BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14160_g2_i2 len=754 path=[1:0-51 53:52-753]

Length=754
                                                                      Score     E

ref|XP_011021316.1|  PREDICTED: uncharacterized protein LOC105123...  65.1    2e-13   
ref|XP_006383378.1|  hypothetical protein POPTR_0005s15010g           65.1    1e-12   
ref|XP_008231541.1|  PREDICTED: uncharacterized protein At2g29880...  62.4    7e-09   
emb|CAN74698.1|  hypothetical protein VITISV_005798                   60.5    1e-07   Vitis vinifera
ref|XP_010655873.1|  PREDICTED: uncharacterized protein At2g29880...  60.5    2e-07   
ref|XP_010652552.1|  PREDICTED: uncharacterized protein At2g29880...  60.5    2e-07   
ref|XP_010652561.1|  PREDICTED: uncharacterized protein LOC100853265  60.1    3e-07   
ref|XP_008244442.1|  PREDICTED: uncharacterized protein At2g29880...  59.3    3e-07   
ref|XP_008222570.1|  PREDICTED: uncharacterized protein At2g29880...  56.2    9e-07   
ref|XP_008246059.1|  PREDICTED: uncharacterized protein At2g29880...  54.3    2e-06   
ref|XP_010665236.1|  PREDICTED: uncharacterized protein LOC104882713  57.4    2e-06   
ref|XP_008222122.1|  PREDICTED: uncharacterized protein At2g29880...  57.0    4e-06   
emb|CAN82893.1|  hypothetical protein VITISV_043096                   56.6    7e-06   Vitis vinifera
emb|CAN75216.1|  hypothetical protein VITISV_003517                   53.5    7e-06   Vitis vinifera
gb|KHN21833.1|  hypothetical protein glysoja_033692                   47.4    7e-06   
gb|KHN24697.1|  hypothetical protein glysoja_029766                   48.5    9e-06   
ref|XP_011021317.1|  PREDICTED: uncharacterized protein LOC105123...  41.2    2e-05   
ref|XP_009351225.1|  PREDICTED: uncharacterized protein LOC103942747  54.3    3e-05   
ref|XP_004308208.1|  PREDICTED: uncharacterized protein LOC101308913  53.9    4e-05   
ref|XP_006420050.1|  hypothetical protein CICLE_v10006620mg           53.5    5e-05   
ref|XP_008363681.1|  PREDICTED: uncharacterized protein LOC103427405  52.4    1e-04   
ref|XP_004298194.1|  PREDICTED: uncharacterized protein At2g29880...  48.5    2e-04   
ref|XP_006481535.1|  PREDICTED: uncharacterized protein At2g29880...  51.2    3e-04   
ref|XP_006424122.1|  hypothetical protein CICLE_v10028960mg           51.2    3e-04   
ref|XP_006424123.1|  hypothetical protein CICLE_v10028960mg           51.2    3e-04   
emb|CAN73742.1|  hypothetical protein VITISV_026084                   51.6    3e-04   Vitis vinifera
ref|XP_010648831.1|  PREDICTED: uncharacterized protein At2g29880...  48.5    8e-04   
ref|XP_007206593.1|  hypothetical protein PRUPE_ppa020476mg           47.0    0.001   



>ref|XP_011021316.1| PREDICTED: uncharacterized protein LOC105123429 isoform X1 [Populus 
euphratica]
Length=291

 Score = 65.1 bits (157),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            YNRL+L +  FS+L+ H  VTY+  +N V A E+ WK F  KH  +  FK  GC+ YE++
Sbjct  70   YNRLRLKHRQFSDLISHTGVTYSSSSNQVYATEEVWKMFKKKHKNYITFKSKGCRNYEML  129

Query  442  ADVFALSVATGRSCQL  489
              +F  S     S QL
Sbjct  130  GHIFNNSATHHASTQL  145


 Score = 34.7 bits (78),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = +3

Query  177  LKPSDWNEIDREMMEFIGLSYGMTKLKG  260
             K  DWNEID E+   IG  YG  +L+G
Sbjct  41   FKQVDWNEIDEELFSVIGQKYGAERLQG  68


 Score = 22.7 bits (47),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  485  NSSMQMPPNSDDECLDEDEFF  547
            ++S Q+P NSD    +E++FF
Sbjct  140  HASTQLPLNSDGNHQNEEQFF  160



>ref|XP_006383378.1| hypothetical protein POPTR_0005s15010g [Populus trichocarpa]
 gb|ERP61175.1| hypothetical protein POPTR_0005s15010g [Populus trichocarpa]
Length=291

 Score = 65.1 bits (157),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            YNRL+L +  FS+L+ H  VTY+  +N V A E+ WK F  KH  +  FK  GC+ YE++
Sbjct  70   YNRLRLKHRQFSDLISHTGVTYSSSSNQVYATEEVWKMFKKKHKNYITFKSKGCRNYEML  129

Query  442  ADVFALSVATGRSCQL  489
              +F  S     S QL
Sbjct  130  GQIFNNSSTHHASTQL  145


 Score = 34.3 bits (77),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = +3

Query  177  LKPSDWNEIDREMMEFIGLSYGMTKLKG  260
             K  DWNEID E+   IG  YG  +L+G
Sbjct  41   FKQVDWNEIDEELFSAIGQKYGAERLQG  68


 Score = 20.4 bits (41),  Expect(3) = 1e-12, Method: Compositional matrix adjust.
 Identities = 8/21 (38%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +2

Query  485  NSSMQMPPNSDDECLDEDEFF  547
            ++S Q+P  SD    +E++FF
Sbjct  140  HASTQLPLTSDGNHQNEEQFF  160



>ref|XP_008231541.1| PREDICTED: uncharacterized protein At2g29880-like, partial [Prunus 
mume]
Length=155

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL++++  FS+L+ H  V ++PV N V A ED W  +     K K F+  G + Y+++
Sbjct  69   FNRLRIVHHDFSDLIEHTGVGWDPVANTVIASEDVWASYLKSKPKAKQFRTQGLEHYQIL  128

Query  442  ADVFALSVATGR  477
             ++F  + ATG+
Sbjct  129  GEIFNTTTATGQ  140



>emb|CAN74698.1| hypothetical protein VITISV_005798 [Vitis vinifera]
Length=232

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 4/79 (5%)
 Frame = +1

Query  250  NLKE----YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKN  417
            NLK+    +NRL+ M+  FS+L+ H    ++  TN V A E+TW+ +   H   K F+  
Sbjct  61   NLKQLKQKFNRLRAMHREFSDLLKHTGFGWDVETNTVHALEETWQNYIWAHPNAKRFRSK  120

Query  418  GCKRYELMADVFALSVATG  474
            GC  Y L+  +F  S+ATG
Sbjct  121  GCPNYNLLGLIFNPSIATG  139



>ref|XP_010655873.1| PREDICTED: uncharacterized protein At2g29880-like [Vitis vinifera]
Length=313

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 4/79 (5%)
 Frame = +1

Query  250  NLKE----YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKN  417
            NLK+    +NRL+ M+  FS+L+ H    ++  TN V A E+TW+ +   H   K F+  
Sbjct  61   NLKQLKQKFNRLRAMHREFSDLLKHTGFGWDAETNTVHALEETWQNYIRAHPNAKRFRSK  120

Query  418  GCKRYELMADVFALSVATG  474
            GC  Y L+  +F  S ATG
Sbjct  121  GCPNYNLLGLIFNPSTATG  139



>ref|XP_010652552.1| PREDICTED: uncharacterized protein At2g29880-like [Vitis vinifera]
Length=313

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 4/79 (5%)
 Frame = +1

Query  250  NLKE----YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKN  417
            NLK+    +NRL+ M+  FS+L+ H    ++  TN V A E+TW+ +   H   K F+  
Sbjct  61   NLKQLKQKFNRLRAMHREFSDLLKHTGFGWDAETNTVHALEETWQNYIRAHPNAKRFRSK  120

Query  418  GCKRYELMADVFALSVATG  474
            GC  Y L+  +F  S ATG
Sbjct  121  GCPNYNLLGLIFNPSTATG  139



>ref|XP_010652561.1| PREDICTED: uncharacterized protein LOC100853265 [Vitis vinifera]
Length=336

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  256  KEYNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYE  435
            +++NRL+ M+  FS+L+ H    ++  TN V A E+TW+ +   H   K F+  GC  Y 
Sbjct  67   QKFNRLRAMHREFSDLLKHTGFGWDAETNTVHALEETWQNYIRAHPNAKRFRSKGCPNYN  126

Query  436  LMADVFALSVATG  474
            L+  +F  S ATG
Sbjct  127  LLGLIFNPSTATG  139



>ref|XP_008244442.1| PREDICTED: uncharacterized protein At2g29880-like [Prunus mume]
Length=291

 Score = 59.3 bits (142),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL++++  FS+L+ H    ++PV N V A ED W  +     K K F+  G + Y+++
Sbjct  69   FNRLRIVHHDFSDLIEHTGFGWDPVANTVIASEDVWASYLKSKPKAKQFRTQGLEHYQIL  128

Query  442  ADVFALSVATGR  477
             ++F  + ATG+
Sbjct  129  GEIFNTTTATGQ  140


 Score = 22.7 bits (47),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 0/25 (0%)
 Frame = +2

Query  488  SSMQMPPNSDDECLDEDEFFIVQDH  562
            +S Q+PPN DDE   E+ F     H
Sbjct  144  ASSQLPPNFDDERELENNFLNTGVH  168



>ref|XP_008222570.1| PREDICTED: uncharacterized protein At2g29880-like [Prunus mume]
Length=249

 Score = 56.2 bits (134),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL+ ++  FS+L+ H    ++P+ N V A ED W  +     K K F+    + Y+++
Sbjct  69   FNRLRKVHRYFSDLIEHTIFGWDPIANTVTALEDVWASYLKSKPKAKQFRTQDLEDYQVL  128

Query  442  ADVFALSVATGR  477
             ++F  ++ATGR
Sbjct  129  GEIFNTTIATGR  140


 Score = 23.9 bits (50),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = +2

Query  488  SSMQMPPNSDDECLDEDEFFIVQDH  562
            +S Q+PPNSDD+   E+ F     H
Sbjct  144  ASSQLPPNSDDKRELENNFLNTGVH  168



>ref|XP_008246059.1| PREDICTED: uncharacterized protein At2g29880-like [Prunus mume]
Length=292

 Score = 54.3 bits (129),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL++ +  FS+L+ H    ++P  N V A ED W  +     + K ++  G   Y+L+
Sbjct  69   FNRLRIAHREFSDLIEHTGFGWDPNANTVTASEDVWASYIKSKPRAKQYRTQGLVHYQLL  128

Query  442  ADVFALSVATGR  477
             ++F  + ATG+
Sbjct  129  GEIFNTTTATGQ  140


 Score = 25.0 bits (53),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 16/53 (30%)
 Frame = +2

Query  488  SSMQMPPNSDDEC----------------LDEDEFFIVQDHHQLQLIQVVPIP  598
            +S Q+PPNSD+E                 LD+D F +  DH + +   V   P
Sbjct  144  ASNQLPPNSDEERELENNFLNTGVHIDVDLDDDGFNLETDHGKGKRKSVTATP  196



>ref|XP_010665236.1| PREDICTED: uncharacterized protein LOC104882713 [Vitis vinifera]
Length=314

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  256  KEYNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYE  435
            +++NRL++ +  F+EL+  +   ++  TNIV A E+TW+ +   H K   F+K GC+ Y+
Sbjct  74   QKFNRLRIKHREFTELLKQIGFDWDAETNIVHATEETWQNYLRAHPKASQFRKRGCQHYK  133

Query  436  LMADVFALSVATG  474
            L+  +F  S   G
Sbjct  134  LLGLIFDKSTTIG  146



>ref|XP_008222122.1| PREDICTED: uncharacterized protein At2g29880-like [Prunus mume]
 ref|XP_008222124.1| PREDICTED: uncharacterized protein At2g29880-like [Prunus mume]
Length=305

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  256  KEYNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYE  435
            ++YNRL+ ++  F++L+ H  + ++P TN V+A E+ W  +  K+     F+  GC  Y+
Sbjct  68   QKYNRLRKIHREFTKLISHTGMGWDPNTNTVQASEEIWASYLKKNKFASRFRSKGCPHYD  127

Query  436  LMADVFALSVATGR-SCQLVHA  498
            L+  +F  + A+G+  C   H+
Sbjct  128  LLGLIFNYTTASGQMQCASTHS  149



>emb|CAN82893.1| hypothetical protein VITISV_043096 [Vitis vinifera]
Length=561

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  256  KEYNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYE  435
            +++NRL+ M+  FS+L+ H    ++  TN   A E+TW+ +   H   K F+  GC  Y 
Sbjct  67   QKFNRLRAMHREFSDLLKHTGFGWDVETNTEHALEETWQNYIRAHPNAKRFRSKGCPNYN  126

Query  436  LMADVFALSVATG  474
            L+  +F  S ATG
Sbjct  127  LLGLIFNPSTATG  139



>emb|CAN75216.1| hypothetical protein VITISV_003517 [Vitis vinifera]
Length=998

 Score = 53.5 bits (127),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +1

Query  256  KEYNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYE  435
            +++NRL+ M+  FS+L+ H    ++  TN V   E+TW+ +   H   K F+  GC  Y 
Sbjct  528  QKFNRLRAMHREFSDLLKHTGFGWDAETNTVHTLEETWQNYIRAHPNAKRFRSKGCLNYN  587

Query  436  LMADVFALSVATG  474
            L+  +F  S A G
Sbjct  588  LLGLIFNPSTAIG  600


 Score = 23.9 bits (50),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = +2

Query  488  SSMQMPPNSDDE  523
            SS Q PPN+DDE
Sbjct  605  SSTQDPPNTDDE  616



>gb|KHN21833.1| hypothetical protein glysoja_033692 [Glycine soja]
Length=351

 Score = 47.4 bits (111),  Expect(3) = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 47/83 (57%), Gaps = 4/83 (5%)
 Frame = +1

Query  259  EYNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCK-RYE  435
            ++NRL+ ++  FS L+    VT+   +N V A ++ W +   K   +K FKK+G +  Y+
Sbjct  56   KFNRLRQIHRDFSTLLARTGVTWEMESNKVNALDEVWDELIKKGRHYKNFKKHGFEYDYD  115

Query  436  LMADVFALSVATGRSCQLVHANA  504
            ++ D+F  S  TG+   L HA+ 
Sbjct  116  ILGDIFNSSTTTGK---LSHAST  135


 Score = 29.3 bits (64),  Expect(3) = 7e-06, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  177  LKPSDWNEIDREMMEFIGLSYGMTKLKG  260
             K + W EI++++ E I  +YG+ KLK 
Sbjct  28   FKTTTWEEINKDLFEMIQTNYGVDKLKS  55


 Score = 20.0 bits (40),  Expect(3) = 7e-06, Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +2

Query  482  ANSSMQMPPNSDDECLDEDEFFIVQDH  562
            +++S Q PPN D+E   E +F     H
Sbjct  131  SHASTQDPPNFDEERAMEGDFLTKGIH  157



>gb|KHN24697.1| hypothetical protein glysoja_029766 [Glycine soja]
Length=142

 Score = 48.5 bits (114),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCK-RYEL  438
            +NRL+ M+  FS L+   RVT+   +N V A ++ W +   K   +K FKK+G +  Y++
Sbjct  68   FNRLRQMHRDFSTLLARTRVTWEMESNEVNAPDEVWDELIKKGRHYKNFKKHGFEYNYDI  127

Query  439  MADVFALSVATGR  477
            ++D+F  S   G+
Sbjct  128  LSDIFNSSTLIGK  140


 Score = 28.5 bits (62),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +3

Query  177  LKPSDWNEIDREMMEFIGLSYGMTKLK  257
             K + W EI++++ E I  +YG+ KLK
Sbjct  39   FKTTTWEEINKDLFEMIQTNYGVDKLK  65



>ref|XP_011021317.1| PREDICTED: uncharacterized protein LOC105123429 isoform X2 [Populus 
euphratica]
Length=243

 Score = 41.2 bits (95),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKF  378
            YNRL+L +  FS+L+ H  VTY+  +N V A E+ WK F
Sbjct  70   YNRLRLKHRQFSDLISHTGVTYSSSSNQVYATEEVWKMF  108


 Score = 34.7 bits (78),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = +3

Query  177  LKPSDWNEIDREMMEFIGLSYGMTKLKG  260
             K  DWNEID E+   IG  YG  +L+G
Sbjct  41   FKQVDWNEIDEELFSVIGQKYGAERLQG  68



>ref|XP_009351225.1| PREDICTED: uncharacterized protein LOC103942747 [Pyrus x bretschneideri]
Length=303

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 49/82 (60%), Gaps = 4/82 (5%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            YNRL+ +Y  F++LV H  + ++P T+ V A E+ W+ +  K+     F++ GC  Y+++
Sbjct  66   YNRLRKIYREFAKLVAHTGMCWDPETDKVHASEEVWESYLKKNKFASRFRRKGCPEYQVL  125

Query  442  ADVFALSVATGRSCQLVHANAT  507
             ++F    +TG+    +H+ +T
Sbjct  126  REIFNHIPSTGQ----MHSGST  143



>ref|XP_004308208.1| PREDICTED: uncharacterized protein LOC101308913 [Fragaria vesca 
subsp. vesca]
Length=274

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL+  +  FS+L+ H    ++P+ N V A E+ W  +  +    K ++K G + YE++
Sbjct  69   FNRLRKKHREFSDLIEHTGFGWDPIANTVTASEEVWATYIKRVSGVKPYRKKGLEHYEIL  128

Query  442  ADVFALSVATGRSCQL  489
             ++F  S AT    +L
Sbjct  129  GEIFNTSTATDDEREL  144



>ref|XP_006420050.1| hypothetical protein CICLE_v10006620mg, partial [Citrus clementina]
 gb|ESR33290.1| hypothetical protein CICLE_v10006620mg, partial [Citrus clementina]
Length=315

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL+  +  FS+LV H    ++PV+N V A E  W ++  +    K ++K G + Y+ +
Sbjct  126  FNRLRKKHREFSDLVAHTGFGWDPVSNTVTASEAVWAEYIKRVPGVKPYRKKGLEHYQTL  185

Query  442  ADVFALSVATGRSC  483
             ++F  + A+G  C
Sbjct  186  GEIFNTTTASGHLC  199



>ref|XP_008363681.1| PREDICTED: uncharacterized protein LOC103427405 [Malus domestica]
Length=303

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            YNRL+ +Y  F++LV H  + ++P T+ V A E+ W+ +  K+     F++ GC +Y+++
Sbjct  66   YNRLRKIYREFAKLVAHTGMCWDPETDKVHASEEVWESYLKKNKFASRFRRKGCPQYQVL  125

Query  442  ADVFALSVATGR  477
             ++F    + G+
Sbjct  126  GEIFNHIPSNGQ  137



>ref|XP_004298194.1| PREDICTED: uncharacterized protein At2g29880-like [Fragaria vesca 
subsp. vesca]
Length=147

 Score = 48.5 bits (114),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +1

Query  277  LMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELMADVFA  456
            L++  FS+L+ H    ++P+ N + A E+ W  +  +    K ++K G + YE++ ++F 
Sbjct  12   LLHREFSDLIEHTGFGWDPIRNTITASEEVWATYVKRVSGVKPYRKKGLEHYEILREIFD  71

Query  457  LSVATGR  477
             + +TG+
Sbjct  72   TTTSTGQ  78


 Score = 23.5 bits (49),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +2

Query  488  SSMQMPPNSDDE  523
            +S Q+PPNSDDE
Sbjct  82   ASSQVPPNSDDE  93



>ref|XP_006481535.1| PREDICTED: uncharacterized protein At2g29880-like [Citrus sinensis]
Length=292

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL+  Y  FS+L+ H    +NPVTN + A +  W  +       K ++K G + Y ++
Sbjct  70   FNRLRKKYREFSDLIKHPGFDWNPVTNTITAPDSVWAAYVKSVPGVKPYRKKGLENYHIL  129

Query  442  ADVFALSVATGR  477
             ++F+ + AT +
Sbjct  130  GEIFSGNTATSQ  141



>ref|XP_006424122.1| hypothetical protein CICLE_v10028960mg [Citrus clementina]
 gb|ESR37362.1| hypothetical protein CICLE_v10028960mg [Citrus clementina]
Length=261

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL+  Y  FS+L+ H    +NPVTN + A +  W  +       K ++K G + Y ++
Sbjct  39   FNRLRKKYREFSDLIKHPGFDWNPVTNTITAPDSVWAAYVKSVPGVKPYRKKGLENYHIL  98

Query  442  ADVFALSVATGR  477
             ++F+ + AT +
Sbjct  99   GEIFSGNTATSQ  110



>ref|XP_006424123.1| hypothetical protein CICLE_v10028960mg [Citrus clementina]
 gb|ESR37363.1| hypothetical protein CICLE_v10028960mg [Citrus clementina]
Length=292

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +1

Query  262  YNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELM  441
            +NRL+  Y  FS+L+ H    +NPVTN + A +  W  +       K ++K G + Y ++
Sbjct  70   FNRLRKKYREFSDLIKHPGFDWNPVTNTITAPDSVWAAYVKSVPGVKPYRKKGLENYHIL  129

Query  442  ADVFALSVATGR  477
             ++F+ + AT +
Sbjct  130  GEIFSGNTATSQ  141



>emb|CAN73742.1| hypothetical protein VITISV_026084 [Vitis vinifera]
Length=708

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +1

Query  256  KEYNRLKLMYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYE  435
            +++NRL+ M+  FS L+ H+   ++  T  V A E+TW+ +       K F+  GC  Y 
Sbjct  67   QKFNRLRAMHREFSNLLKHIGFGWDAKTXTVXALEETWQNYIRAXPNAKRFRSKGCPNYN  126

Query  436  LMADVFALSVAT  471
            L+  +F  S AT
Sbjct  127  LLGLIFXPSTAT  138



>ref|XP_010648831.1| PREDICTED: uncharacterized protein At2g29880-like [Vitis vinifera]
Length=239

 Score = 48.5 bits (114),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 0/65 (0%)
 Frame = +1

Query  280  MYT*FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELMADVFAL  459
            M+  F +L+ H    ++  TN V A E+TW+ +   H   K F+  GC  Y L+  +F  
Sbjct  1    MHREFFDLLKHTGFGWDAETNTVHALEETWQNYIRAHPNAKRFRSKGCPNYNLLGLIFNP  60

Query  460  SVATG  474
            S ATG
Sbjct  61   STATG  65


 Score = 21.6 bits (44),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = +2

Query  488  SSMQMPPNSDDE  523
            SS Q PPN+DDE
Sbjct  70   SSTQDPPNTDDE  81



>ref|XP_007206593.1| hypothetical protein PRUPE_ppa020476mg, partial [Prunus persica]
 gb|EMJ07792.1| hypothetical protein PRUPE_ppa020476mg, partial [Prunus persica]
Length=175

 Score = 47.0 bits (110),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = +1

Query  292  FSELVYHMRVTYNPVTNIVEACEDTWKKFYAKHLKFKFFKKNGCKRYELMADVFALSVAT  471
            FS+L+ H    ++P  N V A ED W  +     + K ++ +G   Y+L+ ++F  + AT
Sbjct  1    FSDLIEHTGFGWDPNANTVTASEDVWASYIKSKPRAKQYRTHGLVHYQLLEEIFNTTTAT  60

Query  472  GR  477
            G+
Sbjct  61   GQ  62


 Score = 23.1 bits (48),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = +2

Query  488  SSMQMPPNSDDECLDEDEFFIVQDH  562
            +S Q+PPNSD+E   E+ F     H
Sbjct  66   ASNQLPPNSDEEHELENNFLNTGVH  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1309270154804