  YLKELASWGLEPNSVIYNSLIGGYSRDGKIAEASNLLDEMKSKGIEPTSVTYCTLMHGMC  666

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                ++ A+  + +M+E+G+   +  + T++DGY      ++   + + +   G  P+ +
Sbjct  667  DVGRVEEAKNFIVKMKEDGLELNVVSYTTLIDGYCKIGQMDEASKVIEEMHASGLAPNKV  726

Query  15   SYGCL  1
            +Y  L
Sbjct  727  TYTIL  731



>ref|XP_006346446.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006346447.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
isoform X2 [Solanum tuberosum]
Length=767

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++N   + G  HRA E F+++ +RG+ P    YT L   ++    M EA   
Sbjct  355  PDVVTYTSLINSMCKTGSLHRAMEFFDQLHARGLYPNDRTYTTLIVGFSQQGLMNEAYKL  414

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M   G+  S+VTY+ ++ G   VG +E A     E ++R        Y  II   C+
Sbjct  415  LNEMISNGLSPSIVTYNALINGHCAVGRMEDALRVTQEMEQRRLVPDVVTYSTIISGFCR  474

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
             C ++RA  + + M E+G+   +  + +++ G    +   +   +F  +   G  P   +
Sbjct  475  NCGLERAFCVKQLMVEKGVLPDVITYSSLIQGLCEQQRLTEACELFQEMLRVGLQPDKFT  534

Query  12   YGCL  1
            Y  L
Sbjct  535  YTTL  538


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 77/168 (46%), Gaps = 0/168 (0%)
 Frame = -2

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            G    A++ ++ M   G+ P  Y Y  +        D+++ L    +M   G   +VVTY
Sbjct  196  GSFELAQKFYDDMVQSGVSPNVYTYNIMIRGLCAKGDLQKGLVVFNEMEKTGCLRNVVTY  255

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            + I+GG+ K+G V+ A       + R+   +   Y  II   C+   M    E+L EM  
Sbjct  256  NTIIGGYCKIGKVDEAVELLKLMQVRNLEPTVVTYNAIINGLCREGRMKETSEILEEMRG  315

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             G+      ++T+++GY    N  + L++   +   G +P V++Y  L
Sbjct  316  NGLMPDEVTYNTLVNGYCREGNFHQALVLHSEMLRNGLSPDVVTYTSL  363



>ref|XP_010518888.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518889.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518890.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518891.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518892.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518893.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518896.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518897.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518898.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518899.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518900.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518901.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518902.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518904.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
Length=537

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 90/176 (51%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +++Y  + G    A  +F KM S GIVP    ++++   Y  +  ++E L    +M+
Sbjct  271  YNTIIDYLCKAGHMEGALNLFGKMSSCGIVPNVVTFSSMINGYCKANRVDEGLNLFYEMS  330

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G+  + +TYS ++ GF +VGN+ AA++ F+E + +        Y  ++   C+    D
Sbjct  331  RRGLVANAITYSTLIQGFYRVGNLGAAQNVFMEMQYKGHRHDLVTYNIVLDGLCKNGKTD  390

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             A  L  ++++ GI   I +   MM G       ++ L++F++L + G  P+VI Y
Sbjct  391  MALCLYNKLDKSGIDLDIPLHSCMMHGLCKVGRVDEALILFNKLLDRGVKPNVIMY  446


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 74/154 (48%), Gaps = 0/154 (0%)
 Frame = -2

Query  471  KMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVG  292
            K+   G  P    YT L + + +   +  AL+ V +M +EG +  VVT+S ++ GF   G
Sbjct  153  KILKLGYEPNVVTYTTLAHGFCIHGKISAALSLVDQMVEEGYKPDVVTFSTLINGFCLEG  212

Query  291  NVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFH  112
             V  A     + ++         +G +I   C+  +   A  LL +MEE  I   I I++
Sbjct  213  RVSEALSLLDQMQKMDCQPDVVTFGIVINGACKARDHALAMNLLEKMEEMHIEINIVIYN  272

Query  111  TMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            T++D      + E  L +F ++  CG  P+V+++
Sbjct  273  TIIDYLCKAGHMEGALNLFGKMSSCGIVPNVVTF  306


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  + + +   G    A  + ++M   G  P    ++ L   + +   + EAL+
Sbjct  160  EPNVVTYTTLAHGFCIHGKISAALSLVDQMVEEGYKPDVVTFSTLINGFCLEGRVSEALS  219

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M     +  VVT+ I++ G  K  +   A +   + +E H  ++  IY  II   C
Sbjct  220  LLDQMQKMDCQPDVVTFGIVINGACKARDHALAMNLLEKMEEMHIEINIVIYNTIIDYLC  279

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M+ A  L  +M   GI   +  F +M++GY      ++ L +F  +   G   + I
Sbjct  280  KAGHMEGALNLFGKMSSCGIVPNVVTFSSMINGYCKANRVDEGLNLFYEMSRRGLVANAI  339

Query  15   SYGCL  1
            +Y  L
Sbjct  340  TYSTL  344



>ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY31434.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=1159

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552   PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
             PS   F +++N   + G    AR+M +K   +G VP    Y ++   +     M  AL  
Sbjct  854   PSDFTFNIIINGLAKVGRTSEARDMLKKFVDKGFVPICLTYNSIINGFVKEGAMNSALAV  913

Query  372   VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              R+M + G+  +VVTY+ ++ GF K  N++ A     E K +   L    +  +I   C+
Sbjct  914   YREMCESGLSPNVVTYTTLINGFCKSHNIDLALKMQYEMKSKGLRLDVPAFSALIDGFCK  973

Query  192   TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +MDRA EL  E+++ G++  + ++++M+ G+    N E  L +  ++   G    + +
Sbjct  974   EQDMDRACELFSELQQVGLSPNVIVYNSMIRGFRNVNNMEAALDLHKKMINEGILCDLQT  1033

Query  12    YGCL  1
             Y  L
Sbjct  1034  YTTL  1037


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 97/190 (51%), Gaps = 0/190 (0%)
 Frame = -2

Query  570   FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
              ER  KP+   + ++++ + ++G+  +A ++F++M    I P+ + +  +          
Sbjct  813   LERGIKPTVITYTILMDGHFKKGNAEQALDVFDEMVGVNITPSDFTFNIIINGLAKVGRT  872

Query  390   EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
              EA   ++K  D+G     +TY+ I+ GF K G + +A   + E  E   + +   Y  +
Sbjct  873   SEARDMLKKFVDKGFVPICLTYNSIINGFVKEGAMNSALAVYREMCESGLSPNVVTYTTL  932

Query  210   IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
             I   C++ N+D A ++  EM+ +G+   +  F  ++DG+   ++ ++   +F  L++ G 
Sbjct  933   INGFCKSHNIDLALKMQYEMKSKGLRLDVPAFSALIDGFCKEQDMDRACELFSELQQVGL  992

Query  30    TPSVISYGCL  1
             +P+VI Y  +
Sbjct  993   SPNVIVYNSM  1002


 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 91/184 (49%), Gaps = 1/184 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P++  + +++ +  R+ +  +A E++ +M+   I PT +   +L   +  +  ++EA   
Sbjct  680  PNKVTYAVLIEWCCRKQNVKKAYELYTEMKLMDIQPTVFNVNSLIRGFLEACSLKEASNL  739

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +  + GI  +V TY++++  F   G V  A   +   ++     + + Y N+I A+C+
Sbjct  740  FDEAVESGIA-NVFTYNVLLYHFCNDGKVNEAHSLWQRMEDNGVVPTYASYNNMILAHCR  798

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NMD A  +  EM E GI   +  +  +MDG+    N E+ L +FD +     TPS  +
Sbjct  799  AGNMDMAHTVFSEMLERGIKPTVITYTILMDGHFKKGNAEQALDVFDEMVGVNITPSDFT  858

Query  12   YGCL  1
            +  +
Sbjct  859  FNII  862


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 91/179 (51%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +++ ++   G  + A  ++++M   G+VPT   Y N+  A+  + +M+ A T   +M 
Sbjct  754  YNVLLYHFCNDGKVNEAHSLWQRMEDNGVVPTYASYNNMILAHCRAGNMDMAHTVFSEML  813

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            + GI+ +V+TY+I++ G  K GN E A   F E    + T S   +  II    +     
Sbjct  814  ERGIKPTVITYTILMDGHFKKGNAEQALDVFDEMVGVNITPSDFTFNIIINGLAKVGRTS  873

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A ++L++  ++G       ++++++G+         L ++  + E G +P+V++Y  L
Sbjct  874  EARDMLKKFVDKGFVPICLTYNSIINGFVKEGAMNSALAVYREMCESGLSPNVVTYTTL  932


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 87/182 (48%), Gaps = 6/182 (3%)
 Frame = -2

Query  537   FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
             +  ++N + + G  + A  ++ +M   G+ P    YT L   +  S +++ AL    +M 
Sbjct  894   YNSIINGFVKEGAMNSALAVYREMCESGLSPNVVTYTTLINGFCKSHNIDLALKMQYEMK  953

Query  357   DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              +G+ + V  +S ++ GF K  +++ A   F E ++   + +  +Y ++I       NM+
Sbjct  954   SKGLRLDVPAFSALIDGFCKEQDMDRACELFSELQQVGLSPNVIVYNSMIRGFRNVNNME  1013

Query  177   RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC---GFTPSVISYG  7
              A +L ++M  EGI   +  + T++DG      E K L  FD   E    G  P +I+Y 
Sbjct  1014  AALDLHKKMINEGILCDLQTYTTLIDGLL---REGKLLFAFDLYSEMLAKGIEPDIITYT  1070

Query  6     CL  1
              L
Sbjct  1071  VL  1072


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/188 (23%), Positives = 90/188 (48%), Gaps = 3/188 (2%)
 Frame = -2

Query  564   RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEE  385
             R++ P+   F  +++ + +  D  RA E+F +++  G+ P    Y ++   +    +ME 
Sbjct  958   RLDVPA---FSALIDGFCKEQDMDRACELFSELQQVGLSPNVIVYNSMIRGFRNVNNMEA  1014

Query  384   ALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIY  205
             AL   +KM +EGI   + TY+ ++ G  + G +  A   + E   +        Y  ++ 
Sbjct  1015  ALDLHKKMINEGILCDLQTYTTLIDGLLREGKLLFAFDLYSEMLAKGIEPDIITYTVLLN  1074

Query  204   ANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTP  25
               C    ++ A ++L EM+ +G+   + I++T++ G     N E+ L + + + + G  P
Sbjct  1075  GLCNKGQLENARKILEEMDRKGMTPSVLIYNTLIAGQFKEGNLEEALRLHNEMLDRGLVP  1134

Query  24    SVISYGCL  1
                +Y  L
Sbjct  1135  DAATYDIL  1142


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 85/170 (50%), Gaps = 1/170 (1%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            ++ D + A  +  +MR RG VP+   +T +  A+    ++ EAL    +M   G ++++V
Sbjct  589  QKPDLNMAGGLLREMRDRGWVPSEGTFTTVIGAFVKQGNLAEALRLKDEMLSCGKQLNLV  648

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
              + ++ G+ K G++ +A + F + KE   T +   Y  +I   C+  N+ +A EL  EM
Sbjct  649  VATSLMKGYCKQGDIGSALYLFNKIKEDGLTPNKVTYAVLIEWCCRKQNVKKAYELYTEM  708

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +   I   +   ++++ G+    + ++   +FD   E G   +V +Y  L
Sbjct  709  KLMDIQPTVFNVNSLIRGFLEACSLKEASNLFDEAVESGIA-NVFTYNVL  757



>ref|XP_007038120.1| Pentatricopeptide repeat superfamily protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007038121.1| Pentatricopeptide repeat superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY22621.1| Pentatricopeptide repeat superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY22622.1| Pentatricopeptide repeat superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=1021

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 89/177 (50%), Gaps = 0/177 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  K + ++++     G  + AR++F ++  +GIVP  + YT+L   +    DM+ AL  
Sbjct  603  PDVKTYTVLIHGLATNGRINDARDVFSQLHGKGIVPDVFTYTSLISGFCKLGDMKAALNL  662

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M  + I  ++VTY+ ++GG  K GN+E A   F E  ++    +   Y  II   C+
Sbjct  663  YKEMCQKSIAPNIVTYNTLIGGLCKAGNIEKARKVFNEISQKALAPNTKSYTMIIDGYCK  722

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
            + N+ +A +LL EM   G+      +  ++DG       EK L +F  +   GF  +
Sbjct  723  SGNLTQAFQLLDEMPSRGVPPDSFAYCALVDGCCKEGKLEKALSLFYEMVRKGFAST  779


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 96/192 (50%), Gaps = 0/192 (0%)
 Frame = -2

Query  585  AVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYT  406
             +V   +R  KP+   +G  ++ Y + G+       F++M++ GI P +  Y+ L  ++ 
Sbjct  522  CLVEMVDRGLKPNAHTYGAFIHGYAKAGEIEAVERCFKEMQNYGIAPNNVIYSELINSHC  581

Query  405  VSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSAS  226
             + ++ EAL+ +R M+++G+   V TY++++ G A  G +  A   F +   +       
Sbjct  582  KAGNVTEALSTLRCMSEQGVVPDVKTYTVLIHGLATNGRINDARDVFSQLHGKGIVPDVF  641

Query  225  IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
             Y ++I   C+  +M  A  L +EM ++ IA  I  ++T++ G     N EK   +F+ +
Sbjct  642  TYTSLISGFCKLGDMKAALNLYKEMCQKSIAPNIVTYNTLIGGLCKAGNIEKARKVFNEI  701

Query  45   KECGFTPSVISY  10
             +    P+  SY
Sbjct  702  SQKALAPNTKSY  713


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 86/185 (46%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   +  ++  + ++     AR + ++M  +G++P       L      ++ M+EA +
Sbjct  462  KPNLVIYTNLIKGHIQKSRFEEARRILDRMMEKGVLPDVICCNTLISGLCKAQKMDEARS  521

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
            C+ +M D G++ +  TY   + G+AK G +EA E  F E +      +  IY  +I ++C
Sbjct  522  CLVEMVDRGLKPNAHTYGAFIHGYAKAGEIEAVERCFKEMQNYGIAPNNVIYSELINSHC  581

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  N+  A   LR M E+G+   +  +  ++ G            +F +L   G  P V 
Sbjct  582  KAGNVTEALSTLRCMSEQGVVPDVKTYTVLIHGLATNGRINDARDVFSQLHGKGIVPDVF  641

Query  15   SYGCL  1
            +Y  L
Sbjct  642  TYTSL  646


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 94/199 (47%), Gaps = 4/199 (2%)
 Frame = -2

Query  585  AVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            AV R F+ +      P+   +  ++N + + G+   A      M  +G+VP    YT L 
Sbjct  553  AVERCFKEMQNYGIAPNNVIYSELINSHCKAGNVTEALSTLRCMSEQGVVPDVKTYTVLI  612

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
            +    +  + +A     +++ +GI   V TY+ ++ GF K+G+++AA + + E  ++   
Sbjct  613  HGLATNGRINDARDVFSQLHGKGIVPDVFTYTSLISGFCKLGDMKAALNLYKEMCQKSIA  672

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
             +   Y  +I   C+  N+++A ++  E+ ++ +A     +  ++DGY  + N  +   +
Sbjct  673  PNIVTYNTLIGGLCKAGNIEKARKVFNEISQKALAPNTKSYTMIIDGYCKSGNLTQAFQL  732

Query  57   FDRLKECGFTPSVISYGCL  1
             D +   G  P   +Y  L
Sbjct  733  LDEMPSRGVPPDSFAYCAL  751


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/184 (23%), Positives = 82/184 (45%), Gaps = 1/184 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ K + M+++ Y + G+  +A ++ ++M SRG+ P S+ Y  L         +E+AL+ 
Sbjct  708  PNTKSYTMIIDGYCKSGNLTQAFQLLDEMPSRGVPPDSFAYCALVDGCCKEGKLEKALSL  767

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M  +G   S   ++ ++ G  K G    A     +  ++  T +   Y  +I  +C+
Sbjct  768  FYEMVRKGFA-STTAFNALIDGLCKSGKPNDANGLLEDMVDKCITPNHITYTILIDHHCK  826

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M  AE L  EM+   +      +  ++ GY       +   +F+R+      P  I 
Sbjct  827  AGEMKEAENLFLEMQRRNLVPNTVTYTLLLHGYDRLGRRAEMFALFERMAANAVEPDEII  886

Query  12   YGCL  1
            YG +
Sbjct  887  YGLM  890


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/184 (23%), Positives = 82/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++   ++G+      + ++M +RGI    + Y  L      + D+E+A   
Sbjct  323  PNHFAYTALIDGLMKQGNVVEGFRVKDEMVARGIKLNVFTYNALISGVCKAGDLEKAKAL  382

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   G E    T+SI++  +++   ++ A     E K  + T +   Y  II   C 
Sbjct  383  FNEMVWIGAEPDAQTFSILIESYSRAKKIDKAYELLNEMKRSNLTPTLYTYSGIINGLCH  442

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +++RA  +L  M E G+   + I+  ++ G+      E+   + DR+ E G  P VI 
Sbjct  443  CGDLERANHVLDAMVEGGLKPNLVIYTNLIKGHIQKSRFEEARRILDRMMEKGVLPDVIC  502

Query  12   YGCL  1
               L
Sbjct  503  CNTL  506


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/182 (21%), Positives = 72/182 (40%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P  + F +++  Y R     +A E+  +M+   + PT Y Y+ +        D+E A  
Sbjct  392  EPDAQTFSILIESYSRAKKIDKAYELLNEMKRSNLTPTLYTYSGIINGLCHCGDLERANH  451

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M + G++ ++V Y+ ++ G  +    E A        E+           +I   C
Sbjct  452  VLDAMVEGGLKPNLVIYTNLIKGHIQKSRFEEARRILDRMMEKGVLPDVICCNTLISGLC  511

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   MD A   L EM + G+      +   + GY      E     F  ++  G  P+ +
Sbjct  512  KAQKMDEARSCLVEMVDRGLKPNAHTYGAFIHGYAKAGEIEAVERCFKEMQNYGIAPNNV  571

Query  15   SY  10
             Y
Sbjct  572  IY  573



>ref|XP_010246577.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400 
[Nelumbo nucifera]
Length=683

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 93/184 (51%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   FG++++   + G+  ++R++F  M   GI+P  + Y +L      +  + EAL  
Sbjct  296  PNIVTFGILIDGLCKVGELEKSRKLFVDMAKYGIIPNIFIYNSLITCRCTTGRLSEALDL  355

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M+  GI   V+TYSI++ G    G ++  +  F + ++     ++  Y  +I   C+
Sbjct  356  YSEMSKIGICPDVLTYSILLKGLCITGRLQEGDDLFNKMQQNGIVANSVTYNTLIDGYCK  415

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM++A ++  EM E+GI   +  F +++DGY    N E  + ++  +   G  P V+ 
Sbjct  416  DGNMEKALKMCSEMTEKGIEPNVITFSSLIDGYCKEGNLETAMGLYSEMVIKGIAPDVVV  475

Query  12   YGCL  1
            Y  L
Sbjct  476  YTSL  479


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/202 (22%), Positives = 96/202 (48%), Gaps = 4/202 (2%)
 Frame = -2

Query  594  NWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N H   + F+ + +    P+   + +++    +  +   A EM   M+   ++P  Y Y 
Sbjct  208  NIHKARQIFDEMVEKRIYPTVVTYSILICGLCKESNVAEATEMLRMMQQSDVLPNLYTYN  267

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L   Y     +++AL   ++M  +G+  ++VT+ I++ G  KVG +E +   F++  + 
Sbjct  268  ALLDGYCKMSRVQQALDLYKEMLVDGLHPNIVTFGILIDGLCKVGELEKSRKLFVDMAKY  327

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                +  IY ++I   C T  +  A +L  EM + GI   +  +  ++ G  IT   ++ 
Sbjct  328  GIIPNIFIYNSLITCRCTTGRLSEALDLYSEMSKIGICPDVLTYSILLKGLCITGRLQEG  387

Query  66   LLMFDRLKECGFTPSVISYGCL  1
              +F+++++ G   + ++Y  L
Sbjct  388  DDLFNKMQQNGIVANSVTYNTL  409


 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 80/168 (48%), Gaps = 0/168 (0%)
 Frame = -2

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            G    A +++ +M   GI P    Y+ L     ++  ++E      KM   GI  + VTY
Sbjct  347  GRLSEALDLYSEMSKIGICPDVLTYSILLKGLCITGRLQEGDDLFNKMQQNGIVANSVTY  406

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            + ++ G+ K GN+E A     E  E+    +   + ++I   C+  N++ A  L  EM  
Sbjct  407  NTLIDGYCKDGNMEKALKMCSEMTEKGIEPNVITFSSLIDGYCKEGNLETAMGLYSEMVI  466

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +GIA  + ++ +++DG++   N ++   +   + E G   +V +  CL
Sbjct  467  KGIAPDVVVYTSLIDGHSKNGNFKEAFRLHKEMTEAGLDSNVFTISCL  514


 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 0/152 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    + +++      G      ++F KM+  GIV  S  Y  L   Y    +ME+AL  
Sbjct  366  PDVLTYSILLKGLCITGRLQEGDDLFNKMQQNGIVANSVTYNTLIDGYCKDGNMEKALKM  425

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++GIE +V+T+S ++ G+ K GN+E A   + E   +       +Y ++I  + +
Sbjct  426  CSEMTEKGIEPNVITFSSLIDGYCKEGNLETAMGLYSEMVIKGIAPDVVVYTSLIDGHSK  485

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDG  97
              N   A  L +EM E G+ + +     ++DG
Sbjct  486  NGNFKEAFRLHKEMTEAGLDSNVFTISCLIDG  517


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 72/161 (45%), Gaps = 0/161 (0%)
 Frame = -2

Query  483  EMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGF  304
            E++E M S G  P    Y+ L  A     ++ +A     +M ++ I  +VVTYSI++ G 
Sbjct  179  ELYENMLSNGFGPNVVTYSTLINACCNQGNIHKARQIFDEMVEKRIYPTVVTYSILICGL  238

Query  303  AKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPI  124
             K  NV  A       ++     +   Y  ++   C+   + +A +L +EM  +G+   I
Sbjct  239  CKESNVAEATEMLRMMQQSDVLPNLYTYNALLDGYCKMSRVQQALDLYKEMLVDGLHPNI  298

Query  123  SIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              F  ++DG       EK   +F  + + G  P++  Y  L
Sbjct  299  VTFGILIDGLCKVGELEKSRKLFVDMAKYGIIPNIFIYNSL  339



>ref|XP_007211305.1| hypothetical protein PRUPE_ppa001411mg [Prunus persica]
 gb|EMJ12504.1| hypothetical protein PRUPE_ppa001411mg [Prunus persica]
Length=836

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 98/200 (49%), Gaps = 7/200 (4%)
 Frame = -2

Query  588  HAVVRAFERINK-------PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
             ++V+A+E +N+       P+   +G+++N   R GD  RA ++ ++M +RG+ P +  Y
Sbjct  270  QSMVKAYEILNEMKKRNLAPNVYTYGVIINGLSRCGDLQRANKVLKEMITRGLKPGAVIY  329

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            T +   +      EEA+   + MN++GI   V  Y+ ++ G  K   +E A  +FLE  E
Sbjct  330  TTVIRGHVQEGKFEEAIKLFKGMNEKGIMPDVFCYNSLIIGLCKARKMEEARTYFLEMVE  389

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
            R    +A  YG  ++ +C+   M  A    +EM   GIA    I+  +++G+    N  +
Sbjct  390  RGLRPNAYTYGAFVHGHCKDGEMQLANRYFQEMLGCGIAPNDVIYTALIEGHCKEGNLTE  449

Query  69   CLLMFDRLKECGFTPSVISY  10
                F  +   G  P + +Y
Sbjct  450  AYSAFRCMLGRGVLPDIKTY  469


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 91/187 (49%), Gaps = 0/187 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER  +P+   +G  V+ + + G+   A   F++M   GI P    YT L   +    ++ 
Sbjct  389  ERGLRPNAYTYGAFVHGHCKDGEMQLANRYFQEMLGCGIAPNDVIYTALIEGHCKEGNLT  448

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EA +  R M   G+   + TYS+I+ G +K G ++ A   F E   +        Y ++I
Sbjct  449  EAYSAFRCMLGRGVLPDIKTYSVIIHGLSKNGKLQEAMGVFSELLGKDLVPDVFTYSSLI  508

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+  N+D+A +LL  M + GI   I  ++ +++G   + + +K   +FD +   G T
Sbjct  509  SGFCKQGNVDKAFQLLELMCQRGIDPNIVTYNALINGLCKSGDVDKARELFDGISGKGLT  568

Query  27   PSVISYG  7
            P+ ++Y 
Sbjct  569  PNAVTYA  575


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 86/187 (46%), Gaps = 0/187 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E+   P+   + +++    R G    A E+ + M  +G+VP  Y Y+ L       +  E
Sbjct  109  EKGCNPNLSTYNVVIGALCRTGGVDEALEVKKAMVEKGLVPDRYTYSALLDGLCRHKRSE  168

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EA   ++ M D G+      Y +++ GF K GN+E A     E   R   L  + Y  I+
Sbjct  169  EAKLILKDMYDMGLNPENTCYIVLIDGFIKEGNMEEALSIKGEMIARGVKLCDASYNAIL  228

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+   M++AE +L EM   GI      F  ++DGY   ++  K   + + +K+    
Sbjct  229  AGVCRNGTMEKAEAVLNEMNVMGIKPNAQTFKFLIDGYCREQSMVKAYEILNEMKKRNLA  288

Query  27   PSVISYG  7
            P+V +YG
Sbjct  289  PNVYTYG  295


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 84/177 (47%), Gaps = 0/177 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  K + ++++   + G    A  +F ++  + +VP  + Y++L   +    ++++A   
Sbjct  464  PDIKTYSVIIHGLSKNGKLQEAMGVFSELLGKDLVPDVFTYSSLISGFCKQGNVDKAFQL  523

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +  M   GI+ ++VTY+ ++ G  K G+V+ A   F     +  T +A  Y  ++    +
Sbjct  524  LELMCQRGIDPNIVTYNALINGLCKSGDVDKARELFDGISGKGLTPNAVTYATMMGGYSK  583

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
               +  A  LL EM   G      I+ T++DG     + EK L +F+ + E GF  +
Sbjct  584  AGKLTEAFRLLDEMLLHGFPTDSFIYCTLIDGCCKAGDTEKALSLFEDVVEKGFAAT  640


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++  + + G+   A   F  M  RG++P    Y+ + +  + +  ++EA+  
Sbjct  429  PNDVIYTALIEGHCKEGNLTEAYSAFRCMLGRGVLPDIKTYSVIIHGLSKNGKLQEAMGV  488

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              ++  + +   V TYS ++ GF K GNV+ A        +R    +   Y  +I   C+
Sbjct  489  FSELLGKDLVPDVFTYSSLISGFCKQGNVDKAFQLLELMCQRGIDPNIVTYNALINGLCK  548

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + ++D+A EL   +  +G+      + TMM GY+      +   + D +   GF      
Sbjct  549  SGDVDKARELFDGISGKGLTPNAVTYATMMGGYSKAGKLTEAFRLLDEMLLHGFPTDSFI  608

Query  12   YGCL  1
            Y  L
Sbjct  609  YCTL  612


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/182 (23%), Positives = 86/182 (47%), Gaps = 1/182 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  M+  Y + G    A  + ++M   G    S+ Y  L      + D E+AL+ 
Sbjct  569  PNAVTYATMMGGYSKAGKLTEAFRLLDEMLLHGFPTDSFIYCTLIDGCCKAGDTEKALSL  628

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               + ++G   +  +++ ++ GF K+G +  A   F +  ++H T +   Y  +I +  +
Sbjct  629  FEDVVEKGFA-ATASFNALINGFCKLGKMMEAIRLFEDMVDKHVTPNHVSYTILIVSLSK  687

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M+ +E+L  EM++  +   I  + +++ GY IT +  K   +F+ +   G  P  ++
Sbjct  688  EGLMNESEQLFLEMQKRNLTPTIVTYTSLLHGYNITGSRFKMFALFEEMMARGLKPDEVN  747

Query  12   YG  7
            YG
Sbjct  748  YG  749


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 85/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    + ++++ + + G+   A  +  +M +RG+      Y  +      +  ME+A   
Sbjct  184  PENTCYIVLIDGFIKEGNMEEALSIKGEMIARGVKLCDASYNAILAGVCRNGTMEKAEAV  243

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +MN  GI+ +  T+  ++ G+ +  ++  A     E K+R+   +   YG II    +
Sbjct  244  LNEMNVMGIKPNAQTFKFLIDGYCREQSMVKAYEILNEMKKRNLAPNVYTYGVIINGLSR  303

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++ RA ++L+EM   G+     I+ T++ G+      E+ + +F  + E G  P V  
Sbjct  304  CGDLQRANKVLKEMITRGLKPGAVIYTTVIRGHVQEGKFEEAIKLFKGMNEKGIMPDVFC  363

Query  12   YGCL  1
            Y  L
Sbjct  364  YNSL  367



>ref|XP_010530463.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
Length=558

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 96/198 (48%), Gaps = 4/198 (2%)
 Frame = -2

Query  591  WHAVVRAFE----RINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTN  424
            W  V R       R   P+   F  +++ + + G    ARE++E+M  RG+VP+++ YT+
Sbjct  295  WTDVARLLNDMIXRNITPNVVSFNGLIDNFVKEGKFLEARELYEQMVQRGLVPSTFTYTS  354

Query  423  LTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH  244
            L     +   ++EA      M  +G    VVT+S ++ G+ K G V+     F E   R 
Sbjct  355  LIVGLCMQNRLDEAKKMFDSMATKGCPPDVVTFSALINGYCKSGRVDQGLKLFSEMFRRG  414

Query  243  ATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCL  64
                   Y ++I   C+  N+  A++L  EM+ +G    +  F+ ++DG       E+ L
Sbjct  415  VVADTPTYTSLIQGFCRADNLAVAQKLFLEMQCQGQYPNLVTFNVLLDGLCKNGKLEEAL  474

Query  63   LMFDRLKECGFTPSVISY  10
             +++++++ G    +I++
Sbjct  475  CLYNKMEKSGMNLDIIAH  492



>ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X1 [Vitis vinifera]
 ref|XP_010648630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X1 [Vitis vinifera]
 ref|XP_010648631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X1 [Vitis vinifera]
 ref|XP_010648632.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X1 [Vitis vinifera]
 ref|XP_010648633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X1 [Vitis vinifera]
 ref|XP_010648634.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, 
mitochondrial-like isoform X1 [Vitis vinifera]
Length=877

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 95/185 (51%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   + ++++   ++GD  +A ++F++M S  I PT + +  +         M EA  
Sbjct  536  KPNVVTYSILIDGNFKKGDSEKALDLFDQMLSLNIAPTDFTFNTIINGLCKVGQMSEARD  595

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             ++   +EG   S +TY+ IV GF K GN+++A   + E  E   + +   Y ++I   C
Sbjct  596  KLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSLINGFC  655

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            ++  +D A +   EM E+G+   ++ +  ++DG+   R+ E    +F  L E G +P+ I
Sbjct  656  KSNRIDLALKTRDEMREKGLELDVTAYSALIDGFCKRRDMESAQDLFFELLEVGLSPNRI  715

Query  15   SYGCL  1
             Y  +
Sbjct  716  VYNSM  720


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 84/169 (50%), Gaps = 0/169 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   F  ++N   + G    AR+  +     G +P+   Y ++   +    +++ AL  
Sbjct  572  PTDFTFNTIINGLCKVGQMSEARDKLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAV  631

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M + G+  +VVTY+ ++ GF K   ++ A     E +E+   L  + Y  +I   C+
Sbjct  632  YREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKTRDEMREKGLELDVTAYSALIDGFCK  691

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
              +M+ A++L  E+ E G++    ++++M+ G+    N E  L+ + ++
Sbjct  692  RRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRDLNNMEAALVWYKKM  740


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 86/179 (48%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            + +M+++  + G    A  + + M ++G+VP    Y ++   +    +M+ A +    M 
Sbjct  472  YNIMMSWLCKGGKMDEACSLLDNMVNQGMVPNVVSYNDMILGHCRKGNMDMASSVFSDML  531

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
               ++ +VVTYSI++ G  K G+ E A   F +    +   +   +  II   C+   M 
Sbjct  532  ARDLKPNVVTYSILIDGNFKKGDSEKALDLFDQMLSLNIAPTDFTFNTIINGLCKVGQMS  591

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A + L+   EEG       +++++DG+    N +  L ++  + E G +P+V++Y  L
Sbjct  592  EARDKLKNFLEEGFIPSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSL  650


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/178 (24%), Positives = 88/178 (49%), Gaps = 0/178 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER  K     + +++    ++ + +   E+ E+M+ RG VP+   +T++  A     +M 
Sbjct  288  ERGVKLDAGAYSIIIQAVCKKPNSNLGLELLEEMKERGWVPSEATFTSVIVACVAQGNMV  347

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EAL    +M + G  +++V  + ++ G+   GN+++A + F +  E     +   Y  +I
Sbjct  348  EALRLKEEMINCGKPMNLVVATSLMKGYCAQGNLDSALNLFNKITEDGLFPNKVTYSVLI  407

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECG  34
               C + N+++A EL  +M+  GI   +   ++++ GY      E+   +FD   +CG
Sbjct  408  EGCCNSGNIEKASELYTQMKLNGIPPSVFNVNSLLRGYLKAPLWEEASKLFDEAVDCG  465


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 88/187 (47%), Gaps = 6/187 (3%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +  +V+ + + G+   A  ++ +M   G+ P    YT+L   +  S  ++ AL  
Sbjct  607  PSCMTYNSIVDGFIKEGNIDSALAVYREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKT  666

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+E+ V  YS ++ GF K  ++E+A+  F E  E   + +  +Y ++I     
Sbjct  667  RDEMREKGLELDVTAYSALIDGFCKRRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRD  726

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKEC---GFTPS  22
              NM+ A    ++M  + I   +  + T++DG      E + +   D   E    G  P 
Sbjct  727  LNNMEAALVWYKKMINDRIPCDLGTYTTLIDGLL---KEGRLVFASDLYMEMLSKGIVPD  783

Query  21   VISYGCL  1
            +I++  L
Sbjct  784  IITFHVL  790


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 85/179 (47%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +++ + +R D   A+++F ++   G+ P    Y ++   +    +ME AL   +KM 
Sbjct  682  YSALIDGFCKRRDMESAQDLFFELLEVGLSPNRIVYNSMISGFRDLNNMEAALVWYKKMI  741

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            ++ I   + TY+ ++ G  K G +  A   ++E   +        +  ++   C    ++
Sbjct  742  NDRIPCDLGTYTTLIDGLLKEGRLVFASDLYMEMLSKGIVPDIITFHVLVNGLCNKGQLE  801

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A ++L EM+ + +   + I++T++ GY    N ++   + D + + G  P  ++Y  L
Sbjct  802  NARKILEEMDRKNMTPSVLIYNTLIAGYFREGNLKEAFTLHDEMLDRGLVPDDVTYDIL  860


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 73/170 (43%), Gaps = 0/170 (0%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            RR      R+++ KM  RGI    +    +  A      +EEA    R+  + G+++   
Sbjct  237  RRNMIGELRDLYNKMVLRGIYGDHFTVHVMVRACLKEGRVEEAEEYFRETKERGVKLDAG  296

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellrem  151
             YSII+    K  N         E KER    S + + ++I A     NM  A  L  EM
Sbjct  297  AYSIIIQAVCKKPNSNLGLELLEEMKERGWVPSEATFTSVIVACVAQGNMVEALRLKEEM  356

Query  150  eeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
               G    + +  ++M GY    N +  L +F+++ E G  P+ ++Y  L
Sbjct  357  INCGKPMNLVVATSLMKGYCAQGNLDSALNLFNKITEDGLFPNKVTYSVL  406


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 80/184 (43%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  M+  + R+G+   A  +F  M +R + P    Y+ L        D E+AL  
Sbjct  502  PNVVSYNDMILGHCRKGNMDMASSVFSDMLARDLKPNVVTYSILIDGNFKKGDSEKALDL  561

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M    I  +  T++ I+ G  KVG +  A        E     S   Y +I+    +
Sbjct  562  FDQMLSLNIAPTDFTFNTIINGLCKVGQMSEARDKLKNFLEEGFIPSCMTYNSIVDGFIK  621

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+D A  + REM E G++  +  + ++++G+  +   +  L   D ++E G    V +
Sbjct  622  EGNIDSALAVYREMCEFGVSPNVVTYTSLINGFCKSNRIDLALKTRDEMREKGLELDVTA  681

Query  12   YGCL  1
            Y  L
Sbjct  682  YSAL  685



>ref|XP_009773242.1| PREDICTED: pentatricopeptide repeat-containing protein At4g11690 
[Nicotiana sylvestris]
Length=562

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/198 (28%), Positives = 93/198 (47%), Gaps = 7/198 (4%)
 Frame = -2

Query  573  AFERINK-------PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTY  415
            AFE + K       P+   +  M++   + G+  RA+E+F  M + GIVP  Y Y+ L  
Sbjct  182  AFEALAKLKDLGWHPNVVIYTTMIDGCFKHGNAGRAKELFSIMSAEGIVPNQYTYSVLLS  241

Query  414  AYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATL  235
             +       +      KM  EG+   + TY+ ++  +   G V  A   F E        
Sbjct  242  GFFRQGLKTDGFELYEKMKLEGVFPDIYTYNSLINVYCSDGKVNKAFGLFDEMHRNGVVC  301

Query  234  SASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMF  55
            +   Y  +I   CQ   +  AE+LL  +++ G+   +  ++T++DGY      EK L +F
Sbjct  302  NIVTYNTLIRGLCQEKRVSEAEKLLERLKQAGLHPNLITYNTLIDGYCRAGKLEKGLALF  361

Query  54   DRLKECGFTPSVISYGCL  1
            +++K CG TP+ I+Y  L
Sbjct  362  NQIKSCGLTPTSITYNTL  379


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 94/196 (48%), Gaps = 5/196 (3%)
 Frame = -2

Query  576  RAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            +  ER+ +    P+   +  +++ Y R G   +   +F +++S G+ PTS  Y  L   +
Sbjct  324  KLLERLKQAGLHPNLITYNTLIDGYCRAGKLEKGLALFNQIKSCGLTPTSITYNTLIAGF  383

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
            + + +    +  VR+M + GI  S VTY+I++  FA+  ++E A   F    +   ++  
Sbjct  384  SRAGNPSRVVDFVREMEERGIFPSKVTYTILIDAFARSKDMEKALEVFSRMHKAGLSVDL  443

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
              +G +I+  C   NM  A +L R M E  +     I++ ++ GY    +  K L +   
Sbjct  444  CTFGALIHGWCSQGNMKEALKLFRSMAEHHLEPNDVIYNMIIFGYCKEGSSYKALRLLKE  503

Query  48   LKECGFTPSVISYGCL  1
            + E G  P+  SY CL
Sbjct  504  MVENGMVPNGASY-CL  518


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/184 (23%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++N Y   G  ++A  +F++M   G+V     Y  L       + + EA   
Sbjct  266  PDIYTYNSLINVYCSDGKVNKAFGLFDEMHRNGVVCNIVTYNTLIRGLCQEKRVSEAEKL  325

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + ++   G+  +++TY+ ++ G+ + G +E     F + K    T ++  Y  +I    +
Sbjct  326  LERLKQAGLHPNLITYNTLIDGYCRAGKLEKGLALFNQIKSCGLTPTSITYNTLIAGFSR  385

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N  R  + +REMEE GI      +  ++D +  +++ EK L +F R+ + G +  + +
Sbjct  386  AGNPSRVVDFVREMEERGIFPSKVTYTILIDAFARSKDMEKALEVFSRMHKAGLSVDLCT  445

Query  12   YGCL  1
            +G L
Sbjct  446  FGAL  449


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/160 (23%), Positives = 77/160 (48%), Gaps = 0/160 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A ++ E+++  G+ P    Y  L   Y  +  +E+ L    ++   G+  + +TY+ ++ 
Sbjct  322  AEKLLERLKQAGLHPNLITYNTLIDGYCRAGKLEKGLALFNQIKSCGLTPTSITYNTLIA  381

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            GF++ GN      +  E +ER    S   Y  +I A  ++ +M++A E+   M + G++ 
Sbjct  382  GFSRAGNPSRVVDFVREMEERGIFPSKVTYTILIDAFARSKDMEKALEVFSRMHKAGLSV  441

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             +  F  ++ G+    N ++ L +F  + E    P+ + Y
Sbjct  442  DLCTFGALIHGWCSQGNMKEALKLFRSMAEHHLEPNDVIY  481



>ref|XP_010523070.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400 
[Tarenaya hassleriana]
Length=670

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+    G++V+ + +  +   AR +F  M   G+ P  + Y +L   Y    +M EAL  
Sbjct  305  PNVFVLGILVDGFCKVHELTNARSLFVHMVKFGVDPNLFVYNSLINGYCGLGNMSEALGL  364

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M    +   VVTYSI++ G      +E A   F   K+     ++  Y ++I+ +C+
Sbjct  365  CSEMKSLKLSPDVVTYSILIKGLLSQDQLEEAHGLFQTMKDEKIVPNSVTYNSLIHGHCK  424

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM++A EL  EM   GI   I  F T++DGY    N +  + ++  +   G  P V++
Sbjct  425  EGNMEKALELSSEMTAFGIEPNIITFSTLIDGYCKACNMKAAMGLYSEMIIKGIAPDVVT  484

Query  12   YGCL  1
            Y  L
Sbjct  485  YTAL  488


 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++N Y   G+   A  +  +M+S  + P    Y+ L         +EEA   
Sbjct  340  PNLFVYNSLINGYCGLGNMSEALGLCSEMKSLKLSPDVVTYSILIKGLLSQDQLEEAHGL  399

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             + M DE I  + VTY+ ++ G  K GN+E A     E        +   +  +I   C+
Sbjct  400  FQTMKDEKIVPNSVTYNSLIHGHCKEGNMEKALELSSEMTAFGIEPNIITFSTLIDGYCK  459

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
             CNM  A  L  EM  +GIA  +  +  ++DG+    N ++ + +++ + E G  P+  +
Sbjct  460  ACNMKAAMGLYSEMIIKGIAPDVVTYTALIDGHFKDANMKEAIRLYNEMLETGICPNSYT  519

Query  12   YGCL  1
            + CL
Sbjct  520  FACL  523


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 88/203 (43%), Gaps = 4/203 (2%)
 Frame = -2

Query  597  ENWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
            + +H+V   ++ +      P    + ++ +   ++G   R  ++ + M +RGI P    Y
Sbjct  181  KQFHSVWEVYQHMISHGLVPDAHIYSVLFDCCSKQGYSSRKEKLLKGMATRGIQPNVVIY  240

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            T L         MEEA    + M + GI  ++ TY  ++ G+ K   +  A   + E   
Sbjct  241  TLLIRDLCKKEKMEEAEKMFQLMKEHGILPNLYTYGTMINGYCKASQLRPAYALYKEIPV  300

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
                 +  + G ++   C+   +  A  L   M + G+   + +++++++GY    N  +
Sbjct  301  SGLLPNVFVLGILVDGFCKVHELTNARSLFVHMVKFGVDPNLFVYNSLINGYCGLGNMSE  360

Query  69   CLLMFDRLKECGFTPSVISYGCL  1
             L +   +K    +P V++Y  L
Sbjct  361  ALGLCSEMKSLKLSPDVVTYSIL  383


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 68/159 (43%), Gaps = 0/159 (0%)
 Frame = -2

Query  477  FEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAK  298
            F+ M+  GI+P  Y Y  +   Y  +  +  A    +++   G+  +V    I+V GF K
Sbjct  260  FQLMKEHGILPNLYTYGTMINGYCKASQLRPAYALYKEIPVSGLLPNVFVLGILVDGFCK  319

Query  297  VGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISI  118
            V  +  A   F+   +     +  +Y ++I   C   NM  A  L  EM+   ++  +  
Sbjct  320  VHELTNARSLFVHMVKFGVDPNLFVYNSLINGYCGLGNMSEALGLCSEMKSLKLSPDVVT  379

Query  117  FHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +  ++ G       E+   +F  +K+    P+ ++Y  L
Sbjct  380  YSILIKGLLSQDQLEEAHGLFQTMKDEKIVPNSVTYNSL  418



>ref|XP_010539051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 91/176 (52%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +++Y  + G    A  +F KM S GIVP    + ++   Y  +  ++E +    +M+
Sbjct  266  YNTIIDYLCKVGHVDGALNLFGKMGSCGIVPDVVTFNSIINGYCKANRVDEGINLFYEMS  325

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G+   VVTY+I++ GF +VGN+ AA+  F+E + +  +     Y  ++   C+    D
Sbjct  326  RRGLVADVVTYNILIQGFYRVGNLGAAQKVFMEMQYKGHSPDLVTYIILLDGLCKNGKTD  385

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A  L  ++++ GI   I +   MM G       ++ L++F++L + G  P+VI Y
Sbjct  386  KALCLYNKLDKSGIDLHIPLHSCMMHGLCKVGRVDEALILFNKLLDRGVKPNVIMY  441


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 80/177 (45%), Gaps = 0/177 (0%)
 Frame = -2

Query  540  EFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKM  361
               +++N +           +  K+   G  P    YT L + + +   +  AL+ V +M
Sbjct  125  SLNVLINCFSHSPQVFLGLSVVGKILKLGYKPNVVTYTTLAHGFCIHGKISAALSLVDQM  184

Query  360  NDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNM  181
             +EG + +VVT+S ++ G    G V  A   F +  +     +   +G +I   C+  + 
Sbjct  185  VEEGYKPNVVTFSTLINGLCLEGRVSEALSLFDQMLKMDCQPNVVTFGILINGICKARDY  244

Query  180  DRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
              A  LL +MEE  I   I I++T++D      + +  L +F ++  CG  P V+++
Sbjct  245  ALAMNLLEKMEEMYIEINIVIYNTIIDYLCKVGHVDGALNLFGKMGSCGIVPDVVTF  301


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   +  + + +   G    A  + ++M   G  P    ++ L     +   + EAL+
Sbjct  155  KPNVVTYTTLAHGFCIHGKISAALSLVDQMVEEGYKPNVVTFSTLINGLCLEGRVSEALS  214

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M     + +VVT+ I++ G  K  +   A +   + +E +  ++  IY  II   C
Sbjct  215  LFDQMLKMDCQPNVVTFGILINGICKARDYALAMNLLEKMEEMYIEINIVIYNTIIDYLC  274

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  ++D A  L  +M   GI   +  F+++++GY      ++ + +F  +   G    V+
Sbjct  275  KVGHVDGALNLFGKMGSCGIVPDVVTFNSIINGYCKANRVDEGINLFYEMSRRGLVADVV  334

Query  15   SYGCL  1
            +Y  L
Sbjct  335  TYNIL  339



>ref|XP_010539050.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 91/176 (52%), Gaps = 0/176 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  +++Y  + G    A  +F KM S GIVP    + ++   Y  +  ++E +    +M+
Sbjct  271  YNTIIDYLCKVGHVDGALNLFGKMGSCGIVPDVVTFNSIINGYCKANRVDEGINLFYEMS  330

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G+   VVTY+I++ GF +VGN+ AA+  F+E + +  +     Y  ++   C+    D
Sbjct  331  RRGLVADVVTYNILIQGFYRVGNLGAAQKVFMEMQYKGHSPDLVTYIILLDGLCKNGKTD  390

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A  L  ++++ GI   I +   MM G       ++ L++F++L + G  P+VI Y
Sbjct  391  KALCLYNKLDKSGIDLHIPLHSCMMHGLCKVGRVDEALILFNKLLDRGVKPNVIMY  446


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 80/177 (45%), Gaps = 0/177 (0%)
 Frame = -2

Query  540  EFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKM  361
               +++N +           +  K+   G  P    YT L + + +   +  AL+ V +M
Sbjct  130  SLNVLINCFSHSPQVFLGLSVVGKILKLGYKPNVVTYTTLAHGFCIHGKISAALSLVDQM  189

Query  360  NDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNM  181
             +EG + +VVT+S ++ G    G V  A   F +  +     +   +G +I   C+  + 
Sbjct  190  VEEGYKPNVVTFSTLINGLCLEGRVSEALSLFDQMLKMDCQPNVVTFGILINGICKARDY  249

Query  180  DRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
              A  LL +MEE  I   I I++T++D      + +  L +F ++  CG  P V+++
Sbjct  250  ALAMNLLEKMEEMYIEINIVIYNTIIDYLCKVGHVDGALNLFGKMGSCGIVPDVVTF  306


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   +  + + +   G    A  + ++M   G  P    ++ L     +   + EAL+
Sbjct  160  KPNVVTYTTLAHGFCIHGKISAALSLVDQMVEEGYKPNVVTFSTLINGLCLEGRVSEALS  219

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M     + +VVT+ I++ G  K  +   A +   + +E +  ++  IY  II   C
Sbjct  220  LFDQMLKMDCQPNVVTFGILINGICKARDYALAMNLLEKMEEMYIEINIVIYNTIIDYLC  279

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  ++D A  L  +M   GI   +  F+++++GY      ++ + +F  +   G    V+
Sbjct  280  KVGHVDGALNLFGKMGSCGIVPDVVTFNSIINGYCKANRVDEGINLFYEMSRRGLVADVV  339

Query  15   SYGCL  1
            +Y  L
Sbjct  340  TYNIL  344



>ref|XP_008463574.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400 
[Cucumis melo]
Length=652

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   FG +++   R+GD  RA+EMF++MR +GIVPT   YT L         MEEA + 
Sbjct  182  PSVITFGTLIDGCCRQGDLLRAQEMFDEMRVKGIVPTVVVYTILIRGLCSDSKMEEAESM  241

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R M + G+  ++ TY+ ++ G+ K+ N + A   + +            +G +I   C+
Sbjct  242  HRAMREVGVYPNLYTYNTLMDGYCKLANAKQALRLYQDMLGEGLVPDVVTFGILIDGLCK  301

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M  A  L   M +  +   I+++++++D Y    +  + +  F  L+    +P V +
Sbjct  302  FGEMKAARNLFVNMIKFCVTPNINVYNSLIDAYCKVGDVSEAMAFFLELERYKVSPDVFT  361

Query  12   YGCL  1
            Y  L
Sbjct  362  YSIL  365


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 0/131 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A  +FEKM   GI+  S  Y +L   Y     ME+AL    +M + G+E +V+T+S ++ 
Sbjct  378  AGNIFEKMTKEGILANSVTYNSLIDGYCKEGKMEKALEICSQMTENGVEPNVITFSTLID  437

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            G+ K+ N++AA   + E   +  +     Y  +I  +C+  +M  A +L  +M + GI  
Sbjct  438  GYCKIRNLQAAMGIYSEMVIKSLSPDVVTYTAMIDGHCKYGSMKEALKLYSDMLDNGITP  497

Query  129  PISIFHTMMDG  97
                   ++DG
Sbjct  498  NCYTISCLLDG  508


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 81/184 (44%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y + GD   A   F ++    + P  + Y+ L          EEA   
Sbjct  322  PNINVYNSLIDAYCKVGDVSEAMAFFLELERYKVSPDVFTYSILIRGLCSVTRTEEAGNI  381

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              KM  EGI  + VTY+ ++ G+ K G +E A     +  E     +   +  +I   C+
Sbjct  382  FEKMTKEGILANSVTYNSLIDGYCKEGKMEKALEICSQMTENGVEPNVITFSTLIDGYCK  441

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+  A  +  EM  + ++  +  +  M+DG+    + ++ L ++  + + G TP+  +
Sbjct  442  IRNLQAAMGIYSEMVIKSLSPDVVTYTAMIDGHCKYGSMKEALKLYSDMLDNGITPNCYT  501

Query  12   YGCL  1
              CL
Sbjct  502  ISCL  505


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = -2

Query  366  KMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTC  187
            +M   G+  SV+T+  ++ G  + G++  A+  F E + +    +  +Y  +I   C   
Sbjct  174  EMISNGLSPSVITFGTLIDGCCRQGDLLRAQEMFDEMRVKGIVPTVVVYTILIRGLCSDS  233

Query  186  NMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYG  7
             M+ AE + R M E G+   +  ++T+MDGY    N ++ L ++  +   G  P V+++G
Sbjct  234  KMEEAESMHRAMREVGVYPNLYTYNTLMDGYCKLANAKQALRLYQDMLGEGLVPDVVTFG  293

Query  6    CL  1
             L
Sbjct  294  IL  295



>ref|XP_011071527.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like 
[Sesamum indicum]
 ref|XP_011071528.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like 
[Sesamum indicum]
Length=633

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +G+++     RGD  +AR + E+M  RG+ PT   YT L +   +  +M EA   
Sbjct  153  PSSVTYGILIGASCDRGDIVKARLLLEEMIERGLKPTVVIYTTLIHGLCIENNMLEAEKI  212

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M + G+  ++ TY+ ++ G+AK+ +VE A   + E  ++    +   Y  +IY  C+
Sbjct  213  FTRMREYGVVPNLYTYNTLIDGYAKMASVEKARRVYYEKLDQGVLPNVITYSILIYLLCK  272

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +         M +  +   + I++ +MDG+    +    + M   ++  G  P V++
Sbjct  273  KGELVAFRSYFVHMVKLNVIPNVYIYNCLMDGFCEAGDLSAAMDMHLEMEIFGILPDVVT  332

Query  12   YGCL  1
            YG L
Sbjct  333  YGIL  336


 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 97/193 (50%), Gaps = 3/193 (2%)
 Frame = -2

Query  570  FERINK---PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVS  400
            +E++++   P+   + +++    ++G+    R  F  M    ++P  Y Y  L   +  +
Sbjct  249  YEKLDQGVLPNVITYSILIYLLCKKGELVAFRSYFVHMVKLNVIPNVYIYNCLMDGFCEA  308

Query  399  RDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIY  220
             D+  A+    +M   GI   VVTY I++ G+ ++G VE AE+ F +  +    L++ I+
Sbjct  309  GDLSAAMDMHLEMEIFGILPDVVTYGILMKGYCRIGRVEEAENLFCKMNKEGLMLNSVIF  368

Query  219  GNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKE  40
              +I   C+  +M++  E+  +M E+G+   I+ F T+++GY         + +++ +  
Sbjct  369  NTLIDGYCKKGSMEKVVEISSQMIEKGLQLDIATFCTLINGYCKAGQLAAAMGLYNEMTI  428

Query  39   CGFTPSVISYGCL  1
             G+   V++Y  L
Sbjct  429  KGYKLDVVAYSAL  441


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 79/167 (47%), Gaps = 1/167 (1%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
             ER  KP+   +  +++      +   A ++F +MR  G+VP  Y Y  L   Y     +
Sbjct  182  IERGLKPTVVIYTTLIHGLCIENNMLEAEKIFTRMREYGVVPNLYTYNTLIDGYAKMASV  241

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
            E+A     +  D+G+  +V+TYSI++    K G + A   +F+   + +   +  IY  +
Sbjct  242  EKARRVYYEKLDQGVLPNVITYSILIYLLCKKGELVAFRSYFVHMVKLNVIPNVYIYNCL  301

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYT-ITRNEE  73
            +   C+  ++  A ++  EME  GI   +  +  +M GY  I R EE
Sbjct  302  MDGFCEAGDLSAAMDMHLEMEIFGILPDVVTYGILMKGYCRIGRVEE  348


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 71/152 (47%), Gaps = 0/152 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +G+++  Y R G    A  +F KM   G++  S  +  L   Y     ME+ +  
Sbjct  328  PDVVTYGILMKGYCRIGRVEEAENLFCKMNKEGLMLNSVIFNTLIDGYCKKGSMEKVVEI  387

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+++ + T+  ++ G+ K G + AA   + E   +   L    Y  +I  + +
Sbjct  388  SSQMIEKGLQLDIATFCTLINGYCKAGQLAAAMGLYNEMTIKGYKLDVVAYSALIDGHFK  447

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDG  97
                D A +L +EM + GIA  I    +++DG
Sbjct  448  NGYTDAALQLHKEMMDAGIAPNIFTISSVIDG  479


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/180 (22%), Positives = 79/180 (44%), Gaps = 0/180 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ +   GD   A +M  +M   GI+P    Y  L   Y     +EEA   
Sbjct  293  PNVYIYNCLMDGFCEAGDLSAAMDMHLEMEIFGILPDVVTYGILMKGYCRIGRVEEAENL  352

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              KMN EG+ ++ V ++ ++ G+ K G++E       +  E+   L  + +  +I   C+
Sbjct  353  FCKMNKEGLMLNSVIFNTLIDGYCKKGSMEKVVEISSQMIEKGLQLDIATFCTLINGYCK  412

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  A  L  EM  +G    +  +  ++DG+      +  L +   + + G  P++ +
Sbjct  413  AGQLAAAMGLYNEMTIKGYKLDVVAYSALIDGHFKNGYTDAALQLHKEMMDAGIAPNIFT  472



>ref|XP_010934958.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Elaeis guineensis]
 ref|XP_010934959.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Elaeis guineensis]
 ref|XP_010934960.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g02150 [Elaeis guineensis]
Length=741

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 100/220 (45%), Gaps = 35/220 (16%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   F + ++ + + G    A + F  M+ RG+ P  + YT+L      + +++E L 
Sbjct  343  KPNVVTFSIFIDAFCKEGMMQEAVKFFVDMKVRGLTPNEFTYTSLIDGNYKAGNLKEVLF  402

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAE------------------------HW  268
             V +M  EG+E++VVTY+ +V G  K   V  AE                        H+
Sbjct  403  LVDEMVQEGVELNVVTYTALVDGLCKAEKVVEAEKVFQDMERAGVAANQLVYTALIHGHF  462

Query  267  FLEAKERHATL-----------SASIYGNIIYANCQTCNMDRAeellremeeEGIAAPIS  121
              +  E+  +L             S+YG II+  C+   +D A+ L+ EM+E G+     
Sbjct  463  VSKNMEKAVSLLTDMKGKGIKPDTSLYGTIIWGLCKDGKIDEAKLLVSEMDEYGLMPNHV  522

Query  120  IFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            I+ T+MD         + L +  ++ +CG  PSV++Y  L
Sbjct  523  IYTTIMDACFKAGKASEALGLLHKMLDCGMLPSVVTYCAL  562


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/184 (23%), Positives = 85/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   F +M++++ + GD   A+ +F +M+  G  P    Y +L   +    ++EEA   
Sbjct  239  PTVFTFNIMIDFFCKEGDLKAAKGLFLRMKEMGCSPDVVTYNSLIDGHGKHGELEEAERL  298

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M   G +  V+TY+ ++  F K G +  A  +  E K      +   +   I A C+
Sbjct  299  LGEMKVAGCKPDVITYNALINCFCKFGKLPKAFGYLSEMKRNDLKPNVVTFSIFIDAFCK  358

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M  A +   +M+  G+      + +++DG     N ++ L + D + + G   +V++
Sbjct  359  EGMMQEAVKFFVDMKVRGLTPNEFTYTSLIDGNYKAGNLKEVLFLVDEMVQEGVELNVVT  418

Query  12   YGCL  1
            Y  L
Sbjct  419  YTAL  422


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/182 (25%), Positives = 83/182 (46%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +G ++    + G    A+ +  +M   G++P    YT +  A   +    EAL 
Sbjct  483  KPDTSLYGTIIWGLCKDGKIDEAKLLVSEMDEYGLMPNHVIYTTIMDACFKAGKASEALG  542

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM D G+  SVVTY  +V G  K G+V  A + F + ++     +   Y  +I   C
Sbjct  543  LLHKMLDCGMLPSVVTYCALVDGLCKQGSVREATYHFDKMRDLGLQPNVLAYTALIDGLC  602

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  A +L +EM   G+A     + +++DG+    N ++   + +++ E G    + 
Sbjct  603  KNGCLGEAIKLFKEMVGNGMAPDKVAYTSLIDGHLKQGNLQEAFDLRNKMAENGLELDLH  662

Query  15   SY  10
             Y
Sbjct  663  GY  664



>ref|XP_002451024.1| hypothetical protein SORBIDRAFT_05g022840 [Sorghum bicolor]
 gb|EES10012.1| hypothetical protein SORBIDRAFT_05g022840 [Sorghum bicolor]
Length=813

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 86/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F +++  Y + G   RA  +F +MR +G+ P    Y+ +  A      M++A+  
Sbjct  389  PDSHIFNVLIKAYAKCGMLDRATIIFNEMREQGVEPDVVTYSTVIAALCRIGKMDDAVEK  448

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M D+G+  S+ TY  ++ GF   G++  A+   L+   +        +  II   C+
Sbjct  449  FNQMIDQGVAPSISTYHFLIQGFCTHGDLLKAKDLVLQMMNKGMRPDIGCFNFIINNLCK  508

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  A+ +       G+   + +++T+MDGY +    E  L +FD +   G  P+V+ 
Sbjct  509  LGRVMDAQNIFDFTISIGLHPNVMVYNTLMDGYCLVGKMENALRVFDVMVSAGIQPNVVV  568

Query  12   YGCL  1
            YG L
Sbjct  569  YGTL  572


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/188 (24%), Positives = 87/188 (46%), Gaps = 4/188 (2%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            +R   P    +  +VN   +     +A  +  +M  +G++P ++ Y +L Y Y+ +   +
Sbjct  244  QRGISPDLSTYNCVVNALCKARAMDKAEAILRQMVDKGVLPDNWTYNSLIYGYSSTGQWK  303

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EA+   +KM  +GI   VVT + ++    K G ++ A   F     +        Y  ++
Sbjct  304  EAVRVSKKMTSQGILPDVVTLNSLMASLCKHGKIKDARDVFDSMAMKGQKTDIFSYKIML  363

Query  207  --YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECG  34
              YA  + C +D   EL   M  +GIA    IF+ ++  Y      ++  ++F+ ++E G
Sbjct  364  NGYAT-KGCLVDLT-ELFNLMLSDGIAPDSHIFNVLIKAYAKCGMLDRATIIFNEMREQG  421

Query  33   FTPSVISY  10
              P V++Y
Sbjct  422  VEPDVVTY  429


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 76/179 (42%), Gaps = 0/179 (0%)
 Frame = -2

Query  582  VVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            V++   +  +P    F  ++N   + G    A+ +F+   S G+ P    Y  L   Y +
Sbjct  484  VLQMMNKGMRPDIGCFNFIINNLCKLGRVMDAQNIFDFTISIGLHPNVMVYNTLMDGYCL  543

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
               ME AL     M   GI+ +VV Y  +V G+ KVG ++     F E   +    S ++
Sbjct  544  VGKMENALRVFDVMVSAGIQPNVVVYGTLVNGYCKVGRIDEGLSLFREILHKGIKPSTTL  603

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRL  46
            Y  I++   Q      A+    EM E GIA     +  ++ G       ++ +L+F  L
Sbjct  604  YNIILHGLFQAGRTVPAKVKFHEMTESGIAMDRYTYSIVLGGLFKNSCSDEAILLFKEL  662


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/175 (22%), Positives = 73/175 (42%), Gaps = 4/175 (2%)
 Frame = -2

Query  606  SQPENWHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTS  439
            S    W   VR  +++      P       ++    + G    AR++F+ M  +G     
Sbjct  297  SSTGQWKEAVRVSKKMTSQGILPDVVTLNSLMASLCKHGKIKDARDVFDSMAMKGQKTDI  356

Query  438  YEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE  259
            + Y  +   Y     + +       M  +GI      +++++  +AK G ++ A   F E
Sbjct  357  FSYKIMLNGYATKGCLVDLTELFNLMLSDGIAPDSHIFNVLIKAYAKCGMLDRATIIFNE  416

Query  258  AKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGY  94
             +E+        Y  +I A C+   MD A E   +M ++G+A  IS +H ++ G+
Sbjct  417  MREQGVEPDVVTYSTVIAALCRIGKMDDAVEKFNQMIDQGVAPSISTYHFLIQGF  471



>ref|XP_008776298.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Phoenix dactylifera]
 ref|XP_008776299.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Phoenix dactylifera]
 ref|XP_008776300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Phoenix dactylifera]
 ref|XP_008776301.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Phoenix dactylifera]
Length=609

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F  M+  + ++G  +RA E F++M++ G+VP +  YT L   +     + EAL  
Sbjct  255  PDMVSFSSMIGLFAKKGYMNRALEYFKEMKAAGLVPDNVIYTMLIGGFCKISLISEALKM  314

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M D G    VVTY+ I+ G  K   +  A+  F E  ER        +  +I+ +C+
Sbjct  315  RDEMVDHGCMPDVVTYNTILNGMCKEQRLPEADELFSEMTERGVAPDFCTFTTLIHGSCK  374

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +++A  L   M E+ +   I  ++T++DG     + EK   ++D +   G  P++I+
Sbjct  375  NGCIEKALNLFDMMLEKNLKPDIVTYNTLIDGLCKEGDMEKANELWDDMCNRGILPNLIT  434

Query  12   YGCL  1
            Y  L
Sbjct  435  YSIL  438


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 55/115 (48%), Gaps = 0/115 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++  Y R GD  +A E  +KM    + P    Y  L + +     M+EA   
Sbjct  465  PNIATYNSIIKGYCRLGDASKAEEFLQKMIQERVFPDRITYNTLIHGFVKEERMQEAFAL  524

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            + KM+D+G+   V+TY++I+ GF + G ++ A+  F     R      S Y  ++
Sbjct  525  LNKMDDKGVLPDVITYNVIITGFCEQGKMQEADWVFKRMANRGIQPDRSTYTTLV  579


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 89/200 (45%), Gaps = 0/200 (0%)
 Frame = -2

Query  600  PENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNL  421
            PE         ER   P    F  +++   + G   +A  +F+ M  + + P    Y  L
Sbjct  344  PEADELFSEMTERGVAPDFCTFTTLIHGSCKNGCIEKALNLFDMMLEKNLKPDIVTYNTL  403

Query  420  TYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHA  241
                    DME+A      M + GI  +++TYSI++      G V  A  ++ E  E+  
Sbjct  404  IDGLCKEGDMEKANELWDDMCNRGILPNLITYSILIDYHCSKGQVGKAFGYWDEMMEKKI  463

Query  240  TLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLL  61
              + + Y +II   C+  +  +AEE L++M +E +      ++T++ G+      ++   
Sbjct  464  LPNIATYNSIIKGYCRLGDASKAEEFLQKMIQERVFPDRITYNTLIHGFVKEERMQEAFA  523

Query  60   MFDRLKECGFTPSVISYGCL  1
            + +++ + G  P VI+Y  +
Sbjct  524  LLNKMDDKGVLPDVITYNVI  543


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP  + +  ++N + + G   RA+E+  +M + G+VP +              +++EA  
Sbjct  184  KPDVRTYNAVLNGFCKNGKYKRAQELLGEMMAGGLVPNASTSNIFLGRLCKEGNVKEAAR  243

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M   G+   +V++S ++G FAK G +  A  +F E K         IY  +I   C
Sbjct  244  IYNEMLHRGLAPDMVSFSSMIGLFAKKGYMNRALEYFKEMKAAGLVPDNVIYTMLIGGFC  303

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  A ++  EM + G    +  ++T+++G    +   +   +F  + E G  P   
Sbjct  304  KISLISEALKMRDEMVDHGCMPDVVTYNTILNGMCKEQRLPEADELFSEMTERGVAPDFC  363

Query  15   SYGCL  1
            ++  L
Sbjct  364  TFTTL  368


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/190 (21%), Positives = 88/190 (46%), Gaps = 0/190 (0%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
             E+  KP    +  +++   + GD  +A E+++ M +RGI+P    Y+ L   +     +
Sbjct  389  LEKNLKPDIVTYNTLIDGLCKEGDMEKANELWDDMCNRGILPNLITYSILIDYHCSKGQV  448

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
             +A     +M ++ I  ++ TY+ I+ G+ ++G+   AE +  +  +         Y  +
Sbjct  449  GKAFGYWDEMMEKKILPNIATYNSIIKGYCRLGDASKAEEFLQKMIQERVFPDRITYNTL  508

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            I+   +   M  A  LL +M+++G+   +  ++ ++ G+      ++   +F R+   G 
Sbjct  509  IHGFVKEERMQEAFALLNKMDDKGVLPDVITYNVIITGFCEQGKMQEADWVFKRMANRGI  568

Query  30   TPSVISYGCL  1
             P   +Y  L
Sbjct  569  QPDRSTYTTL  578



>ref|XP_010554934.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63080, 
mitochondrial-like [Tarenaya hassleriana]
Length=462

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 91/172 (53%), Gaps = 15/172 (9%)
 Frame = -2

Query  492  RAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISV-------  334
            +A+E++E+M  RG+VP +  YT+L   + +   ++EA     +M D+G+ +         
Sbjct  204  KAKELYEEMIRRGLVPNTITYTSLINGFCMQNRLDEA----EQMVDKGMNLCYEMSRREL  259

Query  333  ----VTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAee  166
                 TY++++ GF +V N++AA+ + LE + +   L    Y  ++  +C+    D+A  
Sbjct  260  VADSFTYNVLIQGFYRVDNLDAAQKFLLEMQYKGHHLDLITYSILLDGHCKNGKTDKALG  319

Query  165  llremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            L  ++++ GI   ISI   M+ G       +K  L+F+ L + G  P+VI+Y
Sbjct  320  LYNKLKKSGIDLNISIHSVMVHGLCKAGKVDKAFLLFNGLLDKGVKPNVITY  371



>ref|XP_010248027.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Nelumbo nucifera]
Length=616

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 95/185 (51%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   + +++N + ++     A+ + + +  +G+ P+   +  L  AY  +  MEEA+ 
Sbjct  373  KPNIVTYNVLINGFCKKRMMKEAKALLDDIEEKGLFPSIITFNTLIDAYCKAGKMEEAIA  432

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              R M + GI+  V TY+ ++ GF K GN+E A     E +++   +    Y  +I A C
Sbjct  433  LRRMMLERGIQAEVSTYNCLISGFCKDGNMEGAGKLLDEMRDKGVRVDLVTYNILISALC  492

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +     +A +LL EM E G++     ++T+MDG+    N    L M  R+++ G   +V+
Sbjct  493  KDGESKKAVKLLNEMVEMGLSPSHVTYNTLMDGFCSEGNLRAALNMRSRMEKEGKRANVV  552

Query  15   SYGCL  1
            +Y  L
Sbjct  553  TYNVL  557


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/185 (23%), Positives = 93/185 (50%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   F ++++ Y +  +   A ++FE+M+ + + P    Y +L  +     ++ +AL 
Sbjct  303  QPNLVTFNILIDGYCKDENLPAAMKLFEEMQRQDLKPNIITYNSLINSLCNKGELNQALH  362

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M    ++ ++VTY++++ GF K   ++ A+    + +E+    S   +  +I A C
Sbjct  363  LWDEMLGLSVKPNIVTYNVLINGFCKKRMMKEAKALLDDIEEKGLFPSIITFNTLIDAYC  422

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   M+ A  L R M E GI A +S ++ ++ G+    N E    + D +++ G    ++
Sbjct  423  KAGKMEEAIALRRMMLERGIQAEVSTYNCLISGFCKDGNMEGAGKLLDEMRDKGVRVDLV  482

Query  15   SYGCL  1
            +Y  L
Sbjct  483  TYNIL  487


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 78/181 (43%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   F  +++ Y + G    A  +   M  RGI      Y  L   +    +ME A   
Sbjct  409  PSIITFNTLIDAYCKAGKMEEAIALRRMMLERGIQAEVSTYNCLISGFCKDGNMEGAGKL  468

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M D+G+ + +VTY+I++    K G  + A     E  E   + S   Y  ++   C 
Sbjct  469  LDEMRDKGVRVDLVTYNILISALCKDGESKKAVKLLNEMVEMGLSPSHVTYNTLMDGFCS  528

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+  A  +   ME+EG  A +  ++ ++ G       E+   + + + E G  P+ I+
Sbjct  529  EGNLRAALNMRSRMEKEGKRANVVTYNVLIRGLCQKGKLEEANDLLNEMLEKGLIPNRIT  588

Query  12   Y  10
            Y
Sbjct  589  Y  589


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/187 (22%), Positives = 82/187 (44%), Gaps = 3/187 (2%)
 Frame = -2

Query  552  PSRKEFGMMVNYY---GRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEA  382
            PS   +  +++ Y   GR    ++A  + ++M    I P    +  L   Y    ++  A
Sbjct  266  PSVITYNTLIDGYCKMGRVSKMYKADALLKEMLLNKIQPNLVTFNILIDGYCKDENLPAA  325

Query  381  LTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYA  202
            +    +M  + ++ +++TY+ ++      G +  A H + E        +   Y  +I  
Sbjct  326  MKLFEEMQRQDLKPNIITYNSLINSLCNKGELNQALHLWDEMLGLSVKPNIVTYNVLING  385

Query  201  NCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
             C+   M  A+ LL ++EE+G+   I  F+T++D Y      E+ + +   + E G    
Sbjct  386  FCKKRMMKEAKALLDDIEEKGLFPSIITFNTLIDAYCKAGKMEEAIALRRMMLERGIQAE  445

Query  21   VISYGCL  1
            V +Y CL
Sbjct  446  VSTYNCL  452



>ref|XP_008241311.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, 
mitochondrial [Prunus mume]
Length=829

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 98/196 (50%), Gaps = 2/196 (1%)
 Frame = -2

Query  597  ENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            E W  V +  E+   P+ + +  ++N YG+     +  ++ E+M ++GI P    Y +L 
Sbjct  454  EEW--VKKMAEKGVCPNLETYNTLINGYGQMRVFDKCFQILEEMENKGIKPNVVSYGSLI  511

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
                    + EA   +R M   GI  +   Y++++GG   VGN++ A  +F E      T
Sbjct  512  NGLCKDGRLLEAEIALRDMISRGISPNAQIYNMLIGGSCTVGNLKDAFRFFDEMASTGIT  571

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
             +   Y ++I+  C+   +  AE+   ++   G +  +  +++++ GY+  RN +KCL +
Sbjct  572  PTLITYNSLIHGLCKKGRVMEAEDYFSQITSGGYSPDVITYNSLISGYSDIRNTQKCLEL  631

Query  57   FDRLKECGFTPSVISY  10
            ++ +K  G  P++ +Y
Sbjct  632  YETMKNLGIKPTIYTY  647


 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +VN Y RR D +RA    E+M   G+ P    +  L   +  +RDM+ A   
Sbjct  397  PDVVIYNTIVNGYCRRCDMNRAILAVEQMEIHGLRPNCITFNTLIDKFCETRDMDTAEEW  456

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            V+KM ++G+  ++ TY+ ++ G+ ++   +       E + +    +   YG++I   C+
Sbjct  457  VKKMAEKGVCPNLETYNTLINGYGQMRVFDKCFQILEEMENKGIKPNVVSYGSLINGLCK  516

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  AE  LR+M   GI+    I++ ++ G     N +     FD +   G TP++I+
Sbjct  517  DGRLLEAEIALRDMISRGISPNAQIYNMLIGGSCTVGNLKDAFRFFDEMASTGITPTLIT  576

Query  12   YGCL  1
            Y  L
Sbjct  577  YNSL  580


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 79/163 (48%), Gaps = 0/163 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A+++ E+M + G  P  + Y+ L        D E +L    +   +G++++  T+S+++ 
Sbjct  313  AKKILEEMEAHGFAPDGFTYSILFDGQFRCGDSEGSLALFEEATRKGVKLNRYTWSVLLN  372

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            G  K GNVE  E    +  E        IY  I+   C+ C+M+RA   + +ME  G+  
Sbjct  373  GLCKQGNVEKLEEVLNKLMETGFVPDVVIYNTIVNGYCRRCDMNRAILAVEQMEIHGLRP  432

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
                F+T++D +  TR+ +       ++ E G  P++ +Y  L
Sbjct  433  NCITFNTLIDKFCETRDMDTAEEWVKKMAEKGVCPNLETYNTL  475


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 87/171 (51%), Gaps = 2/171 (1%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            R GD   +  +FE+   +G+    Y ++ L        ++E+    + K+ + G    VV
Sbjct  341  RCGDSEGSLALFEEATRKGVKLNRYTWSVLLNGLCKQGNVEKLEEVLNKLMETGFVPDVV  400

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI-YGNIIYANCQTCNMDRAeellre  154
             Y+ IV G+ +  ++  A    +E  E H      I +  +I   C+T +MD AEE +++
Sbjct  401  IYNTIVNGYCRRCDMNRA-ILAVEQMEIHGLRPNCITFNTLIDKFCETRDMDTAEEWVKK  459

Query  153  meeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            M E+G+   +  ++T+++GY   R  +KC  + + ++  G  P+V+SYG L
Sbjct  460  MAEKGVCPNLETYNTLINGYGQMRVFDKCFQILEEMENKGIKPNVVSYGSL  510


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 73/161 (45%), Gaps = 2/161 (1%)
 Frame = -2

Query  483  EMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGF  304
            E+FE    +GI P  + Y     A     D+E A   V  M  + + + V  Y++++GG 
Sbjct  177  EIFES--GQGIRPDRFTYGKAVQAAVKMGDLERAGQLVNSMKTKRMSLGVFVYNVLLGGL  234

Query  303  AKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPI  124
             K   +  A+  F E  E     +   Y  +I   C+   +++A EL   M++E +AA I
Sbjct  235  CKENKMRDAQKVFDEMIEGKTAPNLVTYNTLIDGFCKVGELEKAFELRERMKDENVAANI  294

Query  123  SIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              ++TM+ G    +  +    + + ++  GF P   +Y  L
Sbjct  295  VTYNTMLSGLCRAKRMDDAKKILEEMEAHGFAPDGFTYSIL  335


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/199 (26%), Positives = 90/199 (45%), Gaps = 13/199 (7%)
 Frame = -2

Query  636  SSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSR  457
            +S+ F K LE     +  +  + + I +P R  +G  V    + GD  RA ++   M+++
Sbjct  164  TSKQFGKTLEL----FSEIFESGQGI-RPDRFTYGKAVQAAVKMGDLERAGQLVNSMKTK  218

Query  456  GIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIE----ISVVTYSIIVGGFAKVGN  289
             +    + Y  L         M +A    +K+ DE IE     ++VTY+ ++ GF KVG 
Sbjct  219  RMSLGVFVYNVLLGGLCKENKMRDA----QKVFDEMIEGKTAPNLVTYNTLIDGFCKVGE  274

Query  288  VEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHT  109
            +E A       K+ +   +   Y  ++   C+   MD A+++L EME  G A     +  
Sbjct  275  LEKAFELRERMKDENVAANIVTYNTMLSGLCRAKRMDDAKKILEEMEAHGFAPDGFTYSI  334

Query  108  MMDGYTITRNEEKCLLMFD  52
            + DG     + E  L +F+
Sbjct  335  LFDGQFRCGDSEGSLALFE  353



>ref|XP_010529887.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=635

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 93/183 (51%), Gaps = 4/183 (2%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++N +  +     A+++F  M ++G  P +  + ++   Y  +  ++E +  
Sbjct  364  PNTITYTSLINGFCLQNRLGEAKQIFNYMITKGCFPNTVTFNSMINGYCKANRVKEGINL  423

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEA--KERHATLSASIYGNIIYAN  199
              +M+  G+++   TY+I++ GF +VGN++AA+  F E   K+ H  L    Y  ++   
Sbjct  424  FNEMSRRGLDVDSFTYNILIQGFYRVGNLDAAQKLFREMHYKDHHPNLVT--YSILLDGL  481

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C+    D A  L  ++++ GI   IS  + MM G     + ++  + FDRL E G  P V
Sbjct  482  CKNGKTDEALGLYNKLQKSGIDLHISSHNIMMHGLCKVGSVDEAFVFFDRLLEKGVRPDV  541

Query  18   ISY  10
            I+Y
Sbjct  542  ITY  544


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 82/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   F  M+N Y +         +F +M  RG+   S+ Y  L   +    +++ A   
Sbjct  399  PNTVTFNSMINGYCKANRVKEGINLFNEMSRRGLDVDSFTYNILIQGFYRVGNLDAAQKL  458

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M+ +    ++VTYSI++ G  K G  + A   + + ++    L  S +  +++  C+
Sbjct  459  FREMHYKDHHPNLVTYSILLDGLCKNGKTDEALGLYNKLQKSGIDLHISSHNIMMHGLCK  518

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++D A      + E+G+   +  ++ M+ G     +  +   +  ++KE G  P   +
Sbjct  519  VGSVDEAFVFFDRLLEKGVRPDVITYNIMISGLCGKGSLYEVEKIIGKMKEDGCFPDAGT  578

Query  12   YGCL  1
            Y  L
Sbjct  579  YNAL  582



>gb|EMT25987.1| hypothetical protein F775_14273 [Aegilops tauschii]
Length=659

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   F +++N Y +RG    A  MFE MR +G+ P   +Y  +  +      M+ AL  
Sbjct  238  PNHHIFNILINAYAKRGLMDEAMHMFEVMRQQGVNPDVVDYLVVIDSLCKMGRMDAALDK  297

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+  ++V Y  +V G    G+   A+    EA  R    +++ +  +I   C+
Sbjct  298  FNQMVNQGVSPNIVVYRCLVLGSCSHGDFVKAKELISEAVNRGLCSNSAFFYPVINDLCK  357

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  A+++   +   G    + ++ ++MDGY +    E+ L + D +K  G  P  I+
Sbjct  358  EGKVKEAQDMFDFIVGIGQQPDVIMYTSLMDGYCLVGKVEEALRVLDAMKSAGLQPDAIT  417

Query  12   YGCL  1
            YG L
Sbjct  418  YGIL  421


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/211 (23%), Positives = 85/211 (40%), Gaps = 35/211 (17%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            F  ++N   + G    A++MF+ +   G  P    YT+L   Y +   +EEAL  +  M 
Sbjct  348  FYPVINDLCKEGKVKEAQDMFDFIVGIGQQPDVIMYTSLMDGYCLVGKVEEALRVLDAMK  407

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLE---------------------------  259
              G++   +TY I++ G+ K+G +      F+E                           
Sbjct  408  SAGLQPDAITYGILLNGYCKIGRITDGLSLFMEMSLSGVKPTTIMYNIILDGLFCSGRTV  467

Query  258  -AKERHATLSAS-------IYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
             AKE+  T+  S        Y  ++   C+    D A EL +++    +   +   +TM+
Sbjct  468  SAKEKFDTMIESGIPVGIDTYNIVLSGLCKNNCTDEAIELFKKLRAMNVKIDVITLNTMI  527

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
                 TR  E+   +F  +   G  PSV++Y
Sbjct  528  SAMFKTRRIEEAKDLFATISAIGLVPSVVTY  558



>ref|XP_004168332.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680-like [Cucumis sativus]
Length=590

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  + + +++N + + G    A+ +F ++R RG+ PT+  +  L      SR+++E    
Sbjct  221  PKVQYYNILINKFCKEGSIRDAKLIFNEIRKRGLRPTTVSFNTLINGLCKSRNLDEGFRL  280

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             + M +  I   V TYS+++ G  K G ++ AE  F E ++R    +   +  +I    +
Sbjct  281  KKTMEENRIYPDVFTYSVLIHGLCKEGRLDVAEQLFDEMQQRGLRPNGITFTALIDGQYR  340

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            +  MD A     +M   G+   + +++T+++G     +  K   + D +K  G  P  I+
Sbjct  341  SRRMDSAMNTYHQMLTMGVKPDLVMYNTLLNGLCKVGDVNKARKLVDEMKMVGMKPDKIT  400

Query  12   YGCL  1
            Y  L
Sbjct  401  YTTL  404


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 88/185 (48%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  ++N   + GD ++AR++ ++M+  G+ P    YT L   Y    D+E A+ 
Sbjct  360  KPDLVMYNTLLNGLCKVGDVNKARKLVDEMKMVGMKPDKITYTTLIDGYCKEGDLESAME  419

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              + MN+EG+ +  V ++ ++ GF + G V  AE    E  E       + Y  +I   C
Sbjct  420  IRKGMNEEGVVLDNVAFTALISGFCRDGRVRDAERTLREMVEAGMKPDDATYTMVIDGYC  479

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  N+    +LL+EM+  G    +  ++ +M+G       +   ++ + +   G TP  I
Sbjct  480  KKGNVKMGFKLLKEMQINGHKPGVITYNVLMNGLCKQGQMKNANMLLEAMLNLGVTPDDI  539

Query  15   SYGCL  1
            +Y  L
Sbjct  540  TYNIL  544



>ref|XP_010530330.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X1 [Tarenaya hassleriana]
Length=634

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 91/187 (49%), Gaps = 0/187 (0%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
             ER   P+   F  ++NY+ +      A E+++KM  RG+VP +  YT+L   + +   +
Sbjct  321  IERKIMPNVVTFTGLINYFIKESKFLEAEELYKKMIQRGLVPNTITYTSLIDGFCMQNRL  380

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
            +EA      M  EG   +VVT+  ++ G+ K G V+       +  +R    +  +Y  +
Sbjct  381  DEARQIFDSMITEGCFPNVVTFGALINGYCKSGRVDEGMKLLTDMSQRGLVANTCVYNTL  440

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            I   C+  N+D  ++L  EM+  G    +  +  M+DG       E+ L ++D++++ G 
Sbjct  441  IQGLCRGGNLDAGQKLFLEMKCLGPHPDLITYKVMLDGLCKNGKLEEALELYDKMEKSGL  500

Query  30   TPSVISY  10
               ++++
Sbjct  501  NLDIVTH  507


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 85/182 (47%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   F  ++N +  RG+   A  + E+M   G  P    +T +     + R + EA +
Sbjct  151  EPNDVAFNTLINGFCIRGNISAALGLMEQMVDVGQKPDVVTFTTIINGLCLQRRIHEAAS  210

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M ++G +  ++TY  I+ G  K+G+  +A +W    + R   +   IY   I   C
Sbjct  211  LIDRMVEKGCQPDIITYGAIINGICKLGDPASALNWIKMMEGRLMMVDVVIYSTFIDCLC  270

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  N+D A  +  +M++ G+   +  + T+++G   +        +   + E    P+V+
Sbjct  271  KCGNIDGALNIFSKMDDRGVEPDVITYTTLINGLCSSSRWNDASRLLKDMIERKIMPNVV  330

Query  15   SY  10
            ++
Sbjct  331  TF  332


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 85/199 (43%), Gaps = 0/199 (0%)
 Frame = -2

Query  597  ENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            E    + R  E+  +P    +G ++N   + GD   A    + M  R ++     Y+   
Sbjct  207  EAASLIDRMVEKGCQPDIITYGAIINGICKLGDPASALNWIKMMEGRLMMVDVVIYSTFI  266

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
                   +++ AL    KM+D G+E  V+TY+ ++ G         A     +  ER   
Sbjct  267  DCLCKCGNIDGALNIFSKMDDRGVEPDVITYTTLINGLCSSSRWNDASRLLKDMIERKIM  326

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
             +   +  +I    +      AEEL ++M + G+      + +++DG+ +    ++   +
Sbjct  327  PNVVTFTGLINYFIKESKFLEAEELYKKMIQRGLVPNTITYTSLIDGFCMQNRLDEARQI  386

Query  57   FDRLKECGFTPSVISYGCL  1
            FD +   G  P+V+++G L
Sbjct  387  FDSMITEGCFPNVVTFGAL  405


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/179 (22%), Positives = 73/179 (41%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
              +++N + R G  H    +  ++   G  P    +  L   + +  ++  AL  + +M 
Sbjct  122  LSILINCFCRSGQVHLGFSVLGRIMKLGYEPNDVAFNTLINGFCIRGNISAALGLMEQMV  181

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
            D G +  VVT++ I+ G      +  A        E+        YG II   C+  +  
Sbjct  182  DVGQKPDVVTFTTIINGLCLQRRIHEAASLIDRMVEKGCQPDIITYGAIINGICKLGDPA  241

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A   ++ ME   +   + I+ T +D      N +  L +F ++ + G  P VI+Y  L
Sbjct  242  SALNWIKMMEGRLMMVDVVIYSTFIDCLCKCGNIDGALNIFSKMDDRGVEPDVITYTTL  300



>gb|EEC79766.1| hypothetical protein OsI_21159 [Oryza sativa Indica Group]
Length=410

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
             +PS   F ++V+ YG+ G    A   F +M++ G  P++  Y  L   +  +RDM  A 
Sbjct  174  TRPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNMLIAGFCRARDMTRAN  233

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
              +  M + G+E + VTY+I++  FA+  ++  A       ++    + A  YG ++ A 
Sbjct  234  RALSDMKERGLEPTKVTYTILIDSFARENHMGKAFEILAGMEKAGLEVDAHTYGVLVRAL  293

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C   NM  A +L + M E+G+     I+  M+ GY    +  K L +   +++ G  P+ 
Sbjct  294  CMEGNMKDARKLFQSMGEKGVEPSNVIYDMMIYGYGREGSSYKALKLIMEMRQKGLIPNS  353

Query  18   ISYG  7
             SYG
Sbjct  354  ASYG  357


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 80/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            +VN   + GD   AR +F++M   G+ P    YT L + Y      E+      +M   G
Sbjct  44   LVNGCCKGGDVAEARRVFDEMPLLGLAPNEVTYTALMHGYFTHGQREKGFALFEEMRRGG  103

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            +E ++ TY+ ++G + + G  E A   F E   R    +   Y  +I   C+   +  A 
Sbjct  104  VEPNLYTYNCLIGEWCRTGEFERARSLFDEMPVRGIVRNVVSYNTLIAGLCRHGKLWDAA  163

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +LL  M  EG    I  F+ ++DGY         L  F+++K  GF PS ++Y  L
Sbjct  164  KLLDMMRTEGTRPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNML  219


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++  + R G+  RAR +F++M  RGIV     Y  L         + +A  
Sbjct  105  EPNLYTYNCLIGEWCRTGEFERARSLFDEMPVRGIVRNVVSYNTLIAGLCRHGKLWDAAK  164

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M  EG   S++T++++V G+ K G +  A  +F + K      SA  Y  +I   C
Sbjct  165  LLDMMRTEGTRPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNMLIAGFC  224

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M RA   L +M+E G+      +  ++D +    +  K   +   +++ G      
Sbjct  225  RARDMTRANRALSDMKERGLEPTKVTYTILIDSFARENHMGKAFEILAGMEKAGLEVDAH  284

Query  15   SYGCL  1
            +YG L
Sbjct  285  TYGVL  289



>ref|NP_001174544.1| Os05g0583900 [Oryza sativa Japonica Group]
 gb|AAS16889.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH93272.1| Os05g0583900 [Oryza sativa Japonica Group]
Length=467

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS   F ++V+ YG+ G    A   F +M++ G  P++  Y  L   +  +RDM  A  
Sbjct  175  RPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNMLIAGFCRARDMTRANR  234

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M + G+E + VTY+I++  FA+  ++  A       ++    + A  YG ++ A C
Sbjct  235  ALSDMKERGLEPTKVTYTILIDSFARENHMGKAFEILAGMEKAGLEVDAHTYGVLVRALC  294

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
               NM  A +L + M E+G+     I+  M+ GY    +  K L +   +++ G  P+  
Sbjct  295  MEGNMKDARKLFQSMGEKGVEPSNVIYDMMIYGYGREGSSYKALKLIMEMRQKGLIPNSA  354

Query  15   SYG  7
            SYG
Sbjct  355  SYG  357


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 80/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            +VN   + GD   AR +F++M   G+ P    YT L + Y      E+      +M   G
Sbjct  44   LVNGCCKGGDVAEARRVFDEMPLLGLAPNEVTYTALMHGYFTHGQREKGFALFEEMRRGG  103

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            +E ++ TY+ ++G + + G  E A   F E   R    +   Y  +I   C+   +  A 
Sbjct  104  VEPNLYTYNCLIGEWCRTGEFERARSLFDEMPVRGIVRNVVSYNTLIAGLCRHGKLWDAA  163

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +LL  M  EG    I  F+ ++DGY         L  F+++K  GF PS ++Y  L
Sbjct  164  KLLDMMRTEGTRPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNML  219


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++  + R G+  RAR +F++M  RGIV     Y  L         + +A  
Sbjct  105  EPNLYTYNCLIGEWCRTGEFERARSLFDEMPVRGIVRNVVSYNTLIAGLCRHGKLWDAAK  164

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M  EG   S++T++++V G+ K G +  A  +F + K      SA  Y  +I   C
Sbjct  165  LLDMMRTEGTRPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNMLIAGFC  224

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M RA   L +M+E G+      +  ++D +    +  K   +   +++ G      
Sbjct  225  RARDMTRANRALSDMKERGLEPTKVTYTILIDSFARENHMGKAFEILAGMEKAGLEVDAH  284

Query  15   SYGCL  1
            +YG L
Sbjct  285  TYGVL  289



>ref|XP_010043774.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic-like isoform X2 [Eucalyptus grandis]
Length=674

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 95/193 (49%), Gaps = 1/193 (1%)
 Frame = -2

Query  585  AVVRAFERINK-PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            A+V    ++ K P+   +  ++N Y  +     A E+   M  RG  PT   Y+ L   Y
Sbjct  389  AIVDQMIQLGKMPNSVTYNALLNGYCLQNRMKDAMEVLNLMVERGCSPTVVTYSTLINGY  448

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
              ++ M+++    ++M   G+   V+TYS +V GF KVGN+EAAE    E + R  +L  
Sbjct  449  CKAKRMDKSKMLFQEMLQRGLIPDVITYSTLVDGFCKVGNLEAAEELIKEMQSRDLSLDH  508

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
             I  + +   C+   +D+A  LLR+ME+      I  ++ +++G       +  + +FD 
Sbjct  509  YILSSFLDGLCKMQQIDKAMILLRKMEDSKFVLDIVTYNILINGMCDAGKLDDAIGLFDC  568

Query  48   LKECGFTPSVISY  10
            L   G  P+V +Y
Sbjct  569  LHARGLQPNVWTY  581


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  +V+    RG    A  + EKM   GI P    Y ++      S  +EEA  
Sbjct  295  QPNIFTYSSLVHCLCNRGQWKDAMVLLEKMMKAGIEPNDVTYNSVVRGVCNSGHLEEARR  354

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M    +  +VVT+SI+V    K G +  AE    +  +     ++  Y  ++   C
Sbjct  355  LLSHMVQIRVMPNVVTFSILVDTHCKEGLLVEAEAIVDQMIQLGKMPNSVTYNALLNGYC  414

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                M  A E+L  M E G +  +  + T+++GY   +  +K  ++F  + + G  P VI
Sbjct  415  LQNRMKDAMEVLNLMVERGCSPTVVTYSTLINGYCKAKRMDKSKMLFQEMLQRGLIPDVI  474

Query  15   SYGCL  1
            +Y  L
Sbjct  475  TYSTL  479


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  +++     G    A  + ++M   GI P  + Y++L +        ++A+ 
Sbjct  260  KPDVVTYTSLIHSMCDVGQMEDALVLLKEMIRGGIQPNIFTYSSLVHCLCNRGQWKDAMV  319

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM   GIE + VTY+ +V G    G++E A        +     +   +  ++  +C
Sbjct  320  LLEKMMKAGIEPNDVTYNSVVRGVCNSGHLEEARRLLSHMVQIRVMPNVVTFSILVDTHC  379

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  AE ++ +M + G       ++ +++GY +    +  + + + + E G +P+V+
Sbjct  380  KEGLLVEAEAIVDQMIQLGKMPNSVTYNALLNGYCLQNRMKDAMEVLNLMVERGCSPTVV  439

Query  15   SYGCL  1
            +Y  L
Sbjct  440  TYSTL  444



>ref|XP_009356190.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, 
mitochondrial-like [Pyrus x bretschneideri]
Length=722

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 96/205 (47%), Gaps = 7/205 (3%)
 Frame = -2

Query  594  NWHAVVRAFERIN-------KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSY  436
            N H V RA E          KP+   +  M++ + + G+  +A E+  +M+ RG  P   
Sbjct  216  NKHLVTRAKEVYRMMGEAGIKPTIVTYNTMLDSFCKEGEVQQALELLSEMQKRGCFPNDV  275

Query  435  EYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEA  256
             Y  L    +   ++E+A   +++M   G+ I+  TY+ ++ G+   G +E A     E 
Sbjct  276  TYNVLINGLSKKGELEQAKELIKEMMKAGLRITAFTYNPLICGYCNKGLLEEALSLEKEM  335

Query  255  KERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNE  76
              + A  + + Y +++Y  C+   +  A +    M    I   I  ++T++ GY  + N 
Sbjct  336  VVKGANPTVATYNSLMYGLCKWGRITDARDQFSNMLNRNIMPDIVSYNTLIHGYCRSGNL  395

Query  75   EKCLLMFDRLKECGFTPSVISYGCL  1
                ++FD L+   FTP+V++Y  L
Sbjct  396  GAAFILFDELRHRTFTPTVVTYNTL  420


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 73/140 (52%), Gaps = 0/140 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    + + VN   + G+   A  + +KM   GIVP    YT++ +A+  S  + +A   
Sbjct  517  PDLFTYNIFVNGICKLGNLDEAYTLLQKMVRDGIVPDHITYTSMIHAHLESGQLMKAREV  576

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+  SV+TY++++   A  G +E A  +F E +E+    +   Y  +I   C+
Sbjct  577  FYEMLNKGLSPSVITYTVLIHAHAAKGRLELAYMYFSEMQEKRIWPNVITYNALINGLCK  636

Query  192  TCNMDRAeellremeeEGIA  133
               MD+A E   EMEE+GIA
Sbjct  637  VMRMDQAYEYFTEMEEKGIA  656


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 74/152 (49%), Gaps = 0/152 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +++N   ++G+  +A+E+ ++M   G+  T++ Y  L   Y     +EEAL+ 
Sbjct  272  PNDVTYNVLINGLSKKGELEQAKELIKEMMKAGLRITAFTYNPLICGYCNKGLLEEALSL  331

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M  +G   +V TY+ ++ G  K G +  A   F     R+       Y  +I+  C+
Sbjct  332  EKEMVVKGANPTVATYNSLMYGLCKWGRITDARDQFSNMLNRNIMPDIVSYNTLIHGYCR  391

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDG  97
            + N+  A  L  E+        +  ++T+MDG
Sbjct  392  SGNLGAAFILFDELRHRTFTPTVVTYNTLMDG  423


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 75/181 (41%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +++ Y R G+   A  +F+++R R   PT   Y  L        D+  A   
Sbjct  377  PDIVSYNTLIHGYCRSGNLGAAFILFDELRHRTFTPTVVTYNTLMDGLCRFGDLAVAGQL  436

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M ++GI   V TY+I+V G    GN+  A+  F E   +        Y   I    +
Sbjct  437  KKEMTNQGIFPDVFTYTILVNGSCNAGNLSMAKELFDEMLHKGVEPDRFAYNTRIVGELR  496

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +  +A  +  E++  G    +  ++  ++G     N ++   +  ++   G  P  I+
Sbjct  497  LGDPSKAFSMQEEIQARGFPPDLFTYNIFVNGICKLGNLDEAYTLLQKMVRDGIVPDHIT  556

Query  12   Y  10
            Y
Sbjct  557  Y  557


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P R  +   +    R GD  +A  M E++++RG  P  + Y           +++EA T
Sbjct  481  EPDRFAYNTRIVGELRLGDPSKAFSMQEEIQARGFPPDLFTYNIFVNGICKLGNLDEAYT  540

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             ++KM  +GI    +TY+ ++    + G +  A   F E   +  + S   Y  +I+A+ 
Sbjct  541  LLQKMVRDGIVPDHITYTSMIHAHLESGQLMKAREVFYEMLNKGLSPSVITYTVLIHAHA  600

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                ++ A     EM+E+ I   +  ++ +++G       ++    F  ++E G  P+  
Sbjct  601  AKGRLELAYMYFSEMQEKRIWPNVITYNALINGLCKVMRMDQAYEYFTEMEEKGIAPNKY  660

Query  15   SYGCL  1
            +Y  L
Sbjct  661  TYTIL  665



>ref|XP_002514728.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF47834.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=517

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 92/184 (50%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + ++V+   R+GD  RA+ +  +M  +GI PT   YT L +       + EA + 
Sbjct  184  PTVVTYNVLVDACCRQGDVLRAKSLISEMVKKGIEPTVVIYTTLIHGLCSESKLMEAESM  243

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M D G+  ++ TY++++ G+ K  NV+ A H +    +     +   +G +I A C+
Sbjct  244  FRQMKDSGVFPNLYTYNVLMDGYCKTANVKQALHLYQGMLDDGLQPNVVTFGILIDALCK  303

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  A     +M + G+   + +F++++DGY+   N  +   +   +++   +P V +
Sbjct  304  VRELLAARRFFVQMAKFGVVPNVVVFNSLIDGYSKAGNCSEATDLLLEMEKFKISPDVFT  363

Query  12   YGCL  1
            Y  L
Sbjct  364  YSIL  367


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 63/128 (49%), Gaps = 0/128 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   FG++++   +  +   AR  F +M   G+VP    + +L   Y+ + +  EA  
Sbjct  288  QPNVVTFGILIDALCKVRELLAARRFFVQMAKFGVVPNVVVFNSLIDGYSKAGNCSEATD  347

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M    I   V TYSI++    ++G VE A+      ++     ++ +Y ++I   C
Sbjct  348  LLLEMEKFKISPDVFTYSILIKNACRLGTVEEADDILKRMEKEGVPANSVVYNSLIDGYC  407

Query  195  QTCNMDRA  172
            +  NM++A
Sbjct  408  KEGNMEKA  415



>gb|KCW88409.1| hypothetical protein EUGRSUZ_A00796 [Eucalyptus grandis]
Length=574

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 95/193 (49%), Gaps = 1/193 (1%)
 Frame = -2

Query  585  AVVRAFERINK-PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            A+V    ++ K P+   +  ++N Y  +     A E+   M  RG  PT   Y+ L   Y
Sbjct  289  AIVDQMIQLGKMPNSVTYNALLNGYCLQNRMKDAMEVLNLMVERGCSPTVVTYSTLINGY  348

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
              ++ M+++    ++M   G+   V+TYS +V GF KVGN+EAAE    E + R  +L  
Sbjct  349  CKAKRMDKSKMLFQEMLQRGLIPDVITYSTLVDGFCKVGNLEAAEELIKEMQSRDLSLDH  408

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
             I  + +   C+   +D+A  LLR+ME+      I  ++ +++G       +  + +FD 
Sbjct  409  YILSSFLDGLCKMQQIDKAMILLRKMEDSKFVLDIVTYNILINGMCDAGKLDDAIGLFDC  468

Query  48   LKECGFTPSVISY  10
            L   G  P+V +Y
Sbjct  469  LHARGLQPNVWTY  481


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  +V+    RG    A  + EKM   GI P    Y ++      S  +EEA  
Sbjct  195  QPNIFTYSSLVHCLCNRGQWKDAMVLLEKMMKAGIEPNDVTYNSVVRGVCNSGHLEEARR  254

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M    +  +VVT+SI+V    K G +  AE    +  +     ++  Y  ++   C
Sbjct  255  LLSHMVQIRVMPNVVTFSILVDTHCKEGLLVEAEAIVDQMIQLGKMPNSVTYNALLNGYC  314

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                M  A E+L  M E G +  +  + T+++GY   +  +K  ++F  + + G  P VI
Sbjct  315  LQNRMKDAMEVLNLMVERGCSPTVVTYSTLINGYCKAKRMDKSKMLFQEMLQRGLIPDVI  374

Query  15   SYGCL  1
            +Y  L
Sbjct  375  TYSTL  379


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  +++     G    A  + ++M   GI P  + Y++L +        ++A+ 
Sbjct  160  KPDVVTYTSLIHSMCDVGQMEDALVLLKEMIRGGIQPNIFTYSSLVHCLCNRGQWKDAMV  219

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM   GIE + VTY+ +V G    G++E A        +     +   +  ++  +C
Sbjct  220  LLEKMMKAGIEPNDVTYNSVVRGVCNSGHLEEARRLLSHMVQIRVMPNVVTFSILVDTHC  279

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  AE ++ +M + G       ++ +++GY +    +  + + + + E G +P+V+
Sbjct  280  KEGLLVEAEAIVDQMIQLGKMPNSVTYNALLNGYCLQNRMKDAMEVLNLMVERGCSPTVV  339

Query  15   SYGCL  1
            +Y  L
Sbjct  340  TYSTL  344



>ref|XP_010106480.1| hypothetical protein L484_025237 [Morus notabilis]
 gb|EXC10656.1| hypothetical protein L484_025237 [Morus notabilis]
Length=567

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/214 (27%), Positives = 99/214 (46%), Gaps = 11/214 (5%)
 Frame = -2

Query  642  GSSSRNFRKVLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMR  463
            G   R FR + + +   W            P+   +  +++   + GD  RA+ +F KM 
Sbjct  179  GDLDRGFRFLDDLEKMGW-----------SPNVVMYTSLIDGCCKNGDIERAKRLFYKMG  227

Query  462  SRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVE  283
              G+V   Y YT L + +      ++ L    KM  EGI +S  TY+ ++  F   G + 
Sbjct  228  EIGLVANHYTYTVLIHGFFRKGLKKDGLELFEKMKREGILLSTYTYNCLINEFCNDGKLS  287

Query  282  AAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMM  103
            +A   F E  +R    +   Y  +I   C+   +  AE+L+  M+ +G+   +  F+T++
Sbjct  288  SAFEVFDEMHQRGVACNVITYSILICGLCREQRVGEAEKLMHRMKSDGLCPSLITFNTLI  347

Query  102  DGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            DG+    N EK L +F+ LK  G +PS  ++  L
Sbjct  348  DGFCNVGNMEKALSLFEELKSNGHSPSSATFNVL  381


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 89/181 (49%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   F  +++ +   G+  +A  +FE+++S G  P+S  +  L   +  ++D+   +  
Sbjct  338  PSLITFNTLIDGFCNVGNMEKALSLFEELKSNGHSPSSATFNVLIKGFATAKDLARIVGL  397

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            V +M + GI    VTY+I++  F ++ ++E A   F   ++         YG +I+  C 
Sbjct  398  VGEMEERGISPCKVTYTILIDAFIQLDDMEKATKLFSSMEKSGLVADVYAYGVLIHGFCS  457

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM  A +L + M E+ +     I++ +++GY    N  + L     ++E G  P++ S
Sbjct  458  KGNMKEALKLFKSMSEKRLEPTDVIYNMLINGYCKEGNSYRALGFVKEMREKGMFPNIAS  517

Query  12   Y  10
            Y
Sbjct  518  Y  518


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 87/189 (46%), Gaps = 9/189 (5%)
 Frame = -2

Query  540  EFGMMVNYYG---------RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E G++ N+Y          R+G K    E+FEKM+  GI+ ++Y Y  L   +     + 
Sbjct  228  EIGLVANHYTYTVLIHGFFRKGLKKDGLELFEKMKREGILLSTYTYNCLINEFCNDGKLS  287

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
             A     +M+  G+  +V+TYSI++ G  +   V  AE      K      S   +  +I
Sbjct  288  SAFEVFDEMHQRGVACNVITYSILICGLCREQRVGEAEKLMHRMKSDGLCPSLITFNTLI  347

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C   NM++A  L  E++  G +   + F+ ++ G+   ++  + + +   ++E G +
Sbjct  348  DGFCNVGNMEKALSLFEELKSNGHSPSSATFNVLIKGFATAKDLARIVGLVGEMEERGIS  407

Query  27   PSVISYGCL  1
            P  ++Y  L
Sbjct  408  PCKVTYTIL  416


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 85/202 (42%), Gaps = 4/202 (2%)
 Frame = -2

Query  594  NWHAVVRAFERI----NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N    +  FE +    + PS   F +++  +    D  R   +  +M  RGI P    YT
Sbjct  355  NMEKALSLFEELKSNGHSPSSATFNVLIKGFATAKDLARIVGLVGEMEERGISPCKVTYT  414

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L  A+    DME+A      M   G+   V  Y +++ GF   GN++ A   F    E+
Sbjct  415  ILIDAFIQLDDMEKATKLFSSMEKSGLVADVYAYGVLIHGFCSKGNMKEALKLFKSMSEK  474

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
                +  IY  +I   C+  N  RA   ++EM E+G+   I+ ++  +    I     + 
Sbjct  475  RLEPTDVIYNMLINGYCKEGNSYRALGFVKEMREKGMFPNIASYNWTIRLLCIDEKWREA  534

Query  66   LLMFDRLKECGFTPSVISYGCL  1
             ++   +   G TPSV  Y  +
Sbjct  535  TILLKEMIVYGLTPSVSIYNLI  556


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 86/179 (48%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  ++N +   G    A E+F++M  RG+      Y+ L       + + EA   + +M 
Sbjct  273  YNCLINEFCNDGKLSSAFEVFDEMHQRGVACNVITYSILICGLCREQRVGEAEKLMHRMK  332

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
             +G+  S++T++ ++ GF  VGN+E A   F E K    + S++ +  +I       ++ 
Sbjct  333  SDGLCPSLITFNTLIDGFCNVGNMEKALSLFEELKSNGHSPSSATFNVLIKGFATAKDLA  392

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            R   L+ EMEE GI+     +  ++D +    + EK   +F  +++ G    V +YG L
Sbjct  393  RIVGLVGEMEERGISPCKVTYTILIDAFIQLDDMEKATKLFSSMEKSGLVADVYAYGVL  451



>ref|XP_004979539.1| PREDICTED: protein Rf1, mitochondrial-like isoform X1 [Setaria 
italica]
Length=811

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  + F +++  Y + G   RA  +F +MR +G  P    Y  +  A+     M++A+  
Sbjct  388  PDVRIFNVLIKGYAKCGMLDRAMIIFSEMRHQGAKPDVVTYLTVIAAHCRMAKMDDAMEI  447

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M D+G+  S+ TY  ++ GF   G +  A+    E   +          +II + C+
Sbjct  448  FNEMIDQGVAPSIATYQCLIQGFCTHGGLLKAKELVFEMTSKGMRPDIVHLTSIINSLCK  507

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  A+++   +   G+   + ++ ++MDGY +    EK L +FD +   G  P+V+ 
Sbjct  508  EGRVVDAQDIFDLLVSIGLHPDVFVYSSLMDGYCLVGKMEKALRVFDAMVSAGIEPNVVV  567

Query  12   YGCL  1
            YG L
Sbjct  568  YGAL  571


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/170 (23%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = -2

Query  591  WHAVVRAFERINK----PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTN  424
            W+  VR F+ +      P+   +  ++    + G    AR++F+ + ++G  P +  Y  
Sbjct  301  WNEAVRIFKEMTSRGLLPNIATWNSLMASLCKHGKIKEARDVFDSIATKGQEPDTVSYLI  360

Query  423  LTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH  244
            L   Y       +       M  +G+   V  +++++ G+AK G ++ A   F E + + 
Sbjct  361  LLDGYATEGCFVDMTDLFNLMLGDGVAPDVRIFNVLIKGYAKCGMLDRAMIIFSEMRHQG  420

Query  243  ATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGY  94
            A      Y  +I A+C+   MD A E+  EM ++G+A  I+ +  ++ G+
Sbjct  421  AKPDVVTYLTVIAAHCRMAKMDDAMEIFNEMIDQGVAPSIATYQCLIQGF  470


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/163 (23%), Positives = 80/163 (49%), Gaps = 4/163 (2%)
 Frame = -2

Query  492  RAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIV  313
            +A  +  +M  +G+ P ++ YTNL +AY+   +  EA+   ++M   G+  ++ T++ ++
Sbjct  268  KAEAVLRQMVRKGVRPDNWSYTNLIFAYSARGEWNEAVRIFKEMTSRGLLPNIATWNSLM  327

Query  312  GGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII--YANCQTCNMDRAeellremeeEG  139
                K G ++ A   F     +        Y  ++  YA  + C +D   +L   M  +G
Sbjct  328  ASLCKHGKIKEARDVFDSIATKGQEPDTVSYLILLDGYAT-EGCFVDMT-DLFNLMLGDG  385

Query  138  IAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            +A  + IF+ ++ GY      ++ +++F  ++  G  P V++Y
Sbjct  386  VAPDVRIFNVLIKGYAKCGMLDRAMIIFSEMRHQGAKPDVVTY  428


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/171 (24%), Positives = 79/171 (46%), Gaps = 0/171 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P       ++N   + G    A+++F+ + S G+ P  + Y++L   Y +   ME+AL 
Sbjct  492  RPDIVHLTSIINSLCKEGRVVDAQDIFDLLVSIGLHPDVFVYSSLMDGYCLVGKMEKALR  551

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
                M   GIE +VV Y  +V G+ K+G ++     F E   +    S  +Y  ++    
Sbjct  552  VFDAMVSAGIEPNVVVYGALVNGYCKLGRIDDGLTVFREMVHKGIKPSTFMYNIVLDGLF  611

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +      A+E   EM E GI+     ++T++ G       ++ + +F +L+
Sbjct  612  RAGRTVSAKERFHEMIESGISVGTDTYNTVLSGLCKNNCPDEAIALFKKLQ  662



>ref|XP_010043749.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic-like isoform X1 [Eucalyptus grandis]
 ref|XP_010043757.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic-like isoform X1 [Eucalyptus grandis]
 ref|XP_010043765.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, 
chloroplastic-like isoform X1 [Eucalyptus grandis]
Length=686

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 95/193 (49%), Gaps = 1/193 (1%)
 Frame = -2

Query  585  AVVRAFERINK-PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAY  409
            A+V    ++ K P+   +  ++N Y  +     A E+   M  RG  PT   Y+ L   Y
Sbjct  401  AIVDQMIQLGKMPNSVTYNALLNGYCLQNRMKDAMEVLNLMVERGCSPTVVTYSTLINGY  460

Query  408  TVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSA  229
              ++ M+++    ++M   G+   V+TYS +V GF KVGN+EAAE    E + R  +L  
Sbjct  461  CKAKRMDKSKMLFQEMLQRGLIPDVITYSTLVDGFCKVGNLEAAEELIKEMQSRDLSLDH  520

Query  228  SIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDR  49
             I  + +   C+   +D+A  LLR+ME+      I  ++ +++G       +  + +FD 
Sbjct  521  YILSSFLDGLCKMQQIDKAMILLRKMEDSKFVLDIVTYNILINGMCDAGKLDDAIGLFDC  580

Query  48   LKECGFTPSVISY  10
            L   G  P+V +Y
Sbjct  581  LHARGLQPNVWTY  593


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  +V+    RG    A  + EKM   GI P    Y ++      S  +EEA  
Sbjct  307  QPNIFTYSSLVHCLCNRGQWKDAMVLLEKMMKAGIEPNDVTYNSVVRGVCNSGHLEEARR  366

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M    +  +VVT+SI+V    K G +  AE    +  +     ++  Y  ++   C
Sbjct  367  LLSHMVQIRVMPNVVTFSILVDTHCKEGLLVEAEAIVDQMIQLGKMPNSVTYNALLNGYC  426

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                M  A E+L  M E G +  +  + T+++GY   +  +K  ++F  + + G  P VI
Sbjct  427  LQNRMKDAMEVLNLMVERGCSPTVVTYSTLINGYCKAKRMDKSKMLFQEMLQRGLIPDVI  486

Query  15   SYGCL  1
            +Y  L
Sbjct  487  TYSTL  491


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  +++     G    A  + ++M   GI P  + Y++L +        ++A+ 
Sbjct  272  KPDVVTYTSLIHSMCDVGQMEDALVLLKEMIRGGIQPNIFTYSSLVHCLCNRGQWKDAMV  331

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + KM   GIE + VTY+ +V G    G++E A        +     +   +  ++  +C
Sbjct  332  LLEKMMKAGIEPNDVTYNSVVRGVCNSGHLEEARRLLSHMVQIRVMPNVVTFSILVDTHC  391

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  AE ++ +M + G       ++ +++GY +    +  + + + + E G +P+V+
Sbjct  392  KEGLLVEAEAIVDQMIQLGKMPNSVTYNALLNGYCLQNRMKDAMEVLNLMVERGCSPTVV  451

Query  15   SYGCL  1
            +Y  L
Sbjct  452  TYSTL  456



>gb|EEE64841.1| hypothetical protein OsJ_19698 [Oryza sativa Japonica Group]
Length=496

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS   F ++V+ YG+ G    A   F +M++ G  P++  Y  L   +  +RDM  A  
Sbjct  175  RPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNMLIAGFCRARDMTRANR  234

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M + G+E + VTY+I++  FA+  ++  A       ++    + A  YG ++ A C
Sbjct  235  ALSDMKERGLEPTKVTYTILIDSFARENHMGKAFEILAGMEKAGLEVDAHTYGVLVRALC  294

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
               NM  A +L + M E+G+     I+  M+ GY    +  K L +   +++ G  P+  
Sbjct  295  MEGNMKDARKLFQSMGEKGVEPSNVIYDMMIYGYGREGSSYKALKLIMEMRQKGLIPNSA  354

Query  15   SYG  7
            SYG
Sbjct  355  SYG  357


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 80/176 (45%), Gaps = 0/176 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            +VN   + GD   AR +F++M   G+ P    YT L + Y      E+      +M   G
Sbjct  44   LVNGCCKGGDVAEARRVFDEMPLLGLAPNEVTYTALMHGYFTHGQREKGFALFEEMRRGG  103

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            +E ++ TY+ ++G + + G  E A   F E   R    +   Y  +I   C+   +  A 
Sbjct  104  VEPNLYTYNCLIGEWCRTGEFERARSLFDEMPVRGIVRNVVSYNTLIAGLCRHGKLWDAA  163

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            +LL  M  EG    I  F+ ++DGY         L  F+++K  GF PS ++Y  L
Sbjct  164  KLLDMMRTEGTRPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNML  219


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++  + R G+  RAR +F++M  RGIV     Y  L         + +A  
Sbjct  105  EPNLYTYNCLIGEWCRTGEFERARSLFDEMPVRGIVRNVVSYNTLIAGLCRHGKLWDAAK  164

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M  EG   S++T++++V G+ K G +  A  +F + K      SA  Y  +I   C
Sbjct  165  LLDMMRTEGTRPSIITFNLLVDGYGKAGKMSNALPFFNQMKAAGFQPSAVTYNMLIAGFC  224

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  +M RA   L +M+E G+      +  ++D +    +  K   +   +++ G      
Sbjct  225  RARDMTRANRALSDMKERGLEPTKVTYTILIDSFARENHMGKAFEILAGMEKAGLEVDAH  284

Query  15   SYGCL  1
            +YG L
Sbjct  285  TYGVL  289



>ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Vitis vinifera]
Length=762

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 92/185 (50%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+ + +  +++ + R+G  + A  +  +M   G  P+   Y    + + V   MEEAL 
Sbjct  386  RPNERTYTTLIDGFSRQGLLNEAYRILNEMTESGFSPSVVTYNAFIHGHCVLERMEEALG  445

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             V++M ++G+   VV+YS I+ GF + G ++ A     E  E+  +  A  Y ++I   C
Sbjct  446  VVQEMVEKGLAPDVVSYSTIISGFCRKGELDRAFQMKQEMVEKGVSPDAVTYSSLIQGLC  505

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +  A +L +EM + G+      + T+++ Y +  +  K L + D +   GF P  +
Sbjct  506  EMRRLTEACDLSQEMLDMGLPPDEFTYTTLINAYCVEGDLNKALHLHDEMIHKGFLPDAV  565

Query  15   SYGCL  1
            +Y  L
Sbjct  566  TYSVL  570


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/202 (23%), Positives = 92/202 (46%), Gaps = 0/202 (0%)
 Frame = -2

Query  606  SQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            S  E W  +     +   P    +  ++N Y + G+ H+A  +  +M   G+ P+   YT
Sbjct  299  SMKEAWEILEEMGYKGFTPDEVTYNTLLNGYCKEGNFHQALVIHAEMVRNGVSPSVVTYT  358

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
             L  +   +R++  A+    +M   G+  +  TY+ ++ GF++ G +  A     E  E 
Sbjct  359  ALINSMCKARNLNRAMEFFDQMRIRGLRPNERTYTTLIDGFSRQGLLNEAYRILNEMTES  418

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKC  67
              + S   Y   I+ +C    M+ A  +++EM E+G+A  +  + T++ G+      ++ 
Sbjct  419  GFSPSVVTYNAFIHGHCVLERMEEALGVVQEMVEKGLAPDVVSYSTIISGFCRKGELDRA  478

Query  66   LLMFDRLKECGFTPSVISYGCL  1
              M   + E G +P  ++Y  L
Sbjct  479  FQMKQEMVEKGVSPDAVTYSSL  500


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 82/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   + +++N   R G    A E+ E+M  +G  P    Y  L   Y    +  +AL 
Sbjct  281  QPNLISYNVIINGLCREGSMKEAWEILEEMGYKGFTPDEVTYNTLLNGYCKEGNFHQALV  340

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M   G+  SVVTY+ ++    K  N+  A  +F + + R    +   Y  +I    
Sbjct  341  IHAEMVRNGVSPSVVTYTALINSMCKARNLNRAMEFFDQMRIRGLRPNERTYTTLIDGFS  400

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   ++ A  +L EM E G +  +  ++  + G+ +    E+ L +   + E G  P V+
Sbjct  401  RQGLLNEAYRILNEMTESGFSPSVVTYNAFIHGHCVLERMEEALGVVQEMVEKGLAPDVV  460

Query  15   SYGCL  1
            SY  +
Sbjct  461  SYSTI  465


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/181 (24%), Positives = 82/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ Y + G    A  + + M S+G+ P    Y  +         M+EA   
Sbjct  247  PNVVTYNTLIDAYCKMGRIDEAFGLLKSMSSKGMQPNLISYNVIINGLCREGSMKEAWEI  306

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +M  +G     VTY+ ++ G+ K GN   A     E      + S   Y  +I + C+
Sbjct  307  LEEMGYKGFTPDEVTYNTLLNGYCKEGNFHQALVIHAEMVRNGVSPSVVTYTALINSMCK  366

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N++RA E   +M   G+      + T++DG++      +   + + + E GF+PSV++
Sbjct  367  ARNLNRAMEFFDQMRIRGLRPNERTYTTLIDGFSRQGLLNEAYRILNEMTESGFSPSVVT  426

Query  12   Y  10
            Y
Sbjct  427  Y  427



>ref|XP_002892307.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68566.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=1164

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++N Y R G+  +  ++ EKM+ +G+ P SY Y ++         + EA   
Sbjct  702  PDVISYSTVINGYCRFGELDKVWKLIEKMKQKGLKPNSYTYGSIIGLLCRICKLAEAEEA  761

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M  +GI    + Y+ +V GF K G++ AA  +F E   R  T     Y  II   CQ
Sbjct  762  FSEMIGQGILPDTIVYTTLVDGFCKRGDIRAASKFFYEMHSRDITPDVLTYTAIISGFCQ  821

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M  A +L  EM   G+   I  F  +M+GY    + +    + + + + G +P+V++
Sbjct  822  IGDMVEAGKLFHEMLCRGLEPDIITFTELMNGYCKAGHIKDAFRVHNHMIQAGCSPNVVT  881

Query  12   YGCL  1
            Y  L
Sbjct  882  YTTL  885


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555   KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
             +P    F  ++N Y + G    A  +   M   G  P    YT L        D++ A  
Sbjct  841   EPDIITFTELMNGYCKAGHIKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCKEGDLDSANE  900

Query  375   CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              + +M   G++ ++ TY+ IV G  K GN+E A     E +          Y  ++ A C
Sbjct  901   LLHEMWKIGLQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTLMDAYC  960

Query  195   QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
             ++  MD+A+E+L EM  +G+   I  F+ +M+G+ +    E    + + +   G  P+  
Sbjct  961   KSGEMDKAQEILTEMLGKGLQPTIVTFNVLMNGFCLHGMLEDGEKLLNWMLAKGIAPNAT  1020

Query  15    SYGCL  1
             ++ CL
Sbjct  1021  TFNCL  1025


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 85/197 (43%), Gaps = 0/197 (0%)
 Frame = -2

Query  591  WHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYA  412
            W  + +  ++  KP+   +G ++    R      A E F +M  +GI+P +  YT L   
Sbjct  724  WKLIEKMKQKGLKPNSYTYGSIIGLLCRICKLAEAEEAFSEMIGQGILPDTIVYTTLVDG  783

Query  411  YTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLS  232
            +    D+  A     +M+   I   V+TY+ I+ GF ++G++  A   F E   R     
Sbjct  784  FCKRGDIRAASKFFYEMHSRDITPDVLTYTAIISGFCQIGDMVEAGKLFHEMLCRGLEPD  843

Query  231  ASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFD  52
               +  ++   C+  ++  A  +   M + G +  +  + T++DG     + +    +  
Sbjct  844  IITFTELMNGYCKAGHIKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCKEGDLDSANELLH  903

Query  51   RLKECGFTPSVISYGCL  1
             + + G  P++ +Y  +
Sbjct  904  EMWKIGLQPNIFTYNSI  920


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = -2

Query  552   PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
             P+   F  +V  Y  R +   A  +++ M SRG+ P    Y NL   +  +R+M+EA   
Sbjct  1017  PNATTFNCLVKQYCIRNNLKAATAIYKDMCSRGVEPDGKTYENLVKGHCNARNMKEAWFL  1076

Query  372   VRKMNDEGIEISVVTYSIIVGGFAK  298
              ++M  +G  +SV TYS+++ GF K
Sbjct  1077  FQEMKGKGFSVSVSTYSVLIKGFFK  1101



>gb|EYU40330.1| hypothetical protein MIMGU_mgv1a025391mg, partial [Erythranthe 
guttata]
Length=849

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F   ++   + G   +A +MF KM S+G++P ++ Y +L   +    +++EA   
Sbjct  570  PDAVAFSAFIDGLSKGGFVEKAYDMFLKMTSKGLLPNNFAYNSLISGFCNCGNLDEAWKL  629

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+   ++T++II+ GF + G + +A + +++            Y  +I   C+
Sbjct  630  EMEMREKGLIPDLITFNIIIKGFCRQGRMTSAMNTYIDMHRNGFIADTVTYNTLISGFCK  689

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M  AE     ME  G    +  ++T + GY  ++   + ++MFD L   G  P  ++
Sbjct  690  QFDMLNAENWANRMESSGWGPDVITYNTQIHGYCRSKRMNQAIMMFDDLISSGIVPDTVT  749

Query  12   YGCL  1
            Y  L
Sbjct  750  YNTL  753


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 84/180 (47%), Gaps = 0/180 (0%)
 Frame = -2

Query  549  SRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCV  370
            S+  F ++++ Y ++GD  RA +++++M S G+ P +  ++      +    +E+A    
Sbjct  536  SKVAFTVVLDGYFKKGDMMRAHDLWQEMESMGVAPDAVAFSAFIDGLSKGGFVEKAYDMF  595

Query  369  RKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQT  190
             KM  +G+  +   Y+ ++ GF   GN++ A    +E +E+        +  II   C+ 
Sbjct  596  LKMTSKGLLPNNFAYNSLISGFCNCGNLDEAWKLEMEMREKGLIPDLITFNIIIKGFCRQ  655

Query  189  CNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
              M  A     +M   G  A    ++T++ G+    +        +R++  G+ P VI+Y
Sbjct  656  GRMTSAMNTYIDMHRNGFIADTVTYNTLISGFCKQFDMLNAENWANRMESSGWGPDVITY  715


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/187 (23%), Positives = 83/187 (44%), Gaps = 4/187 (2%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSR--DMEEA  382
            +PS     ++       GD  R  ++F  M  +G +P+ Y Y  +   +       + E+
Sbjct  219  RPSVSAVCVLFKLLLMLGDFSRVWKLFRDMVRKGPIPSIYVYNMMVLGFCRQGCISIGES  278

Query  381  LTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYA  202
            L CV  M   G E  V TY+I++  +   G    A  W     E     S++ +  +I A
Sbjct  279  LLCV--MGKYGCEPDVHTYNILINAYCVRGWSWDALDWVDVMVENGCKPSSATFSTVINA  336

Query  201  NCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
             C+  N+ +A  +   M+E G+     +++ +MDGY   R      +++++++  G  P 
Sbjct  337  FCKEGNIVKARNVFDGMQEMGVFPNTVLYNALMDGYVKAREIGLANMLYEKMRRNGVVPD  396

Query  21   VISYGCL  1
             +++  L
Sbjct  397  SVTFNIL  403



>ref|XP_010518883.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518884.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518885.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518886.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010518887.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
Length=537

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 89/173 (51%), Gaps = 0/173 (0%)
 Frame = -2

Query  528  MVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEG  349
            +++Y  + G    A  +F KM S GIVP    ++++   Y  +  ++E L    +M+  G
Sbjct  274  IIDYLCKAGHVDGALNLFGKMDSCGIVPDVVTFSSMINGYCKANRVDEGLNLFYEMSRRG  333

Query  348  IEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAe  169
            +    +TY+I++ GF +VGN+ AA+ +F+E + +        Y  ++   C+    D A 
Sbjct  334  LVADAITYNILIQGFYRVGNLGAAQKFFMEMQYKGHRPDLVTYIILLDGLCKNGKTDMAL  393

Query  168  ellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
             L  ++++ GI   I +   MM G       ++ L++F++L + G  P+VI Y
Sbjct  394  CLYNKLDKSGIDLHIPLHSCMMHGLCKVGRVDEALILFNKLLDRGVKPNVIMY  446


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/185 (23%), Positives = 81/185 (44%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   + ++ +     G    A  + ++M   G  P    +  L   + +   + EAL+
Sbjct  160  KPNVVTYNILAHGLCIHGKISAALNLVDQMVEEGYKPNVVTFNTLVNGFCLEGRVSEALS  219

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             + +M     + +VVT+ I++ G  K  +   A +   + +E H  +   IY  II   C
Sbjct  220  LLDQMLKMDYQPNVVTFGIVINGACKARDYALAMNLLEKMEEMHIEIDIVIYHTIIDYLC  279

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  ++D A  L  +M+  GI   +  F +M++GY      ++ L +F  +   G     I
Sbjct  280  KAGHVDGALNLFGKMDSCGIVPDVVTFSSMINGYCKANRVDEGLNLFYEMSRRGLVADAI  339

Query  15   SYGCL  1
            +Y  L
Sbjct  340  TYNIL  344


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 71/154 (46%), Gaps = 0/154 (0%)
 Frame = -2

Query  471  KMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVG  292
            K+   G  P    Y  L +   +   +  AL  V +M +EG + +VVT++ +V GF   G
Sbjct  153  KILKLGYKPNVVTYNILAHGLCIHGKISAALNLVDQMVEEGYKPNVVTFNTLVNGFCLEG  212

Query  291  NVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFH  112
             V  A     +  +     +   +G +I   C+  +   A  LL +MEE  I   I I+H
Sbjct  213  RVSEALSLLDQMLKMDYQPNVVTFGIVINGACKARDYALAMNLLEKMEEMHIEIDIVIYH  272

Query  111  TMMDGYTITRNEEKCLLMFDRLKECGFTPSVISY  10
            T++D      + +  L +F ++  CG  P V+++
Sbjct  273  TIIDYLCKAGHVDGALNLFGKMDSCGIVPDVVTF  306



>ref|XP_010052756.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
[Eucalyptus grandis]
 ref|XP_010052757.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
[Eucalyptus grandis]
 ref|XP_010052758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
[Eucalyptus grandis]
 ref|XP_010052760.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
[Eucalyptus grandis]
 ref|XP_010052761.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
[Eucalyptus grandis]
Length=905

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    F   ++   + G    A E+F++M  R +VP SY Y+ L   +  S  + EA+  
Sbjct  594  PDVIAFSAYIDGLSKAGFVEEAYEIFQEMLRRELVPNSYIYSTLISGFCDSGKLNEAVRL  653

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R+M  +G+   V T ++I+ GF K G +++A   +L+      T     Y  +I   C+
Sbjct  654  EREMRQKGLLPDVFTSNVIIDGFCKHGKLKSAMDAYLDMHRIGLTPDIVTYNTLINGYCK  713

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +M  A++ + E+   G +  I+ F+  + G+  +R   + ++  D L   G  P++++
Sbjct  714  AFDMTGADKFMNEIYASGWSPDITTFNIRIHGFCCSRKMSRAVMTLDELAAAGVAPNIVT  773

Query  12   YGCL  1
            Y  +
Sbjct  774  YNTM  777


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 80/167 (48%), Gaps = 2/167 (1%)
 Frame = -2

Query  594  NWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTY  415
            NW  V    ER  +PS   F  +++   + G+  RAR+ F+ +   G+   ++ Y +L  
Sbjct  337  NW--VYLMIERGCRPSNVTFNTVISALCKDGNVARARQFFDSVPEMGLSGNTFMYNSLMD  394

Query  414  AYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATL  235
             Y  + D+ +A     +M   GI    VT++I+VGG  K G  E  +  F +    +   
Sbjct  395  GYVKAGDILQANMLYDEMWSNGIPPDCVTFNILVGGNYKYGREEDCDRLFKDMLASNLLP  454

Query  234  SASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGY  94
              S+Y   I   C    +D A ELLR++ E+G    ++ F+T++  Y
Sbjct  455  KGSLYDITIAGLCWAGQIDEAVELLRDILEKGEPVDLTAFNTIIAAY  501


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/184 (22%), Positives = 77/184 (42%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS     +++    R GD     + F  M S+G  P+      +   +     +  A   
Sbjct  244  PSESAMVILLKSLLRVGDFSNVWKAFRDMISKGPFPSEKSVNVVLLGFCRKGCVRIAENL  303

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M   G E  V +Y+I++G +   G    A +W     ER    S   +  +I A C+
Sbjct  304  FHVMGKFGFEPDVYSYNILIGAYCAGGRALVAINWVYLMIERGCRPSNVTFNTVISALCK  363

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+ RA +    + E G++    +++++MDGY    +  +  +++D +   G  P  ++
Sbjct  364  DGNVARARQFFDSVPEMGLSGNTFMYNSLMDGYVKAGDILQANMLYDEMWSNGIPPDCVT  423

Query  12   YGCL  1
            +  L
Sbjct  424  FNIL  427


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 45/189 (24%), Positives = 74/189 (39%), Gaps = 0/189 (0%)
 Frame = -2

Query  591  WHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYA  412
            W A      +   PS K   +++  + R+G    A  +F  M   G  P  Y Y  L  A
Sbjct  266  WKAFRDMISKGPFPSEKSVNVVLLGFCRKGCVRIAENLFHVMGKFGFEPDVYSYNILIGA  325

Query  411  YTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLS  232
            Y        A+  V  M + G   S VT++ ++    K GNV  A  +F    E   + +
Sbjct  326  YCAGGRALVAINWVYLMIERGCRPSNVTFNTVISALCKDGNVARARQFFDSVPEMGLSGN  385

Query  231  ASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFD  52
              +Y +++    +  ++ +A  L  EM   GI      F+ ++ G      EE C  +F 
Sbjct  386  TFMYNSLMDGYVKAGDILQANMLYDEMWSNGIPPDCVTFNILVGGNYKYGREEDCDRLFK  445

Query  51   RLKECGFTP  25
             +      P
Sbjct  446  DMLASNLLP  454



>ref|XP_008778703.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008778704.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008778705.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008778706.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008778707.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008778708.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008778710.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008778711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008778712.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, 
mitochondrial-like [Phoenix dactylifera]
Length=720

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 99/201 (49%), Gaps = 7/201 (3%)
 Frame = -2

Query  582  VVRAFERINK-------PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTN  424
            +V AF+ +N+       P+   F +++N   + G   RA E+F  M  RG+VP    YT 
Sbjct  486  IVEAFKFLNEMHDWGIVPNIFMFKVIINALCKEGRLDRAWEVFGAMTKRGLVPDVVVYTI  545

Query  423  LTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH  244
            L        ++EEA    R+M+ EG+  +  TY+ ++ GF K G +  A  +F E   + 
Sbjct  546  LIDGMVKMLNLEEAYRLFRRMSYEGVMPNSFTYTSLINGFCKSGRLPEALSFFEEMIGKG  605

Query  243  ATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCL  64
             T    +Y ++I   C+  +M++A EL  +M + G+   +  +  ++DGY         +
Sbjct  606  FTPDRVVYTSMIDGYCRCRDMEKAVELFNKMVQNGLLPDVFTYTCLIDGYCKLCQMGIAV  665

Query  63   LMFDRLKECGFTPSVISYGCL  1
             + D + + G TP+ I+Y  L
Sbjct  666  SLMDEMMKMGLTPNEITYTAL  686


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 87/181 (48%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    + ++++ + + G+  +  ++  +M + GI+PT   Y++L +   V  +M  AL  
Sbjct  328  PDMHSYSILIDGHCKIGEVLKGYDLLVEMVNNGIMPTIVSYSSLFHGLCVKGEMGSALNL  387

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             R++ D+G ++ +V YSI++ G+ + G+++ A   + E  + +       Y +IIY  C+
Sbjct  388  FRELRDQGCDLDLVAYSILIDGYCRHGDLDGAYELWQEMVQNNFIPDVFSYTSIIYGYCK  447

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  A +    M   G+   +     ++DG+   R   +     + + + G  P++  
Sbjct  448  KRCLKEALDHFELMLHSGVMPSVVTCTVIVDGFCKERLIVEAFKFLNEMHDWGIVPNIFM  507

Query  12   Y  10
            +
Sbjct  508  F  508


 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/207 (24%), Positives = 92/207 (44%), Gaps = 5/207 (2%)
 Frame = -2

Query  615  VLESQPENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSY  436
            +LE   E +    R   ++  P    F +++  +  R +   A+ +F+ MR  G  P  Y
Sbjct  168  MLEDALEVYMEAKRIGLKVGVPL---FNLLLKCFVERSEVDCAKRLFDDMRISGPSPNVY  224

Query  435  EYTNLTYAYTVSR--DMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFL  262
             YT +   YT     DM+EA   +++M   G+  + VTY   + G    GN E+A  +  
Sbjct  225  TYTIMMDLYTKREMLDMDEADGILKEMEHNGVSPNAVTYGTYIRGLCGAGNPESAWEFLR  284

Query  261  EAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITR  82
            + ++R    +   Y  +I   C    + +A ++L EM+  G+   +  +  ++DG+    
Sbjct  285  DLQDRGLPHNNYCYNAVILGFCWAGELHKALKVLDEMKLCGLTPDMHSYSILIDGHCKIG  344

Query  81   NEEKCLLMFDRLKECGFTPSVISYGCL  1
               K   +   +   G  P+++SY  L
Sbjct  345  EVLKGYDLLVEMVNNGIMPTIVSYSSL  371


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/165 (25%), Positives = 75/165 (45%), Gaps = 4/165 (2%)
 Frame = -2

Query  594  NWHAVVRAFERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYT  427
            N     R F R++     P+   +  ++N + + G    A   FE+M  +G  P    YT
Sbjct  555  NLEEAYRLFRRMSYEGVMPNSFTYTSLINGFCKSGRLPEALSFFEEMIGKGFTPDRVVYT  614

Query  426  NLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKER  247
            ++   Y   RDME+A+    KM   G+   V TY+ ++ G+ K+  +  A     E  + 
Sbjct  615  SMIDGYCRCRDMEKAVELFNKMVQNGLLPDVFTYTCLIDGYCKLCQMGIAVSLMDEMMKM  674

Query  246  HATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFH  112
              T +   Y  +I    +  + D+A E+ + M ++GI++    +H
Sbjct  675  GLTPNEITYTALITGYRKMGDWDKAYEIYKIMMKQGISSDALNYH  719


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 82/164 (50%), Gaps = 0/164 (0%)
 Frame = -2

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            G+ H+A ++ ++M+  G+ P  + Y+ L   +    ++ +    + +M + GI  ++V+Y
Sbjct  309  GELHKALKVLDEMKLCGLTPDMHSYSILIDGHCKIGEVLKGYDLLVEMVNNGIMPTIVSY  368

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremee  145
            S +  G    G + +A + F E +++   L    Y  +I   C+  ++D A EL +EM +
Sbjct  369  SSLFHGLCVKGEMGSALNLFRELRDQGCDLDLVAYSILIDGYCRHGDLDGAYELWQEMVQ  428

Query  144  EGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
                  +  + +++ GY   R  ++ L  F+ +   G  PSV++
Sbjct  429  NNFIPDVFSYTSIIYGYCKKRCLKEALDHFELMLHSGVMPSVVT  472


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 81/181 (45%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    + ++++   +  +   A  +F +M   G++P S+ YT+L   +  S  + EAL+ 
Sbjct  538  PDVVVYTILIDGMVKMLNLEEAYRLFRRMSYEGVMPNSFTYTSLINGFCKSGRLPEALSF  597

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M  +G     V Y+ ++ G+ +  ++E A   F +  +         Y  +I   C+
Sbjct  598  FEEMIGKGFTPDRVVYTSMIDGYCRCRDMEKAVELFNKMVQNGLLPDVFTYTCLIDGYCK  657

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
             C M  A  L+ EM + G+      +  ++ GY    + +K   ++  + + G +   ++
Sbjct  658  LCQMGIAVSLMDEMMKMGLTPNEITYTALITGYRKMGDWDKAYEIYKIMMKQGISSDALN  717

Query  12   Y  10
            Y
Sbjct  718  Y  718



>ref|XP_008445872.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial [Cucumis melo]
 ref|XP_008445873.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial [Cucumis melo]
 ref|XP_008445874.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial [Cucumis melo]
 ref|XP_008445875.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial [Cucumis melo]
Length=1033

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 92/182 (51%), Gaps = 0/182 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP+   +G  +N Y + G+   A   F+ M S GIVP +  YT L   Y    +  EAL+
Sbjct  554  KPNAHTYGAFINLYSKSGEIQVAERYFKDMLSSGIVPNNVIYTILINGYCDVGNTVEALS  613

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
              + M ++G+   V  YS I+   +K G  + A   FLE  ++       +Y ++I   C
Sbjct  614  TFKCMFEKGLIPDVRAYSAIIHSLSKNGKTKEAMGVFLEFLKKGLAPDVFLYNSLISGFC  673

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +  ++++A +L  EM   GI   I +++T+++G       +K   +FD+++     P+V+
Sbjct  674  KEGDIEKASQLYEEMLHNGINPNIVVYNTLINGLCKLGEVKKARELFDKIEGKDLVPNVV  733

Query  15   SY  10
            +Y
Sbjct  734  TY  735


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 81/172 (47%), Gaps = 0/172 (0%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
            FE+   P  + +  +++   + G    A  +F +   +G+ P  + Y +L   +    D+
Sbjct  619  FEKGLIPDVRAYSAIIHSLSKNGKTKEAMGVFLEFLKKGLAPDVFLYNSLISGFCKEGDI  678

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
            E+A     +M   GI  ++V Y+ ++ G  K+G V+ A   F + + +    +   Y  I
Sbjct  679  EKASQLYEEMLHNGINPNIVVYNTLINGLCKLGEVKKARELFDKIEGKDLVPNVVTYSTI  738

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMF  55
            +   C++ N+  A +L  EM  +GI+    I+  ++DG     N EK L +F
Sbjct  739  VDGYCKSGNLTEAFKLFDEMISKGISPDGYIYCILIDGCGKEGNLEKALSLF  790


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 87/184 (47%), Gaps = 1/184 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++N   + G+  +ARE+F+K+  + +VP    Y+ +   Y  S ++ EA   
Sbjct  695  PNIVVYNTLINGLCKLGEVKKARELFDKIEGKDLVPNVVTYSTIVDGYCKSGNLTEAFKL  754

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M  +GI      Y I++ G  K GN+E A   F EA ++    S S + ++I + C+
Sbjct  755  FDEMISKGISPDGYIYCILIDGCGKEGNLEKALSLFHEALQKSVA-SLSAFNSLIDSFCK  813

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  A EL  +M ++ +      +  ++D Y      E+   +F  ++     P+ ++
Sbjct  814  HGKVIEARELFDDMVDKKVTPNSVTYTILIDAYGRAEMMEEAEQLFLDMEMRNIIPNTLT  873

Query  12   YGCL  1
            Y  L
Sbjct  874  YTSL  877


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/185 (22%), Positives = 80/185 (43%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KPS   +G ++  Y +      A E+ + M + G++P  + Y  L      ++ +EEA  
Sbjct  484  KPSVFMYGTLIKAYVQESRYETAIELLKVMIANGVLPDLFCYNCLIIGLCRAKKVEEAKM  543

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             +  M ++GI+ +  TY   +  ++K G ++ AE +F +        +  IY  +I   C
Sbjct  544  LLVDMGEKGIKPNAHTYGAFINLYSKSGEIQVAERYFKDMLSSGIVPNNVIYTILINGYC  603

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
               N   A    + M E+G+   +  +  ++   +     ++ + +F    + G  P V 
Sbjct  604  DVGNTVEALSTFKCMFEKGLIPDVRAYSAIIHSLSKNGKTKEAMGVFLEFLKKGLAPDVF  663

Query  15   SYGCL  1
             Y  L
Sbjct  664  LYNSL  668


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 67/149 (45%), Gaps = 0/149 (0%)
 Frame = -2

Query  549  SRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCV  370
            S   F  +++ + + G    ARE+F+ M  + + P S  YT L  AY  +  MEEA    
Sbjct  800  SLSAFNSLIDSFCKHGKVIEARELFDDMVDKKVTPNSVTYTILIDAYGRAEMMEEAEQLF  859

Query  369  RKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQT  190
              M    I  + +TY+ ++ G+ ++GN       F + + R     A  YG +  A C+ 
Sbjct  860  LDMEMRNIIPNTLTYTSLLLGYNQIGNRFKMISLFKDMEARGIACDAIAYGVMASAYCKE  919

Query  189  CNMDRAeellremeeEGIAAPISIFHTMM  103
                 A +LL +   EGI     +F  ++
Sbjct  920  GKSLEALKLLNKSLVEGIKLEDDVFDALI  948


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/165 (22%), Positives = 75/165 (45%), Gaps = 0/165 (0%)
 Frame = -2

Query  495  HRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSII  316
              A+ +   M  +GI P ++ Y      Y+ S +++ A    + M   GI  + V Y+I+
Sbjct  539  EEAKMLLVDMGEKGIKPNAHTYGAFINLYSKSGEIQVAERYFKDMLSSGIVPNNVIYTIL  598

Query  315  VGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGI  136
            + G+  VGN   A   F    E+        Y  II++  +      A  +  E  ++G+
Sbjct  599  INGYCDVGNTVEALSTFKCMFEKGLIPDVRAYSAIIHSLSKNGKTKEAMGVFLEFLKKGL  658

Query  135  AAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            A  + ++++++ G+    + EK   +++ +   G  P+++ Y  L
Sbjct  659  APDVFLYNSLISGFCKEGDIEKASQLYEEMLHNGINPNIVVYNTL  703


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/186 (20%), Positives = 79/186 (42%), Gaps = 0/186 (0%)
 Frame = -2

Query  558  NKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEAL  379
            + P+      +++ + + G    A  + ++M +RG+      Y  +      + +M +A+
Sbjct  343  SNPNHFTCSALIDGFMKEGTIEEALSIKDEMITRGLKLNVVTYNAMIGGIAKAGEMGKAM  402

Query  378  TCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYAN  199
                +M   GIE    TY+ ++ G+ K  ++  A     E K R+  LS      +I   
Sbjct  403  ALFNEMLMAGIEPDTWTYNTLIDGYLKSHDMAKACELLAEMKARNLMLSPFTCSVLISGL  462

Query  198  CQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSV  19
            C   ++ +A E+L +M   G+   + ++ T++  Y      E  + +   +   G  P +
Sbjct  463  CHCGDLQKANEVLDQMIRSGVKPSVFMYGTLIKAYVQESRYETAIELLKVMIANGVLPDL  522

Query  18   ISYGCL  1
              Y CL
Sbjct  523  FCYNCL  528



>ref|XP_008790931.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Phoenix dactylifera]
Length=743

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +VN Y R+GD H+A  +  +M  +G+ P    YT+L  A   + ++  A+  
Sbjct  305  PDAITYNTLVNGYCRKGDVHKALVLHAEMAQKGVAPNVVTYTSLISAMCKAGNLARAMEF  364

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M + G++++ +T++ ++ GFAK G ++ A     E +E     S   Y  +I   C 
Sbjct  365  AKQMRERGLQLNEITFTTLIDGFAKKGFLDDALLLMKEMQESGILPSVVSYNALINGYCT  424

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               MD A E++REME  G+   +  + T++ GY      E    +   +   G  P  I+
Sbjct  425  LGRMDEALEIIREMEGNGLVPDVVTYSTLLSGYCKNGELEMAFQLNREMVAKGVLPDAIT  484

Query  12   YGCL  1
            Y  L
Sbjct  485  YSSL  488


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 88/179 (49%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            F  +++ + ++G    A  + ++M+  GI+P+   Y  L   Y     M+EAL  +R+M 
Sbjct  380  FTTLIDGFAKKGFLDDALLLMKEMQESGILPSVVSYNALINGYCTLGRMDEALEIIREME  439

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G+   VVTYS ++ G+ K G +E A     E   +     A  Y ++I   C+   +D
Sbjct  440  GNGLVPDVVTYSTLLSGYCKNGELEMAFQLNREMVAKGVLPDAITYSSLIRGLCEVRRLD  499

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A EL+ +M   G+      + T++D +    + +K LL+ D + + G  P V++Y  L
Sbjct  500  NAHELVEKMLSLGLHPDEFTYTTLIDAHCKEGDIKKALLLHDEMTKKGILPDVVTYNVL  558


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 85/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  +++ + + G    A  + + M  +G+ P +  Y  +         ++E    
Sbjct  235  PNVVTYNTLIDGHCKSGKADDAFGLLKTMHEKGVQPNAVTYNTIINGLCREGRVKETGKV  294

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            V +M  EG     +TY+ +V G+ + G+V  A     E  ++    +   Y ++I A C+
Sbjct  295  VDEMAREGFSPDAITYNTLVNGYCRKGDVHKALVLHAEMAQKGVAPNVVTYTSLISAMCK  354

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+ RA E  ++M E G+      F T++DG+      +  LL+   ++E G  PSV+S
Sbjct  355  AGNLARAMEFAKQMRERGLQLNEITFTTLIDGFAKKGFLDDALLLMKEMQESGILPSVVS  414

Query  12   YGCL  1
            Y  L
Sbjct  415  YNAL  418


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 87/185 (47%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   +  ++N   R G      ++ ++M   G  P +  Y  L   Y    D+ +AL 
Sbjct  269  QPNAVTYNTIINGLCREGRVKETGKVVDEMAREGFSPDAITYNTLVNGYCRKGDVHKALV  328

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M  +G+  +VVTY+ ++    K GN+  A  +  + +ER   L+   +  +I    
Sbjct  329  LHAEMAQKGVAPNVVTYTSLISAMCKAGNLARAMEFAKQMRERGLQLNEITFTTLIDGFA  388

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            +   +D A  L++EM+E GI   +  ++ +++GY      ++ L +   ++  G  P V+
Sbjct  389  KKGFLDDALLLMKEMQESGILPSVVSYNALINGYCTLGRMDEALEIIREMEGNGLVPDVV  448

Query  15   SYGCL  1
            +Y  L
Sbjct  449  TYSTL  453


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 7/108 (6%)
 Frame = -2

Query  510  RRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVV  331
            RR D   A E+ EKM S G+ P  + YT L  A+    D+++AL    +M  +GI   VV
Sbjct  496  RRLDN--AHELVEKMLSLGLHPDEFTYTTLIDAHCKEGDIKKALLLHDEMTKKGILPDVV  553

Query  330  TYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTC  187
            TY++++ G  K+   + A+               SI  NI Y     C
Sbjct  554  TYNVLINGLRKIARTKEAKRLLFRLYYEE-----SIPDNIAYDVLMDC  596



>ref|XP_007204201.1| hypothetical protein PRUPE_ppa003538mg [Prunus persica]
 gb|EMJ05400.1| hypothetical protein PRUPE_ppa003538mg [Prunus persica]
Length=567

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/196 (24%), Positives = 98/196 (50%), Gaps = 2/196 (1%)
 Frame = -2

Query  597  ENWHAVVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLT  418
            E W  V +  E+   P+ + + +++N YG+     +  ++ E+M ++GI P    Y +L 
Sbjct  238  EEW--VKKMAEKGVCPNLETYNILINGYGQMRVFDKCFQILEEMENKGIKPNVVSYGSLI  295

Query  417  YAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHAT  238
                    + EA   +R M    I  +   Y++++GG   VGN++ A  +F E      T
Sbjct  296  NGLCKDGRLLEAEIALRDMISRAISPNAQIYNMLIGGSCTVGNLKDAFRFFDEMASTGIT  355

Query  237  LSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLM  58
             +   Y ++I+  C+   +  AE+   ++   G +  +  +++++ GY+  RN +KCL +
Sbjct  356  PTLITYNSLIHGLCKKGRVMEAEDYFSQITSSGYSPDVITYNSLISGYSDIRNTQKCLEL  415

Query  57   FDRLKECGFTPSVISY  10
            ++ +K  G  P++ +Y
Sbjct  416  YETMKNLGIKPTIYTY  431


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 88/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +VN Y RR D +RA    E+M   G+ P    +  L   +  +RDM+ A   
Sbjct  181  PDVVIYNTIVNGYCRRCDMNRAILAIEQMEIHGLRPNCITFNTLIDKFCETRDMDTAEEW  240

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            V+KM ++G+  ++ TY+I++ G+ ++   +       E + +    +   YG++I   C+
Sbjct  241  VKKMAEKGVCPNLETYNILINGYGQMRVFDKCFQILEEMENKGIKPNVVSYGSLINGLCK  300

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +  AE  LR+M    I+    I++ ++ G     N +     FD +   G TP++I+
Sbjct  301  DGRLLEAEIALRDMISRAISPNAQIYNMLIGGSCTVGNLKDAFRFFDEMASTGITPTLIT  360

Query  12   YGCL  1
            Y  L
Sbjct  361  YNSL  364


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 79/163 (48%), Gaps = 0/163 (0%)
 Frame = -2

Query  489  AREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVG  310
            A+ + E+M + G VP  + Y+ L        D E +L    +   +G++++  T+S+++ 
Sbjct  97   AKRILEEMEAHGFVPDGFTYSILFDGQFKCGDSEGSLALFEEATRKGVKLNRYTWSVLLN  156

Query  309  GFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAA  130
            G  K GNVE  E    +  E        IY  I+   C+ C+M+RA   + +ME  G+  
Sbjct  157  GLCKQGNVEKLEEVLKKLMETGFVPDVVIYNTIVNGYCRRCDMNRAILAIEQMEIHGLRP  216

Query  129  PISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
                F+T++D +  TR+ +       ++ E G  P++ +Y  L
Sbjct  217  NCITFNTLIDKFCETRDMDTAEEWVKKMAEKGVCPNLETYNIL  259


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 86/169 (51%), Gaps = 2/169 (1%)
 Frame = -2

Query  504  GDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTY  325
            GD   +  +FE+   +G+    Y ++ L        ++E+    ++K+ + G    VV Y
Sbjct  127  GDSEGSLALFEEATRKGVKLNRYTWSVLLNGLCKQGNVEKLEEVLKKLMETGFVPDVVIY  186

Query  324  SIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI-YGNIIYANCQTCNMDRAeellreme  148
            + IV G+ +  ++  A    +E  E H      I +  +I   C+T +MD AEE +++M 
Sbjct  187  NTIVNGYCRRCDMNRA-ILAIEQMEIHGLRPNCITFNTLIDKFCETRDMDTAEEWVKKMA  245

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            E+G+   +  ++ +++GY   R  +KC  + + ++  G  P+V+SYG L
Sbjct  246  EKGVCPNLETYNILINGYGQMRVFDKCFQILEEMENKGIKPNVVSYGSL  294



>ref|XP_010450780.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
[Camelina sativa]
Length=746

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +  +++   + G+ +RA E  E+MR RG+ P    YT L   ++    M EA   
Sbjct  342  PSVITYTSLIHSMCKAGNMNRATEFLEQMRVRGLCPNERTYTTLVDGFSQKGYMNEAYRV  401

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +++M D G   S+VTY+ +V G    G +E A     + KE+  T     Y  ++   C+
Sbjct  402  LKEMIDNGFSPSIVTYNALVNGHCVAGKMEDAIAVLEDMKEKGLTPDVVSYSTVLSGFCR  461

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            + ++D A  + REM E+GI      + +++ G+   R  ++   ++D +   G  P   +
Sbjct  462  SYDVDEALRVKREMVEKGIKPDTITYSSLIQGFCEQRRTKEACDLYDEMLRAGLPPDQFT  521

Query  12   YGCL  1
            Y  L
Sbjct  522  YTAL  525


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+ + +  +V+ + ++G  + A  + ++M   G  P+   Y  L   + V+  ME+A+  
Sbjct  377  PNERTYTTLVDGFSQKGYMNEAYRVLKEMIDNGFSPSIVTYNALVNGHCVAGKMEDAIAV  436

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +  M ++G+   VV+YS ++ GF +  +V+ A     E  E+        Y ++I   C+
Sbjct  437  LEDMKEKGLTPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKPDTITYSSLIQGFCE  496

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
                  A +L  EM   G+      +  +++ Y +  + EK L + + + E G  P V++
Sbjct  497  QRRTKEACDLYDEMLRAGLPPDQFTYTALINAYCMEGDLEKALQLHNEMVEKGVLPDVVT  556

Query  12   YGCL  1
            Y  L
Sbjct  557  YSVL  560


 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 52/229 (23%), Positives = 101/229 (44%), Gaps = 21/229 (9%)
 Frame = -2

Query  624  FRKVLESQPE----NWHAVVRAF-------------ERINK----PSRKEFGMMVNYYGR  508
            F+++LESQ       ++ ++R F             ER+ K    P+   +  +++ Y +
Sbjct  192  FKEMLESQVSPNVFTYNILIRGFCFAGNIDVALGFFERMEKKGCLPNVVTYNTLIDGYCK  251

Query  507  RGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVT  328
                    E+   M  +G+ P    Y  +         M+E    + +MN +G  +  VT
Sbjct  252  LRKIDDGFELLRSMALKGLEPNLISYNVVINGLCREGRMKETNFVLTEMNKKGYSLDEVT  311

Query  327  YSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellreme  148
            Y+ ++ G+ K GN   A     E      + S   Y ++I++ C+  NM+RA E L +M 
Sbjct  312  YNTLIKGYCKEGNFHQALVMHAEMLRHGLSPSVITYTSLIHSMCKAGNMNRATEFLEQMR  371

Query  147  eEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
              G+      + T++DG++      +   +   + + GF+PS+++Y  L
Sbjct  372  VRGLCPNERTYTTLVDGFSQKGYMNEAYRVLKEMIDNGFSPSIVTYNAL  420


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 82/183 (45%), Gaps = 0/183 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P+   + +++N   R G       +  +M  +G       Y  L   Y    +  +AL 
Sbjct  271  EPNLISYNVVINGLCREGRMKETNFVLTEMNKKGYSLDEVTYNTLIKGYCKEGNFHQALV  330

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M   G+  SV+TY+ ++    K GN+  A  +  + + R    +   Y  ++    
Sbjct  331  MHAEMLRHGLSPSVITYTSLIHSMCKAGNMNRATEFLEQMRVRGLCPNERTYTTLVDGFS  390

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
            Q   M+ A  +L+EM + G +  I  ++ +++G+ +    E  + + + +KE G TP V+
Sbjct  391  QKGYMNEAYRVLKEMIDNGFSPSIVTYNALVNGHCVAGKMEDAIAVLEDMKEKGLTPDVV  450

Query  15   SYG  7
            SY 
Sbjct  451  SYS  453


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/179 (23%), Positives = 87/179 (49%), Gaps = 0/179 (0%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMN  358
            +  ++  Y + G+ H+A  M  +M   G+ P+   YT+L ++   + +M  A   + +M 
Sbjct  312  YNTLIKGYCKEGNFHQALVMHAEMLRHGLSPSVITYTSLIHSMCKAGNMNRATEFLEQMR  371

Query  357  DEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMD  178
              G+  +  TY+ +V GF++ G +  A     E  +   + S   Y  ++  +C    M+
Sbjct  372  VRGLCPNERTYTTLVDGFSQKGYMNEAYRVLKEMIDNGFSPSIVTYNALVNGHCVAGKME  431

Query  177  RAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
             A  +L +M+E+G+   +  + T++ G+  + + ++ L +   + E G  P  I+Y  L
Sbjct  432  DAIAVLEDMKEKGLTPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKPDTITYSSL  490


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  ++  +  +     A +++++M   G+ P  + YT L  AY +  D+E+AL 
Sbjct  481  KPDTITYSSLIQGFCEQRRTKEACDLYDEMLRAGLPPDQFTYTALINAYCMEGDLEKALQ  540

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M ++G+   VVTYS+++ G  K      A+   L+     +  S   Y  +I  NC
Sbjct  541  LHNEMVEKGVLPDVVTYSVLINGLNKQARTREAKRLLLKLFYEDSVPSDVTYHTLI-ENC  599



>ref|XP_008367001.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, 
mitochondrial-like [Malus domestica]
Length=722

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 95/205 (46%), Gaps = 7/205 (3%)
 Frame = -2

Query  594  NWHAVVRAFERIN-------KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSY  436
            N H V RA E          KP+   +  M++ + + G+  +A E+  +M+ RG  P   
Sbjct  216  NKHLVTRAKEVYRMMGEAGIKPTIVTYNTMLDSFCKEGEVQQALELLSEMQKRGCFPNDV  275

Query  435  EYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEA  256
             Y  L    +   ++E+A   +++M   G+ I+  TY+ ++ G+   G +E A     E 
Sbjct  276  TYNVLINGLSKKGELEQAKGLIKEMMKXGLRITAFTYNPLICGYCNKGLLEEALSLEKEM  335

Query  255  KERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNE  76
              + A  + + Y +++Y  C+   M  A +    M    I   I  ++T++ GY    N 
Sbjct  336  VIKGANPTVATYNSLMYGLCKWGRMTDARDQFSNMLNRNIVPDIVSYNTLIYGYCRLGNL  395

Query  75   EKCLLMFDRLKECGFTPSVISYGCL  1
                ++FD L+   FTP++++Y  L
Sbjct  396  GDAFILFDELRHRTFTPTIVTYNTL  420


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    + + VN   + G+   A  + +KM   GIVP    YT++ +A+  S  + +A   
Sbjct  517  PDLFTYNIFVNGICKLGNLDEAYTLLQKMVRDGIVPDHITYTSMIHAHLESGQLMKAREV  576

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+  SV+TY++++   A  G +E A  +F E +E+    +   Y  +I   C+
Sbjct  577  FYEMLNKGLSPSVITYTVLIHAHAAKGRLELAYMYFSEMQEKRIWPNVVTYNALINGLCK  636

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               MD+A E   EMEE+GIA     +  +++      N ++ L ++ ++ +    P   +
Sbjct  637  VMRMDQAYEYFXEMEEKGIAPNKYTYTILINENCNMGNWKEALRLYKQMLDRXIEPDSCT  696

Query  12   YGCL  1
            +  L
Sbjct  697  HSAL  700


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 82/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +++N   ++G+  +A+ + ++M   G+  T++ Y  L   Y     +EEAL+ 
Sbjct  272  PNDVTYNVLINGLSKKGELEQAKGLIKEMMKXGLRITAFTYNPLICGYCNKGLLEEALSL  331

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M  +G   +V TY+ ++ G  K G +  A   F     R+       Y  +IY  C+
Sbjct  332  EKEMVIKGANPTVATYNSLMYGLCKWGRMTDARDQFSNMLNRNIVPDIVSYNTLIYGYCR  391

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+  A  L  E+        I  ++T+MDG   + +      +   +   G  P V +
Sbjct  392  LGNLGDAFILFDELRHRTFTPTIVTYNTLMDGLCRSGDLAVAGQLKKEMTNQGICPDVFT  451

Query  12   YGCL  1
            Y  L
Sbjct  452  YTIL  455


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 75/181 (41%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++  Y R G+   A  +F+++R R   PT   Y  L      S D+  A   
Sbjct  377  PDIVSYNTLIYGYCRLGNLGDAFILFDELRHRTFTPTIVTYNTLMDGLCRSGDLAVAGQL  436

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M ++GI   V TY+I+V G    GN+  A+  F E   +        Y   I    +
Sbjct  437  KKEMTNQGICPDVFTYTILVNGSCNAGNLSMAKELFDEMLRKGVEPDRFAYNTRIVGELR  496

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +  +A  +  E++  G    +  ++  ++G     N ++   +  ++   G  P  I+
Sbjct  497  LGDPSKAFSMQEEIQARGFPPDLFTYNIFVNGICKLGNLDEAYTLLQKMVRDGIVPDHIT  556

Query  12   Y  10
            Y
Sbjct  557  Y  557


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P R  +   +    R GD  +A  M E++++RG  P  + Y           +++EA T
Sbjct  481  EPDRFAYNTRIVGELRLGDPSKAFSMQEEIQARGFPPDLFTYNIFVNGICKLGNLDEAYT  540

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             ++KM  +GI    +TY+ ++    + G +  A   F E   +  + S   Y  +I+A+ 
Sbjct  541  LLQKMVRDGIVPDHITYTSMIHAHLESGQLMKAREVFYEMLNKGLSPSVITYTVLIHAHA  600

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                ++ A     EM+E+ I   +  ++ +++G       ++    F  ++E G  P+  
Sbjct  601  AKGRLELAYMYFSEMQEKRIWPNVVTYNALINGLCKVMRMDQAYEYFXEMEEKGIAPNKY  660

Query  15   SYGCL  1
            +Y  L
Sbjct  661  TYTIL  665


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/170 (24%), Positives = 73/170 (43%), Gaps = 3/170 (2%)
 Frame = -2

Query  516  YGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEIS  337
            +GR  D   AR+ F  M +R IVP    Y  L Y Y    ++ +A     ++       +
Sbjct  357  WGRMTD---ARDQFSNMLNRNIVPDIVSYNTLIYGYCRLGNLGDAFILFDELRHRTFTPT  413

Query  336  VVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellr  157
            +VTY+ ++ G  + G++  A     E   +        Y  ++  +C   N+  A+EL  
Sbjct  414  IVTYNTLMDGLCRSGDLAVAGQLKKEMTNQGICPDVFTYTILVNGSCNAGNLSMAKELFD  473

Query  156  emeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYG  7
            EM  +G+      ++T + G     +  K   M + ++  GF P + +Y 
Sbjct  474  EMLRKGVEPDRFAYNTRIVGELRLGDPSKAFSMQEEIQARGFPPDLFTYN  523



>ref|XP_008239557.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial [Prunus mume]
Length=1019

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 98/200 (49%), Gaps = 7/200 (4%)
 Frame = -2

Query  588  HAVVRAFERINK-------PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEY  430
             ++V+A+E +N+       P+   +G+++N   R GD  RA ++ ++M +RG+ P +  Y
Sbjct  420  QSMVKAYEILNEMKKRNLAPNVYTYGVIINGLSRCGDLQRANKVLKEMITRGLKPGAVIY  479

Query  429  TNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKE  250
            T +   +      EEA+   + MN++G+   V  Y+ ++ G  K   +E A  +FLE  E
Sbjct  480  TTVIRGHVQEGKFEEAIKLFKGMNEKGVMPDVFCYNSLIIGLCKARKMEEARTYFLEMVE  539

Query  249  RHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEK  70
            R    +A  YG  ++ +C+   M  A    +EM   GIA    I+  +++G+    N  +
Sbjct  540  RGLKPNAYTYGAFVHGHCKEGEMQLANRYFQEMLGCGIAPNDVIYTALIEGHCKEGNLTE  599

Query  69   CLLMFDRLKECGFTPSVISY  10
                F  +   G  P + +Y
Sbjct  600  AHSAFRCMLGRGVLPDIKTY  619


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 91/187 (49%), Gaps = 0/187 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            ER  KP+   +G  V+ + + G+   A   F++M   GI P    YT L   +    ++ 
Sbjct  539  ERGLKPNAYTYGAFVHGHCKEGEMQLANRYFQEMLGCGIAPNDVIYTALIEGHCKEGNLT  598

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EA +  R M   G+   + TYS+I+ G +K G ++ A   F E  ++        Y ++I
Sbjct  599  EAHSAFRCMLGRGVLPDIKTYSVIIHGLSKNGKLQEAMGVFSELLDKDLVPDVFTYSSLI  658

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+  N+D+A ++L  M + GI   I  ++ +++G   +   +K   +FD +   G T
Sbjct  659  SGFCKQGNVDKAFQILELMCQRGIDPNIVTYNALINGLCKSGEVDKAKELFDGISGKGLT  718

Query  27   PSVISYG  7
            P+ ++Y 
Sbjct  719  PNAVTYA  725


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 84/177 (47%), Gaps = 0/177 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P  K + ++++   + G    A  +F ++  + +VP  + Y++L   +    ++++A   
Sbjct  614  PDIKTYSVIIHGLSKNGKLQEAMGVFSELLDKDLVPDVFTYSSLISGFCKQGNVDKAFQI  673

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            +  M   GI+ ++VTY+ ++ G  K G V+ A+  F     +  T +A  Y  ++    +
Sbjct  674  LELMCQRGIDPNIVTYNALINGLCKSGEVDKAKELFDGISGKGLTPNAVTYATMMGGYSK  733

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPS  22
               +  A  LL EM   G      I+ T++DG     + EK L +F+ + E GF  +
Sbjct  734  AGKLTEAFRLLDEMLLHGFPTDSFIYCTLIDGCCKAGDTEKALSLFEDMVEKGFAAT  790


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 84/189 (44%), Gaps = 0/189 (0%)
 Frame = -2

Query  567  ERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDME  388
            E+   P+   + +++    R      A E+ + M  +G+VP  Y Y  L       +  E
Sbjct  259  EKGCNPNLSTYNVVIGALCRTWGVDEALEVKKAMVEKGLVPDRYTYLVLLDGLCRHKRSE  318

Query  387  EALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNII  208
            EA   ++ M D G+      Y  ++ GF K GN+E A     E   R   L  + Y  I+
Sbjct  319  EAKLILKDMYDIGLNPENTCYIALIDGFIKEGNMEEALSIKGEMIARGVKLCDATYNTIL  378

Query  207  YANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFT  28
               C+   M++AE +L EM   GI      F  ++DGY   ++  K   + + +K+    
Sbjct  379  AGVCRNGTMEKAEAVLNEMNVMGIKPNAQTFKFLIDGYCREQSMVKAYEILNEMKKRNLA  438

Query  27   PSVISYGCL  1
            P+V +YG +
Sbjct  439  PNVYTYGVI  447


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 87/182 (48%), Gaps = 1/182 (1%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  M+  Y + G    A  + ++M   G    S+ Y  L      + D E+AL+ 
Sbjct  719  PNAVTYATMMGGYSKAGKLTEAFRLLDEMLLHGFPTDSFIYCTLIDGCCKAGDTEKALSL  778

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
               M ++G   +  +++ ++ GF K+G +  A   F +  ++H T +   Y  +I + C+
Sbjct  779  FEDMVEKGFA-ATASFNALINGFCKLGKMMEAIRLFEDMVDKHVTPNHVSYTILIVSLCK  837

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               M+ +E+L  EM++  +   I  + +++ GY +T +  K   +F+ +   G  P  ++
Sbjct  838  EGLMNESEQLFLEMQKRNLTPTIVTYTSLLHGYNLTGSRFKMFALFEEMMARGLKPDEVN  897

Query  12   YG  7
            YG
Sbjct  898  YG  899


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/184 (23%), Positives = 82/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++  + + G+   A   F  M  RG++P    Y+ + +  + +  ++EA+  
Sbjct  579  PNDVIYTALIEGHCKEGNLTEAHSAFRCMLGRGVLPDIKTYSVIIHGLSKNGKLQEAMGV  638

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              ++ D+ +   V TYS ++ GF K GNV+ A        +R    +   Y  +I   C+
Sbjct  639  FSELLDKDLVPDVFTYSSLISGFCKQGNVDKAFQILELMCQRGIDPNIVTYNALINGLCK  698

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            +  +D+A+EL   +  +G+      + TMM GY+      +   + D +   GF      
Sbjct  699  SGEVDKAKELFDGISGKGLTPNAVTYATMMGGYSKAGKLTEAFRLLDEMLLHGFPTDSFI  758

Query  12   YGCL  1
            Y  L
Sbjct  759  YCTL  762


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  +++ + + G+   A  +  +M +RG+      Y  +      +  ME+A   
Sbjct  334  PENTCYIALIDGFIKEGNMEEALSIKGEMIARGVKLCDATYNTILAGVCRNGTMEKAEAV  393

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
            + +MN  GI+ +  T+  ++ G+ +  ++  A     E K+R+   +   YG II    +
Sbjct  394  LNEMNVMGIKPNAQTFKFLIDGYCREQSMVKAYEILNEMKKRNLAPNVYTYGVIINGLSR  453

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              ++ RA ++L+EM   G+     I+ T++ G+      E+ + +F  + E G  P V  
Sbjct  454  CGDLQRANKVLKEMITRGLKPGAVIYTTVIRGHVQEGKFEEAIKLFKGMNEKGVMPDVFC  513

Query  12   YGCL  1
            Y  L
Sbjct  514  YNSL  517



>ref|XP_010275661.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like 
[Nelumbo nucifera]
Length=723

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 118/254 (46%), Gaps = 15/254 (6%)
 Frame = -2

Query  753  AVQFDGVEFHGRVLTVKLDDGRRIMKDKKKGRTRWMEGSSSRNFRKVLESQPENWHAVVR  574
            ++  DG    G VL      G  ++K+ +  + R     S   F  +L    E  H  + 
Sbjct  340  SILIDGFCKKGDVLK-----GWNLLKEMESSKIR----PSIVTFSSILNGLCEGGHMEIA  390

Query  573  A--FERIN----KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYA  412
               F ++N    K  +    +++N Y ++G+   A  + E+M    + P    +T+L + 
Sbjct  391  LDWFYKLNSSGYKHDQISHNILINGYCKQGELDSANRILEEMFRHNLPPDVINWTSLIHG  450

Query  411  YTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLS  232
            Y     +E+AL   + M D GI  + VT ++IV G+ K G V+ A     E +++    +
Sbjct  451  YCKIGCLEKALELFKFMLDGGILPNTVTCTVIVDGYCKEGRVDEAFKLMDEMQDQGIIPN  510

Query  231  ASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFD  52
               Y  II   C+    +RA EL   M + G+   + I+ T++DG+    N ++ L ++ 
Sbjct  511  LFTYNTIINGLCKERKSERAWELFPLMLKRGLVPDVVIYSTLIDGFVKQSNLKEALKLYA  570

Query  51   RLKECGFTPSVISY  10
            R+ + G +P+ I+Y
Sbjct  571  RMSKDGISPNAITY  584


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 84/180 (47%), Gaps = 0/180 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   +  ++N   +     RA E+F  M  RG+VP    Y+ L   +    +++EAL  
Sbjct  509  PNLFTYNTIINGLCKERKSERAWELFPLMLKRGLVPDVVIYSTLIDGFVKQSNLKEALKL  568

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M+ +GI  + +TY+ ++ G      V  A + F E   +H       Y  II   C+
Sbjct  569  YARMSKDGISPNAITYTNLISGLCNCSKVYDALNLFKEMIGKHLMPDKIAYTTIIAGFCK  628

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              NM+ A +L  EM E G +  +  +  ++DG+      +  L++ D + +   TP+ ++
Sbjct  629  IRNMNTAWQLFTEMRERGFSPDVFTYTCIIDGFCKLNQMDIALMLVDEMIQENATPNEVT  688


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/225 (23%), Positives = 94/225 (42%), Gaps = 17/225 (8%)
 Frame = -2

Query  624  FRKVLESQPENWHAVVRAFERIN-----------------KPSRKEFGMMVNYYGRRGDK  496
            FR  L     NW +++  + +I                   P+     ++V+ Y + G  
Sbjct  433  FRHNLPPDVINWTSLIHGYCKIGCLEKALELFKFMLDGGILPNTVTCTVIVDGYCKEGRV  492

Query  495  HRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSII  316
              A ++ ++M+ +GI+P  + Y  +       R  E A      M   G+   VV YS +
Sbjct  493  DEAFKLMDEMQDQGIIPNLFTYNTIINGLCKERKSERAWELFPLMLKRGLVPDVVIYSTL  552

Query  315  VGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGI  136
            + GF K  N++ A   +    +   + +A  Y N+I   C    +  A  L +EM  + +
Sbjct  553  IDGFVKQSNLKEALKLYARMSKDGISPNAITYTNLISGLCNCSKVYDALNLFKEMIGKHL  612

Query  135  AAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
                  + T++ G+   RN      +F  ++E GF+P V +Y C+
Sbjct  613  MPDKIAYTTIIAGFCKIRNMNTAWQLFTEMRERGFSPDVFTYTCI  657


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/171 (25%), Positives = 84/171 (49%), Gaps = 6/171 (4%)
 Frame = -2

Query  516  YGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEIS  337
            + ++G+ ++A  + E+M+S  I P  Y Y+ L   +    D+ +    +++M    I  S
Sbjct  311  FCKKGEVYKATRVLEEMKSDKISPDVYSYSILIDGFCKKGDVLKGWNLLKEMESSKIRPS  370

Query  336  VVTYSIIVGGFAKVGNVEAAEHWFLEAKE---RHATLSASIYGNIIYANCQTCNMDRAee  166
            +VT+S I+ G  + G++E A  WF +      +H  +S +I   +I   C+   +D A  
Sbjct  371  IVTFSSILNGLCEGGHMEIALDWFYKLNSSGYKHDQISHNI---LINGYCKQGELDSANR  427

Query  165  llremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
            +L EM    +   +  + +++ GY      EK L +F  + + G  P+ ++
Sbjct  428  ILEEMFRHNLPPDVINWTSLIHGYCKIGCLEKALELFKFMLDGGILPNTVT  478



>ref|XP_008389244.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, 
mitochondrial-like [Malus domestica]
 ref|XP_008389245.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, 
mitochondrial-like [Malus domestica]
Length=722

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 95/205 (46%), Gaps = 7/205 (3%)
 Frame = -2

Query  594  NWHAVVRAFERIN-------KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSY  436
            N H V RA E          KP+   +  M++ + + G+  +A E+  +M+ RG  P   
Sbjct  216  NKHLVTRAKEVYRMMGEAGIKPTIVTYNTMLDSFCKEGEVQQALELLSEMQKRGCFPNDV  275

Query  435  EYTNLTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEA  256
             Y  L    +   ++E+A   +++M   G+ I+  TY+ ++ G+   G +E A     E 
Sbjct  276  TYNVLINGLSKKGELEQAKGLIKEMMKXGLRITAFTYNPLICGYCNKGLLEEALSLEKEM  335

Query  255  KERHATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNE  76
              + A  + + Y +++Y  C+   M  A +    M    I   I  ++T++ GY    N 
Sbjct  336  VIKGANPTVATYNSLMYGLCKWGRMTDARDQFSNMLNRNIVPDIVSYNTLIYGYCRLGNL  395

Query  75   EKCLLMFDRLKECGFTPSVISYGCL  1
                ++FD L+   FTP++++Y  L
Sbjct  396  GDAFILFDELRHRTFTPTIVTYNTL  420


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 90/184 (49%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    + + VN   + G+   A  + +KM   GIVP    YT++ +A+  S  + +A   
Sbjct  517  PDLFTYNIFVNGICKLGNLDEAYTLLQKMVRDGIVPDHITYTSMIHAHLESGQLMKAREV  576

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M ++G+  SV+TY++++   A  G +E A  +F E +E+    +   Y  +I   C+
Sbjct  577  FYEMLNKGLSPSVITYTVLIHAHAAKGRLELAYMYFSEMQEKRIWPNVVTYNALINGLCK  636

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               MD+A E   EMEE+GIA     +  +++      N ++ L ++ ++ +    P   +
Sbjct  637  VMRMDQAYEYFIEMEEKGIAPNKYTYTILINENCNMGNWKEALRLYKQMLDRXIEPDSCT  696

Query  12   YGCL  1
            +  L
Sbjct  697  HSAL  700


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 82/184 (45%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +++N   ++G+  +A+ + ++M   G+  T++ Y  L   Y     +EEAL+ 
Sbjct  272  PNDVTYNVLINGLSKKGELEQAKGLIKEMMKXGLRITAFTYNPLICGYCNKGLLEEALSL  331

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M  +G   +V TY+ ++ G  K G +  A   F     R+       Y  +IY  C+
Sbjct  332  EKEMVIKGANPTVATYNSLMYGLCKWGRMTDARDQFSNMLNRNIVPDIVSYNTLIYGYCR  391

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              N+  A  L  E+        I  ++T+MDG   + +      +   +   G  P V +
Sbjct  392  LGNLGDAFILFDELRHRTFTPTIVTYNTLMDGLCRSGDLAVAGQLKKEMTNQGICPDVFT  451

Query  12   YGCL  1
            Y  L
Sbjct  452  YTIL  455


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 75/181 (41%), Gaps = 0/181 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P    +  ++  Y R G+   A  +F+++R R   PT   Y  L      S D+  A   
Sbjct  377  PDIVSYNTLIYGYCRLGNLGDAFILFDELRHRTFTPTIVTYNTLMDGLCRSGDLAVAGQL  436

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
             ++M ++GI   V TY+I+V G    GN+  A+  F E   +        Y   I    +
Sbjct  437  KKEMTNQGICPDVFTYTILVNGSCNAGNLSMAKELFDEMLRKGVEPDRFAYNTRIVGELR  496

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
              +  +A  +  E++  G    +  ++  ++G     N ++   +  ++   G  P  I+
Sbjct  497  LGDPSKAFSMQEEIQARGFPPDLFTYNIFVNGICKLGNLDEAYTLLQKMVRDGIVPDHIT  556

Query  12   Y  10
            Y
Sbjct  557  Y  557


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/170 (24%), Positives = 73/170 (43%), Gaps = 3/170 (2%)
 Frame = -2

Query  516  YGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTCVRKMNDEGIEIS  337
            +GR  D   AR+ F  M +R IVP    Y  L Y Y    ++ +A     ++       +
Sbjct  357  WGRMTD---ARDQFSNMLNRNIVPDIVSYNTLIYGYCRLGNLGDAFILFDELRHRTFTPT  413

Query  336  VVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNMDRAeellr  157
            +VTY+ ++ G  + G++  A     E   +        Y  ++  +C   N+  A+EL  
Sbjct  414  IVTYNTLMDGLCRSGDLAVAGQLKKEMTNQGICPDVFTYTILVNGSCNAGNLSMAKELFD  473

Query  156  emeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYG  7
            EM  +G+      ++T + G     +  K   M + ++  GF P + +Y 
Sbjct  474  EMLRKGVEPDRFAYNTRIVGELRLGDPSKAFSMQEEIQARGFPPDLFTYN  523


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 83/185 (45%), Gaps = 0/185 (0%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +P R  +   +    R GD  +A  M E++++RG  P  + Y           +++EA T
Sbjct  481  EPDRFAYNTRIVGELRLGDPSKAFSMQEEIQARGFPPDLFTYNIFVNGICKLGNLDEAYT  540

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
             ++KM  +GI    +TY+ ++    + G +  A   F E   +  + S   Y  +I+A+ 
Sbjct  541  LLQKMVRDGIVPDHITYTSMIHAHLESGQLMKAREVFYEMLNKGLSPSVITYTVLIHAHA  600

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVI  16
                ++ A     EM+E+ I   +  ++ +++G       ++    F  ++E G  P+  
Sbjct  601  AKGRLELAYMYFSEMQEKRIWPNVVTYNALINGLCKVMRMDQAYEYFIEMEEKGIAPNKY  660

Query  15   SYGCL  1
            +Y  L
Sbjct  661  TYTIL  665



>ref|XP_010544768.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, 
mitochondrial-like [Tarenaya hassleriana]
Length=791

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 88/180 (49%), Gaps = 1/180 (1%)
 Frame = -2

Query  537  FGMMVNYYGRRGDKHRAREMFEKMRSR-GIVPTSYEYTNLTYAYTVSRDMEEALTCVRKM  361
            F  +++   + G    A E+  KM++  G    +  Y  L   Y  +  +E A T V +M
Sbjct  399  FNTLIDGLCKLGRLKEAEELLMKMKTEEGCPANTITYNCLIDGYCRAGQLETAKTVVSRM  458

Query  360  NDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQTCNM  181
             DE I  +VVT +IIVGG  K   V  A  +F++ +      +A  Y  +I+A C   N+
Sbjct  459  KDERIRPNVVTLNIIVGGMCKHHGVGMAVQFFMDMQREGLKGNAVTYTTLIHAYCNVNNI  518

Query  180  DRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVISYGCL  1
            ++A     +M E G      +++T++ G    R +   + + ++LKE GF+  V++Y  L
Sbjct  519  EKAMHWFHQMSESGCPPDAKVYYTLISGLCQARRDRDAISVVEKLKEAGFSLDVLAYNML  578


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/94 (27%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            KP    +  +++++ +  D      M EKMR  G+VPT   Y  +  AY  + D +EA+ 
Sbjct  604  KPDSVTYNTLISFFSKHQDFESIERMMEKMRQAGLVPTVVTYGAIIEAYCSNGDTDEAIK  663

Query  375  CVRKMN-DEGIEISVVTYSIIVGGFAKVGNVEAA  277
              + M     +  + V Y+I++  + K G+++ A
Sbjct  664  LFKDMGLRSKVMPNAVIYNILINAYCKKGSIDRA  697



>ref|XP_009628319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial-like [Nicotiana tomentosiformis]
 ref|XP_009628320.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=921

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 93/188 (49%), Gaps = 7/188 (4%)
 Frame = -2

Query  582  VVRAFERINK-------PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTN  424
            + +AF  +N+       P+ + +G+++N   + G    AR +  ++ ++G+VP  + YT+
Sbjct  486  IAQAFSVLNRMLEIGRLPNVQLYGILINALAKNGKLSDARSVLSELYNKGLVPDVFTYTS  545

Query  423  LTYAYTVSRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERH  244
            L   +    + EEA   + +M  +G+  S+VTY+ ++GG  K G++  A   F     + 
Sbjct  546  LISGFCKQGNSEEAFLLLDEMCQKGVRPSIVTYNALIGGLCKSGDLSRAREVFDGISGKG  605

Query  243  ATLSASIYGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCL  64
               +A  Y  II   C+T +++ A  L  EM  +G+     +++ ++ G       EK L
Sbjct  606  LAPNAVTYSTIIDGYCKTGDLNEAFRLSDEMPSQGVQPDAFVYNALLHGCCRAGETEKAL  665

Query  63   LMFDRLKE  40
             +F  + E
Sbjct  666  SLFHEMVE  673


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 91/194 (47%), Gaps = 0/194 (0%)
 Frame = -2

Query  582  VVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            +V   +R   PS    G+++N     GD  +A  + EKM + G  P +  YT +   Y  
Sbjct  318  LVEMTDRNLVPSAYTCGVLINALCNSGDLCQAILVLEKMIAAGARPNAIIYTPIIKGYVE  377

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASI  223
                +EA   V+ M  +GI   ++ Y+ I+ G  KVG ++ A    +E + R    ++  
Sbjct  378  DGKFDEAKEIVQDMWQKGILPDILCYNTIITGLCKVGRIDEARMCLVEMERRKLRPNSYT  437

Query  222  YGNIIYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLK  43
            +   I    +  NM  AE+   EM + G+A   + F +++DGY    N  +   + +R+ 
Sbjct  438  FAAFISWYREAGNMQVAEQYFWEMLDRGVAPNYATFTSIIDGYCKYGNIAQAFSVLNRML  497

Query  42   ECGFTPSVISYGCL  1
            E G  P+V  YG L
Sbjct  498  EIGRLPNVQLYGIL  511


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 86/190 (45%), Gaps = 0/190 (0%)
 Frame = -2

Query  570  FERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDM  391
             +R   P+   F  +++ Y + G+  +A  +  +M   G +P    Y  L  A   +  +
Sbjct  462  LDRGVAPNYATFTSIIDGYCKYGNIAQAFSVLNRMLEIGRLPNVQLYGILINALAKNGKL  521

Query  390  EEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNI  211
             +A + + ++ ++G+   V TY+ ++ GF K GN E A     E  ++    S   Y  +
Sbjct  522  SDARSVLSELYNKGLVPDVFTYTSLISGFCKQGNSEEAFLLLDEMCQKGVRPSIVTYNAL  581

Query  210  IYANCQTCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGF  31
            I   C++ ++ RA E+   +  +G+A     + T++DGY  T +  +   + D +   G 
Sbjct  582  IGGLCKSGDLSRAREVFDGISGKGLAPNAVTYSTIIDGYCKTGDLNEAFRLSDEMPSQGV  641

Query  30   TPSVISYGCL  1
             P    Y  L
Sbjct  642  QPDAFVYNAL  651


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/189 (23%), Positives = 86/189 (46%), Gaps = 10/189 (5%)
 Frame = -2

Query  555  KPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALT  376
            +PS   +  ++    + GD  RARE+F+ +  +G+ P +  Y+ +   Y  + D+ EA  
Sbjct  572  RPSIVTYNALIGGLCKSGDLSRAREVFDGISGKGLAPNAVTYSTIIDGYCKTGDLNEAFR  631

Query  375  CVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANC  196
               +M  +G++     Y+ ++ G  + G  E A   F E  E+    S   +  +I   C
Sbjct  632  LSDEMPSQGVQPDAFVYNALLHGCCRAGETEKALSLFHEMVEKRIA-STLTFNTLIDGLC  690

Query  195  QTCNMDRAeellremeeEGIAAPISIFHTMMDGYT----ITRNEEKCLLMFDRLKECGFT  28
            +   M  A EL++ M +     P  +  T++  Y     + +  E    +F +++E    
Sbjct  691  KLGRMSEALELVKGMSDR--HPPDHVTFTILIDYCCKNGVMKEAED---LFQQMQERKLI  745

Query  27   PSVISYGCL  1
            P++++Y  L
Sbjct  746  PTIVTYTSL  754


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = -2

Query  582  VVRAFERINKPSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTV  403
            +V+     + P    F ++++Y  + G    A ++F++M+ R ++PT   YT+L   Y  
Sbjct  701  LVKGMSDRHPPDHVTFTILIDYCCKNGVMKEAEDLFQQMQERKLIPTIVTYTSLIQGYHR  760

Query  402  SRDMEEALTCVRKMNDEGIEISVVTYSIIVGGFAKVGNVEAA  277
              D  +  +   +M   GIE   V YS +V    + GN+  A
Sbjct  761  LGDKLKVFSLFEEMVARGIEPDEVVYSSMVDALYREGNLHKA  802



>ref|XP_011073790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like 
[Sesamum indicum]
 ref|XP_011073791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like 
[Sesamum indicum]
 ref|XP_011073792.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like 
[Sesamum indicum]
Length=674

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            PS   +G++++    RGD  +AR + E+M  RG+ PT   YT L +   +  +M EA   
Sbjct  194  PSAVTYGILIDASCDRGDIVKARLLLEEMIERGLKPTVVIYTTLIHGLCIENNMLEAEKI  253

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M + G+  ++ TY+ ++ G+AK+ +VE A   + E  ++    +   Y  +IY  C+
Sbjct  254  FTRMREYGVVPNLYTYNALIDGYAKMASVEKARRVYYEMLDQGVLPNVITYSILIYLLCK  313

Query  192  TCNMDRAeellremeeEGIAAPISIFHTMMDGYTITRNEEKCLLMFDRLKECGFTPSVIS  13
               +         M +  +   + I++ +MDG+    +    + M   ++  G  P  ++
Sbjct  314  KGELVAFRSYFVHMVKLNVIPNVYIYNCLMDGFCEAGDLSAAMDMHLEMEIFGILPDAVT  373

Query  12   YGCL  1
            YG L
Sbjct  374  YGIL  377


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  PSRKEFGMMVNYYGRRGDKHRAREMFEKMRSRGIVPTSYEYTNLTYAYTVSRDMEEALTC  373
            P+   + +++    ++G+    R  F  M    ++P  Y Y  L   +  + D+  A+  
Sbjct  299  PNVITYSILIYLLCKKGELVAFRSYFVHMVKLNVIPNVYIYNCLMDGFCEAGDLSAAMDM  358

Query  372  VRKMNDEGIEISVVTYSIIVGGFAKVGNVEAAEHWFLEAKERHATLSASIYGNIIYANCQ  193
              +M   GI    VTY I++ G+ ++G VE AE+ F +