BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14158_g1_i2 len=1028 path=[1006:0-226 2654:227-413 1420:414-455
2344:456-550 1557:551-574 2462:575-743 1750:744-1027]

Length=1028
                                                                      Score     E

ref|XP_009776612.1|  PREDICTED: acid phosphatase 1-like                 408   3e-139   
ref|XP_009622654.1|  PREDICTED: acid phosphatase 1-like                 404   1e-137   
ref|XP_004241953.1|  PREDICTED: acid phosphatase 1                      403   3e-137   
ref|XP_010322861.1|  PREDICTED: acid phosphatase 1-like                 401   1e-136   
ref|XP_006356134.1|  PREDICTED: acid phosphatase 1-like                 397   7e-135   
ref|XP_009787591.1|  PREDICTED: acid phosphatase 1-like                 393   2e-133   
emb|CDO97963.1|  unnamed protein product                                390   5e-132   
ref|XP_004241952.1|  PREDICTED: acid phosphatase 1-like                 388   1e-131   
gb|AFX66999.1|  putative acid phosphatase                               388   3e-131   
ref|XP_009795136.1|  PREDICTED: acid phosphatase 1-like                 370   2e-124   
ref|XP_009625321.1|  PREDICTED: acid phosphatase 1-like                 370   2e-124   
ref|XP_004235637.1|  PREDICTED: acid phosphatase 1-like                 359   2e-120   
ref|XP_010654601.1|  PREDICTED: acid phosphatase 1                      320   5e-105   
emb|CAN82027.1|  hypothetical protein VITISV_000612                     320   7e-105   Vitis vinifera
ref|XP_002515949.1|  Stem 28 kDa glycoprotein precursor, putative       314   2e-102   Ricinus communis
ref|XP_010033712.1|  PREDICTED: acid phosphatase 1-like                 313   4e-102   
ref|XP_010033826.1|  PREDICTED: acid phosphatase 1-like                 312   7e-102   
dbj|BAJ34931.1|  hypothetical protein                                   306   7e-100   
ref|XP_010915365.1|  PREDICTED: acid phosphatase 1-like                 303   2e-98    
ref|XP_006465744.1|  PREDICTED: acid phosphatase 1-like                 303   3e-98    
ref|XP_010258709.1|  PREDICTED: acid phosphatase 1-like                 303   3e-98    
ref|XP_011000941.1|  PREDICTED: acid phosphatase 1-like                 301   2e-97    
ref|XP_003632911.1|  PREDICTED: acid phosphatase 1-like                 301   2e-97    
ref|XP_007024338.1|  Stem 28 kDa glycoprotein, putative                 300   3e-97    
ref|XP_008798588.1|  PREDICTED: acid phosphatase 1-like                 300   6e-97    
ref|XP_002299744.2|  hypothetical protein POPTR_0001s19180g             298   4e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010033711.1|  PREDICTED: acid phosphatase 1-like                 297   9e-96    
ref|XP_010033825.1|  PREDICTED: acid phosphatase 1-like                 296   1e-95    
ref|XP_004302847.1|  PREDICTED: stem 28 kDa glycoprotein-like           296   2e-95    
gb|KDP40846.1|  hypothetical protein JCGZ_24845                         295   4e-95    
ref|XP_008228404.1|  PREDICTED: acid phosphatase 1-like                 293   2e-94    
ref|XP_010690146.1|  PREDICTED: acid phosphatase 1-like                 292   7e-94    
ref|XP_007215831.1|  hypothetical protein PRUPE_ppa010152mg             290   3e-93    
ref|XP_010033713.1|  PREDICTED: acid phosphatase 1-like                 287   4e-92    
ref|XP_006465710.1|  PREDICTED: acid phosphatase 1-like                 287   2e-91    
ref|XP_004302846.1|  PREDICTED: stem 28 kDa glycoprotein-like           286   2e-91    
ref|XP_006426852.1|  hypothetical protein CICLE_v10026223mg             286   3e-91    
ref|XP_010033828.1|  PREDICTED: acid phosphatase 1-like                 285   4e-91    
ref|XP_004960901.1|  PREDICTED: stem 28 kDa glycoprotein-like           284   9e-91    
ref|XP_007045549.1|  Stem 28 kDa glycoprotein, putative                 284   1e-90    
gb|KDO51839.1|  hypothetical protein CISIN_1g036571mg                   283   2e-90    
ref|XP_004960903.1|  PREDICTED: acid phosphatase 1-like                 284   2e-90    
ref|XP_006426853.1|  hypothetical protein CICLE_v10027566mg             283   2e-90    
ref|XP_002440748.1|  hypothetical protein SORBIDRAFT_09g006010          283   7e-90    Sorghum bicolor [broomcorn]
dbj|BAJ94050.1|  predicted protein                                      278   2e-88    
gb|EMS46715.1|  Stem 28 kDa glycoprotein                                278   3e-88    
ref|XP_004963522.1|  PREDICTED: stem 28 kDa glycoprotein-like           278   3e-88    
ref|XP_002439412.1|  hypothetical protein SORBIDRAFT_09g005960          278   4e-88    Sorghum bicolor [broomcorn]
ref|XP_003568779.1|  PREDICTED: stem 28 kDa glycoprotein                278   4e-88    
ref|XP_009338743.1|  PREDICTED: acid phosphatase 1-like                 277   5e-88    
ref|XP_004960899.1|  PREDICTED: stem 28 kDa glycoprotein-like iso...    276   1e-87    
ref|XP_004305256.1|  PREDICTED: acid phosphatase 1-like                 274   6e-87    
ref|XP_004510320.1|  PREDICTED: stem 28 kDa glycoprotein-like           274   9e-87    
ref|XP_011072446.1|  PREDICTED: acid phosphatase 1-like                 271   1e-86    
ref|XP_004960902.1|  PREDICTED: acid phosphatase 1-like                 274   2e-86    
gb|EMS66285.1|  Stem 28 kDa glycoprotein                                273   2e-86    
ref|XP_010654600.1|  PREDICTED: acid phosphatase 1-like                 273   2e-86    
ref|XP_006654133.1|  PREDICTED: acid phosphatase 1-like                 273   2e-86    
ref|XP_008380842.1|  PREDICTED: acid phosphatase 1-like                 273   4e-86    
gb|EMT03894.1|  Stem 28 kDa glycoprotein                                272   4e-86    
emb|CAB71336.2|  putative acid phosphatase                              272   5e-86    Hordeum vulgare [barley]
dbj|BAJ94870.1|  predicted protein                                      272   6e-86    
ref|NP_001148494.1|  stem 28 kDa glycoprotein precursor                 271   9e-86    Zea mays [maize]
ref|NP_001150932.1|  LOC100284565 precursor                             272   1e-85    Zea mays [maize]
ref|XP_009381186.1|  PREDICTED: acid phosphatase 1-like                 271   2e-85    
ref|XP_004960900.1|  PREDICTED: stem 28 kDa glycoprotein-like iso...    271   2e-85    
dbj|BAJ90845.1|  predicted protein                                      270   3e-85    
ref|XP_008348489.1|  PREDICTED: acid phosphatase 1-like                 269   8e-85    
ref|XP_008358084.1|  PREDICTED: acid phosphatase 1-like                 269   9e-85    
gb|AGG23547.1|  acid phosphatase-like protein 1                         268   1e-84    
gb|EMS67586.1|  Acid phosphatase 1                                      268   2e-84    
gb|EMT19717.1|  Acid phosphatase 1                                      268   4e-84    
gb|AFK40440.1|  unknown                                                 267   4e-84    
gb|EMS54507.1|  Acid phosphatase 1                                      268   4e-84    
gb|AFK46217.1|  unknown                                                 266   9e-84    
ref|XP_003627057.1|  Acid phosphatase                                   266   1e-83    
emb|CBI36038.3|  unnamed protein product                                273   2e-83    
ref|XP_003627058.1|  Stem 28 kDa glycoprotein                           265   3e-83    
ref|XP_004960898.1|  PREDICTED: stem 31 kDa glycoprotein-like iso...    264   5e-83    
ref|XP_006356133.1|  PREDICTED: acid phosphatase 1-like                 261   1e-82    
ref|NP_001148296.1|  stem 28 kDa glycoprotein precursor                 264   1e-82    Zea mays [maize]
gb|AFW77368.1|  stem glycoprotein                                       264   1e-82    
ref|XP_002440742.1|  hypothetical protein SORBIDRAFT_09g005940          260   2e-81    Sorghum bicolor [broomcorn]
ref|XP_009344485.1|  PREDICTED: acid phosphatase 1-like                 260   3e-81    
gb|EYU36713.1|  hypothetical protein MIMGU_mgv1a012835mg                259   3e-81    
ref|XP_010088387.1|  Stem 28 kDa glycoprotein                           259   4e-81    
gb|AFW77369.1|  hypothetical protein ZEAMMB73_279889                    258   2e-80    
ref|XP_006654134.1|  PREDICTED: stem 28 kDa glycoprotein-like           256   3e-80    
ref|XP_003530059.1|  PREDICTED: stem 28 kDa glycoprotein-like           256   5e-80    
ref|XP_009797387.1|  PREDICTED: acid phosphatase 1-like                 254   1e-79    
gb|EAY96842.1|  hypothetical protein OsI_18762                          256   2e-79    Oryza sativa Indica Group [Indian rice]
gb|KHN39260.1|  Stem 28 kDa glycoprotein                                253   3e-79    
ref|XP_009625320.1|  PREDICTED: acid phosphatase 1-like                 250   7e-78    
gb|EMT02057.1|  Stem 28 kDa glycoprotein                                249   4e-77    
ref|XP_007135625.1|  hypothetical protein PHAVU_010G144600g             248   6e-77    
ref|XP_009607238.1|  PREDICTED: acid phosphatase 1-like                 245   9e-77    
gb|KHN05326.1|  Stem 28 kDa glycoprotein                                245   2e-75    
ref|XP_006853740.1|  hypothetical protein AMTR_s00056p00177520          244   7e-75    
ref|XP_010941067.1|  PREDICTED: acid phosphatase 1-like                 242   2e-74    
ref|XP_010258799.1|  PREDICTED: acid phosphatase 1                      241   9e-74    
ref|NP_001236180.1|  acid phosphatase precursor                         240   2e-73    
ref|XP_008801792.1|  PREDICTED: acid phosphatase 1-like                 239   3e-73    
emb|CBI25273.3|  unnamed protein product                                236   4e-73    
ref|XP_009588519.1|  PREDICTED: acid phosphatase 1-like                 238   5e-73    
ref|XP_006357920.1|  PREDICTED: acid phosphatase 1-like                 238   6e-73    
ref|XP_003620757.1|  Acid phosphatase-like protein                      238   8e-73    
ref|XP_010662272.1|  PREDICTED: acid phosphatase 1                      238   1e-72    
ref|XP_011101105.1|  PREDICTED: acid phosphatase 1-like                 237   2e-72    
ref|XP_010098159.1|  Acid phosphatase 1                                 236   3e-72    
gb|AFK34288.1|  unknown                                                 236   4e-72    
ref|XP_011076425.1|  PREDICTED: acid phosphatase 1-like                 236   9e-72    
ref|XP_010433112.1|  PREDICTED: acid phosphatase 1-like                 235   9e-72    
ref|XP_009797620.1|  PREDICTED: acid phosphatase 1-like                 235   9e-72    
ref|XP_010532228.1|  PREDICTED: acid phosphatase 1-like isoform X1      235   1e-71    
ref|NP_194245.1|  HAD superfamily, subfamily IIIB acid phosphatase      234   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867623.1|  hypothetical protein ARALYDRAFT_329150             234   2e-71    
ref|XP_010536549.1|  PREDICTED: acid phosphatase 1-like                 234   3e-71    
ref|NP_001234071.1|  acid phosphatase 1 precursor                       233   4e-71    
prf||1908418A  acid phosphatase 1                                       233   8e-71 
gb|EYU31308.1|  hypothetical protein MIMGU_mgv1a011623mg                233   1e-70    
gb|AHC69831.1|  acid phosphatase                                        232   1e-70    
gb|KFK26738.1|  acid phosphatase                                        232   2e-70    
ref|XP_010442941.1|  PREDICTED: acid phosphatase 1-like                 231   2e-70    
ref|XP_004513069.1|  PREDICTED: acid phosphatase 1-like                 231   2e-70    
ref|XP_011028463.1|  PREDICTED: acid phosphatase 1                      231   4e-70    
ref|XP_010433681.1|  PREDICTED: acid phosphatase 1-like                 231   4e-70    
ref|XP_010438922.1|  PREDICTED: acid phosphatase 1-like                 231   5e-70    
ref|XP_009800382.1|  PREDICTED: acid phosphatase 1-like                 231   6e-70    
gb|KHG01291.1|  Acid phosphatase 1                                      231   6e-70    
ref|XP_007215832.1|  hypothetical protein PRUPE_ppa010152mg             229   8e-70    
ref|XP_007038298.1|  HAD superfamily, subfamily IIIB acid phospha...    230   9e-70    
ref|XP_010438316.1|  PREDICTED: acid phosphatase 1-like                 230   1e-69    
ref|XP_010482458.1|  PREDICTED: acid phosphatase 1-like                 230   1e-69    
ref|XP_006284361.1|  hypothetical protein CARUB_v10005533mg             230   1e-69    
ref|NP_194656.1|  HAD superfamily, subfamily IIIB acid phosphatase      229   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385121.1|  acid phosphatase family protein                    229   2e-69    
ref|XP_010693738.1|  PREDICTED: acid phosphatase 1                      229   2e-69    
gb|ABK95709.1|  unknown                                                 226   2e-69    Populus trichocarpa [western balsam poplar]
ref|XP_006358226.1|  PREDICTED: acid phosphatase 1-like                 229   3e-69    
ref|XP_006280976.1|  hypothetical protein CARUB_v10026976mg             228   4e-69    
emb|CDO98049.1|  unnamed protein product                                230   4e-69    
ref|NP_199939.1|  HAD superfamily, subfamily IIIB acid phosphatase      228   5e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370433.1|  PREDICTED: acid phosphatase 1-like                 228   5e-69    
ref|XP_010688366.1|  PREDICTED: acid phosphatase 1-like                 228   5e-69    
ref|XP_008798586.1|  PREDICTED: acid phosphatase 1-like                 228   5e-69    
ref|XP_004235180.1|  PREDICTED: acid phosphatase 1                      228   5e-69    
ref|XP_002865848.1|  hypothetical protein ARALYDRAFT_495196             228   7e-69    
gb|KDP22459.1|  hypothetical protein JCGZ_26290                         228   8e-69    
ref|XP_006401998.1|  hypothetical protein EUTSA_v10014448mg             228   8e-69    
ref|XP_010915367.1|  PREDICTED: acid phosphatase 1-like isoform X1      227   1e-68    
gb|EMT02056.1|  Stem 31 kDa glycoprotein                                227   1e-68    
ref|XP_004307784.1|  PREDICTED: acid phosphatase 1-like                 228   1e-68    
ref|XP_008367296.1|  PREDICTED: acid phosphatase 1-like                 227   2e-68    
gb|EYU20188.1|  hypothetical protein MIMGU_mgv1a011800mg                227   2e-68    
ref|XP_006656617.1|  PREDICTED: acid phosphatase 1-like                 225   2e-68    
ref|XP_009372837.1|  PREDICTED: acid phosphatase 1-like                 226   3e-68    
ref|XP_004511128.1|  PREDICTED: acid phosphatase 1-like                 226   3e-68    
ref|NP_194655.1|  HAD superfamily, subfamily IIIB acid phosphatase      226   4e-68    Arabidopsis thaliana [mouse-ear cress]
gb|KCW90870.1|  hypothetical protein EUGRSUZ_A02919                     226   4e-68    
ref|XP_002510996.1|  Acid phosphatase 1 precursor, putative             226   4e-68    Ricinus communis
ref|XP_009362705.1|  PREDICTED: acid phosphatase 1                      226   5e-68    
ref|XP_009137842.1|  PREDICTED: acid phosphatase 1                      225   6e-68    
ref|XP_002867419.1|  acid phosphatase class B family protein            225   7e-68    
ref|XP_010448471.1|  PREDICTED: acid phosphatase 1-like                 225   9e-68    
ref|XP_009109048.1|  PREDICTED: acid phosphatase 1-like isoform X2      225   1e-67    
ref|XP_008376378.1|  PREDICTED: acid phosphatase 1                      225   1e-67    
gb|EMS60884.1|  Acid phosphatase 1                                      229   1e-67    
ref|XP_010548683.1|  PREDICTED: acid phosphatase 1-like                 224   2e-67    
ref|XP_009388590.1|  PREDICTED: acid phosphatase 1-like                 224   2e-67    
emb|CDY47773.1|  BnaC07g41870D                                          224   2e-67    
ref|XP_002867418.1|  predicted protein                                  224   2e-67    
emb|CDP05370.1|  unnamed protein product                                224   2e-67    
ref|XP_010062554.1|  PREDICTED: acid phosphatase 1                      228   2e-67    
gb|EAZ35770.1|  hypothetical protein OsJ_20061                          225   2e-67    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056747.1|  Os06g0139800                                       225   2e-67    Oryza sativa Japonica Group [Japonica rice]
gb|ABK23358.1|  unknown                                                 224   2e-67    Picea sitchensis
ref|XP_010267101.1|  PREDICTED: acid phosphatase 1-like                 224   3e-67    
ref|XP_007152955.1|  hypothetical protein PHAVU_004G174200g             223   3e-67    
ref|XP_006837335.1|  hypothetical protein AMTR_s00111p00084650          225   3e-67    
ref|XP_007218818.1|  hypothetical protein PRUPE_ppa010063mg             224   3e-67    
gb|KFK29483.1|  hypothetical protein AALP_AA7G140100                    223   3e-67    
ref|XP_008794092.1|  PREDICTED: acid phosphatase 1-like                 223   3e-67    
ref|XP_008234437.1|  PREDICTED: acid phosphatase 1                      223   5e-67    
ref|XP_006412859.1|  hypothetical protein EUTSA_v10026000mg             223   6e-67    
emb|CDY03376.1|  BnaC01g17060D                                          223   8e-67    
ref|XP_007133483.1|  hypothetical protein PHAVU_011G182400g             223   9e-67    
ref|XP_007012979.1|  HAD superfamily isoform 2                          222   1e-66    
ref|XP_009138920.1|  PREDICTED: acid phosphatase 1                      222   1e-66    
ref|XP_004287494.1|  PREDICTED: acid phosphatase 1-like                 222   1e-66    
ref|XP_009127318.1|  PREDICTED: acid phosphatase 1                      222   1e-66    
emb|CDY34346.1|  BnaA01g14490D                                          222   1e-66    
gb|KDO45271.1|  hypothetical protein CISIN_1g023192mg                   223   1e-66    
gb|KCW53447.1|  hypothetical protein EUGRSUZ_J02693                     221   1e-66    
ref|XP_002436441.1|  hypothetical protein SORBIDRAFT_10g002690          223   3e-66    Sorghum bicolor [broomcorn]
ref|NP_001240054.1|  uncharacterized protein LOC100802126 precursor     221   3e-66    
ref|XP_006413336.1|  hypothetical protein EUTSA_v10026026mg             221   4e-66    
gb|ABK21277.1|  unknown                                                 221   4e-66    Picea sitchensis
ref|XP_002867417.1|  predicted protein                                  221   4e-66    
ref|XP_007012978.1|  HAD superfamily isoform 1                          223   4e-66    
ref|XP_010110867.1|  Acid phosphatase 1                                 220   5e-66    
ref|XP_010447874.1|  PREDICTED: acid phosphatase 1-like                 220   5e-66    
ref|XP_009109046.1|  PREDICTED: acid phosphatase 1-like isoform X1      221   5e-66    
gb|ACN40876.1|  unknown                                                 220   6e-66    Picea sitchensis
ref|XP_010925513.1|  PREDICTED: acid phosphatase 1-like isoform X1      220   6e-66    
ref|XP_008387412.1|  PREDICTED: acid phosphatase 1-like                 220   6e-66    
ref|XP_006490172.1|  PREDICTED: acid phosphatase 1-like                 221   6e-66    
ref|XP_010438317.1|  PREDICTED: acid phosphatase 1-like                 220   7e-66    
ref|XP_010249468.1|  PREDICTED: acid phosphatase 1-like                 220   7e-66    
gb|ABK21327.1|  unknown                                                 220   7e-66    Picea sitchensis
gb|AFK42878.1|  unknown                                                 220   7e-66    
ref|XP_002283385.2|  PREDICTED: acid phosphatase 1-like                 221   8e-66    Vitis vinifera
ref|XP_010925515.1|  PREDICTED: acid phosphatase 1-like isoform X2      219   1e-65    
ref|XP_009795729.1|  PREDICTED: acid phosphatase 1-like                 219   2e-65    
ref|XP_002514195.1|  Acid phosphatase 1 precursor, putative             219   2e-65    Ricinus communis
ref|XP_007135620.1|  hypothetical protein PHAVU_010G144200g             219   2e-65    
ref|XP_009352576.1|  PREDICTED: acid phosphatase 1                      219   2e-65    
ref|XP_006284398.1|  hypothetical protein CARUB_v10005568mg             218   2e-65    
emb|CDY14217.1|  BnaA08g13480D                                          219   2e-65    
ref|XP_006284235.1|  hypothetical protein CARUB_v10005397mg             219   3e-65    
gb|ACJ84626.1|  unknown                                                 218   3e-65    Medicago truncatula
gb|AFX67034.1|  stem 28 kDa glycoprotein                                214   3e-65    
ref|XP_006421584.1|  hypothetical protein CICLE_v10005566mg             219   4e-65    
gb|ADE76411.1|  unknown                                                 218   5e-65    
ref|XP_008367917.1|  PREDICTED: acid phosphatase 1-like                 218   5e-65    
ref|XP_007202474.1|  hypothetical protein PRUPE_ppa010268mg             218   5e-65    
ref|XP_010541004.1|  PREDICTED: acid phosphatase 1                      218   6e-65    
ref|XP_010098160.1|  Acid phosphatase 1                                 216   8e-65    
ref|NP_001242215.1|  uncharacterized protein LOC100795218 precursor     217   9e-65    
ref|XP_008242463.1|  PREDICTED: acid phosphatase 1                      217   1e-64    
ref|XP_004245159.1|  PREDICTED: acid phosphatase 1-like                 216   2e-64    
ref|XP_008437018.1|  PREDICTED: acid phosphatase 1                      216   2e-64    
ref|XP_006359744.1|  PREDICTED: acid phosphatase 1-like                 216   2e-64    
gb|EMT02058.1|  Stem 28 kDa glycoprotein                                213   2e-64    
gb|EEE62606.1|  hypothetical protein OsJ_17409                          216   3e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010433115.1|  PREDICTED: acid phosphatase 1-like                 216   3e-64    
ref|XP_002309231.2|  hypothetical protein POPTR_0006s15760g             215   3e-64    Populus trichocarpa [western balsam poplar]
ref|XP_004143740.1|  PREDICTED: acid phosphatase 1-like                 216   3e-64    
emb|CDY14216.1|  BnaA08g13470D                                          216   4e-64    
gb|AGV54493.1|  acid phosphatase                                        215   4e-64    
ref|XP_009109045.1|  PREDICTED: acid phosphatase 1-like                 216   4e-64    
ref|XP_004964488.1|  PREDICTED: acid phosphatase 1-like isoform X1      219   4e-64    
ref|XP_006451342.1|  hypothetical protein CICLE_v10009222mg             215   5e-64    
gb|ADE77538.1|  unknown                                                 215   6e-64    
gb|KDO55859.1|  hypothetical protein CISIN_1g024820mg                   215   6e-64    
ref|NP_001150931.1|  acid phosphatase 1 precursor                       216   9e-64    Zea mays [maize]
ref|XP_006412858.1|  hypothetical protein EUTSA_v10025999mg             214   9e-64    
ref|XP_004964489.1|  PREDICTED: acid phosphatase 1-like isoform X2      218   1e-63    
gb|AFW75455.1|  hypothetical protein ZEAMMB73_076415                    216   1e-63    
gb|ABK92831.1|  unknown                                                 213   2e-63    Populus trichocarpa [western balsam poplar]
ref|XP_010541530.1|  PREDICTED: vegetative storage protein 2-like       214   2e-63    
ref|XP_011078233.1|  PREDICTED: acid phosphatase 1-like                 213   3e-63    
ref|XP_006429635.1|  hypothetical protein CICLE_v10012544mg             213   3e-63    
ref|XP_009128910.1|  PREDICTED: acid phosphatase 1                      213   4e-63    
ref|XP_006426851.1|  hypothetical protein CICLE_v10026223mg             212   4e-63    
ref|XP_003531798.1|  PREDICTED: acid phosphatase 1-like                 213   5e-63    
gb|KFK39517.1|  hypothetical protein AALP_AA3G254300                    213   5e-63    
emb|CDY62035.1|  BnaC03g77680D                                          213   5e-63    
gb|ACU24349.1|  unknown                                                 213   5e-63    Glycine max [soybeans]
gb|KDO64169.1|  hypothetical protein CISIN_1g025360mg                   212   7e-63    
ref|XP_003557220.2|  PREDICTED: acid phosphatase 1-like                 211   2e-62    
ref|XP_004158153.1|  PREDICTED: acid phosphatase 1-like                 211   3e-62    
gb|ABL85037.1|  acid phosphatase                                        210   5e-62    Brachypodium sylvaticum
gb|EMT19714.1|  Acid phosphatase 1                                      212   6e-62    
ref|XP_003529064.1|  PREDICTED: acid phosphatase 1-like                 209   8e-62    
gb|AGV54632.1|  stem 28 kDa glycoprotein                                209   1e-61    
ref|XP_004141163.1|  PREDICTED: acid phosphatase 1-like                 209   1e-61    
ref|XP_010447870.1|  PREDICTED: acid phosphatase 1-like                 209   1e-61    
ref|XP_011007264.1|  PREDICTED: acid phosphatase 1                      209   1e-61    
ref|XP_004302520.1|  PREDICTED: acid phosphatase 1-like                 209   1e-61    
gb|AFW85941.1|  acid phosphatase 1                                      210   2e-61    
ref|NP_001151681.1|  acid phosphatase 1 precursor                       210   2e-61    Zea mays [maize]
gb|AFK41939.1|  unknown                                                 206   3e-61    
gb|KDP21846.1|  hypothetical protein JCGZ_00633                         208   3e-61    
ref|XP_006654131.1|  PREDICTED: acid phosphatase 1-like                 208   3e-61    
emb|CDP03233.1|  unnamed protein product                                208   4e-61    
ref|XP_006285610.1|  hypothetical protein CARUB_v10007060mg             206   5e-61    
emb|CDY48606.1|  BnaA01g07590D                                          207   7e-61    
ref|NP_001054848.1|  Os05g0190500                                       207   9e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004516313.1|  PREDICTED: acid phosphatase 1-like                 206   1e-60    
ref|XP_010258707.1|  PREDICTED: acid phosphatase 1-like                 207   1e-60    
ref|XP_009415369.1|  PREDICTED: acid phosphatase 1-like                 206   2e-60    
ref|XP_010505497.1|  PREDICTED: acid phosphatase 1-like                 205   3e-60    
ref|XP_009370888.1|  PREDICTED: acid phosphatase 1-like                 205   4e-60    
ref|NP_001238459.1|  stem 28 kDa glycoprotein precursor                 204   5e-60    
emb|CDY60756.1|  BnaA05g34800D                                          204   6e-60    
ref|XP_010529940.1|  PREDICTED: acid phosphatase 1-like                 204   8e-60    
gb|KDP33773.1|  hypothetical protein JCGZ_07344                         204   8e-60    
ref|XP_010517161.1|  PREDICTED: acid phosphatase 1-like                 204   8e-60    
ref|XP_010509146.1|  PREDICTED: acid phosphatase 1-like                 204   1e-59    
ref|XP_006599745.1|  PREDICTED: acid phosphatase 1-like                 204   1e-59    
gb|ABK22580.1|  unknown                                                 205   1e-59    
ref|XP_010548682.1|  PREDICTED: acid phosphatase 1-like                 204   1e-59    
ref|XP_010047662.1|  PREDICTED: acid phosphatase 1-like                 204   1e-59    
ref|XP_010688365.1|  PREDICTED: acid phosphatase 1-like                 203   1e-59    
ref|XP_009143372.1|  PREDICTED: acid phosphatase 1-like                 203   1e-59    
gb|KEH18204.1|  plant acid phosphatase                                  203   1e-59    
ref|XP_008244569.1|  PREDICTED: acid phosphatase 1                      204   1e-59    
prf||1609232A  31kD glycoprotein                                        204   1e-59 
ref|XP_009419864.1|  PREDICTED: acid phosphatase 1-like                 202   2e-59    
ref|XP_010098162.1|  Stem 28 kDa glycoprotein                           204   2e-59    
ref|XP_011001652.1|  PREDICTED: acid phosphatase 1-like                 203   2e-59    
gb|ABK27105.1|  unknown                                                 203   2e-59    
ref|XP_006465709.1|  PREDICTED: acid phosphatase 1-like                 203   2e-59    
emb|CDX91480.1|  BnaC04g06700D                                          202   2e-59    
gb|EAY82942.1|  hypothetical protein OsI_38160                          203   2e-59    
ref|XP_007206281.1|  hypothetical protein PRUPE_ppa016173mg             203   2e-59    
ref|XP_008388379.1|  PREDICTED: acid phosphatase 1-like                 203   3e-59    
gb|ACN40193.1|  unknown                                                 204   3e-59    
ref|XP_010653128.1|  PREDICTED: acid phosphatase 1 isoform X2           202   4e-59    
ref|XP_006654132.1|  PREDICTED: stem 28 kDa glycoprotein-like           202   4e-59    
ref|XP_010438315.1|  PREDICTED: acid phosphatase 1-like                 202   4e-59    
gb|EYU30686.1|  hypothetical protein MIMGU_mgv1a011950mg                202   4e-59    
ref|XP_009337802.1|  PREDICTED: acid phosphatase 1-like                 202   4e-59    
ref|XP_010914845.1|  PREDICTED: acid phosphatase 1-like                 202   4e-59    
ref|XP_008799767.1|  PREDICTED: acid phosphatase 1-like                 202   6e-59    
ref|XP_006411076.1|  hypothetical protein EUTSA_v10017121mg             202   6e-59    
ref|XP_008363936.1|  PREDICTED: acid phosphatase 1-like                 202   7e-59    
ref|XP_002531803.1|  Acid phosphatase 1 precursor, putative             202   7e-59    
ref|XP_010653127.1|  PREDICTED: acid phosphatase 1 isoform X1           202   8e-59    
gb|KDP40845.1|  hypothetical protein JCGZ_24844                         202   8e-59    
ref|XP_002323092.1|  hypothetical protein POPTR_0016s14650g             201   8e-59    
ref|XP_002879756.1|  acid phosphatase class B family protein            201   8e-59    
dbj|BAJ97988.1|  predicted protein                                      202   9e-59    
gb|ACU23829.1|  unknown                                                 201   1e-58    
ref|XP_008370281.1|  PREDICTED: acid phosphatase 1                      201   1e-58    
ref|XP_008355740.1|  PREDICTED: acid phosphatase 1-like                 201   1e-58    
ref|XP_010921196.1|  PREDICTED: acid phosphatase 1                      201   2e-58    
ref|XP_009783330.1|  PREDICTED: acid phosphatase 1 isoform X2           201   2e-58    
ref|NP_001241536.1|  stem 31 kDa glycoprotein precursor                 200   2e-58    
gb|ACU24345.1|  unknown                                                 200   2e-58    
gb|KGN54464.1|  Acid phosphatase 1                                      200   3e-58    
ref|XP_008459051.1|  PREDICTED: acid phosphatase 1-like                 201   3e-58    
ref|XP_009783329.1|  PREDICTED: acid phosphatase 1 isoform X1           201   3e-58    
ref|XP_007033481.1|  Acid phosphatase 1, putative isoform 3             200   3e-58    
ref|XP_004142728.1|  PREDICTED: acid phosphatase 1-like                 200   3e-58    
gb|KHN33255.1|  Stem 31 kDa glycoprotein                                199   4e-58    
ref|XP_007033479.1|  Acid phosphatase 1, putative isoform 1             200   4e-58    
ref|NP_181394.1|  HAD superfamily, subfamily IIIB acid phosphatase      199   4e-58    
ref|XP_006426854.1|  hypothetical protein CICLE_v10027612mg             200   4e-58    
ref|XP_010433111.1|  PREDICTED: acid phosphatase 1-like                 200   6e-58    
ref|XP_008463285.1|  PREDICTED: acid phosphatase 1                      199   9e-58    
emb|CDY05398.1|  BnaC02g41060D                                          199   1e-57    
ref|XP_009602496.1|  PREDICTED: acid phosphatase 1-like isoform X2      198   2e-57    
ref|XP_010043658.1|  PREDICTED: acid phosphatase 1-like isoform X1      199   2e-57    
gb|KCW88400.1|  hypothetical protein EUGRSUZ_A00788                     198   2e-57    
ref|XP_010043667.1|  PREDICTED: acid phosphatase 1-like isoform X2      198   3e-57    
ref|NP_001237136.1|  syringolide-induced protein B15-3-5                196   4e-57    
ref|NP_001174256.1|  Os05g0190300                                       197   5e-57    
ref|XP_009130001.1|  PREDICTED: vegetative storage protein 2-like       197   5e-57    
ref|XP_009602493.1|  PREDICTED: acid phosphatase 1-like isoform X1      197   5e-57    
ref|XP_010043653.1|  PREDICTED: acid phosphatase 1-like                 197   5e-57    
ref|XP_011091248.1|  PREDICTED: acid phosphatase 1-like                 197   6e-57    
ref|XP_006296330.1|  hypothetical protein CARUB_v10025510mg             196   6e-57    
gb|ACU23922.1|  unknown                                                 196   7e-57    
ref|XP_010553191.1|  PREDICTED: acid phosphatase 1                      196   9e-57    
ref|XP_010683443.1|  PREDICTED: acid phosphatase 1                      197   1e-56    
emb|CDY14447.1|  BnaC03g21480D                                          196   1e-56    
gb|AFW82018.1|  Stem glycoprotein                                       195   1e-56    
gb|AAS07026.1|  vegetative storage protein                              196   1e-56    
ref|NP_001054851.1|  Os05g0192100                                       194   1e-56    
gb|ACU23890.1|  unknown                                                 193   1e-56    
sp|P10742.2|S25K_SOYBN  RecName: Full=Stem 31 kDa glycoprotein; A...    197   1e-56    
ref|XP_010043643.1|  PREDICTED: acid phosphatase 1-like isoform X2      196   1e-56    
gb|KFK27743.1|  hypothetical protein AALP_AA8G423400                    196   2e-56    
gb|EPS70753.1|  hypothetical protein M569_04009                         194   2e-56    
ref|XP_004141031.1|  PREDICTED: acid phosphatase 1-like                 196   2e-56    
ref|XP_010043635.1|  PREDICTED: acid phosphatase 1-like isoform X1      196   2e-56    
gb|KCW88403.1|  hypothetical protein EUGRSUZ_A00791                     196   2e-56    
emb|CBI27978.3|  unnamed protein product                                193   2e-56    
ref|XP_004157899.1|  PREDICTED: acid phosphatase 1-like                 196   2e-56    
gb|EYU42050.1|  hypothetical protein MIMGU_mgv1a013101mg                194   3e-56    
ref|XP_009773908.1|  PREDICTED: acid phosphatase 1-like                 195   3e-56    
ref|XP_009415619.1|  PREDICTED: acid phosphatase 1-like                 195   3e-56    
ref|XP_003521996.1|  PREDICTED: acid phosphatase 1-like isoform X1      195   5e-56    
ref|XP_006341307.1|  PREDICTED: acid phosphatase 1-like                 194   6e-56    
ref|XP_006418175.1|  hypothetical protein EUTSA_v10008462mg             194   6e-56    
ref|XP_009133272.1|  PREDICTED: acid phosphatase 1                      194   8e-56    
ref|XP_011024457.1|  PREDICTED: acid phosphatase 1                      194   8e-56    
gb|KHN42129.1|  Acid phosphatase 1                                      194   8e-56    
ref|XP_010227605.1|  PREDICTED: acid phosphatase 1-like isoform X2      193   1e-55    
ref|XP_004161712.1|  PREDICTED: acid phosphatase 1-like                 198   1e-55    
gb|EMS46716.1|  Stem 28 kDa glycoprotein                                192   1e-55    
ref|NP_001054847.1|  Os05g0189900                                       193   2e-55    
ref|NP_001054846.1|  Os05g0189300                                       193   2e-55    
ref|XP_008459056.1|  PREDICTED: acid phosphatase 1-like                 192   2e-55    
emb|CDO99292.1|  unnamed protein product                                193   2e-55    
gb|AFK47047.1|  unknown                                                 193   2e-55    
ref|XP_006857494.1|  hypothetical protein AMTR_s00067p00205850          193   2e-55    
gb|EEE62601.1|  hypothetical protein OsJ_17404                          192   2e-55    
ref|XP_011095174.1|  PREDICTED: acid phosphatase 1                      192   2e-55    
ref|XP_004134400.1|  PREDICTED: acid phosphatase 1-like                 192   2e-55    
gb|KHG06095.1|  Acid phosphatase 1                                      192   3e-55    
ref|XP_010482978.1|  PREDICTED: acid phosphatase 1-like                 193   3e-55    
ref|XP_008438471.1|  PREDICTED: acid phosphatase 1-like                 192   3e-55    
emb|CDO99288.1|  unnamed protein product                                192   3e-55    
gb|AAS07027.1|  vegetative storage protein                              192   4e-55    
ref|XP_004141030.1|  PREDICTED: acid phosphatase 1-like                 192   4e-55    
ref|XP_007134577.1|  hypothetical protein PHAVU_010G058800g             192   5e-55    
gb|KHN24563.1|  Acid phosphatase 1                                      191   6e-55    
ref|XP_006842584.1|  hypothetical protein AMTR_s00077p00160000          191   6e-55    
ref|XP_010244565.1|  PREDICTED: acid phosphatase 1                      191   6e-55    
ref|XP_010043623.1|  PREDICTED: acid phosphatase 1-like isoform X2      192   6e-55    
ref|XP_009614482.1|  PREDICTED: acid phosphatase 1                      191   7e-55    
ref|XP_002301854.1|  hypothetical protein POPTR_0002s25950g             191   8e-55    
ref|XP_010043614.1|  PREDICTED: acid phosphatase 1-like isoform X1      192   1e-54    
ref|XP_003548333.1|  PREDICTED: acid phosphatase 1-like                 191   1e-54    
ref|XP_004959893.1|  PREDICTED: acid phosphatase 1-like                 191   2e-54    
gb|EAY96836.1|  hypothetical protein OsI_18758                          190   2e-54    
ref|NP_199215.1|  HAD superfamily, subfamily IIIB acid phosphatase      191   2e-54    
ref|XP_007226669.1|  hypothetical protein PRUPE_ppa021353mg             189   3e-54    
ref|XP_006354440.1|  PREDICTED: acid phosphatase 1-like                 190   3e-54    
gb|EYU30687.1|  hypothetical protein MIMGU_mgv1a011950mg                189   4e-54    
ref|XP_008796365.1|  PREDICTED: acid phosphatase 1                      189   5e-54    
ref|XP_004247765.1|  PREDICTED: acid phosphatase 1-like                 189   7e-54    
ref|XP_010468739.1|  PREDICTED: vegetative storage protein 1-like       192   7e-54    
ref|XP_009118876.1|  PREDICTED: acid phosphatase 1                      189   8e-54    
gb|AAM63804.1|  vegetative storage protein-like                         189   1e-53    
dbj|BAD53728.1|  putative Acid phosphatase precursor 1                  188   1e-53    
gb|EAZ01337.1|  hypothetical protein OsI_23372                          188   1e-53    
emb|CDY32525.1|  BnaA09g50710D                                          188   2e-53    
emb|CDY10082.1|  BnaC08g43690D                                          188   2e-53    
ref|XP_004984487.1|  PREDICTED: acid phosphatase 1-like isoform X1      187   2e-53    
ref|XP_004960897.1|  PREDICTED: stem 31 kDa glycoprotein-like iso...    189   2e-53    
ref|XP_006304095.1|  hypothetical protein CARUB_v10010000mg             188   2e-53    
ref|XP_003590156.1|  Stem 28 kDa glycoprotein                           187   3e-53    
ref|XP_011080101.1|  PREDICTED: acid phosphatase 1-like                 187   3e-53    
gb|KFK42749.1|  hypothetical protein AALP_AA1G034500                    187   3e-53    
ref|XP_010457427.1|  PREDICTED: acid phosphatase 1-like                 187   3e-53    
emb|CDY06827.1|  BnaC01g09260D                                          187   4e-53    
ref|XP_008224179.1|  PREDICTED: acid phosphatase 1-like                 187   4e-53    
ref|XP_010475042.1|  PREDICTED: acid phosphatase 1-like                 187   6e-53    
ref|XP_010098158.1|  Acid phosphatase 1                                 185   7e-53    
ref|NP_563698.1|  HAD superfamily, subfamily IIIB acid phosphatase      186   8e-53    
ref|XP_002967517.1|  hypothetical protein SELMODRAFT_144839             188   9e-53    
ref|XP_002960188.1|  hypothetical protein SELMODRAFT_139413             187   1e-52    
gb|AGV54508.1|  defense associated acid phosphatase                     186   1e-52    
gb|AAL17638.1|  putative defense associated acid phosphatase            185   2e-52    
emb|CAN82026.1|  hypothetical protein VITISV_000611                     184   2e-52    
ref|XP_009133169.1|  PREDICTED: acid phosphatase 1-like                 186   2e-52    
ref|XP_010542903.1|  PREDICTED: acid phosphatase 1-like                 185   3e-52    
gb|KDP26481.1|  hypothetical protein JCGZ_17639                         185   3e-52    
ref|NP_001242155.1|  uncharacterized protein LOC100802885 precursor     184   3e-52    
dbj|BAJ85799.1|  predicted protein                                      186   3e-52    
dbj|BAA19152.1|  pod storage protein                                    184   4e-52    
gb|KEH42677.1|  plant acid phosphatase                                  184   4e-52    
ref|XP_007135621.1|  hypothetical protein PHAVU_010G144300g             184   4e-52    
gb|AHA84282.1|  pod storage protein                                     184   5e-52    
ref|XP_003535883.1|  PREDICTED: acid phosphatase 1-like                 184   5e-52    
ref|XP_002892194.1|  acid phosphatase class B family protein            184   6e-52    
ref|XP_006443754.1|  hypothetical protein CICLE_v10021795mg             184   6e-52    
gb|KHN24673.1|  Acid phosphatase 1                                      184   6e-52    
emb|CDY36966.1|  BnaC09g17820D                                          184   6e-52    
emb|CAC84485.1|  putative acid phosphatase                              182   7e-52    
gb|ACU19317.1|  unknown                                                 183   7e-52    
ref|XP_006288447.1|  hypothetical protein CARUB_v10001708mg             184   9e-52    
emb|CDY15485.1|  BnaA08g27690D                                          184   9e-52    
ref|XP_009113955.1|  PREDICTED: acid phosphatase 1-like                 184   9e-52    
ref|XP_004510091.1|  PREDICTED: acid phosphatase 1-like isoform X1      184   9e-52    
gb|KFK31670.1|  hypothetical protein AALP_AA6G143700                    184   1e-51    
ref|XP_009111130.1|  PREDICTED: acid phosphatase 1-like                 184   1e-51    
ref|XP_003628249.1|  Acid phosphatase                                   183   1e-51    
gb|AFK46111.1|  unknown                                                 184   1e-51    
ref|XP_003626652.1|  Syringolide-induced protein B15-3-5                184   1e-51    
ref|XP_011018959.1|  PREDICTED: acid phosphatase 1-like isoform X1      182   2e-51    
ref|XP_009101743.1|  PREDICTED: acid phosphatase 1                      183   2e-51    
emb|CDX94751.1|  BnaC07g17600D                                          183   2e-51    
gb|KHN24883.1|  Acid phosphatase 1                                      182   2e-51    
ref|XP_010421320.1|  PREDICTED: vegetative storage protein 2-like       183   2e-51    
ref|XP_009123928.1|  PREDICTED: acid phosphatase 1-like                 183   2e-51    
ref|XP_002865388.1|  hypothetical protein ARALYDRAFT_917224             183   2e-51    
ref|XP_010936027.1|  PREDICTED: acid phosphatase 1 isoform X2           182   2e-51    
emb|CDY22316.1|  BnaA06g36380D                                          182   2e-51    
ref|XP_007050188.1|  HAD superfamily, subfamily IIIB acid phospha...    182   2e-51    
ref|XP_003555748.1|  PREDICTED: acid phosphatase 1-like                 182   3e-51    
ref|XP_003563756.1|  PREDICTED: acid phosphatase 1-like isoform X1      183   3e-51    
ref|XP_010493724.1|  PREDICTED: vegetative storage protein 2-like       182   3e-51    
ref|XP_010454803.1|  PREDICTED: vegetative storage protein 2            182   4e-51    
emb|CDX86654.1|  BnaC08g00490D                                          182   4e-51    
emb|CDO98048.1|  unnamed protein product                                179   5e-51    
ref|XP_010481786.1|  PREDICTED: acid phosphatase 1-like                 182   5e-51    
ref|XP_004497819.1|  PREDICTED: acid phosphatase 1-like                 181   5e-51    
ref|XP_010264908.1|  PREDICTED: acid phosphatase 1                      181   6e-51    
ref|XP_009357986.1|  PREDICTED: acid phosphatase 1-like                 182   8e-51    
gb|EPS59737.1|  hypothetical protein M569_15067                         181   8e-51    
ref|XP_002308264.1|  hypothetical protein POPTR_0006s11150g             179   8e-51    
ref|XP_011013440.1|  PREDICTED: acid phosphatase 1-like                 181   9e-51    
ref|XP_010494401.1|  PREDICTED: acid phosphatase 1-like                 181   1e-50    
gb|KHG02415.1|  Acid phosphatase 1                                      180   1e-50    
ref|XP_011041430.1|  PREDICTED: acid phosphatase 1-like                 180   1e-50    
ref|XP_002526558.1|  Acid phosphatase 1 precursor, putative             181   1e-50    
ref|XP_008235609.1|  PREDICTED: acid phosphatase 1-like isoform X2      180   1e-50    
ref|XP_010091790.1|  Acid phosphatase 1                                 180   1e-50    
gb|EMT20409.1|  Acid phosphatase 1                                      180   1e-50    
ref|XP_010441940.1|  PREDICTED: acid phosphatase 1-like                 181   2e-50    
dbj|BAJ94494.1|  predicted protein                                      179   3e-50    
ref|XP_003559787.1|  PREDICTED: acid phosphatase 1-like                 179   3e-50    
gb|KCW60246.1|  hypothetical protein EUGRSUZ_H02960                     179   4e-50    
ref|XP_001768840.1|  predicted protein                                  177   5e-50    
ref|XP_010936026.1|  PREDICTED: acid phosphatase 1 isoform X1           179   5e-50    
ref|NP_001042269.1|  Os01g0191200                                       180   5e-50    



>ref|XP_009776612.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=266

 Score =   408 bits (1048),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  157  IQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQ  336
            I QVVEIHRLRPQTGSAG+RVPQ+DCLSWRLAVETNN+++WKLVP  CENY+GHYMLG+Q
Sbjct  28   ISQVVEIHRLRPQTGSAGYRVPQLDCLSWRLAVETNNLQNWKLVPISCENYIGHYMLGKQ  87

Query  337  YREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTK  516
            YR DCE VA  AI+YA  + LSGDG D+WVFDIDETTLSN+PYYARSDVAFGA+P+N TK
Sbjct  88   YRHDCEAVANAAIEYAKSLKLSGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIPFNSTK  147

Query  517  FNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLI  696
            FNAWV+EGKAPAIP+ L +Y TVLSLGIKPVF+TGT+E+F++VRI NL++AGY NW KL+
Sbjct  148  FNAWVAEGKAPAIPSILGVYKTVLSLGIKPVFITGTRESFKQVRITNLKKAGYSNWAKLV  207

Query  697  LKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            LKG ND+G+AVE+KS KRTELV AGYRIVGN+GDQWSD+LG + G RTFKVPDPMYYI 
Sbjct  208  LKGDNDSGTAVEFKSSKRTELVKAGYRIVGNIGDQWSDILGDNVGSRTFKVPDPMYYIG  266



>ref|XP_009622654.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=267

 Score =   404 bits (1038),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 183/238 (77%), Positives = 214/238 (90%), Gaps = 0/238 (0%)
 Frame = +1

Query  157  IQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQ  336
            I QVVEIHRLRPQTGSAG+RVPQ+DCLSWRLAVETNN+++WKLVP+ CENY+GHY+LG+Q
Sbjct  29   ISQVVEIHRLRPQTGSAGYRVPQLDCLSWRLAVETNNLQNWKLVPSACENYIGHYILGKQ  88

Query  337  YREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTK  516
            YR DCE VA  AI+YA  + L GDG D+WVFDIDETTLSN+PYYARSDVAFGA+PYN+TK
Sbjct  89   YRHDCEAVANAAIEYAKSLKLGGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIPYNNTK  148

Query  517  FNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLI  696
            FNAWV+EGKAPAIP+ L +Y TVLSLGIKPVF+TGT+E+F++VRIANL++AGY NW KL 
Sbjct  149  FNAWVAEGKAPAIPSILGVYKTVLSLGIKPVFITGTRESFKQVRIANLKKAGYSNWAKLA  208

Query  697  LKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            LKG ND+ +AVE+KS KRTELV AGYRIVGN+GDQWSDL+G + G RTFKVPDPMYYI
Sbjct  209  LKGDNDSATAVEFKSSKRTELVKAGYRIVGNIGDQWSDLIGENVGSRTFKVPDPMYYI  266



>ref|XP_004241953.1| PREDICTED: acid phosphatase 1 [Solanum lycopersicum]
Length=278

 Score =   403 bits (1036),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 185/264 (70%), Positives = 224/264 (85%), Gaps = 0/264 (0%)
 Frame = +1

Query  79   MKKAIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVE  258
            M+    LLF  ++ A A+ +  +   I QVVEIHRLRPQTGSAG+ VPQ+DCLSWRLA+E
Sbjct  14   MRCFTLLLFFSSIVAVALASNVEEAVISQVVEIHRLRPQTGSAGYTVPQLDCLSWRLAIE  73

Query  259  TNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDID  438
            TNN+++W+ VP EC NY+GHYM+G+QYR DCEYVA++AI+YA  + LSGDG D+WVFDID
Sbjct  74   TNNLQNWRSVPKECTNYLGHYMMGKQYRHDCEYVAKQAIEYAKSLKLSGDGKDVWVFDID  133

Query  439  ETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLT  618
            ETTLSN PYYARSDVAFGA PYN TKF+AW++EGKAPAIP+ L++YNTVLSLGIKP+F+T
Sbjct  134  ETTLSNSPYYARSDVAFGAKPYNATKFDAWIAEGKAPAIPSILKVYNTVLSLGIKPIFIT  193

Query  619  GTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGD  798
            GTK+ F++VRI NL+EAGY NW  LILKG NDTGSAV++KS KRT LV AGYRI+GN+GD
Sbjct  194  GTKQNFKQVRIVNLKEAGYANWAALILKGANDTGSAVKFKSSKRTALVKAGYRIIGNIGD  253

Query  799  QWSDLLGPDAGDRTFKVPDPMYYI  870
            QWSDL+G + G RTFKVPDPMYYI
Sbjct  254  QWSDLIGENVGARTFKVPDPMYYI  277



>ref|XP_010322861.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=266

 Score =   401 bits (1031),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  157  IQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQ  336
            I QVVEIHRLRPQTGSAG+ VPQ+DCLSWRLAVETNN+++W+LVP ECENYVGHYMLG+Q
Sbjct  28   ISQVVEIHRLRPQTGSAGYTVPQLDCLSWRLAVETNNLQNWRLVPKECENYVGHYMLGKQ  87

Query  337  YREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTK  516
            YR DCEYVA++AI+YA  + L GDG D+WVFDIDETTLSN+PYYARSDVAFGA+ YN+TK
Sbjct  88   YRRDCEYVAKQAIEYAKALKLGGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIAYNNTK  147

Query  517  FNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLI  696
            FNAW++EGKAPAIP+ L +Y TVLSLGIKPVF+TGT+E F++VRI NL++ GY NW  LI
Sbjct  148  FNAWIAEGKAPAIPSILGVYKTVLSLGIKPVFITGTRENFKQVRIVNLKKVGYSNWAALI  207

Query  697  LKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            LKG ND+GSAV++KS KRTELV AGYRIVGN+GDQW+DL+G + G RTFKVPDPMYYI+
Sbjct  208  LKGENDSGSAVQFKSSKRTELVKAGYRIVGNIGDQWTDLIGENVGARTFKVPDPMYYIS  266



>ref|XP_006356134.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=264

 Score =   397 bits (1019),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 183/263 (70%), Positives = 219/263 (83%), Gaps = 0/263 (0%)
 Frame = +1

Query  85   KAIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETN  264
            +   +LF  +       A+     I QVVEIHRLRPQTGSAG+ VPQ+DCLSWRLAVETN
Sbjct  2    RCFTILFFFSAIVVVALASNVEEVISQVVEIHRLRPQTGSAGYTVPQLDCLSWRLAVETN  61

Query  265  NIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDET  444
            N+++WKLVP EC NYVGHYMLG+QYR DCEYVA++AI+YA  + L GDG D+WVFDIDET
Sbjct  62   NLQNWKLVPKECTNYVGHYMLGKQYRRDCEYVAKQAIEYAKTLKLGGDGKDVWVFDIDET  121

Query  445  TLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGT  624
            TLSN PYYARSDVAFGA+ YN+TKF+AW++EGKAPAIP+ L +Y TVLSLGIKPVF+TGT
Sbjct  122  TLSNSPYYARSDVAFGAIAYNNTKFSAWLAEGKAPAIPSILGVYKTVLSLGIKPVFITGT  181

Query  625  KEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQW  804
            +E F++VRI NL++ GY NW  LILKG ND+GSAV++KS KRTELV AGYRIVGN+GDQW
Sbjct  182  RENFKQVRIVNLKKVGYSNWAALILKGENDSGSAVQFKSSKRTELVKAGYRIVGNIGDQW  241

Query  805  SDLLGPDAGDRTFKVPDPMYYIA  873
            +DL+G + G RTFKVPDPMYYI+
Sbjct  242  TDLIGENVGARTFKVPDPMYYIS  264



>ref|XP_009787591.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=268

 Score =   393 bits (1010),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/240 (75%), Positives = 210/240 (88%), Gaps = 0/240 (0%)
 Frame = +1

Query  154  YIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQ  333
            +  QVVEIH LR QTG+AG+RVPQ+DCLSWRLAVETNN+++WKLVP+ CENY+GHY+LG+
Sbjct  29   FTSQVVEIHCLRLQTGAAGYRVPQLDCLSWRLAVETNNLQNWKLVPSACENYIGHYILGK  88

Query  334  QYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDT  513
            QYR DCE VA  AI+YA  V L GDG D+WVFDIDETTLSN+PYYARSDVAFGA+PYN+T
Sbjct  89   QYRHDCEAVANAAIEYAKSVKLGGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIPYNNT  148

Query  514  KFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKL  693
            KFNAWV+EGKAPAIP+ L +Y TVLSLGIK VF+TGT+E+FR+VRI NL++AGY NW KL
Sbjct  149  KFNAWVAEGKAPAIPSILGVYKTVLSLGIKTVFITGTRESFRKVRITNLKKAGYTNWAKL  208

Query  694  ILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            ILKG NDT SAVEYKS KR ELV AGYRI+GN+GDQWSDL+G + G RTFKVPDP+YYI 
Sbjct  209  ILKGENDTRSAVEYKSSKRRELVKAGYRIIGNIGDQWSDLIGDNLGARTFKVPDPLYYIG  268



>emb|CDO97963.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   390 bits (1002),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 204/233 (88%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP++G+AGH VPQI+CLSWRLAVET N+R+WKLVP  CENYVGHYMLG+QYREDC+
Sbjct  46   IHLLRPKSGAAGHNVPQINCLSWRLAVETYNLRNWKLVPESCENYVGHYMLGKQYREDCD  105

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             VA+ AI YA  + L+GDG +IWVFDIDET+LSN PYYARSDV FGA+PYNDTKFNAWV+
Sbjct  106  AVADIAIAYAKNLTLAGDGKEIWVFDIDETSLSNAPYYARSDVQFGAIPYNDTKFNAWVA  165

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG APA+P  LRLY T+LSLGIKPVF++GTKE +REVRI+NL+  GY NWEKLILKG ND
Sbjct  166  EGAAPAVPGVLRLYKTLLSLGIKPVFISGTKEVYREVRISNLKNVGYRNWEKLILKGEND  225

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            TGSAV YKS KRTELV AGYRIVGN+GDQWSDLLG + GDRTFKVPDPMY+I 
Sbjct  226  TGSAVVYKSNKRTELVEAGYRIVGNIGDQWSDLLGTNVGDRTFKVPDPMYFIG  278



>ref|XP_004241952.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=266

 Score =   388 bits (997),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 205/239 (86%), Gaps = 0/239 (0%)
 Frame = +1

Query  157  IQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQ  336
            I QVVEIHRLRP+TGSAG+ VPQ+DCLSWRLAVETNN+RDWKLVP EC NYVGHYMLG+Q
Sbjct  28   ISQVVEIHRLRPRTGSAGYAVPQLDCLSWRLAVETNNVRDWKLVPNECSNYVGHYMLGKQ  87

Query  337  YREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTK  516
            YR DCE VA+ AI+YA G+ LSGDG D+WVFD+DETTLSN+PYYARSDVAFGA  +N T+
Sbjct  88   YRRDCEAVADAAIEYAKGLKLSGDGKDVWVFDVDETTLSNLPYYARSDVAFGAKAFNSTR  147

Query  517  FNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLI  696
            FNAWV EG APAIPA+LRLY TVLSLGIKPV LTGT E  RE R+ NL++AGY +W KLI
Sbjct  148  FNAWVMEGTAPAIPATLRLYKTVLSLGIKPVILTGTPEFTREGRVTNLKKAGYTSWLKLI  207

Query  697  LKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            LKG ND+  +V YKS KRTELV AGYRIVGN GDQWSDL+G +AG RTFKVPDPMYYI 
Sbjct  208  LKGENDSPKSVVYKSNKRTELVIAGYRIVGNTGDQWSDLIGKNAGARTFKVPDPMYYIG  266



>gb|AFX66999.1| putative acid phosphatase [Solanum tuberosum]
Length=284

 Score =   388 bits (997),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 218/274 (80%), Gaps = 0/274 (0%)
 Frame = +1

Query  79   MKKAIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVE  258
            M+    +L L +       A+     I QVVEIHRLRPQTGSAG+ VP +DCLSWRLAVE
Sbjct  1    MRSCFTILLLFSAIVAVALASNVEEVISQVVEIHRLRPQTGSAGYTVPHLDCLSWRLAVE  60

Query  259  TNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDID  438
            TNN++ WKLVP EC NYVGHYMLG+QYR DCEYVA++AI+YA  + L GDG D+WVFDID
Sbjct  61   TNNLQYWKLVPKECTNYVGHYMLGKQYRHDCEYVAKQAIEYAKSLKLGGDGMDVWVFDID  120

Query  439  ETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLT  618
            ETTLSN+PYYARSDVAFGA+ YN TKF+ W++EGKAPAIP+ L LY  VLSLGIKPVF+T
Sbjct  121  ETTLSNLPYYARSDVAFGAIAYNSTKFHEWIAEGKAPAIPSVLGLYKIVLSLGIKPVFIT  180

Query  619  GTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGD  798
            GT+E F +VRIANL++ GY NW  LILKG N +GSAV++KS KRT LV AGYRIVGN+GD
Sbjct  181  GTRENFEQVRIANLKKVGYTNWAALILKGENYSGSAVKFKSSKRTALVKAGYRIVGNIGD  240

Query  799  QWSDLLGPDAGDRTFKVPDPMYYIA*MEE*ILDK  900
            QW+DL+G + G RTFK+PDPMYY+    + +++K
Sbjct  241  QWTDLIGENVGARTFKLPDPMYYVVDSNQILINK  274



>ref|XP_009795136.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=261

 Score =   370 bits (950),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 199/234 (85%), Gaps = 0/234 (0%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRP  GSAG  VPQI+CLSWRLAVETNNI++WKLVP +CE+YVGHYMLG+QYR+DC
Sbjct  28   QIHPLRPTAGSAGRHVPQINCLSWRLAVETNNIQNWKLVPLQCESYVGHYMLGKQYRDDC  87

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              V   AI+YA  + ++ DG D+WVFDIDETTLSN+PYYARSDVAFGA  +N TKF+ W 
Sbjct  88   NAVVVAAIQYAKTLKIAKDGKDVWVFDIDETTLSNLPYYARSDVAFGATKFNGTKFDGWT  147

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+P +L LY T+L++GIKPVF+TGTKE FR+VRIANL++ GY++W KLILKGVN
Sbjct  148  REGKAPAVPGALFLYRTLLAMGIKPVFITGTKEEFRQVRIANLKKVGYHSWVKLILKGVN  207

Query  712  DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            DTGS+V YKSGKR ELV AGYRIVGN+GDQWSDLLG   GDRTFK+PDPMYYI 
Sbjct  208  DTGSSVMYKSGKRAELVKAGYRIVGNIGDQWSDLLGDFVGDRTFKLPDPMYYIG  261



>ref|XP_009625321.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=257

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 199/234 (85%), Gaps = 0/234 (0%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRP  GSAG  VPQI+CLSWRLAVETNNI++WKLVP +CE+YVGHYMLG+QYR+DC
Sbjct  24   QIHPLRPTAGSAGRHVPQINCLSWRLAVETNNIQNWKLVPLQCESYVGHYMLGKQYRDDC  83

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              V   AI+YA  + ++ DG D+WVFDIDETTLSN+PYYARSDVAFGA  +N TKF+ W 
Sbjct  84   NAVIVAAIQYAKTLKIAKDGKDVWVFDIDETTLSNLPYYARSDVAFGATKFNGTKFDEWT  143

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+P +L LY T+L++GIKPVF+TGTKE FR+VRIANL++ GY++W KLILKGVN
Sbjct  144  REGKAPAVPGALFLYRTLLAMGIKPVFITGTKEEFRQVRIANLKKVGYHSWVKLILKGVN  203

Query  712  DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            DTGS+V YKSGKR ELV AGYRIVGN+GDQWSDLLG   GDRTFK+PDPMYYI 
Sbjct  204  DTGSSVMYKSGKRAELVKAGYRIVGNIGDQWSDLLGDFVGDRTFKLPDPMYYIG  257



>ref|XP_004235637.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=255

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 198/234 (85%), Gaps = 0/234 (0%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH L P+TGS+G +VPQI+CLSWRLAVETNNI+DW  VP +CE+YVGHYMLG+QYR+DC
Sbjct  22   QIHPLHPKTGSSGSQVPQINCLSWRLAVETNNIQDWTSVPLQCEDYVGHYMLGKQYRDDC  81

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              V   AI+YA  + +  +G DIWVFDIDETTLSN+PYYARSDVAFG++ YN TKF+ W 
Sbjct  82   YNVVAAAIQYAKTIKIGKNGKDIWVFDIDETTLSNLPYYARSDVAFGSIKYNGTKFDEWT  141

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAP +PA+L LYNT+LS+GIKPVF++GTKE FR++RI NL + GY++W +LILKGVN
Sbjct  142  REGKAPPVPAALFLYNTLLSMGIKPVFISGTKEEFRQIRITNLNKVGYHSWIRLILKGVN  201

Query  712  DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            DTGS+V+YKSGKR ELV  GYRIVGN+GDQWSDLLG   G RTFK+PDPMYYIA
Sbjct  202  DTGSSVKYKSGKRGELVKDGYRIVGNIGDQWSDLLGDYVGQRTFKLPDPMYYIA  255



>ref|XP_010654601.1| PREDICTED: acid phosphatase 1 [Vitis vinifera]
Length=255

 Score =   320 bits (821),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 192/265 (72%), Gaps = 10/265 (4%)
 Frame = +1

Query  79   MKKAIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVE  258
            M   +QLLFL+  T          P I   +EIH LRPQ GS+GH VP + CLSWRL VE
Sbjct  1    MGVLVQLLFLLASTVELS------PGIS--LEIHLLRPQLGSSGHHVPGLSCLSWRLGVE  52

Query  259  TNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDID  438
            T+NI +W  VP  CE+YVGHYMLG QYR+D   V  EAI +A  + L+GDG DIWVFDID
Sbjct  53   THNIIEWSTVPQACESYVGHYMLGDQYRKDSGVVVYEAITHAQSLKLAGDGKDIWVFDID  112

Query  439  ETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLT  618
            ET+LSN+PY+A+    FG   YN T+FN W+ EGKAP +P SL+LY  + SLGIKPVF+T
Sbjct  113  ETSLSNLPYFAKH--GFGVEAYNSTQFNNWIYEGKAPPLPESLKLYKKLQSLGIKPVFIT  170

Query  619  GTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGD  798
            G  EA R V  ANLQ AGY+ WEKLILKG + TG+AV YKS +R +L  +GYRIVGN+GD
Sbjct  171  GRPEAQRNVTAANLQNAGYHTWEKLILKGSSVTGTAVAYKSNERKKLEQSGYRIVGNIGD  230

Query  799  QWSDLLGPDAGDRTFKVPDPMYYIA  873
            QWSD+LG + G+RTFK+PDPMYYI+
Sbjct  231  QWSDILGTNVGNRTFKLPDPMYYIS  255



>emb|CAN82027.1| hypothetical protein VITISV_000612 [Vitis vinifera]
Length=255

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 192/265 (72%), Gaps = 10/265 (4%)
 Frame = +1

Query  79   MKKAIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVE  258
            M   +QLLFL+  T          P I   +EIH LRPQ GS+GH VP + CLSWRL VE
Sbjct  1    MGVLVQLLFLLASTVELS------PGIS--LEIHLLRPQLGSSGHHVPGLSCLSWRLGVE  52

Query  259  TNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDID  438
            T+NI +W  VP  CE+YVGHYMLG QYR+D   V  EAI +A  + L+GDG DIWVFDID
Sbjct  53   THNIIEWSTVPQVCESYVGHYMLGDQYRKDSGAVVYEAISHAQSLKLAGDGKDIWVFDID  112

Query  439  ETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLT  618
            ET+LSN+PY+A+    FG   YN T+FN W+ EGKAP +P SL+LY  + SLGIKPVF+T
Sbjct  113  ETSLSNLPYFAKH--GFGVEAYNSTQFNNWIYEGKAPPLPESLKLYKKLQSLGIKPVFIT  170

Query  619  GTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGD  798
            G  EA R V  ANLQ AGY+ WEKLILKG + TG+AV YKS +R +L  +GYRIVGN+GD
Sbjct  171  GRPEAQRNVTAANLQNAGYHTWEKLILKGSSVTGTAVAYKSNERKKLEQSGYRIVGNIGD  230

Query  799  QWSDLLGPDAGDRTFKVPDPMYYIA  873
            QWSD+LG + G+RTFK+PDPMYYI+
Sbjct  231  QWSDILGTNVGNRTFKLPDPMYYIS  255



>ref|XP_002515949.1| Stem 28 kDa glycoprotein precursor, putative [Ricinus communis]
 gb|EEF46369.1| Stem 28 kDa glycoprotein precursor, putative [Ricinus communis]
Length=258

 Score =   314 bits (804),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 188/262 (72%), Gaps = 8/262 (3%)
 Frame = +1

Query  91   IQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNI  270
             QLLFL  + A +  +    P+     +IH LRPQ+G+AGH VP + CLSWRL VETNNI
Sbjct  4    FQLLFLAIILATSHGSEMGVPH-----QIHLLRPQSGTAGHHVPGVSCLSWRLGVETNNI  58

Query  271  RDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTL  450
              W  VPAECE YVGHYMLG QYR+D + +A+EA  YA  + LSGDG DIWVFDIDETTL
Sbjct  59   IGWTTVPAECEGYVGHYMLGHQYRKDSKIIADEAFLYAKSLELSGDGKDIWVFDIDETTL  118

Query  451  SNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKE  630
            SN+PYYA     FGA PYN T FN WV   KAPA+P SL LY  +LSLGIK VF+TG  E
Sbjct  119  SNLPYYAEH--GFGAEPYNSTLFNKWVVTSKAPALPESLSLYKRLLSLGIKIVFITGRTE  176

Query  631  AFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWS  807
              R V   NL++AGY+ W KL+LK  + +G +AV YKS +R +LV +GYRI GN+GDQWS
Sbjct  177  DQRTVTTNNLKKAGYHTWMKLVLKTSSYSGKTAVFYKSSERGKLVKSGYRITGNIGDQWS  236

Query  808  DLLGPDAGDRTFKVPDPMYYIA  873
            DLLG   G+RTFK+PDPMYYI+
Sbjct  237  DLLGTYTGNRTFKLPDPMYYIS  258



>ref|XP_010033712.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53448.1| hypothetical protein EUGRSUZ_J02694 [Eucalyptus grandis]
Length=258

 Score =   313 bits (802),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 180/235 (77%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            EIH LRP++GSAG RV  + CLSWRL VETNNI++W  VP ECE YVGHYMLG QYRED 
Sbjct  26   EIHLLRPRSGSAGERVHGLSCLSWRLGVETNNIKNWTTVPLECEGYVGHYMLGHQYREDS  85

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + VA EA+ YA  + L+GDG D+WVFD+DET LSN+PYYA+    FGA PYN T FN WV
Sbjct  86   KVVAREAVLYAKSLKLAGDGKDVWVFDVDETLLSNLPYYAKH--GFGAEPYNSTLFNQWV  143

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
              GKAPA+P +L LY  +L LGIKP+FLTG  E  R++  +NL+ AG+ NWE LILKG  
Sbjct  144  LTGKAPALPETLELYRELLKLGIKPIFLTGRTEDQRKITSSNLRNAGFSNWEMLILKGST  203

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G +AV YKS +R ++  +GYRIVGN+GDQWSDLLG  AG+RTFK+PDPMYYI+
Sbjct  204  YSGTTAVVYKSSERRKVEESGYRIVGNIGDQWSDLLGIHAGNRTFKLPDPMYYIS  258



>ref|XP_010033826.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53661.1| hypothetical protein EUGRSUZ_J02928 [Eucalyptus grandis]
Length=258

 Score =   312 bits (800),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 180/235 (77%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            EIH LRP++GSAG RV  + CLSWRL VETNNI++W  VP ECE YVGHYMLG QYRED 
Sbjct  26   EIHLLRPRSGSAGERVHGLSCLSWRLGVETNNIKNWTTVPLECEGYVGHYMLGHQYREDS  85

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + VA EA+ YA  + L+GDG D+WVFD+DET LSN+PYYA+    FGA PYN T FN WV
Sbjct  86   KVVAREAVLYAKSLKLAGDGKDVWVFDVDETLLSNLPYYAKH--GFGAEPYNSTLFNQWV  143

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
              GKAPA+P +L LY  +L LGIKP+FLTG  E  R++  +NL+ AG+ NWE LILKG  
Sbjct  144  LTGKAPALPETLELYRELLKLGIKPIFLTGRTEDQRKITSSNLRNAGFRNWEMLILKGSA  203

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G +AV YKS +R ++  +GYRIVGN+GDQWSDLLG  AG+RTFK+PDPMYYI+
Sbjct  204  YSGTTAVVYKSSERRKVEESGYRIVGNIGDQWSDLLGIHAGNRTFKLPDPMYYIS  258



>dbj|BAJ34931.1| hypothetical protein [Vitis hybrid cultivar]
Length=237

 Score =   306 bits (785),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 178/234 (76%), Gaps = 2/234 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            EIH LRP+ GS GH    + C SWRLAVETNNI +W+ VP  CE+YVGHYMLG QYR+D 
Sbjct  6    EIHLLRPRLGSGGHPASNLSCPSWRLAVETNNIINWETVPQACESYVGHYMLGHQYRQDS  65

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              V  EAI YA  + L GDG D+WVFDIDETTLSN+PYYA +   FGA  +N+T FN WV
Sbjct  66   RVVVYEAIAYAESLKLGGDGKDVWVFDIDETTLSNLPYYAEN--GFGAEVFNETSFNEWV  123

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             +G+APA+P SL+LYN ++SLGIK VFLTG  E  R V +ANL++ GY+ WEKLIL+  +
Sbjct  124  MKGEAPALPESLKLYNKLVSLGIKVVFLTGKGEDERNVTVANLKKVGYHTWEKLILRKSS  183

Query  712  DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            D  +A+ YKS +R ++  +GY+IVGNMGDQWSD+LG + G+RTFK+PDPMYYIA
Sbjct  184  DGSTALVYKSNQRKKVEESGYKIVGNMGDQWSDILGTNTGNRTFKLPDPMYYIA  237



>ref|XP_010915365.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=262

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 174/242 (72%), Gaps = 5/242 (2%)
 Frame = +1

Query  148  PPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYML  327
            PP+    + IH LRP +GS GH +  + C+SWR+ VE NN+RDWK +P+ CE YVGHYML
Sbjct  26   PPF---PLPIHFLRPLSGSGGHPLIGVSCVSWRVGVEANNVRDWKTIPSTCEGYVGHYML  82

Query  328  GQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYN  507
            G  YR+D   V  EA  YA G+ L GDG D+WVFDIDETTLSN+PYYA     FG   YN
Sbjct  83   GDLYRQDSALVTAEAANYAEGLNLQGDGKDVWVFDIDETTLSNLPYYAHH--GFGVELYN  140

Query  508  DTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWE  687
             T FNAWV +G+APA+P SL LY  +LSLGIK VFLTG  E  R +   NL+  GY+ WE
Sbjct  141  ATSFNAWVMKGEAPALPESLGLYKKLLSLGIKIVFLTGRTEDQRNITAHNLRMVGYHTWE  200

Query  688  KLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYY  867
            KL+LK +N  GS+V YKSG R +L++ GYRIVGNMGDQWSD+LG   GDRTFK PDPMYY
Sbjct  201  KLLLKALNVRGSSVAYKSGMRQKLIDEGYRIVGNMGDQWSDILGQPKGDRTFKFPDPMYY  260

Query  868  IA  873
            I+
Sbjct  261  IS  262



>ref|XP_006465744.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
Length=264

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 189/259 (73%), Gaps = 3/259 (1%)
 Frame = +1

Query  100  LFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDW  279
             FL   T   V AT +  Y++   +IH LRP++G+  + VP + CLSWRLAVETNNI  W
Sbjct  8    FFLFLATQALVAATSRGTYLEIPHQIHLLRPKSGARTNDVPDLSCLSWRLAVETNNIIGW  67

Query  280  KLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNI  459
            K +P +CE Y+GHYMLGQQYRED E VA EAI YA  + L+GDG +IW+FDIDET+LSN+
Sbjct  68   KTIPEKCEGYLGHYMLGQQYREDSEAVAYEAIVYAQSLELAGDGREIWIFDIDETSLSNL  127

Query  460  PYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFR  639
            PYYA+    FG  P+N T FN WV++G+AP++P SL LY  +LSLGIK VFLTG  E  R
Sbjct  128  PYYAKH--GFGVEPFNSTLFNEWVNKGEAPSLPESLNLYKKLLSLGIKIVFLTGRPEDQR  185

Query  640  EVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLL  816
             V   NL+  G+Y WE LILKG + +G +AV YKS +R  L   GYRI+GN+GDQWSDLL
Sbjct  186  SVTENNLKNVGFYTWENLILKGSSYSGETAVAYKSNERKRLEKKGYRIIGNIGDQWSDLL  245

Query  817  GPDAGDRTFKVPDPMYYIA  873
            G +AG+RTFK+PDPMYYI+
Sbjct  246  GTNAGNRTFKLPDPMYYIS  264



>ref|XP_010258709.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=260

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 178/234 (76%), Gaps = 3/234 (1%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP+ G+ GH +  + CLSWR  VETNNIR WK +P++CE+YVGHYMLG  YR+DC+
Sbjct  29   IHLLRPKHGAGGHALKGVSCLSWRFGVETNNIRGWKTIPSKCEDYVGHYMLGSLYRKDCK  88

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V +EAI YA  + L+GDG D+W+FDIDET LSN+PYYAR    FG  P+N T FN WV+
Sbjct  89   VVVDEAILYAENLKLTGDGKDVWIFDIDETILSNLPYYARH--GFGVEPFNSTLFNEWVN  146

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
             G+AP +P SLRLY  +LSLG+K VFLTG  E  R+    NL++AG++ WEKLILK  ++
Sbjct  147  TGEAPPLPESLRLYRKLLSLGLKIVFLTGRSEDQRKATSTNLKKAGFHTWEKLILKKSSN  206

Query  715  TG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             G +AV YKSG+R  L  +GYRIVGN+GDQWSD+LG + G+RTFK+PDPMYY++
Sbjct  207  QGTTAVVYKSGERKTLEESGYRIVGNIGDQWSDILGNNTGNRTFKLPDPMYYLS  260



>ref|XP_011000941.1| PREDICTED: acid phosphatase 1-like [Populus euphratica]
Length=271

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 175/242 (72%), Gaps = 3/242 (1%)
 Frame = +1

Query  151  PYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLG  330
            P   + ++IH LR + GS GH +P + CLSWRLAVETNN+  W  VP +CE+YVGHYMLG
Sbjct  32   PLSYEPLQIHLLRSKWGSGGHHIPGMSCLSWRLAVETNNVIGWSTVPEDCEDYVGHYMLG  91

Query  331  QQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYND  510
             QYRED   + +EA  +A    L GDG DIWVFD+DETTLSN+PYYA+    FGA PYN 
Sbjct  92   SQYREDSALITDEAFAHAKTFKLDGDGKDIWVFDVDETTLSNLPYYAKH--GFGAEPYNS  149

Query  511  TKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEK  690
            T FN WV  GKA A+P SL+LY  +LS+GIK VFLTG  E  R V   NL+ AGY+ WEK
Sbjct  150  TAFNQWVFTGKALALPESLKLYRRLLSIGIKVVFLTGRSEDQRAVTSTNLKNAGYHIWEK  209

Query  691  LILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYY  867
            LILK  + +G +AV YKS +R +L   GYRI+GN+GDQWSDLLG   G+RTFK+PDPMYY
Sbjct  210  LILKSSSYSGKTAVFYKSSERAKLEKKGYRIIGNIGDQWSDLLGTSVGNRTFKLPDPMYY  269

Query  868  IA  873
            I+
Sbjct  270  IS  271



>ref|XP_003632911.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=255

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 176/234 (75%), Gaps = 2/234 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            EIH LRP+  S  H    + C SWRLAVETNNI +W+ VP  CE+YVGHYMLG QYR+D 
Sbjct  24   EIHLLRPRLASGVHPASGLSCPSWRLAVETNNIINWETVPQACESYVGHYMLGHQYRQDS  83

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              V  EAI YA  + L GDG D+WVFDIDETTLSN+PYYA +   FGA  +N+T FN WV
Sbjct  84   RVVVYEAIAYAESLKLGGDGKDVWVFDIDETTLSNLPYYAEN--GFGAEVFNETSFNEWV  141

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             +G+APA+P SL+LYN ++SLGIK VFLTG  E  R V +ANL++ GY+ WEKLIL+  +
Sbjct  142  MKGEAPALPESLKLYNKLVSLGIKVVFLTGKGEDERNVTVANLKKVGYHTWEKLILRKSS  201

Query  712  DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            D  +A+ YKS +R ++  +GY+IVGNMGDQWSD+LG + G+RTFK+PDPMYYIA
Sbjct  202  DGSTALVYKSNQRKKVEESGYKIVGNMGDQWSDILGTNTGNRTFKLPDPMYYIA  255



>ref|XP_007024338.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
 gb|EOY26960.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
Length=259

 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 174/235 (74%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRPQ+G+AG+ VP + CLSWRL VETNN+  W  VP ECE YVGHYMLG QYR+D 
Sbjct  27   KIHLLRPQSGAAGNHVPGLSCLSWRLGVETNNVVGWITVPEECEEYVGHYMLGHQYRKDS  86

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              VA +A+ YA  + L+ D  D+WVFDIDET LSN+PYYA+    FG   YN T FN WV
Sbjct  87   RVVANQALLYAQSLSLARDCKDVWVFDIDETALSNLPYYAQH--GFGVEQYNPTLFNKWV  144

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+P +L LY  +LSLG K VFLTG  E  R V   NL++AGY  WEKLILKG +
Sbjct  145  MEGKAPALPETLNLYKKLLSLGTKVVFLTGRPEYQRSVTANNLRKAGYQTWEKLILKGSS  204

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G SAV YKS +R +L  +GY+I+GNMGDQWSDLLG D G+RTFK+PDPMYYI+
Sbjct  205  YSGKSAVVYKSSERKKLAMSGYKIIGNMGDQWSDLLGTDVGNRTFKMPDPMYYIS  259



>ref|XP_008798588.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=262

 Score =   300 bits (768),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 181/262 (69%), Gaps = 5/262 (2%)
 Frame = +1

Query  88   AIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNN  267
            AI LL  +  ++ A +    PP+    + IH LRP +GS  HR+  + C SWR+AVE NN
Sbjct  6    AIVLLAALVTSSHASSRVEDPPF---PLPIHLLRPLSGSGAHRLSGVTCESWRVAVEANN  62

Query  268  IRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETT  447
            +R WK +P  CE YVGHYMLG  YR D   VA EA KYA  + L  DG D+WVFD+DETT
Sbjct  63   MRGWKTIPRTCEGYVGHYMLGGLYRRDSAVVAGEAAKYAESLDLRADGKDVWVFDVDETT  122

Query  448  LSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTK  627
            LSN+PYYAR    FG   YN T FNAWV +GKAPA+P SL LY  +LSLGIK VFLTG  
Sbjct  123  LSNLPYYARH--GFGVELYNATSFNAWVMKGKAPALPESLELYKKLLSLGIKIVFLTGRT  180

Query  628  EAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWS  807
            E  R++   NL+  GY+ WEKL+LKG+N +GS+V YKSG R +L   GY +VGN+GDQWS
Sbjct  181  EDQRDITAHNLKMVGYHTWEKLLLKGLNVSGSSVAYKSGMRQKLEEEGYSVVGNIGDQWS  240

Query  808  DLLGPDAGDRTFKVPDPMYYIA  873
            D+LG   G RTFKVPDPMYYI+
Sbjct  241  DILGQPEGGRTFKVPDPMYYIS  262



>ref|XP_002299744.2| hypothetical protein POPTR_0001s19180g [Populus trichocarpa]
 gb|EEE84549.2| hypothetical protein POPTR_0001s19180g [Populus trichocarpa]
Length=261

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 172/236 (73%), Gaps = 3/236 (1%)
 Frame = +1

Query  169  VEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            + IH LR + GS  H +P + CLSWRLAVETNN+  W  VP ECE+YVGHYMLG QYRED
Sbjct  28   LRIHLLRSKWGSGDHHIPGMSCLSWRLAVETNNVIGWSTVPEECEDYVGHYMLGSQYRED  87

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               + +EA  +A    L+GDG DIWVFD+DETTLSN+PYYA+    FGA PYN T FN W
Sbjct  88   SAVITDEAFAHAKTFKLAGDGKDIWVFDVDETTLSNLPYYAKH--GFGAEPYNSTAFNQW  145

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V  GKA A+P SL+LY  +LS+GIK VFLTG  E  R V   NL+ AGY+ WEKLILK  
Sbjct  146  VFTGKALALPESLKLYRNLLSIGIKVVFLTGRTEDQRAVTSNNLKNAGYHIWEKLILKSS  205

Query  709  NDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            + +G +AV YKS +R +L   GYRI+GN+GDQWSDLLG   G+RTFK+PDPMYYI+
Sbjct  206  SYSGKTAVFYKSSERAKLEKKGYRIIGNIGDQWSDLLGTSVGNRTFKLPDPMYYIS  261



>ref|XP_010033711.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53446.1| hypothetical protein EUGRSUZ_J02693 [Eucalyptus grandis]
Length=262

 Score =   297 bits (760),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 175/235 (74%), Gaps = 1/235 (0%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRPQ GS GH +P + C SWRLAVET+NI+DW +VP  CENYVG+YMLG QYR+DC
Sbjct  28   KIHPLRPQVGSGGHHIPGVSCQSWRLAVETDNIKDWDVVPMVCENYVGNYMLGHQYRKDC  87

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
                  A  YA G+ L  DG D+W+FDIDET LSN+PYYAR D AFGA  YN+T F  W 
Sbjct  88   NAAGWAAYDYAKGLTLKKDGKDVWIFDIDETALSNLPYYARPDNAFGAKEYNETTFKEWE  147

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+PA L LY  +L LG K VF++G  E+ R + + N+++ GY+ WEKLILK  +
Sbjct  148  LEGKAPAVPAILYLYKRLLKLGFKIVFISGKSESLRSITVYNMKKVGYHTWEKLILKQTS  207

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            ++G +A+ YKS KR EL  AGYRI+GNMGDQWSDL+G   G+RTFKVP+PM+YIA
Sbjct  208  ESGTTAMVYKSKKRKELEEAGYRILGNMGDQWSDLMGSHVGNRTFKVPNPMFYIA  262



>ref|XP_010033825.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53660.1| hypothetical protein EUGRSUZ_J02927 [Eucalyptus grandis]
Length=262

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 175/235 (74%), Gaps = 1/235 (0%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRPQ GS GH +P + C SWRLAVET+NI+DW +VP  CENYVG+YMLG QYR+DC
Sbjct  28   KIHPLRPQVGSGGHHIPGVSCQSWRLAVETDNIKDWDVVPMVCENYVGNYMLGHQYRKDC  87

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
                  A  YA G+ L  DG D+W+FDIDET LSN+PYYAR D AFGA  YN+T F  W 
Sbjct  88   NAAGWAAYDYAKGLTLKKDGKDVWIFDIDETALSNLPYYARPDNAFGAKEYNETTFKEWE  147

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+PA L LY  +L LG K VF++G  E+ R + + N+++ GY+ WEKLILK  +
Sbjct  148  LEGKAPAVPAILYLYKRLLKLGFKIVFISGKSESLRSITVYNMKKVGYHTWEKLILKQTS  207

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            ++G +A+ YKS KR EL  AGYRI+GNMGDQWSDL+G   G+RTFKVP+PM+YIA
Sbjct  208  ESGTTAMVYKSKKRKELEEAGYRILGNMGDQWSDLMGSHVGNRTFKVPNPMFYIA  262



>ref|XP_004302847.1| PREDICTED: stem 28 kDa glycoprotein-like [Fragaria vesca subsp. 
vesca]
Length=262

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 173/235 (74%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRPQTGS G  VP I C+SWRL VET+NI  W  +PA CE YVG+YMLG QYR+D 
Sbjct  30   QIHLLRPQTGSQGRHVPGISCMSWRLGVETHNIVGWTTIPAACERYVGNYMLGHQYRQDS  89

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              V  EA+ YA  + L+ DG ++WVFDIDET+LSN+PYYA     FG   YN T FNAWV
Sbjct  90   RAVTNEALLYAKSLNLTKDGKNLWVFDIDETSLSNLPYYAHH--GFGVELYNSTAFNAWV  147

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+P SL+LYN +L+LGIK  F+TG  E+ R V   NL+  GY  WEKLILK  +
Sbjct  148  LEGKAPALPESLKLYNKLLALGIKVAFITGRGESQRSVTEINLRYVGYLTWEKLILKNSS  207

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             TG ++V YKS ++ +L  +GYRI+GN+GDQWSDLLG + GDRTFK+PDPMYYI+
Sbjct  208  YTGNTSVVYKSSEKKKLEESGYRIIGNIGDQWSDLLGTNVGDRTFKLPDPMYYIS  262



>gb|KDP40846.1| hypothetical protein JCGZ_24845 [Jatropha curcas]
Length=262

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 174/235 (74%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRPQ G+AG +V  + CLSWRL VETNNI  WK VP ECE YVGHYMLG QYR D 
Sbjct  30   QIHLLRPQAGAAGSKVTGLTCLSWRLGVETNNIVGWKTVPEECEGYVGHYMLGHQYRLDS  89

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V +EA  YA   +L+GDG D+WVFDIDETTLSN+PYYA     FGA PYN T FN WV
Sbjct  90   KAVTDEAFVYAKSHVLAGDGKDLWVFDIDETTLSNLPYYASH--GFGAEPYNFTLFNKWV  147

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
               KAPA+P SL+LY  +++LG+K VF+TG  E  R     NL++AGY  W KL+LK  +
Sbjct  148  LTSKAPALPESLQLYKRLIALGLKIVFITGRPEDQRAATTDNLKKAGYGAWLKLVLKASS  207

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G +AV YKS +R +LV +GYRI+GN+GDQWSDLLG + G+RTFK+PDPMYYI+
Sbjct  208  YSGKTAVFYKSSERAKLVKSGYRIIGNIGDQWSDLLGTNTGNRTFKLPDPMYYIS  262



>ref|XP_008228404.1| PREDICTED: acid phosphatase 1-like [Prunus mume]
Length=265

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 172/235 (73%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
             IH L P+TG A   VP + CLSWRLAVETNNI +WK VPAECE YVGHYMLG QYR+D 
Sbjct  33   HIHLLTPKTGGARGSVPGLSCLSWRLAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDS  92

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V   A  YA  + L+ DG ++WVFDIDETTLSN+PYYA +   FG   YN T FN WV
Sbjct  93   KVVTNGAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYYAVN--GFGTELYNSTSFNEWV  150

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             +G APA+P SL+LY  +L+LG+K VFLTG  E  R V   NL+  GY+ WEKLILKG  
Sbjct  151  LKGIAPALPESLKLYQKLLTLGVKVVFLTGRGEDQRNVTTTNLKNVGYHTWEKLILKGSA  210

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             TG ++  YKS +RT+LV +G+RI+GN GDQWSD+LG + G+RTFKVPDPMYYI+
Sbjct  211  YTGKTSYVYKSAERTKLVKSGFRIIGNAGDQWSDILGTNVGNRTFKVPDPMYYIS  265



>ref|XP_010690146.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=266

 Score =   292 bits (748),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 169/234 (72%), Gaps = 1/234 (0%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            I+ L P +GSAGHRVP ++CLSWRLAVET N+R+W+ +P ECE YVGHYM+G QYR+DC 
Sbjct  33   INLLMPHSGSAGHRVPGLNCLSWRLAVETYNLREWRTIPEECEGYVGHYMMGSQYRKDCL  92

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V   A  Y   + L+ DG D+WVFDIDET+LSN+PYYAR  V FGA PYN T F+ W  
Sbjct  93   AVTSAAYDYIKSLSLNKDGKDVWVFDIDETSLSNLPYYARPSVGFGANPYNATAFDEWQK  152

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            E K+PAIP+ L  Y  ++  G+K VFL+G+ E FR+ +  N++  GY  W+ +ILK  ++
Sbjct  153  EMKSPAIPSVLSFYKKLVRYGVKIVFLSGSHEEFRQFKERNMKNIGYTKWDMMILKQASE  212

Query  715  TG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +   AVEYKS  RT+L   GYRI+GNMGDQWSDL+G   G RTFK+PDPMYYI 
Sbjct  213  SKLKAVEYKSAHRTKLEKMGYRIIGNMGDQWSDLIGDHPGMRTFKLPDPMYYIG  266



>ref|XP_007215831.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
 gb|EMJ17030.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
Length=261

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 172/235 (73%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
             IH L P+TG A   VP + CLSWRLAVETNNI +WK VPAECE YVGHYMLG QYR+D 
Sbjct  29   HIHLLTPKTGGARGSVPGLSCLSWRLAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDS  88

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V   A  YA  + L+ DG ++WVFDIDETTLSN+PYYA +   FG   YN T F+ WV
Sbjct  89   KVVTNGAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYYAVN--GFGTELYNATSFDEWV  146

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             +G APA+P SL+LY  +L+LG+K VFLTG  E  R V   NL+  GY+ WEKLILKG  
Sbjct  147  LKGTAPALPESLKLYQKLLTLGVKVVFLTGRGEDKRNVTTTNLKNVGYHTWEKLILKGSA  206

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             TG ++  YKS +RT+LV +G+RI+GN GDQWSD+LG + G+RTFK+PDPMYYI+
Sbjct  207  YTGKTSYVYKSAERTKLVKSGFRIIGNAGDQWSDILGTNVGNRTFKLPDPMYYIS  261



>ref|XP_010033713.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53450.1| hypothetical protein EUGRSUZ_J02696 [Eucalyptus grandis]
Length=257

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 172/235 (73%), Gaps = 4/235 (2%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            EIH LRP +GSAG RV  + CLSWRL VET+NI++W  VP ECE YVGHYML  QYRED 
Sbjct  26   EIHLLRPHSGSAGERVHGLYCLSWRLGVETHNIKNWNTVPRECEGYVGHYML-HQYREDS  84

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + VA EA+ YA  + L+GDG D+WVFDIDET+LSN+PYYA  +  FG  P N T+F  W+
Sbjct  85   KVVAREAVLYAKSLKLAGDGKDVWVFDIDETSLSNLPYYA--EHGFGVEPLNATQFGQWI  142

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKG-V  708
              GKAPA+P +L LY  +L LGIKP+FLTG  E  R +  +NL+ AG+  WE LILKG  
Sbjct  143  LTGKAPALPETLELYRELLKLGIKPIFLTGRPEDARNITSSNLRNAGFRTWEMLILKGSA  202

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
                +AV YKS +R ++  +GYRIVGN+GDQWSDLLG   G+RTFK+P+PMYYI+
Sbjct  203  YSETTAVVYKSSERRKVEESGYRIVGNIGDQWSDLLGIHVGNRTFKLPNPMYYIS  257



>ref|XP_006465710.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
 gb|KDO51840.1| hypothetical protein CISIN_1g023352mg [Citrus sinensis]
Length=283

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 193/275 (70%), Gaps = 15/275 (5%)
 Frame = +1

Query  52   HGFLIETKTMKKAIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQID  231
            HGF ++       I+ LFL T++A +   +   P+     +IH LRP+ GS  + VP + 
Sbjct  23   HGFSMD-------IRHLFLATISATSHGFSMDIPH-----QIHLLRPKAGSRNNDVPGLS  70

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            CLSWRL VETNN+  W  VP +C  YVGHYMLGQQYR D E VA EAI YA  + L+GDG
Sbjct  71   CLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDG  130

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             +IWVFDIDET+LSN+PYYA++   FG  PYN T FN WV+ GKAP +P SL+LY  +L 
Sbjct  131  KNIWVFDIDETSLSNLPYYAKN--GFGVKPYNPTLFNEWVNTGKAPPLPESLKLYKKLLL  188

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LGIK VFLTG  E  R V  ANL+ AG+  WEKLILKG + +G +AV YKS +R +L   
Sbjct  189  LGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERKKLEMK  248

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI+GN+GDQWSDLLG +AG+RTFK+PDPMYYI 
Sbjct  249  GYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYIG  283



>ref|XP_004302846.1| PREDICTED: stem 28 kDa glycoprotein-like [Fragaria vesca subsp. 
vesca]
Length=265

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 169/235 (72%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRPQTGS G  +P + CLSWRL VET NI DW  VPA CE YVGHYMLG QYR+D 
Sbjct  33   QIHLLRPQTGSGGRHIPGVSCLSWRLGVETRNIIDWTTVPAACEGYVGHYMLGHQYRKDS  92

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V  EA  YA  + L+ D  ++W+FDIDET+LSN+PYY      FG   YN T F+AWV
Sbjct  93   KAVTYEAYLYAKSLNLTEDDKNLWIFDIDETSLSNLPYYVHH--GFGVEVYNSTTFDAWV  150

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EG APA+P SL+LY  + +LG+K  F+TG  E+ R V   NL++ GY+ WEKL+LK  +
Sbjct  151  LEGTAPALPESLKLYKKLSTLGVKVAFITGRGESQRSVTETNLKKVGYHTWEKLVLKDSS  210

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G +AV YKS +R +L   GYRI+GN+GDQWSDLLG + G+RTFK+PDPMYYI+
Sbjct  211  YSGKTAVVYKSTERKKLEEKGYRIIGNIGDQWSDLLGTNVGNRTFKMPDPMYYIS  265



>ref|XP_006426852.1| hypothetical protein CICLE_v10026223mg [Citrus clementina]
 gb|ESR40092.1| hypothetical protein CICLE_v10026223mg [Citrus clementina]
Length=283

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 192/275 (70%), Gaps = 15/275 (5%)
 Frame = +1

Query  52   HGFLIETKTMKKAIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQID  231
            HGF ++       I+ LFL T+ A +   +   P+     +IH LRP+ GS  + VP + 
Sbjct  23   HGFSMD-------IRHLFLATIPATSHGFSMDIPH-----QIHLLRPKAGSRNNDVPGLS  70

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            CLSWRL VETNN+  W  VP +C +YVGHYMLGQQYR D E VA EAI +A  + L+GDG
Sbjct  71   CLSWRLGVETNNVIGWATVPEKCADYVGHYMLGQQYRLDSEVVANEAILHAQSLTLAGDG  130

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             DIWVFDIDET+L N+PYYA++   FG  PYN T FN WV+ GKAP +P SL+LY  +L 
Sbjct  131  KDIWVFDIDETSLCNLPYYAKN--GFGVKPYNPTMFNEWVNTGKAPPLPESLKLYKKLLL  188

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LGIK VFLTG  E  R V  ANL+ AG+  WEKLILKG + +G +AV YKS +R +L   
Sbjct  189  LGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKGSSHSGETAVVYKSSERKKLEMK  248

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI+GN+GDQWSDLLG +AG+RTFK+PDPMYYI 
Sbjct  249  GYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYIG  283



>ref|XP_010033828.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53662.1| hypothetical protein EUGRSUZ_J02929 [Eucalyptus grandis]
Length=257

 Score =   285 bits (729),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 171/235 (73%), Gaps = 4/235 (2%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            EIH LRP +GSAG RV  + CLSWRL VET+NI++W  VP ECE YVGHYML  QYRED 
Sbjct  26   EIHLLRPHSGSAGERVHGLYCLSWRLGVETHNIKNWNTVPRECEGYVGHYML-YQYREDS  84

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + VA EA+ Y   + L+GDG D+WVFDIDET+LSN+PYYA  +  FG  P N T+F  W+
Sbjct  85   KVVAREAVLYVKSLKLAGDGKDVWVFDIDETSLSNLPYYA--EHGFGVEPLNPTQFGQWI  142

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKG-V  708
              GKAPA+P +L LY  +L LGIKP+FLTG  E  R +  +NL+ AG+  WE LILKG  
Sbjct  143  LTGKAPALPETLELYRELLKLGIKPIFLTGRSEDARNITSSNLRNAGFRTWEMLILKGSA  202

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
                +AV YKS +R ++  +GYRIVGN+GDQWSDLLG   G+RTFK+P+PMYYI+
Sbjct  203  YSETTAVVYKSSERRKVEESGYRIVGNIGDQWSDLLGIHVGNRTFKLPNPMYYIS  257



>ref|XP_004960901.1| PREDICTED: stem 28 kDa glycoprotein-like [Setaria italica]
Length=268

 Score =   284 bits (727),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 168/240 (70%), Gaps = 4/240 (2%)
 Frame = +1

Query  160  QQVVEIHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQ  333
            Q+   IH LRP  GSAG   R   + C SWRLAVE  N RDW+ VPA+CE YVGHYMLG 
Sbjct  31   QKAPLIHALRPMVGSAGDLGRRGGVPCDSWRLAVEAYNKRDWRTVPADCEGYVGHYMLGG  90

Query  334  QYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDT  513
             YR D   V  EA+ YA G+ L G G ++WVFDIDET+LSN+PYYA     FG  PYN T
Sbjct  91   HYRRDSRVVVNEAVAYAEGLKLGGKGKEVWVFDIDETSLSNLPYYATH--GFGTKPYNAT  148

Query  514  KFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKL  693
             FNA+V EG AP +P + RLYN +++LGIKPVFLTG  E  R + +ANL+  GY  W KL
Sbjct  149  SFNAYVLEGSAPVLPETQRLYNKLIALGIKPVFLTGRTEDQRAITVANLRRQGYSGWMKL  208

Query  694  ILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +LK V    SAV +KSG+R +LV+AGY IVGN+GDQWSD+LG   G RTFK+PDP+YYI 
Sbjct  209  LLKPVGFKASAVGFKSGERKKLVDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYIG  268



>ref|XP_007045549.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
 gb|EOY01381.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
Length=260

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 187/263 (71%), Gaps = 5/263 (2%)
 Frame = +1

Query  88   AIQLLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNN  267
            A+ L+  +         + QP ++ +  +IH LRPQ+G+ G  VP + CLSWRL VETNN
Sbjct  2    ALLLVLFLANILTLSQGSSQPAHVHR--QIHLLRPQSGAGGDLVPGLSCLSWRLGVETNN  59

Query  268  IRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETT  447
            I  WK +P ECE YVGHYMLG+QYR+D + VA+EA  YA  + L  DG D+W+FD+DETT
Sbjct  60   IIGWKTIPQECEGYVGHYMLGKQYRKDSKAVADEAFLYAQSLKLPRDGKDVWIFDVDETT  119

Query  448  LSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTK  627
            LSN+PYYA     FG  PYN T FN WV EGKAPA+P SL+LY  +LSLGIK VF+TG  
Sbjct  120  LSNLPYYAEH--GFGVEPYNATLFNKWVMEGKAPALPESLKLYKKLLSLGIKAVFITGRA  177

Query  628  EAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQW  804
            E  R +   NL++ G+++WEKLILK  + +G ++V YKS +R +L   GY+IVGN+GDQW
Sbjct  178  EDQRSITATNLKKVGFHSWEKLILKESSYSGKTSVGYKSNERKKLEKNGYKIVGNIGDQW  237

Query  805  SDLLGPDAGDRTFKVPDPMYYIA  873
            SDLLG   G+RTFK+PDPMYYI+
Sbjct  238  SDLLGTYTGNRTFKLPDPMYYIS  260



>gb|KDO51839.1| hypothetical protein CISIN_1g036571mg, partial [Citrus sinensis]
Length=251

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 181/241 (75%), Gaps = 3/241 (1%)
 Frame = +1

Query  154  YIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQ  333
            Y++   +IH LRP++G+  +  P + CLSWRLAVETNNI  WK  P +CE Y+GHYMLGQ
Sbjct  13   YLEIPHQIHLLRPKSGARTNDFPDLSCLSWRLAVETNNIIGWKTTPEKCEGYLGHYMLGQ  72

Query  334  QYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDT  513
            QYRED E VA EAI YA  + L+GDG +IW+FDIDET+LSN+PYYA+    FG  P+N T
Sbjct  73   QYREDSEAVAYEAIVYAQSLELAGDGREIWIFDIDETSLSNLPYYAKH--GFGVEPFNST  130

Query  514  KFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKL  693
             FN WV++G+AP++P SL+LY  +LSLGIK VFLTG  E  R V   NL+  G+Y WE L
Sbjct  131  LFNEWVNKGEAPSLPESLKLYKKLLSLGIKIVFLTGRPEDQRSVTENNLKNVGFYTWENL  190

Query  694  ILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            ILKG + +G +AV YKS +R  L   GYRI+GN+GDQWSDLLG +AG+RTFK+PDPMYYI
Sbjct  191  ILKGSSYSGETAVVYKSSERKRLEKKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI  250

Query  871  A  873
            +
Sbjct  251  S  251



>ref|XP_004960903.1| PREDICTED: acid phosphatase 1-like [Setaria italica]
Length=280

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 170/235 (72%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GSAG   R   + C SWRLAVE  N RDWK VPA+CE YVGHYMLG  YR D
Sbjct  48   IHALRPLVGSAGDLGRRGGVPCDSWRLAVEAYNKRDWKTVPADCEGYVGHYMLGGHYRRD  107

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               V +EAI YA G+ L+G+G ++WVFDIDET+LSN+PYYA+    FG  P+N T FNA+
Sbjct  108  SRVVVDEAIAYAEGLKLAGNGREVWVFDIDETSLSNLPYYAKH--GFGTEPFNATSFNAY  165

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V EG A A+P + RL++ ++SLGIKPVFLTG  E  R + + NL+  GYY W KL+LK V
Sbjct  166  VLEGSALALPETQRLFDKLISLGIKPVFLTGRTENQRAITVVNLRRQGYYGWMKLLLKPV  225

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               G+A+ +KSG+R +L +AGY IVGN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  226  GFKGTAIGFKSGERRKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  280



>ref|XP_006426853.1| hypothetical protein CICLE_v10027566mg [Citrus clementina]
 gb|ESR40093.1| hypothetical protein CICLE_v10027566mg [Citrus clementina]
Length=264

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/259 (58%), Positives = 188/259 (73%), Gaps = 3/259 (1%)
 Frame = +1

Query  100  LFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDW  279
             FL   T   V AT +  Y++   +IH LRP++G+  +  P + CLSWRLAVETNNI  W
Sbjct  8    FFLFLATLALVAATSRGTYLEIPHQIHLLRPKSGARTNDFPDLSCLSWRLAVETNNIIGW  67

Query  280  KLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNI  459
            K  P +CE Y+GHYMLGQQYRED E VA EAI YA  + L+GDG +IW+FDIDET+LSN+
Sbjct  68   KTTPEKCEGYLGHYMLGQQYREDSEAVAYEAIVYAQSLELAGDGREIWIFDIDETSLSNL  127

Query  460  PYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFR  639
            PYYA+    FG  P+N T FN WV++G+AP++P SL+LY  +LSLGIK VFLTG  E  R
Sbjct  128  PYYAKH--GFGVEPFNSTLFNEWVNKGEAPSLPESLKLYKKLLSLGIKIVFLTGRPEDQR  185

Query  640  EVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLL  816
             V   NL+  G+Y WE LILKG + +G +AV YKS +R  L   GYRI+GN+GDQWSDLL
Sbjct  186  SVTENNLKNVGFYTWENLILKGSSYSGETAVVYKSSERKRLEKKGYRIIGNIGDQWSDLL  245

Query  817  GPDAGDRTFKVPDPMYYIA  873
            G +AG+RTFK+PDPMYYI+
Sbjct  246  GTNAGNRTFKLPDPMYYIS  264



>ref|XP_002440748.1| hypothetical protein SORBIDRAFT_09g006010 [Sorghum bicolor]
 gb|EES19178.1| hypothetical protein SORBIDRAFT_09g006010 [Sorghum bicolor]
Length=285

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 167/234 (71%), Gaps = 4/234 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH L P  GSAG   R   + C SWRLAVE  N RDWK VPA CE+YVGHYMLG+QYR D
Sbjct  53   IHALHPLVGSAGDLGRRAGVPCDSWRLAVEAYNKRDWKTVPANCEHYVGHYMLGRQYRLD  112

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               VA+EAI YA G+ L+G+G ++WVFDIDET+LSN+PYYA+    FG  PYN T FN +
Sbjct  113  SRVVADEAIAYAEGLKLAGNGKEVWVFDIDETSLSNLPYYAKH--GFGTKPYNATSFNEY  170

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V EG AP +P + RL+  ++SLGIKPVFLTG  E  R + + NL+  GY  W  L+LK +
Sbjct  171  VLEGSAPVLPETQRLFKKLISLGIKPVFLTGRTEDQRAITVTNLRRQGYSGWMHLLLKPI  230

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               G+A+ YKSG R +L NAGY IVGN+GDQWSD+LG   G RTFK+PDP+YYI
Sbjct  231  GFKGTAIGYKSGARQKLQNAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYI  284



>dbj|BAJ94050.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 166/233 (71%), Gaps = 4/233 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP  GS   +   + C SWRL VE +N+RDWK VPA CE+YVGHYM+G  YR D +
Sbjct  44   IHALRPLLGSG--KQAGVACDSWRLGVEAHNVRDWKTVPASCEDYVGHYMVGDHYRRDSK  101

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V ++AI Y + + L+G+G ++WVFD+DETTLSN+PYYA+    FGA P+N T F A+  
Sbjct  102  VVIDQAIAYVDSLKLAGNGKEVWVFDVDETTLSNLPYYAKH--GFGATPFNSTSFRAYAR  159

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG APA+P + RLYN +LS+GIKPV LTG +E  R     NL+  GY  W KL+LK  + 
Sbjct  160  EGSAPALPETKRLYNKLLSVGIKPVILTGRRENLRASTTTNLRSQGYSRWMKLLLKQQDF  219

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GS+V +KSG+R +L NAGY IVGN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  220  RGSSVTFKSGERQKLQNAGYIIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  272



>gb|EMS46715.1| Stem 28 kDa glycoprotein [Triticum urartu]
Length=269

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 166/233 (71%), Gaps = 4/233 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP  GS  H    + C SW L VE +N+RDWK VPA CE YVGHYMLG+ +R D +
Sbjct  41   IHALRPLLGSGKH--AGVACDSWVLGVEAHNVRDWKTVPASCEGYVGHYMLGKHFRRDSK  98

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V ++A+ Y + + L+G+G ++WVFDIDETTLSN+PYYA+    FGA P+N T FNA+V 
Sbjct  99   IVIDQALAYVDNLKLAGNGKEVWVFDIDETTLSNLPYYAKH--GFGATPFNATSFNAYVL  156

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG APA+P + RLYN +LS+GIKPVFLTG  E  R V I NL+  G   W  L+LK    
Sbjct  157  EGSAPALPETKRLYNKLLSVGIKPVFLTGRTEDQRAVTITNLRRQGISGWMNLLLKQPGF  216

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GSAV YKSG+R +L +AG+ IVGN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  217  KGSAVTYKSGERQKLQDAGFVIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  269



>ref|XP_004963522.1| PREDICTED: stem 28 kDa glycoprotein-like [Setaria italica]
Length=276

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 165/235 (70%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GSAG   R   + C SWRLAVE  N RDW+ VP +CE YVGHYMLG  YR+D
Sbjct  44   IHALRPMVGSAGDLGRRGGVPCDSWRLAVEAYNKRDWRTVPVDCEGYVGHYMLGGHYRQD  103

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               V +EA+ YA G+ L G G ++WVFD DETTLSN+PYYA     FG  PYN T FN +
Sbjct  104  SGDVVDEAVAYAEGLKLGGKGKEVWVFDTDETTLSNLPYYATD--GFGTKPYNATSFNEY  161

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V EG AP +P + RLYN ++SLGIKPVF+TG  E  R + +ANL+  GY  W KL+LK V
Sbjct  162  VMEGSAPVLPETQRLYNKLISLGIKPVFVTGRTEDQRAITVANLRREGYSGWMKLMLKPV  221

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               G+A+ +KSG+R +L +AGY IVGN+GDQWSD+LG   G RTFK+PDP+YYI 
Sbjct  222  GYNGTAIGFKSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  276



>ref|XP_002439412.1| hypothetical protein SORBIDRAFT_09g005960 [Sorghum bicolor]
 gb|EES17842.1| hypothetical protein SORBIDRAFT_09g005960 [Sorghum bicolor]
Length=268

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 168/235 (71%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP   S+GH  R+  + C SWR AVET+ +RDW+ VPA CE YVG+YMLG QYR D
Sbjct  36   IHMLRPLLHSSGHLGRLGGVPCDSWRFAVETDTLRDWETVPARCEKYVGNYMLGGQYRSD  95

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
             + V +EA+ YA G+ LSGDG ++WVFD+DETTLSN+PYYA     FG+ PYN T F A+
Sbjct  96   SQAVVDEAVAYAEGLKLSGDGKEVWVFDVDETTLSNLPYYAEH--GFGSEPYNSTAFGAY  153

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
                 APA+P + RLY  +  LGIKPV LTG +E  RE    NL + GY  +EKL+LK  
Sbjct  154  TKLANAPALPETQRLYKRLQELGIKPVILTGRREDKRESTAKNLADVGYTGYEKLLLKPQ  213

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +   +AVE+KSG+R +LV+AGY IVGN+GDQW+DLLG   GDRTFK+PDPMYY+ 
Sbjct  214  DARVTAVEFKSGERKKLVDAGYVIVGNIGDQWTDLLGEPEGDRTFKLPDPMYYVG  268



>ref|XP_003568779.1| PREDICTED: stem 28 kDa glycoprotein [Brachypodium distachyon]
Length=287

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 166/235 (71%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS G    +  + C SW L VE +N+R WK +PA+CE YVGHYMLG ++R D
Sbjct  55   IHALRPLLGSGGEMGSLGGVACDSWLLGVEAHNVRGWKTIPAKCEGYVGHYMLGSRFRRD  114

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
             + V +EAI YA G+ L+G+G D+WVFDIDETTLSN+PYYA     FGA P+N T FNA+
Sbjct  115  SKVVIDEAIAYAEGLKLAGNGKDVWVFDIDETTLSNLPYYATH--GFGAKPFNATSFNAY  172

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V EG APA+P + RLYN ++S+G+KPVFLTG  E  R +   NL+  G   W  L+LK  
Sbjct  173  VLEGSAPALPETKRLYNKLVSMGVKPVFLTGRTEDQRVITETNLRRQGITGWMNLLLKQP  232

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               GSAV YKSG+R +L +AGY IVGN+GDQWSDLLG   G RTFK+PDPMYYI 
Sbjct  233  GFKGSAVAYKSGERQKLQDAGYAIVGNIGDQWSDLLGAPEGSRTFKLPDPMYYIG  287



>ref|XP_009338743.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=261

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 173/235 (74%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
             IH LRP++G+ G  VP + CLSWRL VET NI +WK VPAECE+YVGHYMLG QYR+D 
Sbjct  29   HIHLLRPKSGAGGGSVPGVSCLSWRLGVETRNIINWKTVPAECESYVGHYMLGHQYRKDS  88

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + VA+EA  +A  + L+ DG ++WVFDIDETTLSN+PYYAR    FG   YN T FN WV
Sbjct  89   KVVADEAWLHAQSLNLTKDGKNVWVFDIDETTLSNLPYYARH--GFGTEVYNATAFNEWV  146

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EG APA+P SL+LY  +L LG+K VF+TG  E  R V   NL+ AGY  W+KL+LKG N
Sbjct  147  FEGTAPALPESLKLYKKLLRLGVKVVFITGRGEDQRSVTTTNLKNAGYDTWKKLVLKGSN  206

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G ++  YKS +R +L   G+RI+GNMGDQWSD+LG   G+RTFK+PDP+YYI+
Sbjct  207  YSGKTSYVYKSAEREKLEKNGFRIIGNMGDQWSDILGTTVGNRTFKLPDPLYYIS  261



>ref|XP_004960899.1| PREDICTED: stem 28 kDa glycoprotein-like isoform X1 [Setaria 
italica]
Length=274

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 165/235 (70%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP   S GH  R  ++ C SWR AVETNN R WK +PA CE YVG+YM+G  YR D
Sbjct  42   IHMLRPLLSSGGHLGRRGRVPCDSWRFAVETNNKRGWKTIPARCERYVGNYMMGGHYRSD  101

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               V  EAI YA G+ LSG G ++WVFDIDET LSN+PYYA+    FGA PYN T F A+
Sbjct  102  SRAVVNEAIAYAEGLELSGKGNEVWVFDIDETALSNLPYYAKH--GFGAEPYNWTAFGAY  159

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
              +  APA+P +LRLY  + +LGIKPV LTG +E  RE  + NL  AGY  + KL+LK  
Sbjct  160  AKQANAPALPETLRLYKRLQALGIKPVILTGRREDKREATVRNLASAGYTGYLKLLLKPQ  219

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            N    ++E+KSG+R +LV+AGY IVGN+GDQWSDLLG   GDRTFK+PDPMYYIA
Sbjct  220  NVRMHSLEFKSGERKKLVDAGYVIVGNIGDQWSDLLGAPEGDRTFKLPDPMYYIA  274



>ref|XP_004305256.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=263

 Score =   274 bits (701),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 170/234 (73%), Gaps = 3/234 (1%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH L+P++GS G  V  I CLSWRL VET+NI DW  +PA CE YVGHYMLG QYR+D  
Sbjct  32   IHLLQPKSGSGGSHVGNISCLSWRLGVETHNIIDWTTIPAACEGYVGHYMLGDQYRKDSA  91

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V  EA  YA G+ L+ DG  +WVFD+DETTLSN+PYYA+    FG   YN T FNAWV 
Sbjct  92   VVTHEAYVYAEGLNLTDDGNKLWVFDVDETTLSNLPYYAKH--GFGVEVYNSTAFNAWVL  149

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG APA+P SL+LY  +L+LGIK  F+TG  E+ R V   NL+ AGY  WE LILKG + 
Sbjct  150  EGIAPALPESLKLYKKLLALGIKVAFITGRGESQRNVTETNLKNAGYDTWETLILKGSSY  209

Query  715  TG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +G ++V YKS +RT+L  +GY I+GN+GDQWSDL+G   G+RTFK+PDPMYYI+
Sbjct  210  SGNTSVVYKSAERTKLEESGYTIIGNIGDQWSDLIGTSVGNRTFKLPDPMYYIS  263



>ref|XP_004510320.1| PREDICTED: stem 28 kDa glycoprotein-like [Cicer arietinum]
Length=262

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 4/236 (2%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +I  L+ ++G  GH +P + C SWR+ VE +NI +WK +P ECE YVG+YMLG QYR D 
Sbjct  29   QIFPLQMKSGPGGHYIPDLSCASWRVGVEAHNIINWKTIPKECEKYVGNYMLGAQYRADS  88

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            +YV  E   YA  + +SGDG DIWVFDIDETTLSN+PYYA+    FG  PYN+  FN WV
Sbjct  89   KYVNREGYYYAKTLNISGDGKDIWVFDIDETTLSNLPYYAKH--GFGVEPYNEVAFNEWV  146

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
              G APA+P S +LYN +LSLGIK VFLTG     +     NL+ AGY+ WEKLILK   
Sbjct  147  EVGAAPALPESQKLYNKLLSLGIKIVFLTGRPLKQKNSTATNLKNAGYHTWEKLILKDTT  206

Query  712  --DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
                 +AV YKS +R +L   GYRIVGN+GDQWSD+LG + G RTFK+PDP+YYI+
Sbjct  207  KYHGKTAVTYKSSERKKLEKEGYRIVGNIGDQWSDILGTNIGQRTFKLPDPLYYIS  262



>ref|XP_011072446.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=184

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  322  MLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVP  501
            MLG++ R DCE VA+ AI+YA  + L GDG D+WVFDIDETTLSN+PYYARSDV FGA+P
Sbjct  1    MLGKRSRHDCEVVADAAIEYAKSLKLGGDGKDVWVFDIDETTLSNLPYYARSDVQFGALP  60

Query  502  YNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYN  681
            YN TKFN WV+EGKAP +PA  RLY T+LSLGIK VFLTG  +AFR +R ANL  AGY++
Sbjct  61   YNGTKFNEWVTEGKAPPVPAVRRLYKTLLSLGIKAVFLTGGSDAFRRIRTANLYAAGYHS  120

Query  682  WEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPM  861
            W KLI KG  + G+A+ YKS KR E+V+ GYRIVGN+GDQWSDLLG DAG+RTFKVPDPM
Sbjct  121  WLKLIFKGEAEEGAALVYKSKKRREVVDEGYRIVGNIGDQWSDLLGADAGNRTFKVPDPM  180

Query  862  YYIA  873
            YYI 
Sbjct  181  YYIG  184



>ref|XP_004960902.1| PREDICTED: acid phosphatase 1-like [Setaria italica]
Length=290

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 167/235 (71%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHR--VPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GSAG       + C SWRLAVETNN RDW+ VPA CE YVG+YMLG  YR D
Sbjct  58   IHALRPLVGSAGDLGWRGGVPCDSWRLAVETNNKRDWRTVPARCERYVGNYMLGGHYRRD  117

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               V +EA+ YA G+ L+G+G ++WVFDIDET LSN+PYYA +   FG  PY+ T FNA+
Sbjct  118  SRVVIDEAVAYAEGLQLAGNGKEVWVFDIDETALSNLPYYASN--GFGTKPYDATSFNAY  175

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V  G AP +P + RLYN ++SLGI PVFLTG +E  R + +ANL+  GY  W KL+LK V
Sbjct  176  VFAGSAPVLPETQRLYNKLISLGITPVFLTGRRENQRAITVANLRREGYSGWMKLLLKPV  235

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               G+A+ +KS +R +L +AGY IVGN+GDQWSD+LG   G RTFK+PDP+YYI 
Sbjct  236  GYNGTAIGFKSDERRKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  290



>gb|EMS66285.1| Stem 28 kDa glycoprotein [Triticum urartu]
Length=275

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 163/233 (70%), Gaps = 4/233 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP  GS  H    + C SWRL VE  N+RDWK VPA CE YVGHYM+G  YR D +
Sbjct  47   IHALRPLLGSGSH--AGMACDSWRLGVEAYNVRDWKTVPASCEGYVGHYMVGDHYRRDSK  104

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V ++AI Y + + L+G+G ++WVFD+DETTLSN+PYYA+    FGA P+N T+FNA+  
Sbjct  105  VVVDQAIAYVDSLKLAGNGKEVWVFDVDETTLSNLPYYAKH--GFGATPFNVTRFNAYAQ  162

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG APA+P + RLYN +LS+GIKPV LTG  E  R     NL+  GY  W  L+LK    
Sbjct  163  EGSAPALPETKRLYNKLLSVGIKPVILTGRAEYLRASTATNLRRQGYSGWMNLLLKAPGF  222

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GS+V +KSG++ +L +AGY IVGN+GDQWSD++G   G RTFK+PDPMYYI 
Sbjct  223  KGSSVAFKSGEKQKLQDAGYIIVGNIGDQWSDIIGAPDGARTFKLPDPMYYIG  275



>ref|XP_010654600.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=255

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 171/234 (73%), Gaps = 3/234 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            EIH LRPQ GS+GH VP + CLSWRL VE +NI +W  VP  CE+YVGHYMLG QYR+D 
Sbjct  25   EIHLLRPQLGSSGHHVPGLSCLSWRLGVEAHNIIEWSTVPQACESYVGHYMLGHQYRKDS  84

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              V  EA+ YA  + L+ DG DIWVFD+DET+ SN+PYYA+    F    YN T+FN WV
Sbjct  85   RAVVYEALTYAQSLKLAVDGKDIWVFDVDETSPSNLPYYAKH--GFRVEAYNSTQFNNWV  142

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+P SL+LY  +LSLGIK VF+TG  EA R V  ANL+  GY+ WEKLILKG +
Sbjct  143  YEGKAPALPESLKLYKKLLSLGIKAVFITGRPEAQRNVTAANLRNVGYHTWEKLILKG-S  201

Query  712  DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
              G+ V YKS +R +L  +GYRI+ N+GDQWSD+LG +  +RTFK+ +PMYYI+
Sbjct  202  SAGTIVVYKSNERKKLKKSGYRIIDNIGDQWSDILGTNTENRTFKLSNPMYYIS  255



>ref|XP_006654133.1| PREDICTED: acid phosphatase 1-like [Oryza brachyantha]
Length=272

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 166/233 (71%), Gaps = 2/233 (1%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP  GS   ++  + C SWRL VE +NI DW+ VPA+CE YVGHYMLG  YR D  
Sbjct  42   IHALRPLLGSGAGQLAGLPCDSWRLGVEAHNIIDWETVPAKCEGYVGHYMLGGHYRRDSA  101

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V +EA+ YA  + L+G+G ++W+FD+DETTLSN+PYYA  +  FGA P+N T F  + +
Sbjct  102  VVVDEAVAYAETLQLAGNGKEVWIFDVDETTLSNLPYYA--NYGFGAKPFNHTSFINYAA  159

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG APA+P +LRLY  +L LGIKPV LTG +E  R+    NL++ GY  WEKL+LK  + 
Sbjct  160  EGTAPALPETLRLYQRLLELGIKPVILTGRREYLRDATEKNLRQQGYSMWEKLLLKPTSA  219

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
              +   +KSG+R +LV+AGY IVGN+GDQWSD+LG   G RTFK+PDPMYY++
Sbjct  220  LQAGAAFKSGERQKLVDAGYAIVGNIGDQWSDILGAPEGSRTFKLPDPMYYVS  272



>ref|XP_008380842.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=274

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 172/235 (73%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
             IH LRP++G+ G  VP + CLSWRL VE  NI +WK VPA+CE+YVGHYMLG QYR+D 
Sbjct  42   HIHLLRPKSGAGGSSVPGVSCLSWRLGVEVRNIINWKTVPAQCESYVGHYMLGHQYRKDS  101

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V + A  YA  + L+ DG ++WVFDIDETTLSN+PYYAR    FG   YN T FN WV
Sbjct  102  KAVTDVAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYYARH--GFGTEVYNSTSFNEWV  159

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EG APA+P SL+LY  +L LG+K VF+TG  E  R V I NL+  GY+ WEKL+LKG  
Sbjct  160  LEGTAPALPESLQLYKKLLKLGVKVVFITGRGEDQRSVTIXNLKNVGYHTWEKLVLKGSA  219

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G ++ EYKS +R +L  +G+RI+GNMGDQWSD+LG   G+RTFK+PDP+YYI+
Sbjct  220  YSGKTSYEYKSAEREKLEKSGFRIIGNMGDQWSDILGTSVGNRTFKLPDPLYYIS  274



>gb|EMT03894.1| Stem 28 kDa glycoprotein [Aegilops tauschii]
Length=273

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 161/233 (69%), Gaps = 4/233 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP  GS  H    + C SWRL VE  N+RDWK VPA CE+YVGHYM+G  YR D +
Sbjct  45   IHALRPLLGSGRH--AGVACDSWRLGVEAYNVRDWKAVPASCEDYVGHYMVGDHYRRDSK  102

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V ++AI Y + + L+G G ++WVFD+DETTLSN+PYYA+    FGA P+N T FNA+  
Sbjct  103  VVVDQAIAYVDSLKLAGKGKEVWVFDVDETTLSNLPYYAKH--GFGATPFNVTSFNAYAH  160

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG APA+P + RLYN + S+GIKPV LTG  E  R     NL+  GY  W  L+LK    
Sbjct  161  EGSAPALPETKRLYNKLFSVGIKPVILTGRAEYLRASTATNLRRQGYSRWMNLLLKAPGF  220

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GS+V +KSG+R +L +AGY IVGN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  221  KGSSVAFKSGERQKLQDAGYIIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  273



>emb|CAB71336.2| putative acid phosphatase [Hordeum vulgare subsp. vulgare]
 emb|CAF31501.1| putative acid phosphatase [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 161/233 (69%), Gaps = 4/233 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP  GS   +   + C SWRL VE  N+RDWK VPA CE YVGHYMLG  +R DC+
Sbjct  44   IHALRPLLGSG--KQAGVACDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGNHFRRDCK  101

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V ++AI Y +G+ L+G+G D+WVFDIDETTLSN+PYYA     FGA PYN T F+A+V 
Sbjct  102  VVIDQAIAYVDGLKLAGNGKDVWVFDIDETTLSNLPYYATH--GFGARPYNATSFDAYVM  159

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG AP +P + RLY  +L +GIKPVF+TG  E  R V + NL+  G+  W  L LK    
Sbjct  160  EGSAPVLPETKRLYYKLLKVGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMSLTLKQHGF  219

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GSA+ YKS +R +L +AGY IVGN+GDQWSD+LG   G RTF  PDPMYYIA
Sbjct  220  KGSAISYKSAERKKLEDAGYVIVGNIGDQWSDILGAPEGARTFSRPDPMYYIA  272



>dbj|BAJ94870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 164/235 (70%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS G    +  + C SWRL VE  N+RDWK VPA CE YVGHYMLG  +R D
Sbjct  39   IHALRPLLGSGGQLGSRGGVPCDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGNHFRRD  98

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
             + V ++AI Y +G+ L+G+G D+WVFDIDETTLSN+PYYA     FGA PYN T F+A+
Sbjct  99   FKVVIDQAIAYVDGLKLNGNGKDVWVFDIDETTLSNLPYYATH--GFGARPYNATSFDAY  156

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V EG APA+P + RLY  +L +GIKPVF+TG  E  R V + NL+  G+  W  L LK  
Sbjct  157  VLEGSAPALPETKRLYYKLLKVGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMNLTLKQH  216

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               GSA+ YKS +R +L +AGY IVGN+GDQWSD+LG   G RTFK+PDP+YYIA
Sbjct  217  GFKGSAISYKSAERKKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYIA  271



>ref|NP_001148494.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACG31723.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACN31777.1| unknown [Zea mays]
Length=261

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 166/234 (71%), Gaps = 5/234 (2%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHR-VPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            ++H     T +A  R VP   C SWRL VETNNIRDW  +PAEC  YV  YM G  +R+D
Sbjct  31   DLHLEMVTTSAATARAVPS--CASWRLGVETNNIRDWYSIPAECRGYVRDYMYGDLFRQD  88

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
            C  VA EA  YA G+ L GDG ++WVFD+D+TTLSN+PYYA  D  FGA PYN T F+ +
Sbjct  89   CAVVAREAAAYAEGLELGGDGKEVWVFDVDDTTLSNLPYYA--DTGFGAEPYNATYFDEY  146

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V+   AP +P  L+LY T+LSLGIK VF+TG  +  +E  I NL+ AGY+ W+KL+LK  
Sbjct  147  VANATAPPLPEVLQLYETLLSLGIKVVFITGRHDYEKEPTIKNLRSAGYHTWDKLVLKPS  206

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            +   S V YKSG+R +LV+AGYRIVGNMGDQWSDL+G   GDRTFKVPDPMYY+
Sbjct  207  SLGSSVVPYKSGERQKLVDAGYRIVGNMGDQWSDLIGAPEGDRTFKVPDPMYYV  260



>ref|NP_001150932.1| LOC100284565 precursor [Zea mays]
 gb|ACG40988.1| stem 28 kDa glycoprotein precursor [Zea mays]
Length=293

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 161/235 (69%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GSAG   R   + C SWRLAVET N RDW  VPA CE YVGHYMLG  YR D
Sbjct  61   IHALRPLLGSAGDLGRRAGVPCDSWRLAVETYNKRDWTTVPASCERYVGHYMLGGHYRRD  120

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               V +EAI YA G+ L G+G ++WVFDIDET+LSN+PYYA     FG   YN T FN +
Sbjct  121  SRVVIDEAIAYAEGLKLGGNGKEVWVFDIDETSLSNLPYYATH--GFGTKLYNATSFNEY  178

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V EG AP +P + RL+  ++SLGIKPVFLTG  E  R + + NL+  GY  W  L+LK V
Sbjct  179  VLEGSAPVLPETQRLFKKLVSLGIKPVFLTGRTEDQRAITVTNLRRQGYSGWMTLLLKPV  238

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
                +A+ YKSG+R +L +AGY IVGN+GDQWSD+LG   G RTFK+PDP+YYI 
Sbjct  239  GLKATAIAYKSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  293



>ref|XP_009381186.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=263

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 160/233 (69%), Gaps = 2/233 (1%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH L+P  GS G     + C SWR  VETNN+R W+ VP  CE YVGHYMLG +YR+D  
Sbjct  33   IHLLKPLFGSGGLPADGVTCASWRFGVETNNVRGWRTVPRSCEGYVGHYMLGDRYRQDSA  92

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V   A  Y  G+ + GDG D W+FDIDET LSN+PYYA     FG  PYN T FNAWV 
Sbjct  93   VVTAAAAAYVEGLQIPGDGMDAWIFDIDETVLSNLPYYAHH--GFGVEPYNATSFNAWVD  150

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            +G APA+P SL+LY+ +L LGIK VFLTG  E  R V I NL+ AGY  WEKL+LKG   
Sbjct  151  KGIAPALPESLKLYHKLLPLGIKIVFLTGRSEERRNVTITNLKRAGYRTWEKLLLKGEGV  210

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             G+A+ +K+ +R +L   GYRIVGN+GDQWSD+LG   G RTFK+PDP+YYI+
Sbjct  211  NGTAMAFKTAEREKLEEQGYRIVGNIGDQWSDILGKPEGARTFKLPDPLYYIS  263



>ref|XP_004960900.1| PREDICTED: stem 28 kDa glycoprotein-like isoform X2 [Setaria 
italica]
Length=279

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 165/240 (69%), Gaps = 9/240 (4%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP   S GH  R  ++ C SWR AVETNN R WK +PA CE YVG+YM+G  YR D
Sbjct  42   IHMLRPLLSSGGHLGRRGRVPCDSWRFAVETNNKRGWKTIPARCERYVGNYMMGGHYRSD  101

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               V  EAI YA G+ LSG G ++WVFDIDET LSN+PYYA+    FGA PYN T F A+
Sbjct  102  SRAVVNEAIAYAEGLELSGKGNEVWVFDIDETALSNLPYYAKH--GFGAEPYNWTAFGAY  159

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILK--  702
              +  APA+P +LRLY  + +LGIKPV LTG +E  RE  + NL  AGY  + KL+LK  
Sbjct  160  AKQANAPALPETLRLYKRLQALGIKPVILTGRREDKREATVRNLASAGYTGYLKLLLKYS  219

Query  703  ---GVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
                 N    ++E+KSG+R +LV+AGY IVGN+GDQWSDLLG   GDRTFK+PDPMYYIA
Sbjct  220  ICLCTNVRMHSLEFKSGERKKLVDAGYVIVGNIGDQWSDLLGAPEGDRTFKLPDPMYYIA  279



>dbj|BAJ90845.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 163/235 (69%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS G    +  + C SWRL VE  N+RDWK VPA CE YVGHYMLG  +R D
Sbjct  39   IHALRPLLGSGGQLGSRGGVPCDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGNHFRRD  98

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
             + V ++ I Y +G+ L+G+G D+WVFDIDETTLSN+PYYA     FGA PYN T F+A+
Sbjct  99   FKVVIDQTIAYVDGLKLNGNGKDVWVFDIDETTLSNLPYYATH--GFGARPYNATSFDAY  156

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V EG APA+P + RLY  +L +GIKPVF+TG  E  R V + NL+  G+  W  L LK  
Sbjct  157  VLEGSAPALPETKRLYYKLLKVGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMNLTLKQH  216

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               GSA+ YKS +R +L +AGY IVGN+GDQWSD+LG   G RTFK+PDP+YYIA
Sbjct  217  GFKGSAISYKSAERKKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYIA  271



>ref|XP_008348489.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=274

 Score =   269 bits (688),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 174/235 (74%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRP++G+ G  VP + CLSWRLAVE  NI +WK VPA+C +YVGHYMLG QYR+D 
Sbjct  42   QIHLLRPKSGAGGSSVPGLSCLSWRLAVEVGNIINWKTVPAQCGSYVGHYMLGHQYRKDS  101

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + + + A  YA  + L  DG ++WVFDIDETTLSN+PY+AR    FG   +N T FN WV
Sbjct  102  KLITDVAWLYAKSLNLKKDGKNVWVFDIDETTLSNLPYFARQ--GFGTKAFNITAFNEWV  159

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EG+APA+P SL+LY  +L LG+K VF+TG +E  R V I NL+  GY  WEKL+LKG  
Sbjct  160  LEGRAPALPESLQLYKKLLKLGVKVVFITGREEDQRSVTITNLRNVGYRTWEKLVLKGSA  219

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G ++ E+KS +R +L  +G+RI+GNMGDQWSD+LG  AG+RTFK+PDP+YY++
Sbjct  220  YSGKTSYEFKSAERAKLEKSGFRIIGNMGDQWSDILGASAGNRTFKLPDPLYYVS  274



>ref|XP_008358084.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=261

 Score =   269 bits (687),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 174/235 (74%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRP++G+ G  VP + CLSWRLAVE  NI +WK VPA+C +YVGHYMLG QYR+D 
Sbjct  29   QIHLLRPKSGAGGSSVPGLSCLSWRLAVEVGNIINWKTVPAQCGSYVGHYMLGHQYRKDS  88

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + + + A  YA  + L  DG ++WVFDIDETTLSN+PY+AR    FG   +N T FN WV
Sbjct  89   KLITDVAWLYAKSLNLKKDGKNVWVFDIDETTLSNLPYFARQ--GFGTKAFNITAFNEWV  146

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EG+APA+P SL+LY  +L LG+K VF+TG +E  R V I NL+  GY  WEKL+LKG  
Sbjct  147  LEGRAPALPESLQLYKKLLKLGVKVVFITGREEDQRSVTITNLRNVGYRTWEKLVLKGSA  206

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G ++ E+KS +R +L  +G+RI+GNMGDQWSD+LG  AG+RTFK+PDP+YY++
Sbjct  207  YSGKTSYEFKSAERAKLEKSGFRIIGNMGDQWSDILGASAGNRTFKLPDPLYYVS  261



>gb|AGG23547.1| acid phosphatase-like protein 1 [Malus hupehensis]
Length=261

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 172/235 (73%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRP++G+ G  VP + CLSWRL VE  NI +WK VPA+CE+YVGHYMLG QYR+D 
Sbjct  29   QIHLLRPKSGAGGSSVPGVSCLSWRLGVEVRNIINWKTVPAQCESYVGHYMLGHQYRKDS  88

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V + A  YA  + L+ DG ++WVFDIDETTLSN+PYYAR    FG   YN T FN WV
Sbjct  89   KAVTDVAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYYARH--GFGTEVYNSTSFNEWV  146

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EG APA+P SL+LY  +L LG+K VF+TG  E  R V I NL+  GY+ WEKL+LKG  
Sbjct  147  LEGTAPALPESLQLYKKLLKLGVKVVFITGRGEDQRSVTITNLKNVGYHTWEKLVLKGSA  206

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G ++  YKS +R +L  +G+RI+GN+GDQWSD+LG   G+RTFK+PDP+YYI+
Sbjct  207  YSGKTSYVYKSAEREKLEKSGFRIIGNIGDQWSDILGTSVGNRTFKLPDPLYYIS  261



>gb|EMS67586.1| Acid phosphatase 1 [Triticum urartu]
Length=280

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 164/235 (70%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS G    +  + C SWRL VE +N+RDWK VP  CE YVGHYMLG  YR D
Sbjct  48   IHALRPMLGSGGQLGSRAGVACDSWRLGVEAHNVRDWKTVPTSCEGYVGHYMLGGHYRRD  107

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
             + V +EAI Y + + L+G+G ++WVFD+DETTLSN+PYYA     FGA PYN T F+ +
Sbjct  108  SKLVIDEAIFYVDSLKLAGNGKEVWVFDVDETTLSNLPYYATH--GFGATPYNWTSFHEY  165

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
             ++  APA+P + RLYN +LS+GIKPV LTG +EA R   I NL+  G+     ++LK  
Sbjct  166  AAQASAPALPETKRLYNKLLSVGIKPVILTGRREAQRTATITNLRRQGFSGSMAVLLKPA  225

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               GSAV +KSG+R +L++AGY IVGN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  226  EFKGSAVTFKSGERQKLLDAGYVIVGNIGDQWSDILGTPEGARTFKLPDPMYYIG  280



>gb|EMT19717.1| Acid phosphatase 1 [Aegilops tauschii]
Length=278

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 162/235 (69%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS G    +  + C SWRL VE +N+RDWK VPA CE YVGHYMLG  YR D
Sbjct  46   IHALRPMLGSGGQLGSRAGVACDSWRLGVEAHNVRDWKTVPASCEGYVGHYMLGGHYRRD  105

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
             + V ++AI Y + + L+G+G ++WVFD+DETTLSN+PYYA     FGA PYN T F  +
Sbjct  106  SKLVIDQAISYVDSLKLAGNGKEVWVFDVDETTLSNLPYYATH--GFGATPYNWTSFQEY  163

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
              +  APA+P + RL++ +LS+GIKPV LTG +E  R   + NL+  G+  W  ++LK  
Sbjct  164  ARQASAPALPETKRLFDKLLSVGIKPVILTGRREVQRTATVTNLRRQGFSGWMTVLLKPA  223

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               GS V +KSG+R +L++AGY IVGN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  224  EFKGSGVTFKSGERQKLLDAGYVIVGNIGDQWSDILGTPEGARTFKLPDPMYYIG  278



>gb|AFK40440.1| unknown [Lotus japonicus]
Length=261

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 161/232 (69%), Gaps = 4/232 (2%)
 Frame = +1

Query  184  LRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVA  363
            LR +TGS GH +P + C SW L VE +NI +WK +P ECE YVG+YM+GQQYR D + V 
Sbjct  32   LRMKTGSGGHYIPDVSCASWTLGVEAHNIINWKTIPEECEGYVGNYMIGQQYRSDSKTVC  91

Query  364  EEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGK  543
            ++A  YA  + L  DG +IWVFDIDET+LSN+PYYA     FG   YNDT FN WV    
Sbjct  92   KQAYFYARSLNLPRDGKNIWVFDIDETSLSNLPYYAEH--GFGLELYNDTAFNLWVDRAA  149

Query  544  APAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILK--GVNDT  717
            AP +P SL+LYN +LSLGIK  FLTG   + ++    NL+ AG+Y WEKLILK       
Sbjct  150  APVLPESLKLYNKLLSLGIKIAFLTGRPLSQKDNTAKNLKLAGFYTWEKLILKEPSTYSG  209

Query  718  GSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +AV YKS +R +L   GYRI+GN+GDQWSD+LG   G+RTFK+PDPMYYI+
Sbjct  210  KTAVTYKSAERKKLEEEGYRIIGNIGDQWSDILGTTTGNRTFKLPDPMYYIS  261



>gb|EMS54507.1| Acid phosphatase 1 [Triticum urartu]
Length=280

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 162/235 (69%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS+G    +  + C SWRL VE  N+RDWK VPA CE YVGHYMLG  +R D
Sbjct  48   IHALRPLLGSSGELGSRGGVPCDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGSHFRRD  107

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
             + V ++AI Y + + L G+G ++WVFDIDETTLSN+PYYA     FGA PYN T F+A+
Sbjct  108  SKVVIDQAIAYVDSLKLDGNGKEVWVFDIDETTLSNLPYYATH--GFGARPYNATSFDAY  165

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V EG APA+P S RLY  +L +GIKPVF+TG  E  R + +ANL+  G   W  L LK  
Sbjct  166  VLEGTAPALPESKRLYYKLLKVGIKPVFITGRTEDKRAITVANLRSQGISGWMNLTLKQP  225

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               GSA+ YKS +R +L +AGY IVGN+GDQWSDLLG   G RTFK+PDP+YYI 
Sbjct  226  GFHGSAISYKSAQRKKLQDAGYVIVGNIGDQWSDLLGAPEGARTFKLPDPLYYIG  280



>gb|AFK46217.1| unknown [Medicago truncatula]
Length=264

 Score =   266 bits (680),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 165/236 (70%), Gaps = 5/236 (2%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +I  LR ++GS GH + ++ C SWRL +E +NI +WK +P ECE Y+G+YMLG QYR D 
Sbjct  32   QIFPLRVKSGSGGHYIEEVSCASWRLGIEAHNIINWKTIPKECEKYIGNYMLGDQYRADS  91

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V  E   YA  + ++  G DIWVFDIDET+LSN+PYYA+    FG  PYNDT FN WV
Sbjct  92   KAVNREGYFYAKTLNIT-TGKDIWVFDIDETSLSNLPYYAKH--GFGVEPYNDTLFNQWV  148

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKG--  705
              G APA+P S +LYN +LSLGIK  FLTG     +E+   NL+ AG+  WEKLILK   
Sbjct  149  DLGTAPALPESKKLYNKLLSLGIKIAFLTGRPLKQKEITAKNLRRAGFKKWEKLILKNTT  208

Query  706  VNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +    +AV YKS +R +L   GYRIVGN+GDQWSD+LG + G+RTFK+PDP+YYIA
Sbjct  209  IYHGKTAVTYKSSERKKLEEGGYRIVGNIGDQWSDILGTNTGERTFKLPDPLYYIA  264



>ref|XP_003627057.1| Acid phosphatase [Medicago truncatula]
 gb|AET01533.1| stem 28 kDa glycoprotein [Medicago truncatula]
Length=264

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 165/236 (70%), Gaps = 5/236 (2%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +I  LR ++GS GH + ++ C SWRL +E +NI +WK +P ECE Y+G+YMLG QYR D 
Sbjct  32   QIFPLRVKSGSGGHYIEEVSCASWRLGIEAHNIINWKTIPKECEKYIGNYMLGDQYRADS  91

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V  E   YA  + ++  G DIWVFDIDET+LSN+PYYA+    FG  PYNDT FN WV
Sbjct  92   KAVNREGYFYAKTLNIT-TGKDIWVFDIDETSLSNLPYYAKH--GFGVEPYNDTLFNQWV  148

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKG--  705
              G APA+P S +LYN +LSLGIK  FLTG     +E+   NL+ AG+  WEKLILK   
Sbjct  149  DLGTAPALPESKKLYNKLLSLGIKIAFLTGRPLKQKEITAKNLRRAGFKKWEKLILKNTT  208

Query  706  VNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +    +AV YKS +R +L   GYRIVGN+GDQWSD+LG + G+RTFK+PDP+YYIA
Sbjct  209  IYHGKTAVTYKSSERKKLEEEGYRIVGNIGDQWSDILGTNTGERTFKLPDPLYYIA  264



>emb|CBI36038.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 171/234 (73%), Gaps = 3/234 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            EIH LRPQ GS+GH VP + CLSWRL VE +NI +W  VP  CE+YVGHYMLG QYR+D 
Sbjct  271  EIHLLRPQLGSSGHHVPGLSCLSWRLGVEAHNIIEWSTVPQACESYVGHYMLGHQYRKDS  330

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              V  EA+ YA  + L+ DG DIWVFD+DET+ SN+PYYA+    F    YN T+FN WV
Sbjct  331  RAVVYEALTYAQSLKLAVDGKDIWVFDVDETSPSNLPYYAKH--GFRVEAYNSTQFNNWV  388

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+P SL+LY  +LSLGIK VF+TG  EA R V  ANL+  GY+ WEKLILKG +
Sbjct  389  YEGKAPALPESLKLYKKLLSLGIKAVFITGRPEAQRNVTAANLRNVGYHTWEKLILKG-S  447

Query  712  DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
              G+ V YKS +R +L  +GYRI+ N+GDQWSD+LG +  +RTFK+ +PMYYI+
Sbjct  448  SAGTIVVYKSNERKKLKKSGYRIIDNIGDQWSDILGTNTENRTFKLSNPMYYIS  501


 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +1

Query  322  MLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVP  501
            MLG QYR+D   V  EAI +A  + L+GDG DIWVFDIDET+LSN+PY+A+    FG   
Sbjct  1    MLGDQYRKDSGVVVYEAITHAQSLKLAGDGKDIWVFDIDETSLSNLPYFAKH--GFGVEA  58

Query  502  YNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYN  681
            YN T+FN W+ EGKAP +P SL+LY  + SLGIKPVF+TG  EA R V  ANLQ AGY+ 
Sbjct  59   YNSTQFNNWIYEGKAPPLPESLKLYKKLQSLGIKPVFITGRPEAQRNVTAANLQNAGYHT  118

Query  682  WEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPM  861
            WEKLILKG + TG+AV YKS +R +L  +GYRIVGN+GDQWSD+LG + G+RTFK+PDP+
Sbjct  119  WEKLILKGSSVTGTAVAYKSNERKKLEQSGYRIVGNIGDQWSDILGTNVGNRTFKLPDPI  178



>ref|XP_003627058.1| Stem 28 kDa glycoprotein [Medicago truncatula]
 gb|AET01534.1| stem 28 kDa glycoprotein [Medicago truncatula]
 gb|AFK40192.1| unknown [Medicago truncatula]
Length=261

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 166/235 (71%), Gaps = 5/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            I  LR +TG  G  +P++ C SWR+AVE  NI +WK VP ECE YVG+YMLG QYR D +
Sbjct  30   IFPLRMKTGPGGKYIPEVSCASWRVAVEARNIINWKTVPQECEEYVGNYMLGDQYRADSK  89

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
            +V  E   YA  + L  DG D+WVFDIDETTLSN+PYYA     FG  PYN+T FNAWV 
Sbjct  90   FVNREGFFYARTLNLK-DGRDLWVFDIDETTLSNLPYYATH--GFGVNPYNETLFNAWVD  146

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN-  711
            EG APA+P + +LYN +++LG+K  FLTG     +++   NL+EAGY+ +EKLILK    
Sbjct  147  EGAAPALPETQKLYNKLVNLGVKIAFLTGRPLKQKDITAKNLKEAGYHTYEKLILKDTEL  206

Query  712  -DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
                +AV+YKS +R +L   G+RI+GN GDQWSD+LG + G+RTFK+PDP+YYIA
Sbjct  207  YHGKTAVQYKSSERKKLEEEGWRIIGNSGDQWSDILGTNTGERTFKLPDPLYYIA  261



>ref|XP_004960898.1| PREDICTED: stem 31 kDa glycoprotein-like isoform X2 [Setaria 
italica]
Length=262

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 153/213 (72%), Gaps = 2/213 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRL VETNNIR W  +PAEC  YV  YM G  +R+DC  V  EA  YA G+ L+GDG
Sbjct  51   CPSWRLGVETNNIRGWYSIPAECRGYVRDYMFGDLFRQDCAVVVREAAAYAEGLELAGDG  110

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
              +WVFDID+T LSN+PYYA  D  FGA PYN T F  +V++  APA+P  L+LY  +L+
Sbjct  111  EAVWVFDIDDTALSNLPYYA--DTGFGAQPYNATYFEEYVAKATAPALPEVLKLYEKLLA  168

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAG  771
            LGIK  F+TG  E  RE  + NL+ AGY+ WEKL+LK  +   S V YKSG+R +LV+AG
Sbjct  169  LGIKVAFITGRHEYEREPTVKNLRSAGYHTWEKLVLKPSSLGSSVVPYKSGERQKLVDAG  228

Query  772  YRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            YRIVGN+GDQWSDL+G   GDRTFKVPDPMYY+
Sbjct  229  YRIVGNIGDQWSDLVGAPEGDRTFKVPDPMYYV  261



>ref|XP_006356133.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=185

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 151/185 (82%), Gaps = 1/185 (1%)
 Frame = +1

Query  322  MLGQ-QYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAV  498
            MLG+ QYR DCEYVA++AI+YA G+ L+ DG D+WVFD+D+TTLSN+PYYARSDV FG +
Sbjct  1    MLGKLQYRRDCEYVAKQAIEYAKGLKLNRDGKDVWVFDVDDTTLSNLPYYARSDVRFGTI  60

Query  499  PYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYY  678
              NDTKF  W++EGK P IP+ L +Y T+LSLGIKPV +TG  E FR+ RIANL++AGY 
Sbjct  61   ALNDTKFIEWLAEGKLPVIPSILGVYKTLLSLGIKPVIITGAPENFRQSRIANLKKAGYS  120

Query  679  NWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDP  858
            NW KL+L+G N++ SAVEYKS KR ELV AGYRIVGN+GDQW+DL+G   G RTFKVP+P
Sbjct  121  NWLKLVLRGGNNSKSAVEYKSSKRMELVKAGYRIVGNIGDQWTDLIGEIVGARTFKVPNP  180

Query  859  MYYIA  873
            MYY+ 
Sbjct  181  MYYVG  185



>ref|NP_001148296.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACG30436.1| stem 28 kDa glycoprotein precursor [Zea mays]
Length=272

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 161/235 (69%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP   S G   R  ++ C SWR AVETN +RDW  VPA CE YVG+YMLG  YR D
Sbjct  40   IHMLRPLLHSGGDLGRRGRVPCDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSD  99

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               VA EAI YA G+ L+G G ++WVFD+DETTLSN+PYYA+    FG  PYN + F A+
Sbjct  100  SRAVANEAIAYAEGLNLTGQGKEVWVFDVDETTLSNLPYYAKH--GFGVEPYNWSTFGAY  157

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V E  AP +P + RLY  + +LGIKPV LTG +E  RE    NL  AGY  + KL+LK  
Sbjct  158  VKEANAPVLPETQRLYKRLQALGIKPVILTGRREDKREATANNLAAAGYTGYLKLLLKPQ  217

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            N   S++E+KSG+R +L +AGY IVGN+GDQW+DLLG   G RTFK+PDPMYYI 
Sbjct  218  NVKVSSIEFKSGERKKLQDAGYVIVGNIGDQWTDLLGEPEGGRTFKLPDPMYYIG  272



>gb|AFW77368.1| stem glycoprotein [Zea mays]
Length=272

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 161/235 (69%), Gaps = 4/235 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP   S G   R  ++ C SWR AVETN +RDW  VPA CE YVG+YMLG  YR D
Sbjct  40   IHMLRPLLHSGGDLGRRGRVPCDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSD  99

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               VA EAI YA G+ L+G G ++WVFD+DETTLSN+PYYA+    FG  PYN + F A+
Sbjct  100  SRAVANEAIAYAEGLNLTGQGKEVWVFDVDETTLSNLPYYAKH--GFGVEPYNWSTFGAY  157

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V E  AP +P + RLY  + +LGIKPV LTG +E  RE    NL  AGY  + KL+LK  
Sbjct  158  VKEANAPVLPETQRLYKRLQALGIKPVILTGRREDKREATANNLAAAGYTGYLKLLLKPQ  217

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            N   S++E+KSG+R +L +AGY IVGN+GDQW+DLLG   G RTFK+PDPMYYI 
Sbjct  218  NVKVSSIEFKSGERKKLQDAGYVIVGNIGDQWTDLLGEPEGGRTFKLPDPMYYIG  272



>ref|XP_002440742.1| hypothetical protein SORBIDRAFT_09g005940 [Sorghum bicolor]
 gb|EES19172.1| hypothetical protein SORBIDRAFT_09g005940 [Sorghum bicolor]
Length=260

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 164/233 (70%), Gaps = 2/233 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            ++H L+  T +AG       C SWRL VETNNIRDW  +PAEC +YV  YM G  +R+DC
Sbjct  29   DMHHLQMVTSTAGTARAVASCASWRLGVETNNIRDWYSIPAECRSYVRDYMYGDLFRQDC  88

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
              VA EA  YA G+ L+GDG ++WVFD+D+TTL+N+PYYA  D  FGA PYN T F+ +V
Sbjct  89   AVVAGEAAAYAEGLELAGDGEEVWVFDVDDTTLTNLPYYA--DTGFGAEPYNATYFDEYV  146

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
            +   APA+P  L LY  +LSLGIK VF+TG  +      + NL+ AGY+ WEKL+LK  +
Sbjct  147  ANATAPALPEVLELYEKLLSLGIKVVFITGRHDDEEAATVKNLRSAGYHTWEKLVLKPSS  206

Query  712  DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               S V YKSG+R +LV+AGYRIVGNMGDQWSDL G   GDRTFKVPDPMYY+
Sbjct  207  LGSSVVPYKSGERQKLVDAGYRIVGNMGDQWSDLTGAPEGDRTFKVPDPMYYV  259



>ref|XP_009344485.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=274

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 168/235 (71%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
             IH LR ++G+ G  VP + CLSWRL VE  NI +WK VPA+CE+YVGHYMLG QYR+D 
Sbjct  42   HIHLLRSKSGAGGSSVPGVSCLSWRLGVEVRNIINWKTVPAQCESYVGHYMLGHQYRKDS  101

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V + A  YA  + L+ DG ++WVFDIDETTLSN+PYYAR    FG   YN T F+ WV
Sbjct  102  KAVTDVAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYYARH--GFGTEVYNSTSFDEWV  159

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EG APA+P SL+LY  +L LG+K VF+TG  E  R V   NL+  GY  WEKL+LKG  
Sbjct  160  LEGTAPALPESLQLYKKLLKLGVKVVFITGRGEDRRSVTTTNLKNVGYRTWEKLVLKGSA  219

Query  712  DTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +G ++  YKS +R +L  +G+RI+GN+GDQWSD+LG   G+RTFK+PDP+YYI+
Sbjct  220  YSGKTSYVYKSAEREKLEKSGFRIIGNIGDQWSDILGTSVGNRTFKLPDPLYYIS  274



>gb|EYU36713.1| hypothetical protein MIMGU_mgv1a012835mg [Erythranthe guttata]
Length=238

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = +1

Query  229  DCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGD  408
            +CLSWRL+VETNN+R+WKLVP EC  +V  YM   QYR+DC+ VA+ A+++A  V L+GD
Sbjct  22   NCLSWRLSVETNNLRNWKLVPNECATHVKVYMERGQYRQDCDIVADTAVEFAKTVKLAGD  81

Query  409  GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVL  588
            G +IWVFDIDET LSN+P+YAR DVA+GA  YN T    W+ EGKAPA P+ L+LY  ++
Sbjct  82   GKEIWVFDIDETALSNLPFYARPDVAYGAKSYNWTGLGEWIKEGKAPANPSMLKLYKELI  141

Query  589  SLGIKPVFLTG-TKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVE-YKSGKRTELV  762
            +L  K VFLTG  +E F + RI+NL+ AGY  WEKLI K   + G+  + +KS KR EL 
Sbjct  142  ALKYKIVFLTGANEERFMKPRISNLKNAGYTTWEKLIFKPGAEKGTPTKIFKSKKRKELE  201

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             AGYRIVGN+GDQW DL+G   G RTFK+P+PMYY+A
Sbjct  202  TAGYRIVGNVGDQWGDLVGDYVGMRTFKLPNPMYYVA  238



>ref|XP_010088387.1| Stem 28 kDa glycoprotein [Morus notabilis]
 gb|EXB34861.1| Stem 28 kDa glycoprotein [Morus notabilis]
Length=259

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 165/234 (71%), Gaps = 4/234 (2%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            I+ LRP+ GS G     + CLSWR  VETNNI DW  +P +CE YVG+YMLG+QYR+D E
Sbjct  29   IYLLRPRYGSGGGGN-GVSCLSWRFGVETNNIIDWSTIPEKCELYVGNYMLGEQYRKDSE  87

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V +EA  YA  + LS DG D+W+FDIDET+LSN+PYYAR    FG  P+N T F  W+ 
Sbjct  88   VVIKEAYLYATSLNLSKDGKDVWIFDIDETSLSNLPYYARH--GFGVEPFNLTSFTEWIL  145

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
               APA+P +L+LY +++SLG K VFL+G  E  R     NL   GY  WEK++L+  +D
Sbjct  146  TEDAPALPETLKLYKSLISLGFKIVFLSGRYEKTRSATERNLIYVGYKAWEKVLLRKDSD  205

Query  715  -TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             + S++EYKS +R +LV  GY IVGN+GDQWSDLLG D G+RTFK+PDPMYYI+
Sbjct  206  KSASSLEYKSAQRKQLVKDGYSIVGNIGDQWSDLLGTDPGNRTFKLPDPMYYIS  259



>gb|AFW77369.1| hypothetical protein ZEAMMB73_279889 [Zea mays]
Length=276

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 161/239 (67%), Gaps = 8/239 (3%)
 Frame = +1

Query  175  IHRLRPQTGSAGH--RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP   S G   R  ++ C SWR AVETN +RDW  VPA CE YVG+YMLG  YR D
Sbjct  40   IHMLRPLLHSGGDLGRRGRVPCDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSD  99

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFG----AVPYNDTK  516
               VA EAI YA G+ L+G G ++WVFD+DETTLSN+PYYA+    FG      PYN + 
Sbjct  100  SRAVANEAIAYAEGLNLTGQGKEVWVFDVDETTLSNLPYYAKH--GFGERRRVEPYNWST  157

Query  517  FNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLI  696
            F A+V E  AP +P + RLY  + +LGIKPV LTG +E  RE    NL  AGY  + KL+
Sbjct  158  FGAYVKEANAPVLPETQRLYKRLQALGIKPVILTGRREDKREATANNLAAAGYTGYLKLL  217

Query  697  LKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            LK  N   S++E+KSG+R +L +AGY IVGN+GDQW+DLLG   G RTFK+PDPMYYI 
Sbjct  218  LKPQNVKVSSIEFKSGERKKLQDAGYVIVGNIGDQWTDLLGEPEGGRTFKLPDPMYYIG  276



>ref|XP_006654134.1| PREDICTED: stem 28 kDa glycoprotein-like [Oryza brachyantha]
Length=245

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 158/222 (71%), Gaps = 8/222 (4%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C SWRL VE +N+ +WK VPA+CE YVGHY+LG  YR D   V +EAI YA  + L+G
Sbjct  26   VACDSWRLGVEAHNVINWKTVPAKCEGYVGHYLLGGHYRRDSAVVVDEAIAYAETLQLAG  85

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            +G ++W+FDIDET+LSN+PYYA+    FG  PYNDT F  +V+EG APA+P + RLY  +
Sbjct  86   NGKEVWIFDIDETSLSNLPYYAKH--GFGVTPYNDTSFREYVAEGSAPALPETRRLYRRL  143

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS------AVEYKSGK  747
            L +G+KPVFLTG  E  R V +ANL++ GY  WEKL+LK      +      AV YKSG+
Sbjct  144  LEIGVKPVFLTGRTEDQRAVTVANLRKQGYSGWEKLLLKPAVHGAAGGLHAPAVAYKSGQ  203

Query  748  RTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            R +L ++G+ IVGN+GDQWSD+LG   G RTFK+PDP+YYI 
Sbjct  204  RQKLKDSGFIIVGNIGDQWSDILGEPEGARTFKLPDPLYYIG  245



>ref|XP_003530059.1| PREDICTED: stem 28 kDa glycoprotein-like [Glycine max]
Length=264

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 163/236 (69%), Gaps = 6/236 (3%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +I  LR +TG  GH +P++ C SWRL VE +N+ DW+ +P +CE Y+G+YMLG QYR D 
Sbjct  33   QIFPLRMKTGPGGHYIPEVSCKSWRLGVEAHNVIDWRTIPQDCEGYIGNYMLGHQYRSDS  92

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V  EA  YA  + ++   T  WVFD+DETTLSN+PY+A  D  FG   YN T FN WV
Sbjct  93   KTVCREAYFYAKTINITAKTT--WVFDVDETTLSNLPYFA--DHGFGVELYNATAFNEWV  148

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
              G+APA+P SL+LYN +LSLGIK VF+TG     + V   NL+ AGYY WEKLI K  +
Sbjct  149  DLGEAPALPESLKLYNKLLSLGIKIVFITGRPLYQQAVTATNLKLAGYYKWEKLITKDTD  208

Query  712  --DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
              +  +AV YKS +R +L   GY I+GN+GDQWSD+LG + G RTFK+PDPMYYI+
Sbjct  209  KYNGKTAVTYKSTERQKLEENGYNIIGNIGDQWSDILGTNTGLRTFKLPDPMYYIS  264



>ref|XP_009797387.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=239

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 167/222 (75%), Gaps = 6/222 (3%)
 Frame = +1

Query  217  VPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVI  396
            VPQI+CLSWR+AVETNNIRDWK VP +C++YV  YM  QQYR+DC  V   AI+YA  + 
Sbjct  20   VPQINCLSWRMAVETNNIRDWKTVPVQCKSYVSEYMTSQQYRDDCNAVVIAAIQYAKTLN  79

Query  397  LSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLY  576
            +S +G D+WVF+IDETTLSN+PYY+R +V FGA   +  K+ +W+ EGK+PA+P +L LY
Sbjct  80   VSKEGKDLWVFNIDETTLSNVPYYSRPEVGFGATKSSGKKYESWIKEGKSPAVPGALLLY  139

Query  577  NTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVE----YKSG  744
             T+L LGIKP+F+T TKE FR++RIANL++AGY++W K I KG ND+    E    +K+ 
Sbjct  140  KTLLDLGIKPIFITDTKEEFRQLRIANLKKAGYHSWFKFICKGKNDSELYSEHKGNWKTQ  199

Query  745  KRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            KR ELV AGYR+VGN+G  W D++  D   RTFK+P+PMYY 
Sbjct  200  KRAELVKAGYRLVGNLGG-WDDII-VDFLLRTFKMPNPMYYF  239



>gb|EAY96842.1| hypothetical protein OsI_18762 [Oryza sativa Indica Group]
Length=280

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 163/240 (68%), Gaps = 9/240 (4%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS G    +  + C SWRL VE +N+  W+ VPA CE YVGHYMLG  YR D
Sbjct  43   IHALRPLLGSGGQLAARAGVACDSWRLGVEAHNVIGWRTVPARCEGYVGHYMLGGHYRRD  102

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               V +EAI YA  + L+G+G +IWVFDIDET+LSN+PYYA     FGA  YNDT F  +
Sbjct  103  SAVVVDEAIAYAESLQLAGNGKEIWVFDIDETSLSNLPYYANH--GFGATLYNDTSFREY  160

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
            V+EG APA+P + RLY  +L LG+KPVFLTG  E  R + + NL+  GY  W +L+LK V
Sbjct  161  VAEGSAPALPETRRLYRRLLQLGVKPVFLTGRTEDQRNITVTNLRRQGYSGWMELLLKPV  220

Query  709  NDT-----GSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
                    GSAV YKSG+R +L +AG+ IVGN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  221  VHAAGELQGSAVAYKSGERQKLEDAGFTIVGNIGDQWSDILGTPEGARTFKLPDPMYYIG  280



>gb|KHN39260.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=226

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 159/229 (69%), Gaps = 6/229 (3%)
 Frame = +1

Query  193  QTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEA  372
            +TG  GH +P++ C SWRL VE +N+ DW+ +P +CE Y+G+YMLG QYR D + V  EA
Sbjct  2    KTGPGGHYIPEVSCKSWRLGVEAHNVIDWRTIPQDCEGYIGNYMLGHQYRSDSKTVCREA  61

Query  373  IKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPA  552
              YA  + ++   T  WVFD+DETTLSN+PY+A  D  FG   YN T FN WV  G+APA
Sbjct  62   YFYAKTINITAKTT--WVFDVDETTLSNLPYFA--DHGFGVELYNATAFNEWVDLGEAPA  117

Query  553  IPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN--DTGSA  726
            +P SL+LYN +LSLGIK VF+TG     + V   NL+ AGYY WEKLI K  +  +  +A
Sbjct  118  LPESLKLYNKLLSLGIKIVFITGRPLYQQAVTATNLKLAGYYKWEKLITKDTDKYNGKTA  177

Query  727  VEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            V YKS +R +L   GY I+GN+GDQWSD+LG + G RTFK+PDPMYYI+
Sbjct  178  VTYKSTERQKLEENGYNIIGNIGDQWSDILGTNTGHRTFKLPDPMYYIS  226



>ref|XP_009625320.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=237

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 162/220 (74%), Gaps = 6/220 (3%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            +I+CLSWR+AVETNNIRDWK VP +C++YV  YM  QQYR+DC  V   AI+YA  + +S
Sbjct  20   KINCLSWRIAVETNNIRDWKTVPTQCKSYVSEYMTSQQYRDDCNAVVIAAIEYAKSLNIS  79

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             +G D+WVF+IDETTLSN+PYY+R  V FGA   +  KF +W+ EGK+PA+P  L LY  
Sbjct  80   KEGKDLWVFNIDETTLSNVPYYSRPQVGFGATKSSGKKFESWIKEGKSPAVPGVLLLYKI  139

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVE----YKSGKR  750
            +L LGIKP+F+T TKE FR++RIANL++AGY++W K I KG ND+    E    +K+ KR
Sbjct  140  LLDLGIKPIFITDTKEEFRQLRIANLKKAGYHSWFKFICKGKNDSELYTEHKGNWKTQKR  199

Query  751  TELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             ELV AGYR+VGN+G  W D++  D   RTFK+P+PMYY 
Sbjct  200  AELVKAGYRLVGNLGG-WDDII-VDFLLRTFKMPNPMYYF  237



>gb|EMT02057.1| Stem 28 kDa glycoprotein [Aegilops tauschii]
Length=261

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 156/233 (67%), Gaps = 13/233 (6%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP  GS  H    + C SW L VE +N+RDWK VPA CE           +R D +
Sbjct  42   IHALRPLLGSGKH--AGVACDSWVLGVEAHNVRDWKTVPASCEG---------PFRRDSK  90

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V ++A+ Y + + L+G+G ++WVFDIDETTLSN+PYYA+    FGA P+N T FNA+V 
Sbjct  91   VVVDQALAYVDSLKLTGNGKEVWVFDIDETTLSNLPYYAKH--GFGATPFNATSFNAYVR  148

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG APA+P + RLYN + S+GIKPVFLTG  E  R + + NL+  G   W  L+LK    
Sbjct  149  EGSAPALPETKRLYNKLRSVGIKPVFLTGRTEDQRAITVTNLRRQGISGWMNLLLKQPGF  208

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GSAV YKSG+R +L +AGY IVGN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  209  KGSAVTYKSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  261



>ref|XP_007135625.1| hypothetical protein PHAVU_010G144600g [Phaseolus vulgaris]
 gb|ESW07619.1| hypothetical protein PHAVU_010G144600g [Phaseolus vulgaris]
Length=260

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 166/236 (70%), Gaps = 6/236 (3%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +I  LR +TGS GH +P++ C SWR+ VE +N+ +WK VPA+CE YVG+YMLG+QYR D 
Sbjct  29   QIFPLRMKTGSGGHYIPEVSCQSWRVGVEAHNVVEWKTVPADCEGYVGNYMLGKQYRSDS  88

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V  EA  YA    L+    DIWVFD+DETTLSN+PYYA     FG  PYN T  + WV
Sbjct  89   KTVCHEAFSYAK--TLNITSRDIWVFDVDETTLSNLPYYAHH--GFGVEPYNATTSDEWV  144

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILK--G  705
              G+APA+P SL+LY  +LSLGIK VFLTG     + V + NL+ AGY+ WEKLILK   
Sbjct  145  EVGEAPALPESLKLYKKLLSLGIKIVFLTGRPLNQKAVTVTNLKIAGYHKWEKLILKDTS  204

Query  706  VNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +    +AV YKS +R ++   GY+I+GN+GDQWSD+LG + G RTFK+PDPMYYI+
Sbjct  205  IYHGKTAVTYKSSERKKVEKEGYKIIGNIGDQWSDILGTNTGQRTFKLPDPMYYIS  260



>ref|XP_009607238.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=169

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +1

Query  397  LSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLY  576
            + GDG D+ VFDIDETTL N+PYYARSDVAFGA+P+N+ KFN WVSEGKAPAIPA+LRLY
Sbjct  11   IGGDGKDVCVFDIDETTLFNLPYYARSDVAFGAIPFNNAKFNEWVSEGKAPAIPATLRLY  70

Query  577  NTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTE  756
              VLSLGIKPVF+TGT    R+ RIANL++AGY +W KL+LKG ND+  +V +KS KRTE
Sbjct  71   KMVLSLGIKPVFITGTPRFTRKARIANLKKAGYTSWLKLVLKGKNDSPKSVVFKSSKRTE  130

Query  757  LVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            LV AGYRIVGN+GDQWSDL+G + G RTFKVPDPMYYI 
Sbjct  131  LVKAGYRIVGNIGDQWSDLIGDNVGSRTFKVPDPMYYIG  169



>gb|KHN05326.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=271

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 166/239 (69%), Gaps = 6/239 (3%)
 Frame = +1

Query  163  QVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYR  342
               +I  LR +TG  GH +P++ C SWRL VE +N+ DWK VP +CE Y+G+YMLG+QYR
Sbjct  37   HTYQIFPLRMKTGHGGHYIPEVSCQSWRLGVEAHNVIDWKTVPQDCEGYIGNYMLGEQYR  96

Query  343  EDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFN  522
             D + V ++A  YA  + ++      WVFDIDETTLSN+PYYA  D  FG   YN+T FN
Sbjct  97   SDSKIVNQQAYFYAKTLNITAKTA--WVFDIDETTLSNLPYYA--DHGFGVELYNETSFN  152

Query  523  AWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILK  702
             WV  G+APA+P SL+LY  +LSLGIK VF+TG     + V   NL+ AGY+ WEKLI K
Sbjct  153  KWVDLGEAPALPESLKLYKKLLSLGIKIVFITGRPLDQKAVTATNLKLAGYHTWEKLITK  212

Query  703  GVND--TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
              ++    +AV YKS +R +L   GY+I+GN+GDQWSDLLG + GDRTFK+PDPMYYI+
Sbjct  213  NTSEYHGKTAVTYKSTERKKLEEKGYKIIGNIGDQWSDLLGTNTGDRTFKLPDPMYYIS  271



>ref|XP_006853740.1| hypothetical protein AMTR_s00056p00177520 [Amborella trichopoda]
 gb|ERN15207.1| hypothetical protein AMTR_s00056p00177520 [Amborella trichopoda]
Length=287

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 152/215 (71%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWR AVETNN+R+WK VP +C+ YVG YM G +Y  D E V+ EA  +A  + + GDG
Sbjct  75   CDSWRFAVETNNLREWKKVPDKCQEYVGVYMTGDRYESDSEIVSGEAENFARNISILGDG  134

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+WVFDIDET LSN+PYYA +   FG+  +N+  FN WV + +APA+P SL+LYN +  
Sbjct  135  KDVWVFDIDETLLSNLPYYAEN--GFGSKDFNEDSFNEWVVKAEAPALPYSLKLYNELKK  192

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
            LG + + LTG +E+ R V   NL  AGY +WE+LIL+G  D+G  AV YKS KR E+   
Sbjct  193  LGFRVILLTGREESQRTVTAENLIAAGYDSWERLILRGAKDSGKPAVVYKSEKRMEIEGE  252

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI GN GDQWSDLLG   G+R+FK+P+PMYYI+
Sbjct  253  GYRIHGNSGDQWSDLLGFAIGNRSFKLPNPMYYIS  287



>ref|XP_010941067.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=271

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR A E NN+  WK VPA+C  YV  YM G+ YR D E VA+EA  YA  + L 
Sbjct  56   HLRCASWRFAGEANNLAPWKTVPADCGAYVKDYMTGKAYRFDLEMVADEAAAYARSISLV  115

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D WVFD+DET LSN+PYYA  D  +G   +N  +F+ WV +  APAI +SL+LY  
Sbjct  116  GDGMDAWVFDVDETLLSNLPYYA--DHGYGLEVFNSHEFDKWVDKAMAPAIQSSLKLYEE  173

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            +L LG K   LTG  E  + V + NL++ G+ +WEKLIL+GVND G  A  YKS KR+E+
Sbjct  174  ILRLGFKIFLLTGRSEGQKIVTVENLKKVGFQDWEKLILRGVNDHGKLATTYKSEKRSEI  233

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               GYRI+GN GDQWSDLLG   G+R+FK+P+PMYYI
Sbjct  234  TAEGYRILGNSGDQWSDLLGSSTGNRSFKLPNPMYYI  270



>ref|XP_010258799.1| PREDICTED: acid phosphatase 1 [Nelumbo nucifera]
Length=282

 Score =   241 bits (615),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 148/216 (69%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C SWR A ETNN+  WK +P+EC  YV  Y+ G+ Y  D E V++EAI YA  V L G
Sbjct  68   LQCTSWRFAAETNNLNPWKTIPSECAGYVKDYVTGRGYLVDLERVSKEAIAYARSVQLVG  127

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG D W+FDIDET LSN+PYYA  D  +G   ++  +F+ WV +  AP I +SL+LY  V
Sbjct  128  DGKDAWIFDIDETLLSNLPYYA--DHGYGLEVFDGREFDKWVEKAMAPVIESSLKLYEEV  185

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELV  762
            L LG K   LTG  E  R V I NL++AG+ NW+KLIL+ + D G SA  YKS +R+E+V
Sbjct  186  LELGFKVFLLTGRSERHRSVTIENLRDAGFQNWDKLILRNLGDNGKSATLYKSERRSEMV  245

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            N GYRI+GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  246  NEGYRILGNSGDQWSDLLGSSTSNRSFKLPNPMYYI  281



>ref|NP_001236180.1| acid phosphatase precursor [Glycine max]
 emb|CAA11075.1| acid phosphatase [Glycine max]
Length=264

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 166/241 (69%), Gaps = 8/241 (3%)
 Frame = +1

Query  163  QVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYR  342
               +I  LR +TG  GH +P++ C SWRL VE +N+ DWK VP +CE Y+G+YMLG+QYR
Sbjct  28   HTYQIFPLRMKTGHGGHYIPEVSCQSWRLGVEAHNVIDWKTVPQDCEGYIGNYMLGEQYR  87

Query  343  EDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFN  522
             D + V ++A  YA  + ++      WVFDIDETTLSN+PYYA  D  FG   YN+T FN
Sbjct  88   SDSKIVNQQAYFYAKTLNITAKTA--WVFDIDETTLSNLPYYA--DHGFGVELYNETSFN  143

Query  523  AWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIA--NLQEAGYYNWEKLI  696
             WV  G+APA+P SL+LY  +LSLGIK VF+TG     + V     NL+ AGY+ WEKLI
Sbjct  144  KWVDLGEAPALPESLKLYKKLLSLGIKIVFITGRPLDQKAVTATNLNLKLAGYHTWEKLI  203

Query  697  LKGVND--TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             K  ++    +AV YKS +R +L   GY+I+GN+GDQWSDLLG + GDRTFK+PDPMYYI
Sbjct  204  TKNTSEYHGKTAVTYKSTERKKLEEKGYKIIGNIGDQWSDLLGTNTGDRTFKLPDPMYYI  263

Query  871  A  873
            +
Sbjct  264  S  264



>ref|XP_008801792.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=270

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 157/242 (65%), Gaps = 8/242 (3%)
 Frame = +1

Query  148  PPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYML  327
            PP   Q+ +       T   G    Q+ C SWR A E NN+  WK VPA+C  YV  YM 
Sbjct  35   PPGDDQIFQT-----STSDVGKEEVQLRCASWRFAGEANNLAPWKTVPADCGAYVKDYMT  89

Query  328  GQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYN  507
            G+ YR D E VA+EA  YA  V L+GD  D WVFD+DET LSN+PYYA  D  +G   ++
Sbjct  90   GKAYRFDLEMVADEAAAYARSVSLAGDCMDAWVFDVDETLLSNLPYYA--DHGYGLEVFS  147

Query  508  DTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWE  687
              +F+ WV +  APAI +SL+LY  +L LG K   LTG  E  + V + NL++ G+ +W+
Sbjct  148  SHEFDKWVDKAMAPAIQSSLKLYEEILRLGFKIFLLTGRTEGQKIVTMENLKKVGFRDWK  207

Query  688  KLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMY  864
            +LIL+GVND G +A  YKS KR+E+V  GYRI+GN GDQWSDLLG   G+R+FK+P+PM+
Sbjct  208  QLILRGVNDHGRTATMYKSEKRSEIVANGYRILGNSGDQWSDLLGSSMGNRSFKLPNPMF  267

Query  865  YI  870
            YI
Sbjct  268  YI  269



>emb|CBI25273.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +1

Query  322  MLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVP  501
            MLG QYR+D   V  EAI YA  + L GDG D+WVFDIDETTLSN+PYYA +   FGA  
Sbjct  1    MLGHQYRQDSRVVVYEAIAYAESLKLGGDGKDVWVFDIDETTLSNLPYYAEN--GFGAEV  58

Query  502  YNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYN  681
            +N+T FN WV +G+APA+P SL+LYN ++SLGIK VFLTG  E  R V +ANL++ GY+ 
Sbjct  59   FNETSFNEWVMKGEAPALPESLKLYNKLVSLGIKVVFLTGKGEDERNVTVANLKKVGYHT  118

Query  682  WEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPM  861
            WEKLIL+  +D  +A+ YKS +R ++  +GY+IVGNMGDQWSD+LG + G+RTFK+PDPM
Sbjct  119  WEKLILRKSSDGSTALVYKSNQRKKVEESGYKIVGNMGDQWSDILGTNTGNRTFKLPDPM  178

Query  862  YYIA  873
            YYIA
Sbjct  179  YYIA  182



>ref|XP_009588519.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=258

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q++C SWR AVETNN+  WK +P EC +YV  Y+ G  Y+ D + V+ EA  YA  + L 
Sbjct  43   QLECTSWRFAVETNNLSPWKTIPEECADYVRQYINGGAYKLDIDRVSSEAGTYAESMKLG  102

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+WVFD+DET LSN+PYY++    +G   ++  KF+ WV +G APAI +SL+LY  
Sbjct  103  GDGKDVWVFDVDETLLSNLPYYSQH--GYGLEVFDSVKFDEWVEKGVAPAIGSSLKLYQD  160

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            V+ LG K   LTG  E  R V + NL  AG+ +W+KLIL+G  D G SA  YKS KR E+
Sbjct  161  VMRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATMYKSEKRDEM  220

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+RIVGN GDQWSDLLG  A  R+FK+P+PMYYI
Sbjct  221  VKEGFRIVGNSGDQWSDLLGSSASIRSFKLPNPMYYI  257



>ref|XP_006357920.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=251

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 150/217 (69%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q+ C SWR AVETNN+  WK +P EC +YV  Y++G  Y+ D + V+ EA +YA  V L 
Sbjct  36   QLKCTSWRFAVETNNLSPWKTIPQECADYVREYIVGPGYKMDIDRVSNEAGEYAKSVDLG  95

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D+WVFD+DET LSN+PYY  SD  +G   ++  +F+ WV +G APA+ +SL+LY  
Sbjct  96   DDGRDVWVFDVDETLLSNLPYY--SDHGYGLEVFDSVEFDKWVEKGTAPALGSSLKLYQE  153

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            VLSLG K   LTG  E  R V + NL  AG+++W KLIL+G +D G +A  +KS +R E+
Sbjct  154  VLSLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTFKSERRNEI  213

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+RIVGN GDQWSDLLG    +R+FK+P+P+YYI
Sbjct  214  VEEGFRIVGNSGDQWSDLLGSSMSNRSFKLPNPIYYI  250



>ref|XP_003620757.1| Acid phosphatase-like protein [Medicago truncatula]
 gb|AES76975.1| plant acid phosphatase [Medicago truncatula]
Length=252

 Score =   238 bits (606),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLAVETNN+  WK +PA C   V  YM+G++Y  DCE V + + ++  GV + GDG
Sbjct  40   CDSWRLAVETNNVGQWKQIPARCVESVAEYMIGEKYESDCEVVGKFSAEFVKGVTVGGDG  99

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSN+PYY   DV FG+  +N+T FN WV+   APA+PASL  Y  +  
Sbjct  100  RDAWVFDIDETLLSNVPYY--QDVGFGSKIFNETSFNDWVNLADAPALPASLSFYRKLQE  157

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG     LTG  E  R V  ANL  AGY NWE+LIL+G +D G SA  YKS KR EL++ 
Sbjct  158  LGFTIFLLTGRSEHQRNVTEANLLFAGYRNWERLILRGASDQGKSATSYKSEKRQELMSE  217

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI G+ GDQWSDL G     R+FK+P+PMY+I 
Sbjct  218  GYRIHGSSGDQWSDLWGYAVSTRSFKLPNPMYFIG  252



>ref|XP_010662272.1| PREDICTED: acid phosphatase 1 [Vitis vinifera]
Length=259

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q++C SWR  VE NN+  WK +P  C  YV  YM G+ Y  D E VA EA  YA  V LS
Sbjct  44   QLECTSWRFGVEANNLGPWKTIPVACAEYVKDYMTGRAYEIDLERVANEAAIYARTVELS  103

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D+WVFD+DET LSN+PYYA     +G   +++ +F  WV +  APAI +SL+LY  
Sbjct  104  ADGNDVWVFDVDETLLSNLPYYAEH--GYGLEVFDEMEFAKWVEKATAPAIGSSLKLYEV  161

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            V SLG K   LTG  E  R V + NL  AG+ NW+KLIL+G ND G  A  YKS KR+E+
Sbjct  162  VQSLGFKTFLLTGRSENQRSVTVENLINAGFQNWDKLILRGSNDHGKQATVYKSEKRSEM  221

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRIVGN GDQWSDLLG +   R+FK+P+PMYYI
Sbjct  222  VKEGYRIVGNSGDQWSDLLGSEMSLRSFKLPNPMYYI  258



>ref|XP_011101105.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=267

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/237 (49%), Positives = 152/237 (64%), Gaps = 3/237 (1%)
 Frame = +1

Query  166  VVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRE  345
            +VEI+  + +         Q+ C SWR+AVE NN+  W+ +P EC +YV  YM+G+ Y  
Sbjct  33   IVEINEAQLKEWPVEEEEVQLQCTSWRVAVEANNLSPWEKIPEECADYVKEYMIGKGYEL  92

Query  346  DCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNA  525
            D + V+ EA  +A  V LSGDG   W+FD+DET LSN+PYYA  D  FG   ++ TKF  
Sbjct  93   DLQRVSNEAKAFARSVYLSGDGKSAWIFDVDETLLSNLPYYA--DHGFGLEVFDSTKFGQ  150

Query  526  WVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKG  705
            WV  G APAI +SL LY  VLSLG K + LTG  E  R + + NL +AG+  W+KL+L+ 
Sbjct  151  WVEMGIAPAIESSLELYEEVLSLGFKVILLTGRSERHRSITVENLFQAGFREWDKLLLRS  210

Query  706  VND-TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
              D   +A  YKS KR ELV  GY+I+GN GDQWSDLLG     R+FK+P+PMYYI+
Sbjct  211  SEDHEKTATIYKSEKRNELVEQGYQILGNSGDQWSDLLGSSMSIRSFKLPNPMYYIS  267



>ref|XP_010098159.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXB74596.1| Acid phosphatase 1 [Morus notabilis]
Length=262

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 160/241 (66%), Gaps = 3/241 (1%)
 Frame = +1

Query  151  PYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLG  330
            P  +   ++H LR Q GS G       C SW+  VETNNI  WK VP +CE YV  YMLG
Sbjct  25   PLNKNFNKLHLLRRQ-GSFGGNSNGAWCSSWQYGVETNNIIGWKTVPEKCELYVARYMLG  83

Query  331  QQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYND  510
            ++Y ED + V +EA  YA    LS DG D+W+FD+D+T +SN+PYYA +   FG  PY+ 
Sbjct  84   ERYGEDSKVVTKEAYLYAQSHTLSDDGKDVWLFDVDDTAVSNLPYYATN--GFGVKPYDP  141

Query  511  TKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEK  690
              F+ W+    APA+P SL+LY  + +LG K +FLTG +E  R    +NL+ AGY+ WE 
Sbjct  142  ESFHQWILSEAAPALPKSLKLYKNLKTLGFKIIFLTGRRENERSAIESNLKVAGYHTWEL  201

Query  691  LILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            ++LK  + +G+  ++K+ +R  L +AGYRIVGN+GDQW+DLLG +AG RTFK+P+P+YY 
Sbjct  202  VLLKDDDYSGTTADFKAEQRKNLEDAGYRIVGNIGDQWTDLLGTNAGHRTFKLPNPLYYA  261

Query  871  A  873
            A
Sbjct  262  A  262



>gb|AFK34288.1| unknown [Medicago truncatula]
Length=252

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLAVETN++  WK +PA C   V  YM+G++Y  DCE V + + ++  GV + GDG
Sbjct  40   CDSWRLAVETNSVGQWKQIPARCVESVAEYMIGEKYESDCEVVGKFSAEFVKGVTVGGDG  99

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSN+PYY   DV FG+  +N+T FN WV+   APA+PASL  Y  +  
Sbjct  100  RDAWVFDIDETLLSNVPYY--QDVGFGSKIFNETSFNDWVNLADAPALPASLSFYRKLQE  157

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG     LTG  E  R V  ANL  AGY NWE+LIL+G +D G SA  YKS KR EL++ 
Sbjct  158  LGFTIFLLTGRSEHQRNVTEANLLFAGYRNWERLILRGASDQGKSATSYKSEKRQELMSE  217

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI G+ GDQWSDL G     R+FK+P+PMY+I 
Sbjct  218  GYRIHGSSGDQWSDLWGYAVSTRSFKLPNPMYFIG  252



>ref|XP_011076425.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=269

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 142/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR+AVE NN+  WK +P +C +YV  YM G  Y  D + V  EA  YA  V L+
Sbjct  54   HLQCTSWRVAVEANNLSPWKTIPEDCADYVKEYMTGNVYEFDLQRVYNEAGIYARSVNLN  113

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D W+FD+DET LSN+PYYA     +G   +N TKF+ WV  G APA+ +SL+LY  
Sbjct  114  GDGKDAWIFDVDETLLSNLPYYAEH--GYGLEMFNSTKFDQWVETGTAPAVESSLKLYEE  171

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            VLSLG K + LTG  E  R + + NL  AG+  W+KLIL+   D G +A  YKS KR EL
Sbjct  172  VLSLGFKVILLTGRSERHRGITVENLLRAGFREWDKLILRSSEDHGKTATVYKSDKRNEL  231

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  232  VEEGYRILGNSGDQWSDLLGSSMSKRSFKLPNPMYYI  268



>ref|XP_010433112.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=259

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 147/222 (66%), Gaps = 3/222 (1%)
 Frame = +1

Query  211  HRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANG  390
            H     +C SWRLA ETNN   WK+VP+ C N V +Y+ G Q+  D   VA  AI YA  
Sbjct  40   HSSIASNCESWRLASETNNAGSWKVVPSRCVNSVKNYITGGQFENDYNIVARYAIAYAKR  99

Query  391  VILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLR  570
            V L GDG D WVFDIDET LSN+ YY    + +G+ PY+DTKFN W  +GKAPA  ASL+
Sbjct  100  VKLGGDGKDAWVFDIDETLLSNLEYY--KALGYGSEPYDDTKFNEWAVQGKAPAFDASLK  157

Query  571  LYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGK  747
            LY  +  LG   + LTG  E+ R V   NL++AGY+ W +L+L+G ND G +A +YKS +
Sbjct  158  LYKALKRLGFTIILLTGRDESQRSVTAKNLRDAGYFGWNRLLLRGKNDQGKTATQYKSEQ  217

Query  748  RTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            R+++V  GY+I G+ GDQWSDL G     R+FKVP+PMYYIA
Sbjct  218  RSKVVKEGYKIHGSTGDQWSDLQGFAVAARSFKVPNPMYYIA  259



>ref|XP_009797620.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=263

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 146/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q+ C SWR AVETNN+  WK +P EC NYV  Y+ G  Y+ D + V++EA  YA    L 
Sbjct  48   QLQCTSWRFAVETNNLGPWKTIPEECGNYVRQYIEGGAYKMDIDRVSDEAGAYAKSRDLG  107

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D+WVFD+DET LSN+PYY  SD   G   ++  +F  WV +G APAI +SL+LY  
Sbjct  108  ADGKDVWVFDVDETLLSNLPYY--SDHGHGLEVFDSVEFEKWVEKGMAPAIGSSLKLYQD  165

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            VLSLG K   LTG  E  R + + NL  AG+ +W KLIL+G +D G +A  +KS +R E+
Sbjct  166  VLSLGFKVFLLTGRGERHRGITVENLMNAGFRDWHKLILRGSDDHGKTATTFKSERRNEM  225

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+RI+GN GDQWSDLLG  A +R+FK+P+PMYYI
Sbjct  226  VEEGFRILGNSGDQWSDLLGSSASNRSFKLPNPMYYI  262



>ref|XP_010532228.1| PREDICTED: acid phosphatase 1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010532229.1| PREDICTED: acid phosphatase 1-like isoform X2 [Tarenaya hassleriana]
Length=266

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 150/226 (66%), Gaps = 9/226 (4%)
 Frame = +1

Query  214  RVPQID------CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAI  375
            R+ ++D      C SWR A ETNN+  WK VPAEC +YV  Y++G+ Y  D E V++EA 
Sbjct  42   RIKELDDETNLRCTSWRFAAETNNLAPWKTVPAECADYVKDYVMGRAYVIDLERVSDEAG  101

Query  376  KYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAI  555
             YA+ V LSGDG DIWVFDIDET LSN+PYY      +G   ++  +F+ WV +G APAI
Sbjct  102  FYASSVDLSGDGKDIWVFDIDETLLSNLPYYIEH--GYGMEVFDHLEFDKWVEKGVAPAI  159

Query  556  PASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVE  732
              SL+LY  V+ LG K   LTG  E+ R V + NL  AG+ NW+KLIL+   + G +A E
Sbjct  160  APSLKLYQKVIDLGYKVFLLTGRSESHRLVTVENLINAGFQNWDKLILRSSEEKGKTATE  219

Query  733  YKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            YKS KR E+V  GYRI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  220  YKSEKREEMVKEGYRIRGNSGDQWSDLLGSSMSQRSFKLPNPMYYI  265



>ref|NP_194245.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB36757.1| acid phosphatase-like protein [Arabidopsis thaliana]
 emb|CAB79424.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAL67073.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14241.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AEE85017.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=260

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR A ETNN+  WK +PAEC +YV  Y++G+ Y  D E V+EEA  YA+    +
Sbjct  45   NLHCTSWRFAAETNNLAPWKTIPAECADYVKDYLMGEGYVVDVERVSEEAKVYASSFESN  104

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG DIW+FDIDET LSN+PYY       G   ++ +KF+ WV +G APAI  SL+LY  
Sbjct  105  GDGKDIWIFDIDETLLSNLPYYMEH--GCGLEVFDHSKFDMWVEKGIAPAIAPSLKLYQK  162

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            V+ LG K + LTG +E  R + + NL+ AG++NW+KLIL+ ++D   +A  YKS KR E+
Sbjct  163  VIHLGYKVILLTGRRENHRVITVENLRNAGFHNWDKLILRSLDDRNKTATMYKSEKREEM  222

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  223  VKEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>ref|XP_002867623.1| hypothetical protein ARALYDRAFT_329150 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43882.1| hypothetical protein ARALYDRAFT_329150 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR A ETNN+  WK +PAEC +YV HY++G+ Y  D E V+EEA  YA+    +
Sbjct  45   NLHCTSWRFAAETNNLAPWKTIPAECADYVYHYLMGEGYVVDVERVSEEAKLYASSFQSN  104

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG DIW+FDIDET LSN+PYY       G   ++ +KF+ WV +G APAI  S +LY  
Sbjct  105  ADGKDIWIFDIDETLLSNLPYYMEHGC--GLEVFDHSKFDKWVEKGIAPAIAPSFKLYQK  162

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            V+ LG K + LTG +E  R + + NL+ AG++NW+KLIL+ ++D   +A  YKS KR E+
Sbjct  163  VVDLGYKVILLTGRRENHRVITVENLRNAGFHNWDKLILRSLDDRNKTATMYKSEKREEM  222

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  223  VKEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>ref|XP_010536549.1| PREDICTED: acid phosphatase 1-like [Tarenaya hassleriana]
Length=258

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR A ETNN+  WK VPAEC +YV  YM+ + Y  D E V++EA  YA+ V LS
Sbjct  43   NLHCTSWRFAAETNNLAPWKAVPAECADYVKDYMVERAYVIDLEKVSDEAEVYASSVELS  102

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG DIWVFDIDET LSN+PYY      +GA  ++  +F+ WV +G+APAI ASL+LY  
Sbjct  103  GDGKDIWVFDIDETLLSNLPYYIEH--GYGAEVFDHLEFDKWVEKGRAPAIEASLKLYQK  160

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT-GSAVEYKSGKRTEL  759
            V  LG K   LTG  E+ R V + NL  AG+ NW+KLIL+   D   +A EYKS KR  +
Sbjct  161  VRDLGYKVFLLTGRSESHRLVTVENLINAGFQNWDKLILRSSEDKWKTATEYKSEKREGM  220

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V+ GY+I GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  221  VDDGYKIRGNSGDQWSDLLGSSMSERSFKLPNPMYYI  257



>ref|NP_001234071.1| acid phosphatase 1 precursor [Solanum lycopersicum]
 sp|P27061.1|PPA1_SOLLC RecName: Full=Acid phosphatase 1; AltName: Full=Apase-1(1); Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34134.1| acid phosphatase type 1 precursor [Solanum lycopersicum]
 gb|AAA34135.1| acid phosphatase type 5 [Solanum lycopersicum]
 emb|CAA39370.1| acid phosphatase [Solanum lycopersicum]
 prf||1908427A acid phosphatase 1
Length=255

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C +WR  VETNN+  WK +P EC +YV  YM+G  Y+ + + V++EA +YA  V L 
Sbjct  40   ELKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLG  99

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D+W+FD+DET LSN+PYY  SD  +G   ++D +F+ WV  G APA+ +SL+LY  
Sbjct  100  DDGRDVWIFDVDETLLSNLPYY--SDHRYGLEVFDDVEFDKWVENGTAPALGSSLKLYQE  157

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            VL LG K   LTG  E  R V + NL  AG+++W KLIL+G +D G +A  YKS +R  +
Sbjct  158  VLKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAM  217

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+RIVGN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  218  VEEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI  254



>prf||1908418A acid phosphatase 1
Length=255

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 147/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C +WR  VETNN+  WK +P EC +YV  YM+G  Y+ + + V++EA +YA  V L 
Sbjct  40   ELKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLG  99

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D+W+FD+DET LSN+PYY  SD  +G   ++D +F+ WV  G APA+ +SL+LY  
Sbjct  100  DDGRDVWIFDVDETLLSNLPYY--SDHRYGLEVFDDVEFDKWVENGIAPALGSSLKLYQE  157

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            VL LG K   LTG  E  R V + NL  AG+++W KLIL+G +D G +A  YKS +R  +
Sbjct  158  VLKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAM  217

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+RIVGN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  218  VEEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI  254



>gb|EYU31308.1| hypothetical protein MIMGU_mgv1a011623mg [Erythranthe guttata]
Length=276

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 157/242 (65%), Gaps = 7/242 (3%)
 Frame = +1

Query  151  PYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLG  330
            P I ++ E H L+    S      ++ C SWR+A E NN+  WK +P EC +YV  YM  
Sbjct  39   PLILEINESHHLK---KSPAAEESELQCTSWRVAAEANNLSPWKKIPDECADYVKEYMEY  95

Query  331  QQYREDCEYVAEEAIKYANGVILSG-DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYN  507
            + Y  D + V+ E++ YA  + LSG DG   WVFD+DET LSN+PYY   D  +G   ++
Sbjct  96   KGYEIDLQRVSNESVLYARTLNLSGSDGKFSWVFDVDETLLSNLPYYV--DHGYGLEIFD  153

Query  508  DTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWE  687
              KF+ WV +G+APA+ +SL++Y  VL+LG K   LTG  E FR +   NL  AG+ NW+
Sbjct  154  GEKFDEWVEKGEAPALKSSLKVYEEVLALGFKVFLLTGRSERFRNITARNLVRAGFRNWD  213

Query  688  KLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMY  864
            KLIL+   D G +A++YKSGKR ELV  GY+I+GN GDQWSDLLG    +R+FK+P+PMY
Sbjct  214  KLILRSTEDNGKTAIKYKSGKRNELVQEGYKILGNSGDQWSDLLGTSISERSFKLPNPMY  273

Query  865  YI  870
            YI
Sbjct  274  YI  275



>gb|AHC69831.1| acid phosphatase [Nicotiana tabacum]
Length=263

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q+ C SWR AVETNN+  WK +P EC NYV  Y+ G  Y+ D + V++EA  YA    L 
Sbjct  48   QLQCTSWRFAVETNNLGPWKTIPEECGNYVRQYIEGGAYKMDIDRVSDEAGAYAKSRDLG  107

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D+WVFD+DET LSN+PYY  SD   G   ++  +F  WV +G APAI +SL+LY  
Sbjct  108  ADGKDVWVFDVDETLLSNLPYY--SDHGHGLEVFDSVEFEKWVEKGMAPAIGSSLKLYQD  165

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            V+ LG K   LTG  E  R V + NL  AG+ +W+KLIL+G  D G SA  YKS KR E+
Sbjct  166  VMRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRDEM  225

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+R+VGN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  226  VEEGFRLVGNSGDQWSDLLGSSTSIRSFKLPNPMYYI  262



>gb|KFK26738.1| acid phosphatase [Arabis alpina]
Length=264

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 155/244 (64%), Gaps = 6/244 (2%)
 Frame = +1

Query  142  PQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHY  321
            P+P  +Q   EI   RP+   +   V  + C SWR A ETNN+  WK +P EC +YV  Y
Sbjct  25   PRPLVLQYPSEI-VTRPK--KSDEDVINLHCTSWRFAAETNNLSPWKTIPEECADYVKDY  81

Query  322  MLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVP  501
            +LG+ Y  D E V+EEA  +A+ V  +GDG DIW+FDIDET LSN+PYY   D  FG   
Sbjct  82   VLGKGYVTDLERVSEEASMFASSVEFAGDGKDIWIFDIDETLLSNLPYYI--DHGFGLEV  139

Query  502  YNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYN  681
            ++ ++F+ WV  G APAI  SL+LY  V+ LG K   LTG KE+ R + + NL  AG+ N
Sbjct  140  FHHSEFDKWVERGVAPAIAPSLKLYQRVVDLGYKVFLLTGRKESHRLITVENLINAGFQN  199

Query  682  WEKLILKGVNDTGS-AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDP  858
            W+KLIL+  ++    A  YKS KR E+V  GYRI GN GDQWSDLLG     R+FK+ +P
Sbjct  200  WDKLILRSPDEQHKMATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLGSSMSQRSFKLANP  259

Query  859  MYYI  870
            MYYI
Sbjct  260  MYYI  263



>ref|XP_010442941.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=260

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 144/216 (67%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C +WR A E NN+  WK +PAEC +YV +Y++G+ Y  D E V+EEA+ +AN V  SG
Sbjct  46   LHCTTWRFAAEMNNLAPWKSIPAECADYVKNYVMGKGYATDLERVSEEALIFANSVEFSG  105

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG DIWVFDIDET LSN+PYY   D  FG   ++ ++F+ WV  G APAI  SL+LY  V
Sbjct  106  DGKDIWVFDIDETLLSNLPYYI--DHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRV  163

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELV  762
            + LG K   LTG KE+ R V + NL  AG+ NW+KLIL+   +    A  YKS KR E+V
Sbjct  164  VDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  223

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRI GN GDQWSDLLG     R+FK+ +PMYYI
Sbjct  224  KEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  259



>ref|XP_004513069.1| PREDICTED: acid phosphatase 1-like [Cicer arietinum]
Length=250

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLAVETNN+  WK +PA C + V  YM+G+QY+ DC+ V E + ++A  V   GDG
Sbjct  38   CDSWRLAVETNNVGAWKQIPASCVDSVAEYMIGEQYKRDCDVVGEYSYEFAKRVAFGGDG  97

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSN+PYY    V FG+  +N+T FN WV    APA+P+SL LY  +L 
Sbjct  98   RDAWVFDIDETLLSNVPYY--KTVGFGSEFFNETSFNDWVKLADAPALPSSLSLYKKLLE  155

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
            LG +   LTG  E  R     NL  +GY NW++LIL+G  D G  A+ +KS KR ELV+ 
Sbjct  156  LGFRIFLLTGRSEYQRNATETNLLFSGYRNWDRLILRGPYDQGKPAIRFKSEKREELVSE  215

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI G+ GDQWSDL G     R+FK+P+PMY+IA
Sbjct  216  GYRIHGSSGDQWSDLWGFAVASRSFKLPNPMYFIA  250



>ref|XP_011028463.1| PREDICTED: acid phosphatase 1 [Populus euphratica]
Length=261

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR  VE NN+  WK VP EC  YV  YMLG+ Y  D E V+ EA  YA  + LS
Sbjct  46   KLQCTSWRFGVEANNLNPWKTVPLECGEYVKDYMLGRAYSLDLERVSNEAGVYAKSLKLS  105

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG DIWVFD+DET LS++PYYA  D  +G   ++  +FN WV +  APA+  SL+LY  
Sbjct  106  GDGKDIWVFDVDETLLSHLPYYA--DHGYGLERFDPAEFNKWVDKAIAPALEPSLKLYKE  163

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            V+ LG K   LTG  E  R V   NL  AG+ NW+KLIL+G  D G  A  +KS KR+E+
Sbjct  164  VMGLGFKVFLLTGRSEMQRSVTEENLINAGFQNWDKLILRGSEDHGKLATIFKSDKRSEM  223

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI+GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  224  VKEGYRILGNSGDQWSDLLGSFMSNRSFKLPNPMYYI  260



>ref|XP_010433681.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 150/227 (66%), Gaps = 3/227 (1%)
 Frame = +1

Query  193  QTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEA  372
            Q  +    V  + C SWR A ETNN+  WK +P EC +YV  Y++G+ Y  D E V+EEA
Sbjct  42   QLKNIDDNVNLLHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMGKGYVFDVERVSEEA  101

Query  373  IKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPA  552
              YA+    +GDG D+W+FDIDET LSN+PYY       G   +N +KF+ WV +G APA
Sbjct  102  KIYASSFESNGDGKDVWIFDIDETLLSNLPYYLEH--GCGLEVFNHSKFDKWVEKGIAPA  159

Query  553  IPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT-GSAV  729
            I  SL+LY  V  +G K + LTG +E  R V + NL+ AG++NW+KLIL+ ++D   +A 
Sbjct  160  IAPSLKLYQMVQDMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTAT  219

Query  730  EYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             YKS KR E+VN GYRI GN GDQWSDLLG    +R+FK+P+PMY+I
Sbjct  220  IYKSEKRDEMVNEGYRIRGNSGDQWSDLLGFAMSERSFKLPNPMYFI  266



>ref|XP_010438922.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 150/227 (66%), Gaps = 3/227 (1%)
 Frame = +1

Query  193  QTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEA  372
            Q  +    V  + C SWR A ETNN+  WK +P EC +YV  Y++G+ Y  D E V+EEA
Sbjct  42   QLKNIDDNVNLLHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMGKGYVFDVERVSEEA  101

Query  373  IKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPA  552
              YA+    +GDG D+W+FDIDET LSN+PYY       G   +N +KF+ WV +G APA
Sbjct  102  KIYASSFESNGDGKDVWIFDIDETLLSNLPYYLEH--GCGLEVFNHSKFDKWVEKGIAPA  159

Query  553  IPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT-GSAV  729
            I  SL+LY  V  +G K + LTG +E  R V + NL+ AG++NW+KLIL+ ++D   +A 
Sbjct  160  IAPSLKLYKLVQDMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTAT  219

Query  730  EYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             +KS KR E+VN GYRI GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  220  IFKSEKRDEMVNEGYRIRGNSGDQWSDLLGFAMSERSFKLPNPMYYI  266



>ref|XP_009800382.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=257

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 145/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            +++C SWR AVE NN+  WK +P EC +YV  Y+ G  Y+ D + V+ EA  YA  + L 
Sbjct  42   ELECTSWRFAVEANNLSPWKTIPKECADYVRQYINGGAYKLDIDRVSSEAGAYAESMKLG  101

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D+W+FD+DET LSN+PYY++    +G   ++  KF+ WV +G APAI +SL+LY  
Sbjct  102  ADGKDVWIFDVDETLLSNLPYYSQH--GYGLEVFDSVKFDEWVEKGVAPAIGSSLKLYQD  159

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            V+ LG K   LTG  E  R V + NL  AG+ +W+KLIL+G  D G SA  YKS KR E+
Sbjct  160  VMRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRDEM  219

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+RIVGN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  220  VEEGFRIVGNSGDQWSDLLGSSTSIRSFKLPNPMYYI  256



>gb|KHG01291.1| Acid phosphatase 1 [Gossypium arboreum]
Length=266

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C SWR +VE NN+  WK +P EC  YV  YM G+ Y+ D E V+ EA  YA  + LSG
Sbjct  52   LHCTSWRFSVEANNLSPWKTIPEECLGYVKEYMTGRGYKLDLERVSSEAGVYAKNLELSG  111

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG D+W+FDIDET LSN+PYY      +G   ++  +F+ WV +G APAI  SL+LY  +
Sbjct  112  DGKDVWIFDIDETLLSNLPYYIEH--GYGLEIFDPIEFDKWVQKGMAPAIEPSLKLYEKI  169

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELV  762
            L LG K   LTG  E  R + I NL +AG+  W+KLIL+     G  AV +KS KR+E+V
Sbjct  170  LDLGFKVFLLTGRNEKHRSITIENLTKAGFQRWDKLILRDSEQHGKLAVVFKSEKRSEMV  229

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRIVGN GDQWSDLLG D   R+FK+P+PMYYI
Sbjct  230  EEGYRIVGNSGDQWSDLLGADPSRRSFKLPNPMYYI  265



>ref|XP_007215832.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
 gb|EMJ17031.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
Length=228

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 139/198 (70%), Gaps = 3/198 (2%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
             IH L P+TG A   VP + CLSWRLAVETNNI +WK VPAECE YVGHYMLG QYR+D 
Sbjct  29   HIHLLTPKTGGARGSVPGLSCLSWRLAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDS  88

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V   A  YA  + L+ DG ++WVFDIDETTLSN+PYYA +   FG   YN T F+ WV
Sbjct  89   KVVTNGAWLYAKSLNLTKDGKNVWVFDIDETTLSNLPYYAVN--GFGTELYNATSFDEWV  146

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             +G APA+P SL+LY  +L+LG+K VFLTG  E  R V   NL+  GY+ WEKLILKG  
Sbjct  147  LKGTAPALPESLKLYQKLLTLGVKVVFLTGRGEDKRNVTTTNLKNVGYHTWEKLILKGSA  206

Query  712  DTG-SAVEYKSGKRTELV  762
             TG ++  YKS +RT+LV
Sbjct  207  YTGKTSYVYKSAERTKLV  224



>ref|XP_007038298.1| HAD superfamily, subfamily IIIB acid phosphatase [Theobroma cacao]
 gb|EOY22799.1| HAD superfamily, subfamily IIIB acid phosphatase [Theobroma cacao]
Length=266

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 141/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q+ C SWR  VETNN+  WK +P +C  YV  YM G+ Y  D E VA EA  YA  V LS
Sbjct  51   QLQCTSWRFTVETNNLSPWKTIPEKCGGYVKDYMTGRGYTMDLERVANEAGVYAKSVELS  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+WVFDIDET LSN+PYYA     +G   +   +F+ WV  G APAI  SL+LY  
Sbjct  111  GDGKDVWVFDIDETLLSNLPYYAEH--GYGLEIFYPVEFDKWVQRGMAPAIDPSLKLYEM  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL LG K   LTG  E  R V I NL +AG+ +W+KLIL+   D G  A  +KS KR+++
Sbjct  169  VLDLGFKVFLLTGRSEEQRSVTIENLTKAGFQSWDKLILRDSEDHGKLATVFKSEKRSKM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+RI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  229  VEEGFRILGNSGDQWSDLLGSSPSSRSFKLPNPMYYI  265



>ref|XP_010438316.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=259

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 144/222 (65%), Gaps = 3/222 (1%)
 Frame = +1

Query  211  HRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANG  390
            H     +C SWRLA ETNN   WK+VP+ C N V +Y+ G Q+  D   VA   I YA  
Sbjct  40   HSSIASNCESWRLASETNNAGSWKVVPSRCVNSVKNYITGGQFDNDYNIVARYVIAYAKR  99

Query  391  VILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLR  570
            V L GDG D WVFDIDET LSN+ YY      +G+ PY+DTKFN W  +GKAPA  ASL+
Sbjct  100  VKLGGDGKDAWVFDIDETLLSNLEYYKAH--GYGSEPYDDTKFNEWAVQGKAPAFDASLK  157

Query  571  LYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGK  747
            LY  +  LG   + LTG  E+ R +   NL++AGY+ W + +L+G ND G +A +YKS +
Sbjct  158  LYKALKRLGFTIILLTGRDESQRSITAKNLRDAGYFGWNRFLLRGKNDQGKTATQYKSEQ  217

Query  748  RTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            R+++V  GY+I G+ GDQWSDL G     R+FKVP+PMYYIA
Sbjct  218  RSKVVKEGYKIHGSTGDQWSDLQGFAVAARSFKVPNPMYYIA  259



>ref|XP_010482458.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=260

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C +WR A E NN+  WK +P EC +YV +Y++G+ Y  D E V+EEA  +AN V  SG
Sbjct  46   LHCTTWRFAAEMNNLAPWKTIPVECADYVKNYVMGKGYATDLERVSEEAFIFANSVEFSG  105

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG DIWVFDIDET LSN+PYY   D  FG   ++ ++F+ WV  G APAI  SL+LY  V
Sbjct  106  DGKDIWVFDIDETLLSNLPYYI--DHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRV  163

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELV  762
            + LG K   LTG KE+ R V + NL  AG+ NW+KLIL+   +    A  YKS KR E+V
Sbjct  164  VDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  223

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRI GN GDQWSDLLG     R+FK+ +PMYYI
Sbjct  224  KEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  259



>ref|XP_006284361.1| hypothetical protein CARUB_v10005533mg [Capsella rubella]
 gb|EOA17259.1| hypothetical protein CARUB_v10005533mg [Capsella rubella]
Length=260

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 145/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR A ETNN+  WK +PAEC +YV  Y++G+ Y  D E V+EEA  YA+    +
Sbjct  45   NLHCTSWRFAAETNNLAPWKTIPAECADYVKDYLMGKGYVFDVERVSEEAKVYASTFESN  104

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDIDET LSN+PYY       G   ++ +KF+ WV  G APAI  SL+LY  
Sbjct  105  GDGKDVWIFDIDETLLSNLPYYLEH--GCGLEVFDHSKFDKWVERGIAPAIAPSLKLYQM  162

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT-GSAVEYKSGKRTEL  759
            V  +G K + LTG +E  R V + NL+ AG++NW+KLIL+  +D   +A  YKS KR E+
Sbjct  163  VKEMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSSDDDHKTATTYKSEKRDEM  222

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  223  VKEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>ref|NP_194656.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB79685.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAM61010.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAO44078.1| At4g29270 [Arabidopsis thaliana]
 dbj|BAE99747.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AEE85609.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=256

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 146/215 (68%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLA ETNN+  WK++P++CENY+ +Y+ G Q+ +D + VA  AI YA  V + GDG
Sbjct  44   CESWRLAAETNNVGPWKVIPSQCENYIKNYINGGQFDKDYDVVASYAIDYAKTVKVGGDG  103

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSNI YY  +   +G+ PY+  K+N  V +GK P   ASLRLY  +  
Sbjct  104  KDAWVFDIDETLLSNIEYYKAN--GYGSEPYDSIKYNEVVEKGKDPGYDASLRLYKALKK  161

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG   + LTG  E  R V   NL++AGY+ W +L+L+G ND G +A +YKS +R+++V  
Sbjct  162  LGFTIILLTGRDEGHRSVTEKNLRDAGYFGWNRLLLRGQNDQGKTATQYKSEQRSQVVKE  221

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GY I GN GDQWSDLLG     R+FKVP+PMYY+A
Sbjct  222  GYTIHGNTGDQWSDLLGFAVASRSFKVPNPMYYVA  256



>ref|XP_006385121.1| acid phosphatase family protein [Populus trichocarpa]
 gb|ERP62918.1| acid phosphatase family protein [Populus trichocarpa]
Length=261

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR  VE NN+  WK VP EC  YV  YMLG+ Y  D E V+ E+  YA  + LS
Sbjct  46   KLQCTSWRFGVEANNLNPWKTVPLECGEYVKDYMLGRAYSLDLERVSNESGVYAKSLKLS  105

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG DIWVFD+DET LS++PYYA  D  +G   ++  +FN WV +  APA+  SL+LY  
Sbjct  106  GDGKDIWVFDVDETLLSHLPYYA--DHGYGLEIFDPAEFNKWVDKAIAPALEPSLKLYKE  163

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            V+ LG K   LTG  E  R V   NL  AG+ NW+KLIL+G  D G  A  +KS KR+E+
Sbjct  164  VMDLGFKVFLLTGRSETQRSVTEENLINAGFQNWDKLILRGSEDHGKLATIFKSDKRSEM  223

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  G+RI+GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  224  VKEGFRILGNSGDQWSDLLGSFMSNRSFKLPNPMYYI  260



>ref|XP_010693738.1| PREDICTED: acid phosphatase 1 [Beta vulgaris subsp. vulgaris]
Length=263

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/245 (47%), Positives = 153/245 (62%), Gaps = 11/245 (4%)
 Frame = +1

Query  160  QQVVEIHRL-------RPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGH  318
            Q+ V +H+L        P  G+    +  + C SWR  VE NN+  WK +P EC +YV +
Sbjct  21   QESVNVHQLPRPLILEYPDEGTEQEEI-NLQCTSWRFGVEANNLNPWKTIPQECGDYVKN  79

Query  319  YMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAV  498
            YM+G+ Y+ D E V+ E+  +A  V L  D  D+WVFD+DET LSN+PYY +    +G  
Sbjct  80   YMMGKGYQLDLERVSYESSVFAKSVHLGDDSNDVWVFDVDETLLSNLPYYVQH--GYGLE  137

Query  499  PYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYY  678
             ++  +F+ WV +G APAI  SLRLY  VLSLG K   LTG  E  R+V   NL  AG+ 
Sbjct  138  VFDSVEFDKWVDKGMAPAIEPSLRLYEEVLSLGFKIFLLTGRSEKRRDVTAQNLMNAGFK  197

Query  679  NWEKLILKGVNDTGS-AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPD  855
            NW+KLIL+   D G  A+ +KS KR E+V  G+RI+GN GDQWSDLLG     R+FK+P+
Sbjct  198  NWDKLILRDTEDHGKLAMIFKSEKRIEMVKEGFRILGNSGDQWSDLLGSAMSTRSFKLPN  257

Query  856  PMYYI  870
            PMYYI
Sbjct  258  PMYYI  262



>gb|ABK95709.1| unknown [Populus trichocarpa]
Length=183

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = +1

Query  322  MLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVP  501
            MLG QYRED   + +EA  +A    L+GDG DIWVFD+DETTLSN+PYYA+    FGA P
Sbjct  1    MLGSQYREDSAVITDEAFAHAKTFKLAGDGKDIWVFDVDETTLSNLPYYAKH--GFGAEP  58

Query  502  YNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYN  681
            YN T FN WV  GKA A+P SL+LY  +LS+GIK VFLTG  E  R V   NL+ AGY+ 
Sbjct  59   YNSTAFNQWVFTGKALALPESLKLYRNLLSIGIKVVFLTGRTEDQRAVTSNNLKNAGYHI  118

Query  682  WEKLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDP  858
            WEKLILK  + +G +AV YKS +R +L   GYRI+GN+GDQWSDLLG   G+RTFK+PDP
Sbjct  119  WEKLILKSSSYSGKTAVFYKSSERAKLEKKGYRIIGNIGDQWSDLLGTSVGNRTFKLPDP  178

Query  859  MYYIA  873
            MYYI+
Sbjct  179  MYYIS  183



>ref|XP_006358226.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=263

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 146/220 (66%), Gaps = 3/220 (1%)
 Frame = +1

Query  214  RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGV  393
            R   ++C SWR AVE NN+  WK++P EC +YV  Y+ G  Y+ + + V+ EA  +A  +
Sbjct  45   RTLHLECTSWRFAVEANNLSPWKIIPQECTDYVRQYITGGAYKMEIDRVSSEAGAFAESM  104

Query  394  ILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRL  573
             L  DG D+W+FD+DET LSN+PYY++    +G+  ++  +F+ WV +G APAI +SL+L
Sbjct  105  KLGEDGKDVWIFDVDETLLSNLPYYSQH--GYGSEVFDSVEFDKWVEKGVAPAIGSSLKL  162

Query  574  YNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKR  750
            Y  V+ LG K   LTG  E  R V + NL  AG+ +W+KLIL+G  D G SA  YKS KR
Sbjct  163  YQDVMRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKR  222

Query  751  TELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             E+V  G RI GN GDQWSDLLG  A  R+FK+P+PMYYI
Sbjct  223  NEMVEEGLRIAGNSGDQWSDLLGSSASIRSFKLPNPMYYI  262



>ref|XP_006280976.1| hypothetical protein CARUB_v10026976mg [Capsella rubella]
 gb|EOA13874.1| hypothetical protein CARUB_v10026976mg [Capsella rubella]
Length=258

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C +WR A E NN+  WK +P EC +YV +Y++G+ Y  D E V+EEA  +A+ V  SG
Sbjct  44   LHCTTWRFAAEMNNLAPWKTIPVECADYVKNYVMGKGYATDLERVSEEAFIFASSVEFSG  103

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG DIWVFDIDET LSN+PYY   D  FG   ++ ++F+ WV  G APAI  SL+LY  V
Sbjct  104  DGKDIWVFDIDETLLSNLPYYI--DHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRV  161

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELV  762
            + LG K   LTG KE+ R V + NL  AG+ NW+KLIL+   +    A  YKS KR E+V
Sbjct  162  IDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  221

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRI GN GDQWSDLLG     R+FK+ +PMYYI
Sbjct  222  KEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  257



>emb|CDO98049.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 156/245 (64%), Gaps = 8/245 (3%)
 Frame = +1

Query  142  PQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHY  321
            P P  I  +    R+ P+  S+G  V   +CLSWRL VETNN R+W  VP  C NYV HY
Sbjct  61   PDPKLINPL----RIMPE-ASSGDSVSVNNCLSWRLTVETNNKRNWNGVPEICGNYVAHY  115

Query  322  MLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVP  501
            M G+QY  DC+ V + AI+Y   + +  DG  IW+FDID+T LSN+P+++R DV FG   
Sbjct  116  MTGKQYGYDCDAVVDIAIEYVKSLPIPRDGRSIWIFDIDDTALSNLPFFSRPDVFFGVKT  175

Query  502  YN---DTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAG  672
             N   + +F  +V   + P + A+LRLY  V+  GIK VFLTG+ E   + R  NL+  G
Sbjct  176  DNAELEAEFYEFVLTAEVPVLEATLRLYQAVVEAGIKAVFLTGSSERSADARDKNLKAVG  235

Query  673  YYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVP  852
            Y+ WEKLILK  + T S   +KS  R +LV  GYRI GN+GDQW+D++G + G RTFK+P
Sbjct  236  YHTWEKLILKPDSVTTSVQAFKSEVRDQLVAEGYRIEGNIGDQWADIVGSNVGRRTFKLP  295

Query  853  DPMYY  867
            +PMYY
Sbjct  296  NPMYY  300



>ref|NP_199939.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 dbj|BAA97389.1| acid phosphatase [Arabidopsis thaliana]
 dbj|BAD95053.1| acid phosphatase [Arabidopsis thaliana]
 gb|ABD19661.1| At5g51260 [Arabidopsis thaliana]
 gb|AED96059.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=257

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 141/216 (65%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C +WR A E NN+  WK +P EC +YV  Y++G+ Y  D E V+EEA+ +A  +  SG
Sbjct  43   LHCTTWRFAAEMNNLAPWKTIPVECADYVKDYVMGKGYLTDLERVSEEALIFARSIEFSG  102

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG DIW+FDIDET LSN+PYY   D  FG   ++ ++F+ WV  G APAI  SL+LY  V
Sbjct  103  DGKDIWIFDIDETLLSNLPYYI--DHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRV  160

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELV  762
            L LG K   LTG KE+ R V + NL  AG+ NW+KLIL+   +    A  YKS KR E+V
Sbjct  161  LDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  220

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRI GN GDQWSDLLG     R+FK+ +PMYYI
Sbjct  221  KEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  256



>ref|XP_009370433.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=266

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 145/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR +VE NN+  WK +P EC  YV  Y+ G+ Y  D E V++EA  YA  V L+
Sbjct  51   RLHCASWRFSVEANNVNPWKTIPEECAEYVKDYLKGRAYGFDLERVSKEAGVYAKSVELN  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDID+T LSN+PYYA  D  +G   +++ +F+ WV +  APAI +SL+LY  
Sbjct  111  GDGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDNVEFDKWVEKAMAPAIKSSLKLYEE  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VLSLG K   LTG  E  R+V + NL  AG+ +W KLIL+  +D    A  YKS KR+E+
Sbjct  169  VLSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDLEKMATIYKSEKRSEM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  229  EKEGYRILGNSGDQWSDLLGTSVSPRSFKLPNPMYYI  265



>ref|XP_010688366.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=257

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 146/218 (67%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q+ C SWR +VETN+   W  VP+ C N+V +YM+G +Y  D   VA  ++++A  V +S
Sbjct  42   QLFCESWRFSVETNDAGLWYSVPSRCHNFVKNYMIGDRYLSDSNVVAGNSLEFAKSVKVS  101

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D WVFD+DET L N+PYY   D  FG+  +N+  F+ ++   ++P +PASL LY  
Sbjct  102  GDGKDAWVFDVDETLLFNLPYYEAHD--FGSEVFNEDSFDQYMLLAESPVLPASLSLYKE  159

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKSGKRTEL  759
            +  LG     LTG  E FR    ANLQ AGY NWE+LIL+G +D +  AVEYKS KR EL
Sbjct  160  LQRLGFTIFILTGRSEPFRNATEANLQSAGYSNWERLILRGPSDKSKKAVEYKSEKRKEL  219

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             +AGYRI GN GDQWSDLLG   G R+FK+P+PMYYIA
Sbjct  220  EDAGYRIRGNSGDQWSDLLGYAIGQRSFKLPNPMYYIA  257



>ref|XP_008798586.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=255

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 145/214 (68%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRL+ ETNN   WK +PA C  +V  YM G ++  D   VA E++ +A  V + GDG
Sbjct  43   CDSWRLSEETNNAGYWKTIPARCLQFVAEYMNGDRFASDSAVVAAESLAFAQTVQVVGDG  102

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+W+FD+DET LSN+PYYA +   +G+  +N+T F+ WV+  KAPA+PASLRLY  +L 
Sbjct  103  KDVWIFDVDETLLSNLPYYAVN--GYGSEDFNETTFDEWVNLAKAPALPASLRLYEELLG  160

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG + V LTG  EA R V   NL  AGY++W +LIL+  +D G  AV YKSG+R EL   
Sbjct  161  LGFQVVLLTGRVEAQRNVTAENLSFAGYHSWNRLILREDSDIGKKAVRYKSGRRAELEAQ  220

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            GYRI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  221  GYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  254



>ref|XP_004235180.1| PREDICTED: acid phosphatase 1 [Solanum lycopersicum]
Length=263

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 146/220 (66%), Gaps = 3/220 (1%)
 Frame = +1

Query  214  RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGV  393
            R   ++C SWR AVE NN+  WK++P EC +YV  Y+ G  Y+ + + V+ EA  +A  +
Sbjct  45   RTLHLECTSWRFAVEANNLSPWKIIPQECADYVRQYITGGAYKMEIDRVSTEAGAFAESM  104

Query  394  ILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRL  573
             L  DG D+W+FD+DET LSN+PYY++    +G   ++  +F+ WV +G+APAI +SL+L
Sbjct  105  KLGEDGKDVWIFDVDETLLSNLPYYSQH--GYGLEVFDSVEFDKWVEKGEAPAIGSSLKL  162

Query  574  YNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKR  750
            Y  V+ LG K   LTG  E  R V + NL  AG+ +W+KLIL+G  D G SA  YKS KR
Sbjct  163  YQDVMRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKR  222

Query  751  TELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             E+V  G RI GN GDQWSDLLG  A  R+FK+P+PMYYI
Sbjct  223  NEMVEDGLRIAGNSGDQWSDLLGSSASIRSFKLPNPMYYI  262



>ref|XP_002865848.1| hypothetical protein ARALYDRAFT_495196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42107.1| hypothetical protein ARALYDRAFT_495196 [Arabidopsis lyrata subsp. 
lyrata]
Length=257

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C +WR A E NN+  WK +P EC +YV  Y++G+ Y  D E V+EEA+ +A+ V  S
Sbjct  42   NLHCTTWRFAAEMNNLAPWKTIPVECADYVKDYVMGKGYVTDLERVSEEALIFASSVEFS  101

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG DIW+FDIDET LSN+PYY   D  FG   ++ ++F+ WV +G APAI  SL+LY  
Sbjct  102  GDGKDIWIFDIDETLLSNLPYYI--DHGFGLELFDHSEFDKWVEKGVAPAIAPSLKLYQR  159

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            V+ LG K   LTG KE+ R V + NL  AG+ NW+KLIL+   +    A  YKS KR E+
Sbjct  160  VIDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEM  219

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI GN GDQWSDLLG     R+FK+ +PMYYI
Sbjct  220  VKDGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  256



>gb|KDP22459.1| hypothetical protein JCGZ_26290 [Jatropha curcas]
Length=268

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 142/218 (65%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q+ C SWR AVE NN+  WK +P +C  YV +YM+G+ Y+ D E V+ EA  YA  V L+
Sbjct  53   QLQCTSWRFAVEANNLNPWKTIPQDCAEYVRNYMMGRGYQVDLERVSNEAGVYAKSVQLN  112

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D WVFD+DET LSN+PYY  +   +G   ++  +F+ WV +  APAI  SL+LY  
Sbjct  113  EDGKDAWVFDVDETLLSNLPYY--TGHGYGLEIFDPLEFDKWVEKAMAPAIEPSLKLYKE  170

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            +L LG K   LTG  E  R V   NL  AG+ NW+KLIL+  +D G  A  YKS KR E+
Sbjct  171  ILGLGFKVFLLTGRNEKQRSVTEENLINAGFQNWDKLILRASDDHGKLATTYKSEKRNEM  230

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            VN GYRI GN GDQWSDLLG     R+FK+P+PMYYIA
Sbjct  231  VNEGYRIQGNSGDQWSDLLGSSMSTRSFKLPNPMYYIA  268



>ref|XP_006401998.1| hypothetical protein EUTSA_v10014448mg [Eutrema salsugineum]
 gb|ESQ43451.1| hypothetical protein EUTSA_v10014448mg [Eutrema salsugineum]
Length=258

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 151/238 (63%), Gaps = 4/238 (2%)
 Frame = +1

Query  163  QVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYR  342
             ++E    R +    G     + C SWR A ETNN+  W+ +P EC +Y+  Y+LG+ Y 
Sbjct  22   SILEYPSTRHKNPDDGGDEVDLHCTSWRFAAETNNLAPWQTIPVECADYIKDYVLGKGYV  81

Query  343  EDCEYVAEEAIKYANGVI-LSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKF  519
             D E V+EEA  +A+ V+  SGDG DIW+FDIDET LSN+PYY   D  FG   ++ ++F
Sbjct  82   TDLERVSEEASNFASSVVESSGDGKDIWIFDIDETLLSNLPYYI--DHGFGLELFDHSEF  139

Query  520  NAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLIL  699
            + WV  G APAI  SL+LY  VL LG K   LTG KE+ R V + NL  AG+ NW+KLIL
Sbjct  140  DKWVERGVAPAIAPSLKLYQRVLDLGYKVFLLTGRKESHRLVTVENLISAGFQNWDKLIL  199

Query  700  KGVNDT-GSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            +  ++   +A  YKS KR E+V  GYRI GN GDQWSDLLG     R+FK+ +PMYYI
Sbjct  200  RSPDEQHKTATLYKSEKRDEMVKEGYRIRGNSGDQWSDLLGSSMSQRSFKLANPMYYI  257



>ref|XP_010915367.1| PREDICTED: acid phosphatase 1-like isoform X1 [Elaeis guineensis]
Length=255

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 143/214 (67%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRL+ ETNN   WK +PA C  +V  YM G ++  D   VA E++ +A  V + GDG
Sbjct  43   CDSWRLSAETNNAGYWKTIPAGCLQFVAEYMNGDRFLSDSAVVAAESLAFAQAVQVVGDG  102

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             DIW+FD+DET LSN+PYY  +   +G+  +N+T F+ WV+  KAPA+PASLRLY  +L 
Sbjct  103  KDIWIFDVDETLLSNLPYYVVN--GYGSEDFNETAFDEWVNLAKAPALPASLRLYEELLG  160

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG + VFLTG  EA R   + NL  AGY++W +LIL+  +D G  A  YKS +R EL   
Sbjct  161  LGFQVVFLTGRVEAQRNATVENLSFAGYHSWNRLILREASDIGKKAAAYKSERRAELEAQ  220

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            GYRI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  221  GYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  254



>gb|EMT02056.1| Stem 31 kDa glycoprotein [Aegilops tauschii]
Length=250

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 150/233 (64%), Gaps = 23/233 (10%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCE  354
            IH LRP  GS  H   ++ C SW L VE +N+R                     +R D +
Sbjct  41   IHALRPLLGSGKH--ARVACDSWVLGVEAHNVR-------------------ADFRRDSK  79

Query  355  YVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVS  534
             V ++A+ Y + + LSG+G ++WVFDIDETTLSN+PYYA+    FGA P+N T F+A+V 
Sbjct  80   VVVDQALAYVDSLKLSGNGKEVWVFDIDETTLSNLPYYAKH--GFGATPFNATSFDAYVL  137

Query  535  EGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND  714
            EG AP++P + RLYN +LS+G+KPVFLTG  E  R + + NL+  G   W  L+LK    
Sbjct  138  EGSAPSLPETKRLYNKLLSVGVKPVFLTGRTEDKRAITVTNLRRQGISGWMNLLLKQPGF  197

Query  715  TGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GSAV YKSG+R +L +AGY I+GN+GDQWSD+LG   G RTFK+PDPMYYI 
Sbjct  198  KGSAVTYKSGERQKLQDAGYIIIGNIGDQWSDILGAPEGARTFKLPDPMYYIG  250



>ref|XP_004307784.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=267

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 146/232 (63%), Gaps = 4/232 (2%)
 Frame = +1

Query  178  HRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEY  357
            H   P        V ++ C SWR AVE NN+  WK +P EC  YV  Y+ G+ Y  D E 
Sbjct  38   HHAEPNFKELDEEV-KLRCTSWRFAVEANNVNPWKTIPEECVEYVKDYVTGRGYSVDLER  96

Query  358  VAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSE  537
            V+ EA  Y   V+L GDG D+W+FD+D+T LSN+PYYA  D  +G+  ++  +F+ WV +
Sbjct  97   VSNEAGIYVKSVVLGGDGKDVWIFDVDDTLLSNVPYYA--DHGYGSEVFDQVEFDKWVDK  154

Query  538  GKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT  717
            G +PAI +SL+LY  VL LG K   LTG  E  R V   NL+  G+ +W KLIL+  +D 
Sbjct  155  GMSPAIKSSLKLYEEVLGLGFKVFLLTGRSEGKRGVTAENLKNVGFQDWHKLILRAADDH  214

Query  718  G-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            G SA  YKS KR+E+   GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  215  GKSATIYKSEKRSEMEKEGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  266



>ref|XP_008367296.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=266

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 144/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR +VE NN+  WK +P EC  YV  Y+ G+ Y  D E V++EA  YA  V L+
Sbjct  51   RLHCDSWRFSVEANNVNXWKTIPEECAGYVKDYLTGRAYAXDLERVSKEAGVYAKSVELN  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDID+T LSN+PYYA  D  +G   ++  +F+ WV +  APAI +SL+LY  
Sbjct  111  GDGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDTVEFDKWVEKAMAPAIKSSLKLYEE  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VLSLG K   LTG  E  R+V + NL  AG+  W KLIL+  +D    A+ YKS KR+E+
Sbjct  169  VLSLGFKVFLLTGRTEGKRKVTVENLNNAGFXEWHKLILRSADDHEKLAIIYKSEKRSEM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               GYR++GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  229  EKEGYRLLGNSGDQWSDLLGTSLALRSFKLPNPMYYI  265



>gb|EYU20188.1| hypothetical protein MIMGU_mgv1a011800mg [Erythranthe guttata]
Length=270

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 149/241 (62%), Gaps = 5/241 (2%)
 Frame = +1

Query  151  PYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLG  330
            P I Q  EI     Q      R  ++ C SWR+A E NN+  W+ +P EC +YV  Y+ G
Sbjct  33   PVIGQFSEIDG--AQLKEWPQREDELQCTSWRVAGEANNLNPWRTIPEECIDYVKEYIKG  90

Query  331  QQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYND  510
            + Y  D   V++ A  +A  V LS DG D W+FDIDET LSN+PYYA     +G   ++ 
Sbjct  91   KGYEFDLVRVSKIAGAFATTVNLSNDGRDAWIFDIDETLLSNLPYYAAH--GYGLEIFDS  148

Query  511  TKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEK  690
             KF+ WV  G APAI +SL LY  VL LG K + LTG  E  R + + NL +AG+ +WEK
Sbjct  149  AKFDKWVETGNAPAIESSLNLYREVLRLGFKAILLTGRSERHRSITVENLSKAGFCDWEK  208

Query  691  LILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYY  867
            LIL+   D G +A EYKS KR ELV  GYRI+GN GDQWSDLLG    +R+FK+ +PMYY
Sbjct  209  LILRSTEDHGKTAKEYKSEKRNELVEEGYRILGNSGDQWSDLLGSSVSERSFKLSNPMYY  268

Query  868  I  870
            I
Sbjct  269  I  269



>ref|XP_006656617.1| PREDICTED: acid phosphatase 1-like, partial [Oryza brachyantha]
Length=226

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 144/226 (64%), Gaps = 4/226 (2%)
 Frame = +1

Query  199  GSAGHRVP-QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAI  375
            G  G  VP ++ C SWRLA E NN+  W  VP EC  YV  Y+ G  YR D E VA EA 
Sbjct  2    GGEGEEVPVEVRCASWRLAGEANNLAPWSAVPEECAAYVRGYVTGVAYRSDLEEVAREAS  61

Query  376  KYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAI  555
             YA    ++GDG D WVFD+DET LSN+PYYA  +  +G   ++  +F+ WV  G+APAI
Sbjct  62   TYARAARVAGDGRDAWVFDVDETLLSNLPYYA--EHGYGLELFDHREFDKWVERGEAPAI  119

Query  556  PASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVE  732
            P+SL+LY  V  LG K   LTG  E  + V + NL++ GY+ W+KLIL+   D   +A  
Sbjct  120  PSSLKLYKEVRDLGFKTFLLTGRSEGHQGVTVDNLKKQGYHEWDKLILRAPADRKKTATI  179

Query  733  YKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            YKS KR E+   GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  180  YKSEKRKEMEEEGYRILGNSGDQWSDLLGYSTSARSFKLPNPMYYI  225



>ref|XP_009372837.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=266

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 144/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR +VE NN+  WK +P EC  YV  Y+ G+ Y  D E V++EA  YA  V L+
Sbjct  51   RLHCASWRFSVEANNVNPWKTIPEECAEYVKDYLTGRAYGFDLERVSKEAGLYAKSVELN  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDID+T LSN+PYYA  D  +G   +++ +F+ WV +  APA+ +SL+LY  
Sbjct  111  GDGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDNVEFDKWVEKAMAPAVKSSLKLYEE  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VLSLG K   LTG  E  R+V + NL  AG+ +W KLIL+  +D    A  YKS KR E+
Sbjct  169  VLSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDREKLATIYKSEKRGEM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  229  EKEGYRILGNSGDQWSDLLGTSVSLRSFKLPNPMYYI  265



>ref|XP_004511128.1| PREDICTED: acid phosphatase 1-like [Cicer arietinum]
Length=264

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 145/218 (67%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR A E NN+  WK VP EC  YV  YM G+ Y  D E V++EA +YA  V L+
Sbjct  49   RLRCSSWRFAGEANNLSPWKTVPKECAEYVKEYMTGKGYVYDLEIVSKEAEEYAKSVQLN  108

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D W+FDIDET LSN+PYYA     FG   ++  KF+ WV +G APAI  SL+LY  
Sbjct  109  EDGLDAWIFDIDETLLSNLPYYAAH--GFGLQVFDHAKFDDWVVKGVAPAIEPSLKLYED  166

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL+LG K + LTG  E  R V + NL  AG+ +W +LIL+G +D G  AV YKS KR+E+
Sbjct  167  VLNLGYKVILLTGRSEQHRAVTVDNLINAGFRDWHQLILRGSDDKGKRAVIYKSEKRSEM  226

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               GYRI+GN GDQWSDL+G     ++FK+P+PMYYI+
Sbjct  227  EKDGYRILGNSGDQWSDLIGSSLSVKSFKLPNPMYYIS  264



>ref|NP_194655.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB79684.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAK93622.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14114.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AEE85608.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=255

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 146/225 (65%), Gaps = 7/225 (3%)
 Frame = +1

Query  199  GSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIK  378
            GS G R     C SWRLA ETNN+  W L+P+ C + V  Y+ G Q+  D   + + A+ 
Sbjct  36   GSDGSRY----CDSWRLAAETNNVGTWDLIPSICVDSVAEYLNGDQFLSDYSVIVDYALA  91

Query  379  YANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIP  558
            +A  V +SGDG D+W+FDIDET L+NI YY      +G+ PY+D KF+ WV +G APA  
Sbjct  92   FAKSVEISGDGKDVWIFDIDETLLTNIDYYKAH--GYGSEPYDDNKFSEWVEQGTAPAFD  149

Query  559  ASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEY  735
            ASLRLYN +  LG   + LTG  E  R     NL++AGY  WE+L+L+G ND G SA  Y
Sbjct  150  ASLRLYNALKKLGFTIILLTGRDEHQRTSTETNLRDAGYSGWERLLLRGPNDQGKSATNY  209

Query  736  KSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            KS +R++L+  G++I GN GDQWSDL G    DR+FKVP+PMYYI
Sbjct  210  KSEQRSKLIEEGFKIRGNSGDQWSDLQGFAVADRSFKVPNPMYYI  254



>gb|KCW90870.1| hypothetical protein EUGRSUZ_A02919 [Eucalyptus grandis]
Length=263

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 142/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR AVE NN+  WK +P EC +YV  YM+G+ Y  D + V++EA  YA  V LS
Sbjct  48   RLQCDSWRFAVEANNVNPWKTIPQECADYVRDYMMGKGYGFDIDRVSKEAAVYAGSVELS  107

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDIDET LSN+PYYA     FG   ++  +F+ WV + +A  I  SL+LY  
Sbjct  108  GDGKDVWIFDIDETLLSNLPYYAEH--GFGLEVFDPVEFDKWVDKAEALGIQPSLKLYEL  165

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL LG K   LTG  E  R V I NL  AG+ NW+KLI++   D    AV YKS KR E+
Sbjct  166  VLGLGFKVFLLTGRSEEQRSVTIENLINAGFQNWDKLIVRASEDHSKLAVVYKSEKRDEM  225

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  226  VREGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  262



>ref|XP_002510996.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
 gb|EEF51598.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
Length=272

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            Q+ C SWR AVE NN+  WK +P EC  YV  Y++G+ Y+ D E V+ EA  YA  V LS
Sbjct  57   QLQCTSWRFAVEANNLNPWKTIPQECAGYVRDYVMGRGYQVDLERVSNEAGVYAKSVQLS  116

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D WVFD+DET LSN+PYYA  D  +G   ++  KF+ WV E  APAI +SL+LY  
Sbjct  117  EDGKDAWVFDVDETLLSNLPYYA--DHGYGLEVFDPMKFDKWVEEATAPAIESSLKLYKE  174

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            V  LG K   LTG  E  R V   NL +AG+ +W+KLIL+   D G  A  YKS KR+E+
Sbjct  175  VRGLGFKVFLLTGRSEYQRGVTEENLIKAGFQSWDKLILRASGDHGKLASIYKSEKRSEM  234

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V+ GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  235  VSEGYRILGNSGDQWSDLLGISMSTRSFKLPNPMYYI  271



>ref|XP_009362705.1| PREDICTED: acid phosphatase 1 [Pyrus x bretschneideri]
Length=266

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 144/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR +VE NN+  WK +P +C  YV  Y+ G+ Y  D E V++EA  YA  V L+
Sbjct  51   RLHCDSWRFSVEANNVNPWKTIPEDCAEYVKDYLTGRAYEFDLERVSKEAGVYAKRVELN  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDID+T LSN+PYYA  D  +G   ++  +FN WV +  APAI +SL+LY  
Sbjct  111  GDGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDTVEFNKWVEKAMAPAIKSSLKLYEE  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VLSLG K   LTG  E  R+V + NL  AG+  W KLIL+  +D    A+ YKS KR+E+
Sbjct  169  VLSLGFKVFLLTGRTEGKRKVTVENLNNAGFREWHKLILRSADDHEKLAIIYKSEKRSEM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               GYR++GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  229  EREGYRLLGNSGDQWSDLLGTSVALRSFKLPNPMYYI  265



>ref|XP_009137842.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
 emb|CDY30222.1| BnaA03g49480D [Brassica napus]
Length=261

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 145/227 (64%), Gaps = 5/227 (2%)
 Frame = +1

Query  199  GSAGHRVPQID--CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEA  372
            GS G R    D  C SWRLA ETNN   W ++P+ C + V  Y+ G QY  D   +A+ A
Sbjct  36   GSDGSRSSAADTYCESWRLAAETNNAGTWDVIPSVCVDSVAGYLNGDQYASDYGVIADYA  95

Query  373  IKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPA  552
            + +A  V +SGDG D+W+FDIDET L+N+ YY      +G+ P+    FN WV EG APA
Sbjct  96   LAFAKTVQVSGDGKDVWIFDIDETLLTNLDYYKAH--GYGSEPFESNSFNEWVVEGTAPA  153

Query  553  IPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAV  729
              ASLRLYN +  LG   V LTG  E  R V   NL++AGY  WE+L+L+G  D G SA 
Sbjct  154  FEASLRLYNALKKLGFTIVLLTGRDEHQRSVTETNLRDAGYSGWERLLLRGPEDQGKSAT  213

Query  730  EYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             YKS +R++L+  G++I GN GDQWSDLLG    DR+FKVP+PMYYI
Sbjct  214  NYKSEQRSKLIGEGFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYI  260



>ref|XP_002867419.1| acid phosphatase class B family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43678.1| acid phosphatase class B family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 143/214 (67%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLA ETNN   W ++P+ C + V  Y+ G Q+R D + +A+ A+ +A  V +SGDG
Sbjct  41   CDSWRLAAETNNAGTWDVIPSICVDSVAEYLNGDQFRSDYDVIADYALAFAKSVEISGDG  100

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+W+FDIDET L+NI YY      +G+ PY++  F+ WV +G APA  ASLRLYN +  
Sbjct  101  KDVWIFDIDETLLTNIDYYKAH--GYGSEPYDNNSFSEWVEQGTAPAFDASLRLYNALKK  158

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
             G   + LTG  E  R     NL++AGY  WE+L+L+G ND G SA  YKS +R++L+  
Sbjct  159  FGFTIILLTGRDEDQRSSTETNLRDAGYSGWERLLLRGPNDQGKSATNYKSEQRSKLIQE  218

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            G++I GN GDQWSDLLG    DR+FKVP+PMYYI
Sbjct  219  GFKIRGNSGDQWSDLLGFAVADRSFKVPNPMYYI  252



>ref|XP_010448471.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=270

 Score =   225 bits (574),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = +1

Query  217  VPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVI  396
            V  + C SWR A ETNN+  WK +P EC +YV  Y++ + Y  D E V+EEA  YA+   
Sbjct  53   VNLLHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMDKGYVFDMERVSEEAEVYASSFE  112

Query  397  LSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLY  576
             +GDG D+W+FDIDET LSN+PYY       G   +N +KF+ WV +G APAI  SL+LY
Sbjct  113  SNGDGKDVWIFDIDETLLSNLPYYLEH--GCGLEVFNHSKFDKWVEKGIAPAIAPSLKLY  170

Query  577  NTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT-GSAVEYKSGKRT  753
              V  +G K + LTG +E  R V + NL+ AG++NW+KLIL+ ++D   +A  +KS KR 
Sbjct  171  QMVQDMGYKIILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIFKSEKRD  230

Query  754  ELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            E+++ GYRI GN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  231  EMMDEGYRIRGNSGDQWSDLLGYAMSERSFKLPNPMYYI  269



>ref|XP_009109048.1| PREDICTED: acid phosphatase 1-like isoform X2 [Brassica rapa]
Length=262

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 147/226 (65%), Gaps = 5/226 (2%)
 Frame = +1

Query  202  SAGHRVPQID--CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAI  375
            S G R    D  C SWRLAVETNN   W ++P+ C + V  Y+ G QY  D + + + A+
Sbjct  38   SDGSRSTAADTYCESWRLAVETNNAGTWGVLPSSCVDSVARYLNGDQYGSDYDVIVDYAL  97

Query  376  KYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAI  555
             +A  V +SGDG D+W+FDIDET L+NI YY      +G+ P++   FN WV +G APA 
Sbjct  98   AFAKTVKISGDGKDVWIFDIDETLLTNIGYYKNH--GYGSEPFDSKSFNEWVVQGTAPAF  155

Query  556  PASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVE  732
             ASLR+YN +  LG   V LTG  E  R V   NL++ GY  WE+LIL+G +D G SA  
Sbjct  156  AASLRMYNALKKLGFTIVLLTGRDEDQRNVTEKNLRDVGYSGWERLILRGPDDQGKSATN  215

Query  733  YKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            YKS +R++L++ G++I GN GDQWSDLLG    DR+FKVP+PMYYI
Sbjct  216  YKSEQRSKLIDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  261



>ref|XP_008376378.1| PREDICTED: acid phosphatase 1 [Malus domestica]
Length=266

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 144/216 (67%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C SWR +VE NN+  W+ +P EC  YV  Y+ G+ Y  D E V++EA  YA  V L+G
Sbjct  52   LHCASWRFSVEANNVNPWETIPEECAEYVKDYLTGRAYGFDLERVSKEAGVYAKSVELNG  111

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG D+W+FDID+T LSN+PYY  +D  +G   +++ +F+ WV +  APAI +SL+LY  V
Sbjct  112  DGKDVWIFDIDDTLLSNLPYY--TDHGYGLEVFDNVEFDKWVEKAMAPAIKSSLKLYEEV  169

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELV  762
            LSLG K   LTG  E  R+V + NL  AG+ +W KLIL+  +D    A  YKS KR+E+ 
Sbjct  170  LSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDREKLATIYKSEKRSEME  229

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  230  KEGYRILGNSGDQWSDLLGTSVSLRSFKLPNPMYYI  265



>gb|EMS60884.1| Acid phosphatase 1 [Triticum urartu]
Length=395

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 150/232 (65%), Gaps = 12/232 (5%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS G    +  + C SWRL VE +N+RD K VPA CE YVGH MLG  Y  D
Sbjct  9    IHALRPMLGSGGQLGSRAGVACDSWRLGVEAHNVRDRKRVPASCEGYVGHCMLGGHYHRD  68

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
             + V ++AI Y + + LSG+G ++ VFDIDETTLSN+PYYA     FG        F  +
Sbjct  69   SKLVIDQAISYIDSIKLSGNGKEVLVFDIDETTLSNLPYYATQ--GFG--------FQEY  118

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGV  708
              +  APA+P + RLYN +LS+GIK V LTG +E  R   + NL+  G+  W  ++LK  
Sbjct  119  ARQASAPALPETKRLYNKLLSVGIKLVILTGRREVQRTATVTNLRRQGFSGWMTVLLKPA  178

Query  709  NDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMY  864
            +  GS V +KS +R +L++AGY IVGN+GDQWSD+LG   G RTFK+PDP+Y
Sbjct  179  DFKGSTVTFKSSERQKLLDAGYIIVGNIGDQWSDILGTPEGARTFKLPDPIY  230


 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 120/189 (63%), Gaps = 23/189 (12%)
 Frame = +1

Query  307  YVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVA  486
            YVGHYMLG  YR D + V +EAI Y + + L+G+G ++WVFD+DETTLSN+PYYA     
Sbjct  230  YVGHYMLGGHYRRDSKLVIDEAISYIDSLKLAGNGKEVWVFDVDETTLSNLPYYATH--G  287

Query  487  FGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQE  666
            FGA PYN T F  +  +  APA+P + RL++ +LS+GIKPV LTG +E  R   + NL+ 
Sbjct  288  FGATPYNWTSFQEYARQASAPALPETKRLFDKLLSVGIKPVILTGRREVQRTATVTNLRR  347

Query  667  AGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFK  846
             G+  W                      T+L++AGY IVGN+GDQWSD+L    G RTFK
Sbjct  348  QGFSGW---------------------MTKLLDAGYIIVGNIGDQWSDILSTPEGARTFK  386

Query  847  VPDPMYYIA  873
            +PDPMYYI 
Sbjct  387  LPDPMYYIG  395



>ref|XP_010548683.1| PREDICTED: acid phosphatase 1-like [Tarenaya hassleriana]
Length=249

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 139/214 (65%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLAVETNN   W +VP  C+++V  Y+ G Q+  D E +A+ A+++A  + ++GDG
Sbjct  37   CESWRLAVETNNAGSWNVVPVACKDFVADYVTGGQFDSDYEVMADYAVEFAKTLKIAGDG  96

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET L+NI YY      FG  P++   FNAWV    APA  ASLRLYN +  
Sbjct  97   YDAWVFDIDETLLTNIDYYKAH--GFGTEPFDGESFNAWVESSAAPAFDASLRLYNELKK  154

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG     LTG  E  R     NLQ AGY NWE+LIL+G  D G +A  YKS KR+EL+  
Sbjct  155  LGFTIFLLTGRDEGQRSCTEKNLQYAGYSNWERLILRGHEDQGKAATTYKSEKRSELIKE  214

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            GY+I G+ GDQWSDL+G     R+FKVP+PMYYI
Sbjct  215  GYKIHGSTGDQWSDLVGFAVAKRSFKVPNPMYYI  248



>ref|XP_009388590.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=256

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 142/214 (66%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRL+VETNN R W+ VP  C  +V  YM G +Y  D + V +E++ +A  V ++ DG
Sbjct  44   CDSWRLSVETNNARFWRTVPFRCSEFVQEYMSGARYASDTDIVVDESLAFARSVQIANDG  103

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D W+FD+DET LSN+PYYA +   FG   +N+T FN WV + +APA+ ASLRLY  +L 
Sbjct  104  NDAWIFDVDETLLSNVPYYAIN--GFGTKVFNETSFNEWVDKARAPALAASLRLYEELLV  161

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
             G + + LTG  EA R+V + NL  AGY++W  LI +  +D G  AV +KSG+R EL   
Sbjct  162  SGFQIILLTGRNEAQRKVTVENLLHAGYHSWRSLIFREDSDMGKPAVVFKSGRRAELEGQ  221

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            G+RI+ + GDQWSDLLG     R+FK P+PMYYI
Sbjct  222  GFRILASSGDQWSDLLGFPMAQRSFKHPNPMYYI  255



>emb|CDY47773.1| BnaC07g41870D [Brassica napus]
Length=261

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 145/227 (64%), Gaps = 5/227 (2%)
 Frame = +1

Query  199  GSAGHRVPQID--CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEA  372
            GS G R    D  C SWRLA ETNN   W ++P+ C + V  Y+ G QY  D   +A+ A
Sbjct  36   GSDGSRSSAADTYCESWRLAAETNNAGTWDVIPSVCVDSVAGYLNGDQYGSDYGVIADYA  95

Query  373  IKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPA  552
            + +A  V +SGDG D+W+FDIDET L+N+ YY      +G+ P+    FN WV EG APA
Sbjct  96   LAFAKTVQVSGDGKDVWIFDIDETLLTNLDYYRAH--GYGSEPFEANSFNEWVVEGTAPA  153

Query  553  IPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAV  729
              ASLRLYN +  LG   V LTG  E  R V   NL++AGY  WE+L+L+G  D G SA 
Sbjct  154  FEASLRLYNALKKLGFTIVLLTGRDEHQRSVTETNLRDAGYSGWERLLLRGPEDQGKSAT  213

Query  730  EYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             YKS +R++L+  G++I GN GDQWSDLLG    DR+FKVP+PMYYI
Sbjct  214  NYKSEQRSKLIGEGFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYI  260



>ref|XP_002867418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43677.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 141/214 (66%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLA ETNN   WK+VP++CENYV +Y+   Q+ +D + VA  AI YA  V L  DG
Sbjct  44   CESWRLAAETNNAGTWKVVPSQCENYVKNYISEGQFDKDYDLVASYAIAYAKTVKLGRDG  103

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSNI YY      +G+ PY++T FN WV +G AP   ASLRLY  +  
Sbjct  104  KDAWVFDIDETLLSNIEYYKAH--GYGSQPYDNTLFNEWVVKGTAPGFDASLRLYKALKK  161

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVE-YKSGKRTELVNA  768
            LG   + LTG  E+ R +   NL++AGY+ W +L+L+G ND G A   YKS +R+++V  
Sbjct  162  LGFTIILLTGRDESQRSITEKNLRDAGYFGWNRLLLRGKNDQGKAATLYKSEQRSKVVKE  221

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            GY I GN GDQWSDL G     R+FKVP+PMYYI
Sbjct  222  GYTIHGNTGDQWSDLQGFAVAARSFKVPNPMYYI  255



>emb|CDP05370.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 140/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR AVE NN+  WK +P EC  YV  YM G+ Y  D + V+  A  +A  V L+
Sbjct  53   RLQCTSWRFAVEANNLSPWKTIPPECAAYVEDYMTGRAYSYDLQRVSRAAGAFAKSVELA  112

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D+W+FD+DET LSN+PYYA+    +G   +N TKF+ WV EG APAI +SL LY  
Sbjct  113  EDGKDVWIFDVDETLLSNLPYYAQH--GYGLEIFNHTKFDKWVEEGLAPAIHSSLELYRD  170

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT-GSAVEYKSGKRTEL  759
            V SLG K  FLTG  E    +   NL + G+ +W+KLIL+   D    A  YKS KR E+
Sbjct  171  VTSLGFKVFFLTGRSERHGNITADNLIKVGFQHWDKLILRSPEDHPKQATMYKSEKRDEM  230

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            +  GYRIVGN GDQWSDLLG    +R+FK+P+PMYYI
Sbjct  231  IKEGYRIVGNSGDQWSDLLGSSPANRSFKLPNPMYYI  267



>ref|XP_010062554.1| PREDICTED: acid phosphatase 1 [Eucalyptus grandis]
Length=365

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR AVE NN+  WK +P EC +YV  YM+G+ Y  D + V++EA  YA  V LS
Sbjct  150  RLQCDSWRFAVEANNVNPWKTIPQECADYVRDYMMGKGYGFDIDRVSKEAAVYAGSVELS  209

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDIDET LSN+PYYA  +  FG   ++  +F+ WV + +A  I  SL+LY  
Sbjct  210  GDGKDVWIFDIDETLLSNLPYYA--EHGFGLEVFDPVEFDKWVDKAEALGIQPSLKLYEL  267

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL LG K   LTG  E  R V I NL  AG+ NW+KLI++   D    AV YKS KR E+
Sbjct  268  VLGLGFKVFLLTGRSEEQRSVTIENLINAGFQNWDKLIVRASEDHSKLAVVYKSEKRDEM  327

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  328  VREGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  364



>gb|EAZ35770.1| hypothetical protein OsJ_20061 [Oryza sativa Japonica Group]
Length=293

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 143/223 (64%), Gaps = 4/223 (2%)
 Frame = +1

Query  208  GHRVP-QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYA  384
            G  VP ++ C SWRLA E NN+  WK +P EC  YV  Y+ G  YR D E VA EA  YA
Sbjct  72   GEAVPAEVRCASWRLAGEANNLAPWKSLPEECAAYVREYLTGVAYRSDLEVVAREASAYA  131

Query  385  NGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPAS  564
                +  DG D WVFD+DET LSN+PYYA  D  +G   ++  +F+ WV  G+APAIP+S
Sbjct  132  RTARVGDDGRDAWVFDVDETLLSNLPYYA--DHGYGLELFDHREFDKWVERGEAPAIPSS  189

Query  565  LRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKS  741
            L+LYN V  LG K   LTG  E    V + NL++ G+++W+KLIL+   D   +A  YKS
Sbjct  190  LKLYNEVRDLGFKTFLLTGRSEGHHGVTVDNLKKQGFHDWDKLILRAPADRKKTATIYKS  249

Query  742  GKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             KR E+   GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  250  EKRKEMEEEGYRILGNSGDQWSDLLGFSTSARSFKLPNPMYYI  292



>ref|NP_001056747.1| Os06g0139800 [Oryza sativa Japonica Group]
 dbj|BAD68673.1| putative acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF18661.1| Os06g0139800 [Oryza sativa Japonica Group]
 gb|EAY99585.1| hypothetical protein OsI_21563 [Oryza sativa Indica Group]
 dbj|BAG86750.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 143/223 (64%), Gaps = 4/223 (2%)
 Frame = +1

Query  208  GHRVP-QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYA  384
            G  VP ++ C SWRLA E NN+  WK +P EC  YV  Y+ G  YR D E VA EA  YA
Sbjct  72   GEAVPAEVRCASWRLAGEANNLAPWKSLPEECAAYVREYLTGVAYRSDLEVVAREASAYA  131

Query  385  NGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPAS  564
                +  DG D WVFD+DET LSN+PYYA  D  +G   ++  +F+ WV  G+APAIP+S
Sbjct  132  RTARVGDDGRDAWVFDVDETLLSNLPYYA--DHGYGLELFDHREFDKWVERGEAPAIPSS  189

Query  565  LRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKS  741
            L+LYN V  LG K   LTG  E    V + NL++ G+++W+KLIL+   D   +A  YKS
Sbjct  190  LKLYNEVRDLGFKTFLLTGRSEGHHGVTVDNLKKQGFHDWDKLILRAPADRKKTATIYKS  249

Query  742  GKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             KR E+   GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  250  EKRKEMEEEGYRILGNSGDQWSDLLGFSTSARSFKLPNPMYYI  292



>gb|ABK23358.1| unknown [Picea sitchensis]
Length=275

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 143/219 (65%), Gaps = 3/219 (1%)
 Frame = +1

Query  220  PQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVIL  399
            PQ++C SWR  VETN +R W +VP EC  YV  YM G QY  D   VA  +I YAN + L
Sbjct  59   PQLNCESWRFGVETNTVRFWSVVPQECVEYVKDYMDGSQYLLDSNVVANVSIAYANSLNL  118

Query  400  SGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYN  579
            SGDG D+WVFD+DET LSN+P YA  +  +G    +D  F  W    +APA+PAS RLY 
Sbjct  119  SGDGKDVWVFDVDETLLSNLPLYAAYN--YGGADMDDGAFIKWADLAEAPALPASQRLYA  176

Query  580  TVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKSGKRTE  756
             +L LG K   LTG  +  R     NL +AGY++WE L+L+G +D   +AV YKSG+R +
Sbjct  177  HLLQLGFKIFLLTGRYDYERNATEKNLVQAGYHSWEALLLRGPDDYETTAVVYKSGRRLK  236

Query  757  LVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +   G+RI GN GDQWSDL G   GDRTFK+P+PMY+IA
Sbjct  237  IEKDGFRIRGNSGDQWSDLSGYSCGDRTFKLPNPMYFIA  275



>ref|XP_010267101.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=266

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 154/246 (63%), Gaps = 7/246 (3%)
 Frame = +1

Query  151  PYIQQVVEIHRLRPQTGSAGHRVPQID----CLSWRLAVETNNIRDWKLVPAECENYVGH  318
            P ++ + EI +       AG R  ++D    C SWR +VETN+   WK +P  C N+V  
Sbjct  23   PVLKILPEIRKSARVDPIAGDRKIRVDDGMFCDSWRFSVETNDAGLWKQIPERCVNFVKE  82

Query  319  YMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAV  498
            Y+ G +Y  D   VAE+++ +A  V +SG G D+WVFDIDET LSN+PYY      FG+ 
Sbjct  83   YVTGDRYASDSVVVAEDSLSFAKTVKVSGHGKDVWVFDIDETLLSNLPYYELH--GFGSE  140

Query  499  PYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYY  678
             +++  F+ WV   +APA+PASLRLY  +  LG   V LTG  EA R V   NL  AGY 
Sbjct  141  EFDEKSFDEWVELAEAPALPASLRLYKQLQQLGFTVVLLTGRTEAQRNVTEKNLLFAGYS  200

Query  679  NWEKLILKGVNDTGS-AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPD  855
            NWE+LIL+G +D G  A+ YKS KR +L   GYRI G+ GDQWSDLLG     R+FK+P+
Sbjct  201  NWERLILRGPSDEGKIALVYKSEKRMQLEEEGYRIHGSSGDQWSDLLGFAMAKRSFKLPN  260

Query  856  PMYYIA  873
            PMYYIA
Sbjct  261  PMYYIA  266



>ref|XP_007152955.1| hypothetical protein PHAVU_004G174200g [Phaseolus vulgaris]
 gb|ESW24949.1| hypothetical protein PHAVU_004G174200g [Phaseolus vulgaris]
Length=251

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 140/214 (65%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLAVETNN   W+ VPA C ++V  Y+ G++YR DCE V   ++ +A  V L GDG
Sbjct  39   CDSWRLAVETNNAGPWERVPANCVDFVAEYISGERYRRDCEVVGNLSLAFARSVRLVGDG  98

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSN+PYY   D+ FG   +N+T F+AWV+   APA+  +L LYN +  
Sbjct  99   RDAWVFDIDETLLSNVPYY--EDIGFGFEIFNETSFDAWVNSAAAPALVPNLILYNELKE  156

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
            LG +   LTG  E  R    ANL  +GY NWE+LIL+   D G  A+ YKS KR EL N 
Sbjct  157  LGFRIFLLTGRSEYQRNATEANLMLSGYRNWERLILRESYDKGKPAISYKSEKREELENE  216

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            GYRI G+ GDQWSDL G     R+FK+P+PMYYI
Sbjct  217  GYRIHGSSGDQWSDLWGYAVAARSFKLPNPMYYI  250



>ref|XP_006837335.1| hypothetical protein AMTR_s00111p00084650 [Amborella trichopoda]
 gb|ERN00189.1| hypothetical protein AMTR_s00111p00084650 [Amborella trichopoda]
Length=298

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 139/214 (65%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWR AVETNN++ WK+VP EC  +V  YM  + YR D E VAE A  +A  V L  DG
Sbjct  86   CESWRFAVETNNLQSWKVVPIECGGFVKKYMSERGYRSDLEMVAEVAGAFARNVELGQDG  145

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D W+FDIDET LSN+ YY  +   FG   +N  KF+ WV   +APAI   L+LY  VL 
Sbjct  146  MDAWIFDIDETLLSNLVYYEEN--GFGLELFNGNKFDEWVDLAEAPAISPFLKLYEEVLE  203

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            +G K   LTG  E+ R   I NLQ +G+ NW++LI++G  D G SAV YKS KR E+   
Sbjct  204  MGFKVFLLTGRSESQRSTTIHNLQNSGFQNWDRLIMRGAADQGKSAVFYKSEKRMEMEKE  263

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            G+RI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  264  GFRILGNSGDQWSDLLGSSMAIRSFKLPNPMYYI  297



>ref|XP_007218818.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica]
 gb|EMJ20017.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica]
Length=266

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 143/217 (66%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR +VE NNI  WK +P EC  YV  Y+ G+ Y  D E V++EA  YA  V LS
Sbjct  51   KLHCTSWRFSVEANNINPWKTIPQECAKYVKDYVTGRAYGFDLERVSKEAGVYAKAVELS  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDID+T LSN+PYYA  D  +G   ++  +F+ WV +  APAI +SL+LY  
Sbjct  111  GDGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDHLEFDRWVDKAMAPAIKSSLKLYEE  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL LGIK   LTG  +  R+  I NL  AG+ +W KLIL+  ++ G  A  YKS KR E+
Sbjct  169  VLGLGIKVFLLTGRSDGKRKATIENLINAGFRDWHKLILRAPDEQGKLATVYKSEKRNEM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               GYRI+GN GDQWSD+LG     R+FK+P+PMYYI
Sbjct  229  EKEGYRILGNSGDQWSDILGTSMSIRSFKLPNPMYYI  265



>gb|KFK29483.1| hypothetical protein AALP_AA7G140100 [Arabis alpina]
Length=257

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 148/227 (65%), Gaps = 5/227 (2%)
 Frame = +1

Query  199  GSAGHRVPQID--CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEA  372
            GS G R    +  C SWRLA ETNN+  W ++P+ C + V  Y+ G QY  D   +A+ A
Sbjct  32   GSDGSRSAATNTYCESWRLAAETNNVGTWDVIPSICVDSVSEYLNGDQYGSDYGVIADYA  91

Query  373  IKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPA  552
            + +A  V +SGDG D+W+FDIDET L+NI YY      +G++PY+   +N WV +G APA
Sbjct  92   LAFAKTVQISGDGKDVWIFDIDETLLTNIDYYKAH--GYGSIPYDSNSYNEWVVQGTAPA  149

Query  553  IPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAV  729
              ASLRLYN +  LG   V LTG  E  R V   NL++AGY +WE+L+L+G  D G SA 
Sbjct  150  FDASLRLYNALKKLGFTIVLLTGRDEDQRSVTEKNLRDAGYLDWERLLLRGREDQGKSAT  209

Query  730  EYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             YKS +R++L+  G++I GN GDQWSDLLG     R+FKVP+PMYYI
Sbjct  210  NYKSEQRSKLIVEGFKIHGNTGDQWSDLLGFAVAVRSFKVPNPMYYI  256



>ref|XP_008794092.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=258

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 145/214 (68%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRL+ ETNN   W  +PA C  +V  YM G +Y  D + VA E++ +A  V ++GDG
Sbjct  46   CDSWRLSEETNNAGYWGTIPARCLQFVAEYMNGDRYALDSDVVAAESLAFAQTVQVAGDG  105

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+W+FD+DET LSN+PYYA +   +G+  +N+T F+ W++  KAPA+PASLRLY  +L 
Sbjct  106  NDVWIFDVDETLLSNLPYYAVN--GYGSEEFNETTFDEWLNLAKAPALPASLRLYEELLG  163

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG + + LTG  EA R     NL  AGY++W +LIL+  +D G +AV YKS KR +L   
Sbjct  164  LGFQIILLTGRVEAERNATEKNLSFAGYHSWTRLILREASDIGKTAVAYKSEKRAQLEAQ  223

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            G+RI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  224  GHRIHGNSGDQWSDLLGSPMATRSFKLPNPMYYI  257



>ref|XP_008234437.1| PREDICTED: acid phosphatase 1 [Prunus mume]
Length=266

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 142/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C+SWR +VE NNI  WK +P EC  YV  Y+ G+ Y  D E V++EA  YA  + LS
Sbjct  51   KLHCISWRFSVEANNINPWKTIPQECAEYVKDYVTGRAYGFDLERVSKEAGVYAKAIELS  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D W+FDID+T LSN+PYYA  D  +G   ++  +F  WV +  APAI +SL+LY  
Sbjct  111  GDGKDAWIFDIDDTLLSNLPYYA--DHGYGLEVFDHLEFERWVEKAMAPAIKSSLKLYEE  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL LGIK   LTG  E  R+  I NL  AG+ +W KLIL+  ++ G  A  YKS KR E+
Sbjct  169  VLGLGIKVFLLTGRGEGKRKATIENLVNAGFRDWHKLILRAPDEQGKLATVYKSEKRNEM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               GYRI+GN GDQWSD+LG     R+FK+P+PMYYI
Sbjct  229  EKEGYRILGNSGDQWSDILGTSMSIRSFKLPNPMYYI  265



>ref|XP_006412859.1| hypothetical protein EUTSA_v10026000mg [Eutrema salsugineum]
 gb|ESQ54312.1| hypothetical protein EUTSA_v10026000mg [Eutrema salsugineum]
Length=263

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 144/226 (64%), Gaps = 5/226 (2%)
 Frame = +1

Query  202  SAGHRVPQID--CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAI  375
            S G R    D  C SWRLA ETNN   W ++P+ C + V  Y+ G QY  D   +A+ A+
Sbjct  39   SDGSRSAAADTYCESWRLAAETNNAGTWDVIPSMCIDSVSEYVNGDQYGSDYGVIADYAL  98

Query  376  KYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAI  555
             +A  V +SGDG D+W+FDIDET L+NI YY      +G+ P+  + FN W  +G APA 
Sbjct  99   AFAKTVQISGDGNDVWIFDIDETLLTNIDYYRAH--GYGSEPFESSSFNEWAVQGTAPAF  156

Query  556  PASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVE  732
             ASLRLYN +  LG   + LTG  E  R V   NL++AGY  WE+L+L+G  D G SA  
Sbjct  157  DASLRLYNALKKLGFTIILLTGRDEDQRSVTETNLRDAGYSGWERLLLRGPGDQGKSATN  216

Query  733  YKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            YKS +R++L+  G+RI GN GDQWSDLLG    DR+FKVP+PMYYI
Sbjct  217  YKSEQRSKLIEKGFRIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  262



>emb|CDY03376.1| BnaC01g17060D [Brassica napus]
Length=264

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 148/237 (62%), Gaps = 7/237 (3%)
 Frame = +1

Query  166  VVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRE  345
            + E H L+            ++C SWR A ETNN+  WK +PAEC  YV  Y++G+ Y  
Sbjct  32   IFETHELKSAIDDDN---VNVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVV  88

Query  346  DCEYVAEEAIKYANGVILSGD-GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFN  522
            D E V+EEA  YA+    SGD G D W+FDIDET LSN+PYY       G   ++ TKF+
Sbjct  89   DLERVSEEANVYASSFGFSGDDGKDTWIFDIDETLLSNLPYYLEH--GCGLEVFDHTKFD  146

Query  523  AWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILK  702
             WV +G APAI  SL+LY  V  LG K + LTG +E  R + I NL  AG+ NW++LIL+
Sbjct  147  KWVEKGAAPAIAPSLKLYEKVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILR  206

Query  703  GVNDT-GSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             ++D   +A  +KS KR E+V  GYRI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  207  SLDDDHKTATIFKSEKRDEMVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  263



>ref|XP_007133483.1| hypothetical protein PHAVU_011G182400g [Phaseolus vulgaris]
 gb|ESW05477.1| hypothetical protein PHAVU_011G182400g [Phaseolus vulgaris]
Length=269

 Score =   223 bits (567),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 144/218 (66%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C +WR+A E NN+  W+ VP EC +YV  YM G+ Y  D E V++EA ++A  V LS
Sbjct  54   RLRCGAWRVAGEANNLGAWRTVPEECADYVKEYMTGKGYLVDLEMVSKEAEEFAKSVKLS  113

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D W+FDIDET LSN+PYYA     +G   ++  KFN WV EG AP++  SL+LY  
Sbjct  114  DDGKDAWIFDIDETLLSNLPYYAAH--GYGLEIFDHEKFNDWVEEGVAPSLQPSLKLYED  171

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL LG K + LTG  E  R V + NL  AG+  W+ LIL+  +D G  AV +KS KR+E+
Sbjct  172  VLKLGFKVILLTGRSERHRSVTVDNLINAGFKEWDHLILRSSDDQGKRAVVFKSEKRSEM  231

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               GYRI+GN GDQWSDL+G     R+FK+P+PMYYI+
Sbjct  232  EKDGYRILGNSGDQWSDLIGSSLSVRSFKLPNPMYYIS  269



>ref|XP_007012979.1| HAD superfamily isoform 2 [Theobroma cacao]
 gb|EOY30598.1| HAD superfamily isoform 2 [Theobroma cacao]
Length=258

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SW L+VETNN   WK +P  CE++V  YM G +Y  D E VA  ++ YA+ V +  DG
Sbjct  46   CASWHLSVETNNAGSWKQIPIRCESFVQDYMTGPRYMSDSEIVANYSLAYASSVEIGRDG  105

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET L+N+PYY      FG+ P+++  ++ WV   +APAIPASL+LYN +  
Sbjct  106  KDAWVFDIDETLLTNLPYYQAH--GFGSEPFDENSWDVWVDLAEAPAIPASLKLYNELKQ  163

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
            +G K   LTG  E  R     NL  AGY +WE+LIL+G +D G+ A  YKS KR++LVN 
Sbjct  164  MGFKIFVLTGRSENQRNATGKNLLFAGYTDWERLILRGPSDDGTLATVYKSEKRSDLVNE  223

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI G+ GDQWSDLLG     R+FK+P+PMYYI+
Sbjct  224  GYRIHGSSGDQWSDLLGFAVAKRSFKLPNPMYYIS  258



>ref|XP_009138920.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=264

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 143/218 (66%), Gaps = 4/218 (2%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             ++C SWR A ETNN+  WK +PAEC  YV  Y++G+ Y  D E V+EEA  YA+    S
Sbjct  48   NVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVVDLERVSEEANVYASSFGFS  107

Query  403  GD-GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYN  579
            GD G D W+FDIDET LSN+PYY       G   ++ TKF+ WV +G APAI  SL+LY 
Sbjct  108  GDDGKDTWIFDIDETLLSNLPYYLEH--GCGLEVFDHTKFDKWVEKGAAPAIAPSLKLYE  165

Query  580  TVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT-GSAVEYKSGKRTE  756
             V  LG K + LTG +E  R + I NL  AG+ NW++LIL+ ++D   +A  +KS KR E
Sbjct  166  KVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILRSLDDDHKTATIFKSEKRDE  225

Query  757  LVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            +V  GYRI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  226  MVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  263



>ref|XP_004287494.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 141/218 (65%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             I C SWR +VETN+   W  +P+ C  +V  YM G +Y  D   V+  ++ +  GV L 
Sbjct  38   NIYCDSWRFSVETNDAGSWDSIPSRCVAFVQDYMTGDRYASDSAIVSNFSLAFGQGVKLG  97

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D WVFDIDET LSN+PYY   +  FGAV +++  F+ WV   +APAIPASL LY  
Sbjct  98   GDGKDSWVFDIDETLLSNLPYY--QEHGFGAVTFDEVSFDKWVDLAEAPAIPASLSLYKG  155

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            +  LG K   LTG  E  R   + NL  +GY +WE+L+L+G +D G+ A EYKS KR EL
Sbjct  156  LQRLGFKIFLLTGRSEFQRNATVNNLVYSGYSDWERLLLRGPSDKGTLATEYKSKKRAEL  215

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            +N G+RI G+ GDQWSDLLG     R+FK+P+PMYYIA
Sbjct  216  INEGFRIHGSSGDQWSDLLGFAVARRSFKLPNPMYYIA  253



>ref|XP_009127318.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=261

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 142/218 (65%), Gaps = 4/218 (2%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR A ETNN+  W  +PAEC +YV  Y+LG+ Y  D E V+EEA  +A+ V  S
Sbjct  45   NLHCTSWRFAAETNNLAPWSTIPAECADYVKDYVLGKGYVADLERVSEEASVFASTVDFS  104

Query  403  -GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYN  579
             GDG D WVFDIDET LSN+PYY   D  FG   ++ ++F+ WV  G APAI  SL+LY 
Sbjct  105  AGDGKDAWVFDIDETLLSNLPYYI--DHGFGLEVFDHSEFDKWVERGVAPAIAPSLKLYQ  162

Query  580  TVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTE  756
             V+ LG +   LTG KE+ R V + NL  AG+ NW+KLIL+  ++    A  YKS KR E
Sbjct  163  RVIDLGYRVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPDEQHKMATLYKSEKRDE  222

Query  757  LVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            +V  GYRI GN GDQWSDLLG     R+FK+ +PMYYI
Sbjct  223  MVKEGYRIRGNSGDQWSDLLGSSMSQRSFKLANPMYYI  260



>emb|CDY34346.1| BnaA01g14490D [Brassica napus]
Length=265

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 143/218 (66%), Gaps = 4/218 (2%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             ++C SWR A ETNN+  WK +PAEC  YV  Y++G+ Y  D E V+EEA  YA+    S
Sbjct  49   NVNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVVDLERVSEEANVYASSFGFS  108

Query  403  GD-GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYN  579
            GD G D W+FDIDET LSN+PYY       G   ++ TKF+ WV +G APAI  SL+LY 
Sbjct  109  GDDGKDTWIFDIDETLLSNLPYYLEH--GCGLEVFDHTKFDKWVEKGAAPAIAPSLKLYE  166

Query  580  TVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDT-GSAVEYKSGKRTE  756
             V  LG K + LTG +E  R + I NL  AG+ NW++LIL+ ++D   +A  +KS KR E
Sbjct  167  KVKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILRSLDDDHKTATIFKSEKRDE  226

Query  757  LVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            +V  GYRI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  227  MVKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  264



>gb|KDO45271.1| hypothetical protein CISIN_1g023192mg [Citrus sinensis]
Length=286

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 140/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C +WR AVE NN+  WK +P EC  YV  YM+G+ Y  D E V+ EA  YA  V L 
Sbjct  71   KLQCTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVYAKSVELR  130

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D W+FDIDET LSN+PYY   +  +G   +N  +F+ WV +  +PAI ASL+LY  
Sbjct  131  GDGKDAWIFDIDETLLSNLPYY--QEHGYGLEIFNPVEFDKWVEKAMSPAIEASLKLYEE  188

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL LG K   LTG  E  R + + NL  AG   W+KLIL+  +D G  A+ YKS KR E+
Sbjct  189  VLGLGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEM  248

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  249  VQEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>gb|KCW53447.1| hypothetical protein EUGRSUZ_J02693 [Eucalyptus grandis]
Length=240

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 129/180 (72%), Gaps = 0/180 (0%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            +IH LRPQ GS GH +P + C SWRLAVET+NI+DW +VP  CENYVG+YMLG QYR+DC
Sbjct  28   KIHPLRPQVGSGGHHIPGVSCQSWRLAVETDNIKDWDVVPMVCENYVGNYMLGHQYRKDC  87

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
                  A  YA G+ L  DG D+W+FDIDET LSN+PYYAR D AFGA  YN+T F  W 
Sbjct  88   NAAGWAAYDYAKGLTLKKDGKDVWIFDIDETALSNLPYYARPDNAFGAKEYNETTFKEWE  147

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVN  711
             EGKAPA+PA L LY  +L LG K VF++G  E+ R + + N+++ GY+ WEKLILK  N
Sbjct  148  LEGKAPAVPAILYLYKRLLKLGFKIVFISGKSESLRSITVYNMKKVGYHTWEKLILKRRN  207



>ref|XP_002436441.1| hypothetical protein SORBIDRAFT_10g002690 [Sorghum bicolor]
 gb|EER87808.1| hypothetical protein SORBIDRAFT_10g002690 [Sorghum bicolor]
Length=303

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 139/217 (64%), Gaps = 4/217 (2%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVI-LS  402
            + C SW LA E NN+  WK VP EC  +V  Y+ G  YR D E VA E+  YA   + L 
Sbjct  88   VRCASWWLAAEANNLAPWKAVPPECVPHVRDYVTGAAYRSDLELVARESAAYARAALPLG  147

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D WVFD+DET LSN+PYYA  D  +GA  ++  +F+ WV  G+A AIP+SL+LYN 
Sbjct  148  DDGRDAWVFDVDETLLSNLPYYA--DHGYGAELFDHHRFDEWVERGEAAAIPSSLKLYNE  205

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKSGKRTEL  759
            V  LG K   LTG  E  R V + NL + G+++WEKLIL+   D   +A  YKS KR E+
Sbjct  206  VRELGFKTFLLTGRSEGHRGVTVENLNKQGFHDWEKLILRAAGDRKKTATVYKSEKRKEM  265

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
               GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  266  EEEGYRILGNSGDQWSDLLGSSMSARSFKLPNPMYYI  302



>ref|NP_001240054.1| uncharacterized protein LOC100802126 precursor [Glycine max]
 gb|ACU19722.1| unknown [Glycine max]
Length=271

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 142/216 (66%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C +WR+A E NN+  W+ +P EC  YV  YM G+ Y  D E V++EA ++A  V L  
Sbjct  57   LRCGAWRVAGEANNLGAWRTIPEECTEYVKEYMTGKGYAVDLEMVSKEAEEFARSVPLGS  116

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG D W+FDIDET LSN+PYYA     +G   ++  KFN WV +G APAI  SL+LY  V
Sbjct  117  DGKDAWIFDIDETLLSNLPYYAAH--GYGLEVFDHEKFNNWVEKGVAPAIEPSLKLYEDV  174

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELV  762
            L+LG K + LTG  E  R V + NL  AG+  W++LIL+  +D G  AV YKS KR+E+ 
Sbjct  175  LNLGFKVILLTGRSERHRSVTVDNLINAGFKEWDQLILRNSDDQGKRAVLYKSEKRSEME  234

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  235  KDGYRILGNSGDQWSDLLGSSVSVRSFKLPNPMYYI  270



>ref|XP_006413336.1| hypothetical protein EUTSA_v10026026mg [Eutrema salsugineum]
 gb|ESQ54789.1| hypothetical protein EUTSA_v10026026mg [Eutrema salsugineum]
Length=258

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 150/247 (61%), Gaps = 17/247 (7%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--------------IDCLSWRLAVETNNIRDWKLVPAECENYV  312
            IH    +  S+ H +P+              + C SWR A ETNN+  WK +P EC +YV
Sbjct  13   IHLAFSEENSSSHILPRPLIFETQLKSVDDNVHCTSWRFAAETNNLAPWKTIPPECADYV  72

Query  313  GHYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFG  492
              Y++G+ Y  D E V+EEA  YA+     GDG D WVFDIDET LSN+PYY       G
Sbjct  73   KDYLMGKGYVADLERVSEEAWVYASTFEFPGDGKDTWVFDIDETLLSNLPYYLEHGC--G  130

Query  493  AVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAG  672
               +N  +F+ WV +G APAI  SL+LY  V  LG K + LTG +E  + V + NL  AG
Sbjct  131  LEVFNHVEFDKWVEKGVAPAIAPSLKLYQKVKDLGYKVILLTGRREKHKVVTVENLLNAG  190

Query  673  YYNWEKLILKGVN-DTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKV  849
            +++W++LIL+ ++    +A  YKS +R E+V  GYRI GN GDQWSDLLG    +R+FK+
Sbjct  191  FHSWDELILRSLDGQNKTATIYKSEQRDEMVKEGYRIRGNSGDQWSDLLGSAMSERSFKL  250

Query  850  PDPMYYI  870
            P+PMYYI
Sbjct  251  PNPMYYI  257



>gb|ABK21277.1| unknown [Picea sitchensis]
 gb|ABR17651.1| unknown [Picea sitchensis]
Length=254

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 143/216 (66%), Gaps = 4/216 (2%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLG-QQYREDCEYVAEEAIKYANGVILSGD  408
            CL+WRL+VET+N+++W +VP++C  YV  YM    QY ED +      + YA  V L GD
Sbjct  41   CLAWRLSVETSNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTILGYAKTVKLVGD  100

Query  409  GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVL  588
            G D W+FDIDET LSN+PYY + +  +G   YN T F AWVSE KA  +P+SL LYN +L
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  589  SLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVE-YKSGKRTELVN  765
            + G K   LTG  E  R +   NL  AGY  W+ LIL+GVN+ GSA   YK  KR ELV 
Sbjct  159  ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  766  AGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GYR+ G++GDQWSDL GP    R+FK+P+PMYYI+
Sbjct  219  KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>ref|XP_002867417.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43676.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 151/244 (62%), Gaps = 5/244 (2%)
 Frame = +1

Query  145  QPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYM  324
             P +  +V    +L     S    V    C  WRLA ETNN   W++VP++CENYV +Y+
Sbjct  22   NPAFSSRVSSFIKLPSSVESRSSDVSY--CEGWRLAAETNNAGTWRVVPSQCENYVKNYI  79

Query  325  LGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPY  504
             G Q+ +D + +A  AI YA  + LSG   D WVFDIDET LSN+ YY      +G+ PY
Sbjct  80   NGGQFDKDYDVLASYAIAYAKTINLSGKDKDAWVFDIDETLLSNLEYYKAH--GYGSEPY  137

Query  505  NDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNW  684
            ++T FN WV +GKAP   ASLRLY  +  LG   + LTG  E+ R +   NL++AGY+ W
Sbjct  138  DNTLFNDWVVKGKAPGFDASLRLYKALKKLGFTIILLTGRDESQRSITEKNLRDAGYFGW  197

Query  685  EKLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPM  861
             +L+L+G  D G +A +YKS +R ++V  GY I G+ GDQWSDL G     R+FKVP+PM
Sbjct  198  NRLLLRGHEDQGKAATQYKSEQRAKVVKEGYTIHGSAGDQWSDLHGFAVATRSFKVPNPM  257

Query  862  YYIA  873
            YYIA
Sbjct  258  YYIA  261



>ref|XP_007012978.1| HAD superfamily isoform 1 [Theobroma cacao]
 gb|EOY30597.1| HAD superfamily isoform 1 [Theobroma cacao]
Length=323

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SW L+VETNN   WK +P  CE++V  YM G +Y  D E VA  ++ YA+ V +  DG
Sbjct  111  CASWHLSVETNNAGSWKQIPIRCESFVQDYMTGPRYMSDSEIVANYSLAYASSVEIGRDG  170

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET L+N+PYY      FG+ P+++  ++ WV   +APAIPASL+LYN +  
Sbjct  171  KDAWVFDIDETLLTNLPYYQAH--GFGSEPFDENSWDVWVDLAEAPAIPASLKLYNELKQ  228

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
            +G K   LTG  E  R     NL  AGY +WE+LIL+G +D G+ A  YKS KR++LVN 
Sbjct  229  MGFKIFVLTGRSENQRNATGKNLLFAGYTDWERLILRGPSDDGTLATVYKSEKRSDLVNE  288

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI G+ GDQWSDLLG     R+FK+P+PMYYI+
Sbjct  289  GYRIHGSSGDQWSDLLGFAVAKRSFKLPNPMYYIS  323



>ref|XP_010110867.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXC28686.1| Acid phosphatase 1 [Morus notabilis]
Length=259

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 146/231 (63%), Gaps = 6/231 (3%)
 Frame = +1

Query  193  QTGSAGHRVPQID---CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVA  363
            Q     HRV   D   C SWR +VETN+   W  +P  CENYV +Y+ G +YR D E+VA
Sbjct  31   QISPRNHRVSDQDLLYCDSWRFSVETNDAGFWPTIPKRCENYVENYVTGDRYRSDSEFVA  90

Query  364  EEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGK  543
             +++ +   + ++ DG D W+FDIDET LSN+PYY      FGA  +++T F+ WV   +
Sbjct  91   GDSLAFVRSLQMNDDGKDAWIFDIDETLLSNLPYYEAH--GFGAEVFDETPFDDWVDLAE  148

Query  544  APAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS  723
            APA+ ASL LYN +  LG K   LTG  E  R     NL  +GY NWE+LIL+G +D   
Sbjct  149  APALAASLSLYNELEQLGFKIFLLTGRSEYQRNATEKNLLYSGYKNWERLILRGPSDQHK  208

Query  724  -AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             A+ YKS KR+ELVN GY I G+ GDQWSDL+G     R+FK+P+PMYYIA
Sbjct  209  PAIVYKSEKRSELVNEGYTIHGSSGDQWSDLMGFAVAQRSFKLPNPMYYIA  259



>ref|XP_010447874.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=256

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLA ETNN   W ++P+ C + V  Y+ G+Q+  D   +A+ AI +A  V +SGDG
Sbjct  44   CDSWRLAAETNNAGTWDVIPSVCVDSVADYLNGEQFLSDYNVIADYAIAFAKTVEISGDG  103

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+W+FDIDET L+NI YY     ++G+ P++   FN WV +G APA  ASLRLYN +  
Sbjct  104  KDVWIFDIDETLLTNIDYYKAH--SYGSEPFDVNSFNEWVVQGTAPAFDASLRLYNALKK  161

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG   + LTG  E  R    +NL++AGY  WE+L+L+G  D G SA  YKS +R++LV  
Sbjct  162  LGFTIILLTGRDEDQRSFTESNLRDAGYSGWERLLLRGPKDQGTSATNYKSEQRSKLVEE  221

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            G+++ GN GDQWSDL G    DR+FKVP+PMYYIA
Sbjct  222  GFKVRGNTGDQWSDLQGFAVADRSFKVPNPMYYIA  256



>ref|XP_009109046.1| PREDICTED: acid phosphatase 1-like isoform X1 [Brassica rapa]
Length=265

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 145/227 (64%), Gaps = 4/227 (2%)
 Frame = +1

Query  202  SAGHRVPQID--CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAI  375
            S G R    D  C SWRLAVETNN   W ++P+ C + V  Y+ G QY  D + + + A+
Sbjct  38   SDGSRSTAADTYCESWRLAVETNNAGTWGVLPSSCVDSVARYLNGDQYGSDYDVIVDYAL  97

Query  376  KYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFG-AVPYNDTKFNAWVSEGKAPA  552
             +A  V +SGDG D+W+FDIDET L+NI YY         + P++   FN WV +G APA
Sbjct  98   AFAKTVKISGDGKDVWIFDIDETLLTNIGYYKNHGYGVSRSEPFDSKSFNEWVVQGTAPA  157

Query  553  IPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAV  729
              ASLR+YN +  LG   V LTG  E  R V   NL++ GY  WE+LIL+G +D G SA 
Sbjct  158  FAASLRMYNALKKLGFTIVLLTGRDEDQRNVTEKNLRDVGYSGWERLILRGPDDQGKSAT  217

Query  730  EYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             YKS +R++L++ G++I GN GDQWSDLLG    DR+FKVP+PMYYI
Sbjct  218  NYKSEQRSKLIDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  264



>gb|ACN40876.1| unknown [Picea sitchensis]
Length=254

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 143/216 (66%), Gaps = 4/216 (2%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLG-QQYREDCEYVAEEAIKYANGVILSGD  408
            CL+WRL+VET+N+++W +VP++C  YV  YM    QY ED +      + YA  V L GD
Sbjct  41   CLAWRLSVETSNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTNLGYAKTVKLVGD  100

Query  409  GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVL  588
            G D W+FDIDET LSN+PYY + +  +G   YN T F AWVSE KA  +P+SL LYN +L
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  589  SLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVE-YKSGKRTELVN  765
            + G K   LTG  E  R +   NL  AGY  W+ LIL+GVN+ GSA   YK  KR ELV 
Sbjct  159  ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  766  AGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GYR+ G++GDQWSDL GP    R+FK+P+PMYYI+
Sbjct  219  KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>ref|XP_010925513.1| PREDICTED: acid phosphatase 1-like isoform X1 [Elaeis guineensis]
Length=256

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 144/215 (67%), Gaps = 5/215 (2%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRL+VETNN   W+ +PA C  +V  YM G++Y  D + VA E++ +A  V ++GDG
Sbjct  44   CDSWRLSVETNNAGYWETIPARCLQFVAEYMNGERYASDSDVVAAESLAFAQTVQVAGDG  103

Query  412  TDIWVFDIDETTLSNIPYYARSDV-AFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVL  588
             D+W+FD+DET LSN+PYY   DV  +G   +N+T F+ WV+  KAPA+ ASLRLY  +L
Sbjct  104  KDVWIFDVDETLLSNVPYY---DVHGYGWEEFNETAFDEWVNLAKAPALQASLRLYEELL  160

Query  589  SLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVN  765
             LG + + LTG  EA R     NL   GY++W++ IL+  +D G  AV YKS +R +L  
Sbjct  161  GLGFQMILLTGRAEAQRNATEKNLSFVGYHSWKRFILREASDIGKKAVTYKSERRAQLEA  220

Query  766  AGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             GYRI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  221  QGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  255



>ref|XP_008387412.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=257

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 147/243 (60%), Gaps = 14/243 (6%)
 Frame = +1

Query  160  QQVVEIHRLRPQTGSAGHRVPQID----CLSWRLAVETNNIRDWKLVPAECENYVGHYML  327
            Q V+++ R R       HR    D    C SWR ++ETN+   W  +P+ C  +V  YM 
Sbjct  24   QSVIQMPRKR-------HRFAASDDSLYCDSWRFSIETNDAGTWSNIPSRCXRFVQDYMT  76

Query  328  GQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYN  507
            G +YR D   VA  ++ +A GV   GDG D WVFDIDET LSN+ YY      FG+  +N
Sbjct  77   GDRYRSDLASVANYSLSFAKGVTXGGDGKDAWVFDIDETLLSNLAYYQAH--GFGSETFN  134

Query  508  DTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWE  687
            +  F+ WV   +APA+PASL LY  +  LG K   LTG  E  R     NL  AGY NWE
Sbjct  135  EAFFDEWVDLAEAPALPASLNLYKELEXLGFKMFLLTGRSEHQRNATARNLLYAGYNNWE  194

Query  688  KLILKGVNDTGS-AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMY  864
            +L+L+G +D G+ A  YKS KR++L+N GYRI G+ GDQWSDL+G     R+FK+P+PMY
Sbjct  195  RLLLRGPSDQGTPATVYKSQKRSDLINEGYRIHGSSGDQWSDLIGFAIAQRSFKLPNPMY  254

Query  865  YIA  873
            YIA
Sbjct  255  YIA  257



>ref|XP_006490172.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
Length=286

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 139/217 (64%), Gaps = 3/217 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C +WR AVE NN+  WK +P EC  YV  YM+G+ Y  D E V+ EA  YA  V L 
Sbjct  71   KLQCTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVYAKSVELR  130

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D W+FDIDET LSN+PYY      +G   ++  +F+ WV +  +PAI ASL+LY  
Sbjct  131  GDGKDAWIFDIDETLLSNLPYYQEH--GYGLEIFDPVEFDKWVEKAMSPAIEASLKLYEE  188

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            VL LG K   LTG  E  R + + NL  AG   W+KLIL+  +D G  A+ YKS KR E+
Sbjct  189  VLGLGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEM  248

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            V  GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  249  VQEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>ref|XP_010438317.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=257

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLA ETNN   W ++P+ C + V  Y+ G+Q+  D   +A+ AI +A  V + GDG
Sbjct  45   CDSWRLAAETNNAGTWDVIPSVCVDSVADYLNGEQFLSDYNVIADYAIAFAKTVEIPGDG  104

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+W+FDIDET L+NI YY      +G+ P+    FN WV +G APA  ASLRLYN +  
Sbjct  105  KDVWIFDIDETLLTNIDYYKAH--GYGSEPFESNTFNEWVVQGTAPAFDASLRLYNALKK  162

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG   + LTG  E  R     NL++AGY  WE+L+L+G  D G SA  YKS +R++L+  
Sbjct  163  LGFTIILLTGRDEDQRSFTETNLRDAGYSGWERLLLRGPKDQGTSATNYKSEQRSKLIEE  222

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            G++I GN GDQWSDLLG    DR+FKVP+PMYYIA
Sbjct  223  GFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYIA  257



>ref|XP_010249468.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=266

 Score =   220 bits (561),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRL+VETNN+  WK +P  C +++  Y+ G  Y  D + VA+ ++ +A  V LSGDG
Sbjct  54   CDSWRLSVETNNVGFWKKIPQRCASFMKEYISGDHYASDSDVVAQSSLAFAETVELSGDG  113

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D W+FDIDET LSN PYY   D  FG   +++  FN WV   +AP +P S RLY  +  
Sbjct  114  KDAWIFDIDETLLSNFPYYELHD--FGLQEFDERTFNVWVDMAEAPPLPPSQRLYKQLQQ  171

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
            LG   + LTG  EA R+    NL  AGY++WEKLIL+G +D G  A+ YKS KR EL   
Sbjct  172  LGFTLILLTGRSEAQRDATEKNLLVAGYHSWEKLILRGPSDQGKPAIIYKSEKRMELEAE  231

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI G+ GDQWSDLLG     R+FK+P+PMYYIA
Sbjct  232  GYRIHGSSGDQWSDLLGFAMAKRSFKLPNPMYYIA  266



>gb|ABK21327.1| unknown [Picea sitchensis]
 gb|ABR18337.1| unknown [Picea sitchensis]
Length=254

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 142/216 (66%), Gaps = 4/216 (2%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLG-QQYREDCEYVAEEAIKYANGVILSGD  408
            CL+WRL+VET N+++W +VP++C  YV  YM    QY ED +      + YA  V L GD
Sbjct  41   CLAWRLSVETGNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTILGYAKTVKLVGD  100

Query  409  GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVL  588
            G D W+FDIDET LSN+PYY + +  +G   YN T F AWVSE KA  +P+SL LYN +L
Sbjct  101  GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  589  SLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGSAVE-YKSGKRTELVN  765
            + G K   LTG  E  R +   NL  AGY  W+ LIL+GVN+ GSA   YK  KR ELV 
Sbjct  159  ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  766  AGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GYR+ G++GDQWSDL GP    R+FK+P+PMYYI+
Sbjct  219  KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>gb|AFK42878.1| unknown [Medicago truncatula]
 gb|AET02725.2| plant acid phosphatase [Medicago truncatula]
Length=259

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 142/218 (65%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR A E NN+  WK VP EC  +V  YM G+ Y  D E   +EA ++A  V L 
Sbjct  44   SLRCRSWRFAGEANNLSPWKTVPKECAEHVKEYMNGKGYVYDLEIANKEAGEFAKSVKLK  103

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D WVFDIDET LSN+PYYA     +G   ++  KF+ WV +G APAI ASL+LY  
Sbjct  104  EDGLDAWVFDIDETLLSNLPYYAAH--GYGFEVFDHAKFDDWVEKGVAPAIEASLKLYED  161

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            +L+LG K + LTG  E+ R V + NL  AG+ +W +LIL+  +D G  AV YKS KR+E+
Sbjct  162  ILNLGYKVILLTGRSESHRAVTVDNLINAGFRDWHQLILRSSDDKGKLAVIYKSEKRSEM  221

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               G+RI+GN GDQWSDLLG     R+FK+P+PMY+IA
Sbjct  222  EKEGFRILGNSGDQWSDLLGSSVSVRSFKLPNPMYFIA  259



>ref|XP_002283385.2| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=307

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 143/214 (67%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWR  VETN+   W  VP  C  +V  YM G +YR D E+ A++++ +A  V ++GDG
Sbjct  95   CDSWRFTVETNDAGVWVSVPDRCVQWVKDYMTGDRYRSDSEFAADDSLSFAKTVQIAGDG  154

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+WVFDIDET LSN+PYYA     FG+  ++D+ F+ WV+  +APA+ ASLRLY  V  
Sbjct  155  KDVWVFDIDETLLSNLPYYAAH--GFGSEAFDDSTFDEWVNLAEAPALQASLRLYREVEQ  212

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG K V +TG  E  R V   NL  AGY NWE+L L+G  D+G +A+ YKS KR EL + 
Sbjct  213  LGFKIVLITGRIEPQRNVTEKNLVYAGYSNWERLFLRGRADSGKTALVYKSEKRRELEDE  272

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            GYRI G+ GDQWSDLLG     R+FK+P+PMYYI
Sbjct  273  GYRIHGSSGDQWSDLLGFAIARRSFKLPNPMYYI  306



>ref|XP_010925515.1| PREDICTED: acid phosphatase 1-like isoform X2 [Elaeis guineensis]
Length=254

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 143/214 (67%), Gaps = 5/214 (2%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRL+VETNN   W+ +PA C  +V  YM G++Y  D + VA E++ +A  V ++GDG
Sbjct  44   CDSWRLSVETNNAGYWETIPARCLQFVAEYMNGERYASDSDVVAAESLAFAQTVQVAGDG  103

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+W+FD+DET LSN+PYY   DV  G   +N+T F+ WV+  KAPA+ ASLRLY  +L 
Sbjct  104  KDVWIFDVDETLLSNVPYY---DV-HGWEEFNETAFDEWVNLAKAPALQASLRLYEELLG  159

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG + + LTG  EA R     NL   GY++W++ IL+  +D G  AV YKS +R +L   
Sbjct  160  LGFQMILLTGRAEAQRNATEKNLSFVGYHSWKRFILREASDIGKKAVTYKSERRAQLEAQ  219

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            GYRI GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  220  GYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  253



>ref|XP_009795729.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=267

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 153/247 (62%), Gaps = 16/247 (6%)
 Frame = +1

Query  151  PYIQQVVEIHRLRPQTGSAGHRVPQ-----IDCLSWRLAVETNNIRDWKLVPAECENYVG  315
            P I +++ I+R R        ++P+     + C SWR  VETN+   W L+P  C ++V 
Sbjct  31   PEILELLTINRHR--------KIPKDNNNALYCESWRFTVETNDAGLWALIPERCASFVQ  82

Query  316  HYMLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGA  495
             YM G +Y  DC  VA+ ++ +AN V +S DG D WVFDIDET LSN+PYY      FG+
Sbjct  83   DYMNGDRYSSDCGAVADLSLAFANTVKVSNDGKDAWVFDIDETLLSNLPYYVTH--GFGS  140

Query  496  VPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGY  675
              +++  F+ WV+E +APAIPASL+LY  +   G K   LTG  E  R     NL  AGY
Sbjct  141  EIFDEIAFDKWVNEAEAPAIPASLKLYKELQQRGFKIFLLTGRSEFQRNYTEKNLVYAGY  200

Query  676  YNWEKLILKGVNDTGS-AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVP  852
             NWE+LIL+G +D G  A +YKS KR EL + GYRI G+ GDQWSDL G     R+FK+P
Sbjct  201  SNWERLILRGPSDKGKLATQYKSEKRKELEDEGYRIHGSSGDQWSDLNGFAVATRSFKLP  260

Query  853  DPMYYIA  873
            +PMYYIA
Sbjct  261  NPMYYIA  267



>ref|XP_002514195.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
 gb|EEF48149.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
Length=251

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 144/227 (63%), Gaps = 3/227 (1%)
 Frame = +1

Query  193  QTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEA  372
            Q  +A  +   + C SWRL+VETNN   W  VP+ CE+YV  YM   ++  D E VA ++
Sbjct  26   QIPTARSKDDDLYCDSWRLSVETNNAGYWVNVPSRCESYVQQYMTSDRFLSDFEVVASDS  85

Query  373  IKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPA  552
            + +A  V ++GDG D WVFDIDET LSN+PYY      FG+ P+++  F+ WV   +APA
Sbjct  86   LSFAKSVNITGDGKDAWVFDIDETLLSNLPYYEVH--GFGSQPFDENAFDQWVDLAEAPA  143

Query  553  IPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AV  729
            + ASL LY  +  LG     LTG  E  R+  + +L  AGY +WE L L+GV D G+ A 
Sbjct  144  LQASLNLYKELKHLGFTIFLLTGRSENQRDATVKDLLFAGYSDWEGLFLRGVTDQGTPAT  203

Query  730  EYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             YKS KR ELVN GYRI G+ GDQWSDL+G     R+FK+P+PMYYI
Sbjct  204  VYKSQKRMELVNEGYRIHGSSGDQWSDLVGFAVAKRSFKLPNPMYYI  250



>ref|XP_007135620.1| hypothetical protein PHAVU_010G144200g [Phaseolus vulgaris]
 gb|ESW07614.1| hypothetical protein PHAVU_010G144200g [Phaseolus vulgaris]
Length=270

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 152/234 (65%), Gaps = 6/234 (3%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            ++  L+ +TGS      Q+ C SWRL VE NN+  WK VPA C+ YV  Y+LG QYR D 
Sbjct  40   QVFPLQMKTGSNEQYSTQVSCTSWRLGVEANNLIKWKTVPAACQEYVADYLLGDQYRSDS  99

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V  EA  YA  + ++    D++VFDID+TTLSN+ Y+A     FG   +N T F  WV
Sbjct  100  KTVCREAYFYAKRLNITAK--DVFVFDIDDTTLSNLQYFANH--GFGVEAHNATAFKIWV  155

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILK--G  705
            S G+A A+P +L LYN ++SLGIK VF+T      ++V I+NL+E G++ WEKLI +   
Sbjct  156  SFGEAFALPETLVLYNKLVSLGIKVVFITERPVDLKDVTISNLKEVGFHTWEKLIARDPA  215

Query  706  VNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYY  867
            +     +  +K+ +R +LV  GYRIVGN+GDQWSD++G   G RTFK+P+P+YY
Sbjct  216  IYSGKLSNAFKTSERKKLVAEGYRIVGNIGDQWSDIVGEKKGFRTFKLPNPLYY  269



>ref|XP_009352576.1| PREDICTED: acid phosphatase 1 [Pyrus x bretschneideri]
Length=258

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 143/226 (63%), Gaps = 7/226 (3%)
 Frame = +1

Query  211  HRVPQID----CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIK  378
            HRV   D    C SWR +VETN+   W  +P+ C  +V +YM G +Y  D   VA  ++ 
Sbjct  35   HRVSASDDSLFCDSWRFSVETNDAGTWSNIPSRCVGFVQNYMTGDRYLSDSAAVANFSLS  94

Query  379  YANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIP  558
            +A GV + GDG D WVFDIDET LSN+PYY      FG+  +++  F+ WV   +APA+P
Sbjct  95   FAKGVTIGGDGKDAWVFDIDETLLSNLPYYQAH--GFGSETFDEASFDEWVELAEAPALP  152

Query  559  ASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEY  735
            ASL LY+ +  LG K   LTG  E  R     NL  AGY NWE+L+L+G +D G+ A  +
Sbjct  153  ASLNLYSQLERLGFKIFLLTGRSEYQRNATAKNLLVAGYNNWERLLLRGPSDQGTLATVF  212

Query  736  KSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            KS KR+ L+N GYRI G+ GDQWSDL+G     R+FK+P+PMYYIA
Sbjct  213  KSQKRSNLINEGYRIHGSSGDQWSDLVGFAIAQRSFKLPNPMYYIA  258



>ref|XP_006284398.1| hypothetical protein CARUB_v10005568mg [Capsella rubella]
 gb|EOA17296.1| hypothetical protein CARUB_v10005568mg [Capsella rubella]
Length=253

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 145/224 (65%), Gaps = 7/224 (3%)
 Frame = +1

Query  214  RVPQID----CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKY  381
            ++P+ D    C SWRLA ETNN   W ++P+ C + V  Y+ G Q+  D   +A+ A+ +
Sbjct  31   KLPRSDGSRYCDSWRLAAETNNAGTWDVIPSVCVDPVADYLNGDQFLSDYNVIADYALSF  90

Query  382  ANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPA  561
            A  V +SGDG D+WVFDIDET L+NI YY      +G+ PY+   F+ WV +G APA  A
Sbjct  91   AKSVDISGDGKDVWVFDIDETLLTNIDYYKAH--GYGSEPYDSNSFSEWVLQGTAPAFDA  148

Query  562  SLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYK  738
            SL+LYN +  LG   + LTG  E  R     NL++AGY  WE+L+L+G  D G SA +YK
Sbjct  149  SLKLYNALQKLGFTIILLTGRDEDQRSFTETNLRDAGYSGWERLLLRGPEDQGKSATDYK  208

Query  739  SGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            S +R +L+  G++I GN GDQWSDLLG    DR+FKVP+PMYYI
Sbjct  209  SEQRAKLIEEGFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYI  252



>emb|CDY14217.1| BnaA08g13480D [Brassica napus]
Length=265

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 144/228 (63%), Gaps = 4/228 (2%)
 Frame = +1

Query  199  GSAGHRVPQID--CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEA  372
            G  G R    D  C SWRLAVETNN   W ++P+ C + V  Y+ G QY  D + + + A
Sbjct  37   GRDGSRSAAADTFCESWRLAVETNNAGTWDVLPSSCVDSVARYLNGDQYGSDYDVIVDYA  96

Query  373  IKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFG-AVPYNDTKFNAWVSEGKAP  549
            + +A  V + GDG D+W+FDIDET L+NI YY         + P++   FN WV +G AP
Sbjct  97   LAFAKTVKIYGDGKDVWIFDIDETLLTNIGYYKNHGYGVSRSEPFDSKSFNEWVVQGTAP  156

Query  550  AIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SA  726
            A  ASLR+YN +  LG   V LTG  E  R V   NL++ GY  WE+LIL+G +D G SA
Sbjct  157  AFAASLRMYNALKKLGFTIVLLTGRDEDQRNVTETNLRDVGYSGWERLILRGPDDQGKSA  216

Query  727  VEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              YKS +R++L++ G++I GN GDQWSDLLG    DR+FKVP+PMYYI
Sbjct  217  TNYKSEQRSKLIDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  264



>ref|XP_006284235.1| hypothetical protein CARUB_v10005397mg, partial [Capsella rubella]
 gb|EOA17133.1| hypothetical protein CARUB_v10005397mg, partial [Capsella rubella]
Length=290

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 139/216 (64%), Gaps = 3/216 (1%)
 Frame = +1

Query  229  DCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGD  408
            +C SWRLA ETNN   W +VP+ C N V +Y+ G Q+  D   VA  AI YA  + L  D
Sbjct  77   NCESWRLASETNNAGSWNVVPSRCVNSVKNYINGGQFENDYNIVARYAIAYAKRINLGRD  136

Query  409  GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVL  588
            G D WVFDIDET LSN+ YY      +G+ PY++ KFN W  +GKA +   SLRLY  + 
Sbjct  137  GKDAWVFDIDETLLSNLDYYKVH--GYGSEPYDNAKFNEWAVQGKASSFDGSLRLYKALK  194

Query  589  SLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVN  765
             LG   + LTG  E  R +   NL+ AGY+ W +LIL+G ND G +A++YKS +R+++V 
Sbjct  195  KLGFTIILLTGRDENQRSITEKNLRNAGYFGWNRLILRGKNDQGKTAIQYKSEQRSKVVK  254

Query  766  AGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GY+I GN GDQWSDL G     R+FKVP+PMYYIA
Sbjct  255  EGYKIHGNTGDQWSDLQGFAVATRSFKVPNPMYYIA  290



>gb|ACJ84626.1| unknown [Medicago truncatula]
Length=259

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 141/218 (65%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
             + C SWR A E NN+  WK VP EC  +V  YM G+ Y  D E   +EA ++A  V L 
Sbjct  44   SLRCRSWRFAGEANNLSPWKTVPKECAEHVKEYMNGKGYVYDLEIANKEAGEFAKSVKLK  103

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
             DG D WVFDIDET LSN+PYYA     +G   ++  KF+ WV +G  PAI ASL+LY  
Sbjct  104  EDGLDAWVFDIDETLLSNLPYYAAH--GYGFEVFDHAKFDDWVEKGVTPAIEASLKLYED  161

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTEL  759
            +L+LG K + LTG  E+ R V + NL  AG+ +W +LIL+  +D G  AV YKS KR+E+
Sbjct  162  ILNLGYKVILLTGRSESHRAVTVDNLINAGFRDWHQLILRSSDDKGKLAVIYKSEKRSEM  221

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
               G+RI+GN GDQWSDLLG     R+FK+P+PMY+IA
Sbjct  222  EKEGFRILGNSGDQWSDLLGSSVSVRSFKLPNPMYFIA  259



>gb|AFX67034.1| stem 28 kDa glycoprotein [Solanum tuberosum]
Length=138

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  322  MLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVP  501
            MLG+QYR DCEYVA++AI+YA  + LSGDG D+WVFDIDETTLSN PYYARSDVAFGA+ 
Sbjct  1    MLGKQYRHDCEYVAKQAIEYAKSLKLSGDGMDVWVFDIDETTLSNSPYYARSDVAFGAIA  60

Query  502  YNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYN  681
            YN TKFN W +EGK PAIP+ L LY  VLSLGIKPVF+TGT++ F++VRIANL++AGY N
Sbjct  61   YNATKFNEWTAEGKLPAIPSILGLYKIVLSLGIKPVFITGTRDNFKQVRIANLKKAGYTN  120

Query  682  WEKLILKGVNDTGSAVEY  735
            W  LILKG ND+GSAV++
Sbjct  121  WAALILKGENDSGSAVKF  138



>ref|XP_006421584.1| hypothetical protein CICLE_v10005566mg [Citrus clementina]
 gb|ESR34824.1| hypothetical protein CICLE_v10005566mg [Citrus clementina]
Length=286

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 138/214 (64%), Gaps = 3/214 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C +WR AVE NN+  WK +P EC  YV  YM+G+ Y  D E V+ EA  +A  V L GDG
Sbjct  74   CTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVFAKSVELRGDG  133

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D W+FDIDET LSN+PYY   +  +G   ++  +F+ WV +  +PAI ASL+LY  VL 
Sbjct  134  KDAWIFDIDETLLSNLPYY--QEHGYGLEIFDPVEFDKWVEKAMSPAIEASLKLYEEVLG  191

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
            LG K   LTG  E  R + + NL  AG   W+KLIL+  +D G  A+ YKS KR E+V  
Sbjct  192  LGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMVQE  251

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  252  GYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>gb|ADE76411.1| unknown [Picea sitchensis]
Length=254

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 142/216 (66%), Gaps = 4/216 (2%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYML-GQQYREDCEYVAEEAIKYANGVILSGD  408
            C  WRL+VE+ N+RDW +VP++C  YV  YM+   QY ED +      ++Y   + L GD
Sbjct  41   CEGWRLSVESGNLRDWDVVPSKCVGYVQKYMMTAGQYWEDSKVAVFTILEYVKTLKLVGD  100

Query  409  GTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVL  588
            G D WVFDIDET LSNIPYY + +  +G   ++   F AWV E K+PA+P+SL LYN +L
Sbjct  101  GKDAWVFDIDETLLSNIPYYQQHE--YGGKAFDSKTFEAWVLEMKSPALPSSLLLYNRLL  158

Query  589  SLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVN  765
            + G K   LTG  E+ R   + NL +AGY  W  LIL+GVN+ GS A  YK  KR ELV 
Sbjct  159  ARGFKIFLLTGRDESQRNGTVHNLFQAGYKGWAGLILRGVNEQGSQASAYKPEKRAELVK  218

Query  766  AGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             GYR+ G++GDQWSDL GP    R+FK+P+PMYYI+
Sbjct  219  KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>ref|XP_008367917.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=259

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/243 (46%), Positives = 151/243 (62%), Gaps = 14/243 (6%)
 Frame = +1

Query  160  QQVVEIHRLRPQTGSAGHRVPQID----CLSWRLAVETNNIRDWKLVPAECENYVGHYML  327
            Q ++++ + R       HRV   D    C SWR +VETN+   W  +P+ C  +V +YM 
Sbjct  26   QSIIQMPKKR-------HRVYASDDSLFCDSWRFSVETNDAGTWSNIPSRCVGFVQNYMT  78

Query  328  GQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYN  507
            G +Y  D   VA  ++ +A GV + GDG D WVFDIDET LSN+PYY      FG+  ++
Sbjct  79   GARYPSDSAAVANFSLSFAKGVTIGGDGKDAWVFDIDETLLSNLPYYQAH--GFGSETFD  136

Query  508  DTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWE  687
            +  F+ WV   +APA+PASL LY+ +  LG K   LTG  E  R     NL  AGY NWE
Sbjct  137  EASFDEWVELAEAPALPASLNLYSQLERLGFKIFLLTGRSEYQRNATAKNLLFAGYNNWE  196

Query  688  KLILKGVNDTGS-AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMY  864
            +L+L+G +D G+ A  +KS KR++L+N GYRI G+ GDQWSDL+G     R+FK+P+PMY
Sbjct  197  RLLLRGPSDQGTLATVFKSQKRSDLINEGYRIHGSSGDQWSDLVGFAIAQRSFKLPNPMY  256

Query  865  YIA  873
            YIA
Sbjct  257  YIA  259



>ref|XP_007202474.1| hypothetical protein PRUPE_ppa010268mg [Prunus persica]
 gb|EMJ03673.1| hypothetical protein PRUPE_ppa010268mg [Prunus persica]
Length=256

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 141/224 (63%), Gaps = 5/224 (2%)
 Frame = +1

Query  211  HRVP--QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYA  384
            HR+    + C SWR +VETN+   W  +P+ C  +V  YM G +Y  D   VA  ++ +A
Sbjct  35   HRITDDNLYCDSWRFSVETNDAGTWTSIPSRCVAFVQDYMTGDRYLSDSAAVANYSLSFA  94

Query  385  NGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPAS  564
             GV + GDG D WVFDIDET LSN PYY      FG+  +++  F+ WV   KAPA+PAS
Sbjct  95   RGVQIGGDGKDAWVFDIDETLLSNFPYYQAH--GFGSETFDEASFDEWVDLAKAPALPAS  152

Query  565  LRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKS  741
            L+LY  +  LG K   LTG  E  R     NL  A Y NWE+L+L+G +D G +A  YKS
Sbjct  153  LKLYKELQELGFKIFLLTGRSEHQRNATAKNLLYARYNNWERLLLRGPSDQGTTATVYKS  212

Query  742  GKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             KR++L+N GYRI G+ GDQWSDLLG     R+FK+P+PMYYIA
Sbjct  213  EKRSDLINEGYRIHGSSGDQWSDLLGFAVAQRSFKLPNPMYYIA  256



>ref|XP_010541004.1| PREDICTED: acid phosphatase 1 [Tarenaya hassleriana]
Length=252

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 151/241 (63%), Gaps = 11/241 (5%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQID--------CLSWRLAVETNNIRDWKLVPAECENYVGHYMLG  330
            +H + P   SA  ++P  +        C SWRLAVET N   W  +P +C++YV  Y+ G
Sbjct  13   LHLIFPAAVSAVIQLPGGESFSAESTYCESWRLAVETYNAGTWYGIPKKCQDYVVAYLTG  72

Query  331  QQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYND  510
            +QY  D E   + AI +A  V +SGDG D W+FD+DET L+NI YY      +G+ PYN+
Sbjct  73   EQYDSDYETAVDYAIDFAKTVKISGDGKDAWIFDVDETLLTNIDYYKAH--GYGSEPYNE  130

Query  511  TKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEK  690
              FN WV  G APA  ASLRLY+ +  +G   + LTG  E  R +   NL +AGY  W +
Sbjct  131  ESFNEWVETGAAPAFDASLRLYSELKKIGFAIIILTGRDEEQRSITEKNLGDAGYSGWSR  190

Query  691  LILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYY  867
            LIL+G  + G SA  +KSG+R+EL+  GYRI G++GDQW+DLLG    +R+FKVP+PMYY
Sbjct  191  LILRGPENKGKSATIFKSGERSELIKKGYRIHGSIGDQWTDLLGFPVAERSFKVPNPMYY  250

Query  868  I  870
            +
Sbjct  251  V  251



>ref|XP_010098160.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXB74597.1| Acid phosphatase 1 [Morus notabilis]
Length=214

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 143/236 (61%), Gaps = 47/236 (20%)
 Frame = +1

Query  166  VVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRE  345
            V +I+ LRPQ GS G     + CLSWR  VETNNI DW+ VP EC  YVG+YMLGQQYR+
Sbjct  26   VNQIYLLRPQYGSGGRN--GVTCLSWRFGVETNNIIDWETVPEECALYVGNYMLGQQYRQ  83

Query  346  DCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNA  525
            D + V +EA +YA  +IL+ DG D+W+FDIDETTLSN+P+YAR    FG  P++   FN 
Sbjct  84   DSKAVVKEAYRYAKSLILADDGKDVWIFDIDETTLSNLPFYAR--YGFGVKPHDAELFNE  141

Query  526  WVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKG  705
            WV    APA+P SL+L                                            
Sbjct  142  WVLTESAPALPESLKL-------------------------------------------D  158

Query  706  VNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             N + +AVEYKS +R +L +AGY+IVGN+GDQWSDLLG + G RTFK+PDPMYY++
Sbjct  159  SNYSITAVEYKSAERKKLEDAGYKIVGNIGDQWSDLLGTNTGCRTFKLPDPMYYVS  214



>ref|NP_001242215.1| uncharacterized protein LOC100795218 precursor [Glycine max]
 gb|ACU20782.1| unknown [Glycine max]
 gb|ACU22719.1| unknown [Glycine max]
 gb|KHN05324.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=255

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 151/230 (66%), Gaps = 6/230 (3%)
 Frame = +1

Query  184  LRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVA  363
            L+ +TG  G    ++ C SWRL VE NN+  W+ VPA C  Y+  Y+LG QYR D + V 
Sbjct  29   LQMKTGFGGQYSNEVACASWRLGVEANNVVKWQTVPAACGEYIADYVLGDQYRSDSKTVN  88

Query  364  EEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGK  543
            ++A  YA  + L+    D++V D+D+TTLSN+ Y+A     FG  P+N T F  WV +G+
Sbjct  89   QQAYFYAKSLKLTNK--DVFVLDVDDTTLSNLQYFANH--GFGVEPHNTTAFKNWVLDGE  144

Query  544  APAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS  723
            A A+P +L++YN +L+LGIK VFL+    +  +V   NL+E G+  WEKLIL+  ++   
Sbjct  145  AFALPETLKMYNKLLALGIKIVFLSERPLSLGDVTAKNLKEVGFNTWEKLILRDPSEYSG  204

Query  724  --AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYY  867
              + EYKS +R +L   GYRI+GN+GDQWSDLLG + G RTFK+P+P+YY
Sbjct  205  KLSFEYKSAEREKLEKEGYRIIGNVGDQWSDLLGSNKGTRTFKLPNPLYY  254



>ref|XP_008242463.1| PREDICTED: acid phosphatase 1 [Prunus mume]
Length=256

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 142/224 (63%), Gaps = 5/224 (2%)
 Frame = +1

Query  211  HRVP--QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYA  384
            HR+    + C SWR ++ETN+   W  +P+ C  +V  YM G +Y  D   V+  ++ +A
Sbjct  35   HRITDDNLYCDSWRFSIETNDAGTWTSIPSRCVAFVQDYMTGDRYLSDSAAVSNYSLSFA  94

Query  385  NGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPAS  564
             GV + GDG D WVFDIDET LSN+PYY      FG+  +++  F+ WV   KAPA+PAS
Sbjct  95   RGVQIGGDGKDAWVFDIDETLLSNLPYYEAH--GFGSETFDEASFDEWVDLAKAPALPAS  152

Query  565  LRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKS  741
            L+LY  +  LG K   LTG  E  R     NL  A Y NWE+L+L+G +D G +A  YKS
Sbjct  153  LKLYKELQQLGFKIFLLTGRSEHQRNATAKNLLYARYNNWERLLLRGPSDQGTTATVYKS  212

Query  742  GKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             KR++L+N GYRI G+ GDQWSDLLG     R+FK+P+PMYYIA
Sbjct  213  EKRSDLINEGYRIHGSSGDQWSDLLGFAVAQRSFKLPNPMYYIA  256



>ref|XP_004245159.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=269

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 141/226 (62%), Gaps = 7/226 (3%)
 Frame = +1

Query  211  HR-VPQID---CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIK  378
            HR +P  D   C SWR  VETNN   W ++P  C ++V  Y  G +Y  D   VA+ ++ 
Sbjct  46   HRKIPNDDALYCDSWRFTVETNNAGLWSMIPQRCISFVQDYTTGDRYSSDSAAVADLSLA  105

Query  379  YANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIP  558
            +AN V +S DG D WVFDIDET LSN+PYY      FG+  +++  F+ WV+E  APAIP
Sbjct  106  FANTVNVSNDGMDAWVFDIDETLLSNLPYYVEH--GFGSQIFDEITFDKWVNEANAPAIP  163

Query  559  ASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEY  735
            ASL+LY  +   G     LTG  E  R     N+  AGY NWE+LIL+G +D G  A EY
Sbjct  164  ASLKLYKELQQRGFTIFLLTGRIENQRNKTERNMVHAGYSNWERLILRGPSDKGKLATEY  223

Query  736  KSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            KS KR EL + GYRI GN GDQWSDL G    +R+FK+P+PMYYIA
Sbjct  224  KSEKRKELEDEGYRIRGNSGDQWSDLTGFAVAERSFKLPNPMYYIA  269



>ref|XP_008437018.1| PREDICTED: acid phosphatase 1 [Cucumis melo]
Length=266

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 141/218 (65%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR  VE NN+  WK +P  C  YV  Y+ G+ Y+ + E  + EA  +A  V L 
Sbjct  51   KLRCDSWRFNVEANNLNPWKTIPKNCSEYVKQYVTGRAYQLELEIASNEAEIFAKTVKLV  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+W+FDIDET LSN+PYY  +D  +G+  +   +F+ WV +  AP +  SL LY  
Sbjct  111  GDGKDVWIFDIDETLLSNLPYY--TDHGYGSESFKPDEFDNWVEKATAPPLQPSLELYKE  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            +L LG K V LTG  E  RE    NL  AG+Y+W++L+L+  +D G SA+ YKS KR+E+
Sbjct  169  LLDLGFKLVLLTGRSEKQRESTTRNLINAGFYDWDRLVLRRDDDQGKSAILYKSEKRSEM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             N G RI+GN GDQWSDLLG     R+FK+P+PMYYI+
Sbjct  229  ENEGLRIIGNSGDQWSDLLGTSVSVRSFKLPNPMYYIS  266



>ref|XP_006359744.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=268

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 136/215 (63%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWR  VETNN   W ++P  C ++V  Y  G +Y  D   VA+ ++ +AN V +S DG
Sbjct  56   CDSWRFTVETNNAGLWSIIPERCISFVQEYTTGDRYSSDSAAVADLSLAFANTVKVSNDG  115

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSN+PYY      FG+  +++  F+ WV+E  APAIPASL+LY  +  
Sbjct  116  MDAWVFDIDETLLSNLPYYVEH--GFGSQIFDENAFDKWVNEANAPAIPASLKLYKELQQ  173

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKRTELVNA  768
             G     LTG  E  R     N+  AGY NWE+LIL+G +D G  A +YKS KR EL + 
Sbjct  174  RGFTIFLLTGRSEYQRNNTEKNMVHAGYSNWERLILRGPSDKGKLATQYKSEKRKELEDE  233

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYRI GN GDQWSDL+G     R+FK+P+PMYYIA
Sbjct  234  GYRIRGNSGDQWSDLMGFAVAQRSFKLPNPMYYIA  268



>gb|EMT02058.1| Stem 28 kDa glycoprotein [Aegilops tauschii]
Length=182

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 131/184 (71%), Gaps = 2/184 (1%)
 Frame = +1

Query  322  MLGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVP  501
            MLG+ +  D + V ++A+ Y + + L+G+G ++WVFDIDETTLSN+PYYA+    FGA P
Sbjct  1    MLGKHFHRDSKIVIDQALAYVDSLKLAGNGKEVWVFDIDETTLSNLPYYAKH--GFGATP  58

Query  502  YNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYN  681
            +N T FNA V EG APA+P + RLYN + S+GIKPVFLTG  E  R + + NL+  G   
Sbjct  59   FNATSFNANVLEGSAPALPETKRLYNKLRSVGIKPVFLTGRTEDQRAITVTNLRRQGISG  118

Query  682  WEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPM  861
            W  L+LK     GSAV YKSGKR +L +AGY IVGN+GDQWSD+LG   G RTFK+PDPM
Sbjct  119  WMNLLLKQPGFNGSAVTYKSGKRQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPM  178

Query  862  YYIA  873
            YYI 
Sbjct  179  YYIG  182



>gb|EEE62606.1| hypothetical protein OsJ_17409 [Oryza sativa Japonica Group]
Length=252

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 143/240 (60%), Gaps = 42/240 (18%)
 Frame = +1

Query  175  IHRLRPQTGSAGHRVPQ--IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYRED  348
            IH LRP  GS      +  + C SWRL VE +N+ DW+ VPAECE Y+GHYMLG+ YR D
Sbjct  48   IHALRPLLGSGRQLAARAGVACDSWRLGVEAHNVIDWRTVPAECEGYIGHYMLGEHYRRD  107

Query  349  CEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAW  528
               V +EA+ YA  + L+G+G +IWVFDIDET+LSN+PYYA+    FGA PYN T F   
Sbjct  108  FAVVVDEAVAYAETLKLAGNGKEIWVFDIDETSLSNLPYYAKH--GFGATPYNATSFR--  163

Query  529  VSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILK-G  705
                                             E  R + + NL   G+  WEKL+LK  
Sbjct  164  -------------------------------RTEDQRTITVTNLHRQGFSGWEKLLLKPA  192

Query  706  VNDT----GSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            V+ T    GSAVEYKSG+R +L +AG+ IVGN+GDQWSD+LG   G RTFK+PDP+YYI 
Sbjct  193  VHATGELQGSAVEYKSGERQKLQDAGFIIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  252



>ref|XP_010433115.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=254

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLA ETNN   W ++P+ C + V  Y+ G+Q+  D   +A+  I +A  V +SGD 
Sbjct  42   CDSWRLAAETNNAGTWDVIPSVCVDSVADYLNGEQFLSDYNVIADYVIAFAKTVEISGDD  101

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D+W+FDIDET L+NI YY      +G+ P++   +N WV +G APA  ASLRLYN +  
Sbjct  102  KDVWIFDIDETLLTNIDYYKAH--GYGSEPFDSNSYNEWVVQGTAPAFDASLRLYNALKK  159

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG   + LTG  E  R     NL++ GY  WE+L+L+G  D G SA  YKS +R++L+  
Sbjct  160  LGFTIILLTGRDEDQRSFTETNLRDVGYSGWERLLLRGPKDQGTSATNYKSEQRSKLIEE  219

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            G++I GN GDQWSDLLG    DR+FKVP+PMYYIA
Sbjct  220  GFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYIA  254



>ref|XP_002309231.2| hypothetical protein POPTR_0006s15760g [Populus trichocarpa]
 gb|EEE92754.2| hypothetical protein POPTR_0006s15760g [Populus trichocarpa]
Length=247

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 137/220 (62%), Gaps = 3/220 (1%)
 Frame = +1

Query  214  RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGV  393
            R   + C  WR +VETN++  W  VP+ C +YV  YM G  YR D E  A  A+ +A  V
Sbjct  29   RDHDVYCNGWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVAASYALGFAKTV  88

Query  394  ILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRL  573
             ++GDG D WVFD+DET LSN+PYYA     FG+ P+++  F+ WV   KAPA+ ASL L
Sbjct  89   EIAGDGKDAWVFDVDETLLSNLPYYAVH--GFGSEPFDELSFDEWVDLAKAPALQASLNL  146

Query  574  YNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKR  750
            Y  +  LG     LTG  E  R     NLQ  GY +WE+LIL+  +D G  A  YKS +R
Sbjct  147  YKELKQLGFTVFMLTGRSEHQRNATAKNLQLEGYSDWERLILRESSDQGKPATFYKSQRR  206

Query  751  TELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             ELVN GYRI GN GDQWSDL G    +R+FK+P+P+YYI
Sbjct  207  LELVNEGYRIHGNSGDQWSDLFGFAVSERSFKLPNPLYYI  246



>ref|XP_004143740.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 gb|KGN50316.1| hypothetical protein Csa_5G167080 [Cucumis sativus]
Length=266

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 140/218 (64%), Gaps = 3/218 (1%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILS  402
            ++ C SWR  VE NN+  WK +P  C  YV  Y+ G+ Y+ + E  + EA  +A  V L 
Sbjct  51   KLRCDSWRFNVEANNLNPWKRIPESCSEYVKQYVTGRAYQLELEIASNEAQVFAKTVKLV  110

Query  403  GDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNT  582
            GDG D+WVFDIDET LSN+PYY  +D  +G+  +   +F+ WV +  AP +  SL  Y  
Sbjct  111  GDGKDVWVFDIDETLLSNLPYY--TDHGYGSENFKPDEFDNWVEKATAPPLQPSLEFYKE  168

Query  583  VLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTEL  759
            +L LG K V LTG  E  RE    NL  AG+Y+W++LIL+  +D G SA+ YKS KR+E+
Sbjct  169  LLDLGFKLVLLTGRSEKQRECTTRNLINAGFYDWDRLILRRDDDQGKSAILYKSEKRSEM  228

Query  760  VNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             N G RI+GN GDQWSDLLG     R+FK+P+PMYYI+
Sbjct  229  ENEGLRIIGNSGDQWSDLLGTSVSVRSFKLPNPMYYIS  266



>emb|CDY14216.1| BnaA08g13470D [Brassica napus]
Length=263

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 136/215 (63%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLAVET+N   WK+VP++C + +  Y    Q+ +D   VA  A  YA  + L GDG
Sbjct  51   CASWRLAVETDNAGKWKVVPSQCVSSLETYYDKGQFDKDYSVVAGYAYAYAKTITLKGDG  110

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSN+ YY      +G+ PYN   FN WV +G AP   ASL+L+N +  
Sbjct  111  KDAWVFDIDETLLSNLEYYKAH--GYGSEPYNSLAFNEWVLQGTAPGFAASLKLFNRLKK  168

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG   + LTG  E  R V   NL +AGY  WE L+L+G  D G +A +YKS +R+ +V  
Sbjct  169  LGFALILLTGRDEVQRSVTEQNLLDAGYSGWEYLLLRGHQDQGKAAAQYKSEQRSRMVKK  228

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYR+ GN GDQWSDL G    DR+FKVP+PMYYIA
Sbjct  229  GYRLHGNTGDQWSDLQGFSVADRSFKVPNPMYYIA  263



>gb|AGV54493.1| acid phosphatase [Phaseolus vulgaris]
Length=256

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 149/234 (64%), Gaps = 6/234 (3%)
 Frame = +1

Query  172  EIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDC  351
            ++  L+ +TGS      Q+ C SWRL VE NN+  WK VPA C+ YV  Y+LG QYR D 
Sbjct  26   QVFPLQMKTGSNEQYSTQVSCTSWRLGVEANNLIKWKTVPAACQEYVADYLLGDQYRSDS  85

Query  352  EYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWV  531
            + V  EA  YA    L+    D++VFDID+TTLSN+ Y+A     FG   +N T F  WV
Sbjct  86   KTVCREAYFYAK--TLNITARDVFVFDIDDTTLSNLQYFANH--GFGVEAHNATAFKIWV  141

Query  532  SEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILK--G  705
            S G+A A+P +L LYN ++ LGIK VF+T      ++V I+NL+E G++ WEK I +   
Sbjct  142  SFGEAFALPETLVLYNKLVGLGIKVVFITERPVDLKDVTISNLKEVGFHTWEKFIARDPA  201

Query  706  VNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYY  867
            +     +  +K+ +R +LV  GYRIVGN+GDQWSD++G   G RTFK+P+P+YY
Sbjct  202  IYSGKLSNAFKTSERKKLVAEGYRIVGNIGDQWSDIVGEKKGFRTFKLPNPLYY  255



>ref|XP_009109045.1| PREDICTED: acid phosphatase 1-like [Brassica rapa]
Length=263

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 136/215 (63%), Gaps = 3/215 (1%)
 Frame = +1

Query  232  CLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSGDG  411
            C SWRLAVET+N   WK+VP++C + +  Y    Q+ +D   VA  A  YA  + L GDG
Sbjct  51   CASWRLAVETDNAGKWKVVPSQCVSSLETYYDKGQFDKDYSVVAGYAYAYAKTITLKGDG  110

Query  412  TDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLS  591
             D WVFDIDET LSN+ YY      +G+ PYN   FN WV +G AP   ASL+L+N +  
Sbjct  111  KDAWVFDIDETLLSNLEYYKAH--GYGSEPYNSLAFNEWVLQGTAPGFAASLKLFNRLKK  168

Query  592  LGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKRTELVNA  768
            LG   + LTG  E  R V   NL +AGY  WE L+L+G  D G +A +YKS +R+ +V  
Sbjct  169  LGFALILLTGRDEVQRSVTEQNLLDAGYSGWEYLLLRGHQDQGKAAAQYKSEQRSRMVKE  228

Query  769  GYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
            GYR+ GN GDQWSDL G    DR+FKVP+PMYYIA
Sbjct  229  GYRLHGNTGDQWSDLQGFSVADRSFKVPNPMYYIA  263



>ref|XP_004964488.1| PREDICTED: acid phosphatase 1-like isoform X1 [Setaria italica]
Length=369

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 137/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C SWRLA E NN+  WK VPA C  +V  Y+ G  YR D + +A E+  YA    L G
Sbjct  155  VRCASWRLAAEANNLAPWKAVPAGCAAHVRDYIAGAAYRSDLDLIARESTTYARAAPLRG  214

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG D WVFDIDET LSN+PYYA     +G   ++  KF+ WV  G+A AIP+SL+LYN V
Sbjct  215  DGRDAWVFDIDETLLSNLPYYAEH--GYGLELFDHQKFDRWVERGEALAIPSSLKLYNEV  272

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKSGKRTELV  762
              LG K   LTG  E   ++   NL++ G+++W+KLIL+   D   +A  YKS KR  + 
Sbjct  273  RELGFKTFLLTGRSEGHLDITAENLKKQGFHDWDKLILREACDRKKTATVYKSEKRKAME  332

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  333  EEGYRILGNSGDQWSDLLGWSMSARSFKLPNPMYYI  368



>ref|XP_006451342.1| hypothetical protein CICLE_v10009222mg [Citrus clementina]
 ref|XP_006475349.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
 gb|ESR64582.1| hypothetical protein CICLE_v10009222mg [Citrus clementina]
Length=262

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 151/246 (61%), Gaps = 10/246 (4%)
 Frame = +1

Query  154  YIQQVVEIHRLRPQTGSAGHRV----PQIDCLSWRLAVETNNIRDWKLVPAECENYVGHY  321
            + Q V++I   R +   AG R      ++ C SWR +VETN+  +W  VP+ C  +V  Y
Sbjct  21   FSQSVIQIFPGRIEF--AGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKY  78

Query  322  MLGQQYREDCEYVAEEAIKYANGVILS-GDGTDIWVFDIDETTLSNIPYYARSDVAFGAV  498
            M G+ Y  D E V+  ++K+A    +S GDG D WVFDIDET LSN+PYYA     FG+ 
Sbjct  79   MTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAH--GFGSE  136

Query  499  PYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYY  678
             +N+  F+ WV   KAPA+PASL  Y  +  LG K   LTG  E  R     NL  AGY 
Sbjct  137  IFNEDAFDEWVDLAKAPALPASLNFYKELKQLGFKIFLLTGRNEFQRNTTEKNLLFAGYS  196

Query  679  NWEKLILKGVNDTGS-AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPD  855
            +W+KL L+G +D G  A  YKS KR ELVN GYRI G+ GDQWSDLLG    +R+FK+P+
Sbjct  197  DWKKLFLRGPSDQGKPATVYKSEKRLELVNEGYRIHGSSGDQWSDLLGFAKAERSFKLPN  256

Query  856  PMYYIA  873
            PMYYIA
Sbjct  257  PMYYIA  262



>gb|ADE77538.1| unknown [Picea sitchensis]
Length=268

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 138/221 (62%), Gaps = 6/221 (3%)
 Frame = +1

Query  223  QIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQ--QYREDCEYVAEEAIKYANGVI  396
            Q++C +WR  VETN +R W +VP EC  YV +YM+G   QY  D   VA E+I Y N + 
Sbjct  50   QVNCEAWRFGVETNTLRSWNVVPPECVEYVKNYMIGSGSQYVRDSNMVANESIAYVNSLQ  109

Query  397  LSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNA-WVSEGKAPAIPASLRL  573
            LSGDG D WVFD+DET +S +PY+A     FG     +  FN  W+    APA+PAS +L
Sbjct  110  LSGDGKDAWVFDVDETLISTLPYFAAHQ--FGGEVIAEDDFNVKWLDRAVAPALPASHKL  167

Query  574  YNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTG-SAVEYKSGKR  750
            Y  +L LG K   LTG +   R V   NL  AGY++WE L L+   D   SAV YKS +R
Sbjct  168  YARLLELGFKIFLLTGRRHCQRNVTERNLVRAGYHSWEALFLREPEDRAKSAVVYKSERR  227

Query  751  TELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYIA  873
             ++   G+RI GN GDQWSDL G   GDRTFK+P+PMYY+A
Sbjct  228  LKIEQNGFRIRGNSGDQWSDLTGYSVGDRTFKLPNPMYYVA  268



>gb|KDO55859.1| hypothetical protein CISIN_1g024820mg [Citrus sinensis]
Length=262

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 151/246 (61%), Gaps = 10/246 (4%)
 Frame = +1

Query  154  YIQQVVEIHRLRPQTGSAGHRV----PQIDCLSWRLAVETNNIRDWKLVPAECENYVGHY  321
            + Q V++I   R +   AG R      ++ C SWR +VETN+  +W  VP+ C  +V  Y
Sbjct  21   FSQSVIQIFPGRIEF--AGDRKIRAGDELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKY  78

Query  322  MLGQQYREDCEYVAEEAIKYANGVILS-GDGTDIWVFDIDETTLSNIPYYARSDVAFGAV  498
            M G+ Y  D E V+  ++K+A    +S GDG D WVFDIDET LSN+PYYA     FG+ 
Sbjct  79   MTGEHYLSDSEIVSGYSLKHAKSANVSAGDGKDAWVFDIDETLLSNLPYYAAH--GFGSE  136

Query  499  PYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYY  678
             +N+  F+ WV   KAPA+PASL  Y  +  LG K   LTG  E  R     NL  AGY 
Sbjct  137  IFNEDAFDEWVDLAKAPALPASLTFYKELKQLGFKIFLLTGRNEFQRNTTEKNLLFAGYS  196

Query  679  NWEKLILKGVNDTGS-AVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPD  855
            +W+KL L+G +D G  A  YKS KR ELVN GYRI G+ GDQWSDLLG    +R+FK+P+
Sbjct  197  DWKKLFLRGPSDQGKPATVYKSEKRLELVNEGYRIHGSSGDQWSDLLGFAKAERSFKLPN  256

Query  856  PMYYIA  873
            PMYYIA
Sbjct  257  PMYYIA  262



>ref|NP_001150931.1| acid phosphatase 1 precursor [Zea mays]
 gb|ACG40987.1| acid phosphatase 1 precursor [Zea mays]
Length=299

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 140/219 (64%), Gaps = 4/219 (2%)
 Frame = +1

Query  220  PQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVI-  396
            P + C SWRLA E NN+  W+ VP EC  +V  Y+ G  YR D + VA E+  YA     
Sbjct  82   PDVRCASWRLAAEANNLAPWRAVPPECAPHVRDYVTGVAYRSDLDLVARESAAYARAAAP  141

Query  397  LSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLY  576
            L  DG D WVFD+DET LSN+PYYA     +GA  ++  KF+ WV  G+A AIP+SL+LY
Sbjct  142  LGADGRDAWVFDVDETLLSNLPYYAEH--GYGAELFDHHKFDEWVERGEAAAIPSSLKLY  199

Query  577  NTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKSGKRT  753
            N V  LG K   LTG  E  R V + NL + G+++WEKL+L+   D   +A  YKS KR 
Sbjct  200  NEVRELGFKTFLLTGRSEGHRGVTVDNLNKQGFHDWEKLVLRAAGDRKKTATVYKSEKRK  259

Query  754  ELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            E+   GYRI+GN GDQWSDLLG   G R+FK+P+PMYYI
Sbjct  260  EMEQEGYRILGNSGDQWSDLLGSSMGARSFKLPNPMYYI  298



>ref|XP_006412858.1| hypothetical protein EUTSA_v10025999mg [Eutrema salsugineum]
 gb|ESQ54311.1| hypothetical protein EUTSA_v10025999mg [Eutrema salsugineum]
Length=263

 Score =   214 bits (546),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 150/243 (62%), Gaps = 10/243 (4%)
 Frame = +1

Query  148  PPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYML  327
              +I+  V +H  R  + ++        C SWRL+VETNN   WK+VP++C + +  Y  
Sbjct  30   SSFIKLPVTVHESRSSSVAS-------YCESWRLSVETNNAGSWKVVPSKCVSSLETYYN  82

Query  328  GQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYN  507
              Q+ +D   VA  A+ +A  + + GDG D WVFDIDET LSN+ YY  +   +G+VPYN
Sbjct  83   RGQFDKDYNVVANYALAFAKTIKIGGDGKDAWVFDIDETLLSNLEYYKAN--GYGSVPYN  140

Query  508  DTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWE  687
               FN WV +G AP   ASL+L+N +  LG   + LTG  EA R +   NL +AGY  WE
Sbjct  141  SKTFNEWVVQGTAPGFDASLKLFNGLKKLGFTIILLTGRDEAQRSITEKNLLDAGYSGWE  200

Query  688  KLILKGVNDTG-SAVEYKSGKRTELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMY  864
             L+L+G  D G +A +YKS +R+ +V  G+++ GN GDQWSDL G    DR+FKVP+PMY
Sbjct  201  HLLLRGDEDQGKAAAQYKSEQRSRMVKKGFKLHGNTGDQWSDLQGFAVADRSFKVPNPMY  260

Query  865  YIA  873
            +IA
Sbjct  261  FIA  263



>ref|XP_004964489.1| PREDICTED: acid phosphatase 1-like isoform X2 [Setaria italica]
Length=367

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 136/216 (63%), Gaps = 5/216 (2%)
 Frame = +1

Query  226  IDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVILSG  405
            + C SWRLA E NN+  WK VPA C  +V  Y+ G  YR D + +A E+  YA    L G
Sbjct  155  VRCASWRLAAEANNLAPWKAVPAGCAAHVRDYIAGAAYRSDLDLIARESTTYARAAPLRG  214

Query  406  DGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTV  585
            DG D WVFDIDET LSN+PYYA   +      ++  KF+ WV  G+A AIP+SL+LYN V
Sbjct  215  DGRDAWVFDIDETLLSNLPYYAEHGLEL----FDHQKFDRWVERGEALAIPSSLKLYNEV  270

Query  586  LSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKSGKRTELV  762
              LG K   LTG  E   ++   NL++ G+++W+KLIL+   D   +A  YKS KR  + 
Sbjct  271  RELGFKTFLLTGRSEGHLDITAENLKKQGFHDWDKLILREACDRKKTATVYKSEKRKAME  330

Query  763  NAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
              GYRI+GN GDQWSDLLG     R+FK+P+PMYYI
Sbjct  331  EEGYRILGNSGDQWSDLLGWSMSARSFKLPNPMYYI  366



>gb|AFW75455.1| hypothetical protein ZEAMMB73_076415 [Zea mays]
Length=299

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 140/219 (64%), Gaps = 4/219 (2%)
 Frame = +1

Query  220  PQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGVI-  396
            P + C SWRLA E NN+  W+ VP EC  +V  Y+ G  YR D + VA E+  YA     
Sbjct  82   PDVRCASWRLAAEANNLAPWRAVPPECAPHVRDYVTGVAYRSDLDLVARESAAYARAAAP  141

Query  397  LSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLY  576
            L  DG D WVFD+DET LSN+PYYA     +GA  ++  KF+ WV  G+A AIP+SL+LY
Sbjct  142  LGADGRDAWVFDVDETLLSNLPYYAEH--GYGAELFDHHKFDEWVERGEAAAIPSSLKLY  199

Query  577  NTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVND-TGSAVEYKSGKRT  753
            N V  LG K   LTG  E  R V + NL + G+++WEKL+L+   D   +A  YKS KR 
Sbjct  200  NEVRELGFKTFLLTGRSEGHRGVTVDNLNKQGFHDWEKLVLRAAGDRKKTATVYKSEKRK  259

Query  754  ELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
            E+   GYRI+GN GDQWSDLLG   G R+FK+P+PMYYI
Sbjct  260  EMEQEGYRILGNSGDQWSDLLGSSMGARSFKLPNPMYYI  298



>gb|ABK92831.1| unknown [Populus trichocarpa]
Length=247

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 137/220 (62%), Gaps = 3/220 (1%)
 Frame = +1

Query  214  RVPQIDCLSWRLAVETNNIRDWKLVPAECENYVGHYMLGQQYREDCEYVAEEAIKYANGV  393
            R   + C  WR +VETN++  W  VP+ C +YV  YM G  YR D E  A  A+ +A  V
Sbjct  29   RDHDVYCNGWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVAASYALGFAKTV  88

Query  394  ILSGDGTDIWVFDIDETTLSNIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRL  573
             ++GDG D WVFD+DET LSN+PYYA     FG+ P+++  F+ WV   +APA+ ASL L
Sbjct  89   EIAGDGKDAWVFDVDETLLSNLPYYAVH--GFGSEPFDELSFDEWVDLAEAPALQASLNL  146

Query  574  YNTVLSLGIKPVFLTGTKEAFREVRIANLQEAGYYNWEKLILKGVNDTGS-AVEYKSGKR  750
            Y  +  LG     LTG  E  R     NLQ  GY +WE+LIL+  +D G  A  YKS +R
Sbjct  147  YKELKQLGFTVFMLTGRSEHQRNATAKNLQLEGYSDWERLILRESSDQGKPATFYKSQRR  206

Query  751  TELVNAGYRIVGNMGDQWSDLLGPDAGDRTFKVPDPMYYI  870
             ELVN GYRI GN GDQWSDL G    +R+FK+P+P+YYI
Sbjct  207  LELVNEGYRIHGNSGDQWSDLFGFAVSERSFKLPNPLYYI  246



>ref|XP_010541530.1| PREDICTED: vegetative storage protein 2-like [Tarenaya hassleriana]
Length=262

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 150/258 (58%), Gaps = 7/258 (3%)
 Frame = +1

Query  97   LLFLvtvtawavtatPQPPYIQQVVEIHRLRPQTGSAGHRVPQIDCLSWRLAVETNNIRD  276
            LLFL TVT         P  I+QV +         S  +     +C SW L VETNNI +
Sbjct  9    LLFLATVTVCNARTMTVPELIEQVTDPDMAEQLRLSISYP----NCRSWHLGVETNNIIN  64

Query  277  WKLVPAECENYVGHYM-LGQQYREDCEYVAEEAIKYANGVILSGDGTDIWVFDIDETTLS  453
            +K VPA CE YV  Y+    QYR D + + +EA  YA G+ L  D  ++W+FD+DET LS
Sbjct  65   FKTVPANCEEYVEDYLTFSDQYRADSKTICKEAYYYAKGLALKNDTVNVWIFDLDETLLS  124

Query  454  NIPYYARSDVAFGAVPYNDTKFNAWVSEGKAPAIPASLRLYNTVLSLGIKPVFLTGTKEA  633
            NIP+Y  +   FG    +   FN W+S G+AP +  +L LYN +   GIKPV +T   E 
Sbjct  125  NIPFYQAN--GFGTESVDSEAFNKWISLGEAPVLGETLHLYNNLQKKGIKPVLITERYEE  182

Query  634  FREVRIANLQEAGYYNWEKLILKGVNDTGSAVEYKSGKRTELVNAGYRIVGNMGDQWSDL  813
             RE+ ++NL++AGY  WEK I K        V YKS +R +L   GY I+GN+GDQWSDL
Sbjct  183  LREITLSNLEKAGYTFWEKAIFKPTGSNAKIVNYKSKERKKLERGGYTIIGNIGDQWSDL  242

Query  814  LGPDAGDRTFKVPDPMYY  867
                AG RTFK+P+P+YY
Sbjct  243  QKESAGRRTFKLPNPLYY  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2339198799562