BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14155_g1_i2 len=907 path=[1009:0-494 1862:495-505 32:506-542
69:543-906]

Length=907
                                                                      Score     E

ref|XP_009622713.1|  PREDICTED: uncharacterized protein LOC104114...  87.0    1e-17   
ref|XP_009622715.1|  PREDICTED: uncharacterized protein LOC104114...  86.3    1e-17   
ref|XP_009622712.1|  PREDICTED: uncharacterized protein LOC104114...  87.0    1e-17   
ref|XP_009622714.1|  PREDICTED: uncharacterized protein LOC104114...  85.9    2e-17   
ref|XP_009782243.1|  PREDICTED: uncharacterized protein LOC104231019  82.8    2e-16   
ref|XP_006339839.1|  PREDICTED: uncharacterized protein LOC102600...  82.0    4e-16   
ref|XP_010315998.1|  PREDICTED: uncharacterized protein LOC101251431  75.5    8e-14   
ref|XP_007199632.1|  hypothetical protein PRUPE_ppa013214mg           74.3    5e-13   
ref|XP_010271395.1|  PREDICTED: uncharacterized protein LOC104607...  70.5    8e-12   
ref|XP_008236399.1|  PREDICTED: uncharacterized protein LOC103335...  70.1    1e-11   
ref|XP_008338242.1|  PREDICTED: uncharacterized protein LOC103401...  68.9    2e-11   
emb|CDP02555.1|  unnamed protein product                              67.0    2e-10   
ref|XP_007156753.1|  hypothetical protein PHAVU_002G014500g           63.9    2e-09   
ref|XP_007199634.1|  hypothetical protein PRUPE_ppa013214mg           63.9    3e-09   
ref|XP_010315205.1|  PREDICTED: uncharacterized protein LOC101248...  61.2    2e-08   
ref|XP_006346346.1|  PREDICTED: uncharacterized protein LOC102598...  61.2    2e-08   
ref|XP_010271403.1|  PREDICTED: uncharacterized protein LOC104607...  60.8    2e-08   
ref|XP_004289748.1|  PREDICTED: uncharacterized protein LOC101297787  60.8    3e-08   
ref|XP_010647954.1|  PREDICTED: uncharacterized protein LOC100260...  60.1    4e-08   
ref|XP_006339840.1|  PREDICTED: uncharacterized protein LOC102600...  59.3    7e-08   
ref|XP_010271399.1|  PREDICTED: uncharacterized protein LOC104607...  58.9    1e-07   
ref|XP_008338244.1|  PREDICTED: uncharacterized protein LOC103401...  58.2    2e-07   
ref|XP_008236397.1|  PREDICTED: uncharacterized protein LOC103335...  58.9    2e-07   
ref|XP_006833282.1|  hypothetical protein AMTR_s00109p00025370        58.2    2e-07   
ref|XP_010277158.1|  PREDICTED: uncharacterized protein LOC104611...  57.8    3e-07   
ref|XP_008236398.1|  PREDICTED: uncharacterized protein LOC103335...  57.0    6e-07   
ref|XP_008338243.1|  PREDICTED: uncharacterized protein LOC103401...  56.2    9e-07   
ref|XP_010028392.1|  PREDICTED: uncharacterized protein LOC104418...  56.2    1e-06   
ref|XP_003517322.1|  PREDICTED: uncharacterized protein LOC100807280  55.8    1e-06   
ref|XP_009398294.1|  PREDICTED: uncharacterized protein LOC103982...  56.2    1e-06   
ref|XP_006346348.1|  PREDICTED: uncharacterized protein LOC102598...  55.8    1e-06   
ref|XP_010941874.1|  PREDICTED: uncharacterized protein LOC105060...  56.2    1e-06   
ref|XP_010315207.1|  PREDICTED: uncharacterized protein LOC101248...  55.8    1e-06   
ref|XP_010679562.1|  PREDICTED: uncharacterized protein LOC104894897  55.8    1e-06   
ref|XP_009408598.1|  PREDICTED: uncharacterized protein LOC103990...  55.5    2e-06   
gb|AFK45136.1|  unknown                                               54.7    3e-06   
emb|CDO97237.1|  unnamed protein product                              54.7    4e-06   
ref|XP_004511878.1|  PREDICTED: uncharacterized protein LOC101504879  54.7    4e-06   
ref|XP_006346347.1|  PREDICTED: uncharacterized protein LOC102598...  54.3    5e-06   
ref|XP_006605985.1|  PREDICTED: uncharacterized protein LOC100809...  54.3    6e-06   
ref|XP_011088195.1|  PREDICTED: uncharacterized protein LOC105169...  54.3    6e-06   
ref|XP_010315206.1|  PREDICTED: uncharacterized protein LOC101248...  53.9    6e-06   
ref|XP_007143072.1|  hypothetical protein PHAVU_007G041500g           53.9    8e-06   
gb|EYU37616.1|  hypothetical protein MIMGU_mgv1a016981mg              52.8    2e-05   
ref|XP_008813190.1|  PREDICTED: uncharacterized protein LOC103723...  52.4    2e-05   
ref|XP_010488936.1|  PREDICTED: uncharacterized protein LOC104766...  52.4    3e-05   
ref|XP_010909759.1|  PREDICTED: uncharacterized protein LOC105035...  52.4    3e-05   
ref|XP_002885949.1|  hypothetical protein ARALYDRAFT_480380           52.4    3e-05   
ref|XP_009397298.1|  PREDICTED: uncharacterized protein LOC103982...  52.0    4e-05   
gb|KHN42344.1|  hypothetical protein glysoja_020056                   51.6    4e-05   
ref|XP_011030380.1|  PREDICTED: uncharacterized protein LOC105129...  51.6    4e-05   
gb|KHG11389.1|  hypothetical protein F383_14795                       55.1    4e-05   
ref|XP_010517947.1|  PREDICTED: uncharacterized protein LOC104793...  51.6    5e-05   
ref|XP_009592473.1|  PREDICTED: uncharacterized protein LOC104089...  51.2    6e-05   
ref|XP_008792611.1|  PREDICTED: uncharacterized protein LOC103709...  50.8    7e-05   
ref|XP_003611654.1|  hypothetical protein MTR_5g016330                50.8    8e-05   
ref|XP_006298846.1|  hypothetical protein CARUB_v10014960mg           51.2    8e-05   
gb|AES94612.2|  hypothetical protein MTR_5g016330                     50.4    2e-04   
ref|XP_007206187.1|  hypothetical protein PRUPE_ppa013887mg           49.7    2e-04   
ref|XP_003631688.1|  PREDICTED: uncharacterized protein LOC100260...  49.3    2e-04   
ref|XP_008792610.1|  PREDICTED: uncharacterized protein LOC103709...  49.7    3e-04   
ref|XP_010941883.1|  PREDICTED: uncharacterized protein LOC105060...  49.3    3e-04   
ref|XP_010467279.1|  PREDICTED: uncharacterized protein LOC104747...  49.3    3e-04   
ref|XP_009398299.1|  PREDICTED: uncharacterized protein LOC103982...  49.3    3e-04   
ref|NP_001077892.1|  uncharacterized protein                          48.9    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003555972.1|  PREDICTED: uncharacterized protein LOC100809...  48.5    4e-04   
ref|XP_011088196.1|  PREDICTED: uncharacterized protein LOC105169...  48.5    5e-04   
ref|XP_007143075.1|  hypothetical protein PHAVU_007G041500g           48.1    6e-04   
ref|XP_010277159.1|  PREDICTED: uncharacterized protein LOC104611...  47.8    0.001   



>ref|XP_009622713.1| PREDICTED: uncharacterized protein LOC104114067 isoform X2 [Nicotiana 
tomentosiformis]
Length=119

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 89/107 (83%), Gaps = 5/107 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R  S+SR LLS++R +++ S+PS+      ++LGQRLQSRR +S IL RTNG+LGCT
Sbjct  1    MARRCISVSRTLLSSSRPSTVHSSPSVQ-----SILGQRLQSRRSISTILTRTNGVLGCT  55

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR*FFMN  501
            QSLLPLHSA+AA+RLTSHI++EAR+CC+L+QGTFFCRTCPDR   M+
Sbjct  56   QSLLPLHSAVAASRLTSHIQMEARTCCQLAQGTFFCRTCPDRYLRMH  102



>ref|XP_009622715.1| PREDICTED: uncharacterized protein LOC104114067 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009622716.1| PREDICTED: uncharacterized protein LOC104114067 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009622717.1| PREDICTED: uncharacterized protein LOC104114067 isoform X4 [Nicotiana 
tomentosiformis]
Length=97

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 87/102 (85%), Gaps = 5/102 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R  S+SR LLS++R +++ S+PS+      ++LGQRLQSRR +S IL RTNG+LGCT
Sbjct  1    MARRCISVSRTLLSSSRPSTVHSSPSVQ-----SILGQRLQSRRSISTILTRTNGVLGCT  55

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QSLLPLHSA+AA+RLTSHI++EAR+CC+L+QGTFFCRTCPDR
Sbjct  56   QSLLPLHSAVAASRLTSHIQMEARTCCQLAQGTFFCRTCPDR  97



>ref|XP_009622712.1| PREDICTED: uncharacterized protein LOC104114067 isoform X1 [Nicotiana 
tomentosiformis]
Length=124

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 87/102 (85%), Gaps = 5/102 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R  S+SR LLS++R +++ S+PS+      ++LGQRLQSRR +S IL RTNG+LGCT
Sbjct  1    MARRCISVSRTLLSSSRPSTVHSSPSVQ-----SILGQRLQSRRSISTILTRTNGVLGCT  55

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QSLLPLHSA+AA+RLTSHI++EAR+CC+L+QGTFFCRTCPDR
Sbjct  56   QSLLPLHSAVAASRLTSHIQMEARTCCQLAQGTFFCRTCPDR  97



>ref|XP_009622714.1| PREDICTED: uncharacterized protein LOC104114067 isoform X3 [Nicotiana 
tomentosiformis]
Length=101

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 87/102 (85%), Gaps = 5/102 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R  S+SR LLS++R +++ S+PS+      ++LGQRLQSRR +S IL RTNG+LGCT
Sbjct  1    MARRCISVSRTLLSSSRPSTVHSSPSVQ-----SILGQRLQSRRSISTILTRTNGVLGCT  55

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QSLLPLHSA+AA+RLTSHI++EAR+CC+L+QGTFFCRTCPDR
Sbjct  56   QSLLPLHSAVAASRLTSHIQMEARTCCQLAQGTFFCRTCPDR  97



>ref|XP_009782243.1| PREDICTED: uncharacterized protein LOC104231019 [Nicotiana sylvestris]
Length=97

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 84/102 (82%), Gaps = 5/102 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R  S SR LLS +R +++ S+PS+      ++LGQRLQSRR LS IL RTNGILGCT
Sbjct  1    MARRCISFSRTLLSGSRPSTVNSSPSVR-----SILGQRLQSRRSLSTILTRTNGILGCT  55

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QSLLPLHSA+AA+RLTSHI++EA +CC+LSQGTFFCRTCPDR
Sbjct  56   QSLLPLHSAVAASRLTSHIQMEASTCCQLSQGTFFCRTCPDR  97



>ref|XP_006339839.1| PREDICTED: uncharacterized protein LOC102600630 isoform X1 [Solanum 
tuberosum]
Length=97

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 82/102 (80%), Gaps = 5/102 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R  S SR LLS++R +++ S+ S+  L     LGQRLQSRR LS IL RTNG+LGC 
Sbjct  1    MARRCMSFSRTLLSSSRPSTVGSSASVQSL-----LGQRLQSRRSLSTILTRTNGVLGCV  55

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QSLLPLHSA+AA RLTSHI++EAR+CC+LSQGTFFCRTCPDR
Sbjct  56   QSLLPLHSAVAATRLTSHIQMEARTCCQLSQGTFFCRTCPDR  97



>ref|XP_010315998.1| PREDICTED: uncharacterized protein LOC101251431 [Solanum lycopersicum]
Length=97

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -3

Query  677  ILPRTNGILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            IL RTNG+LGC QSLLPLHSA+AA RLTSHI++EAR+CC+LSQGTFFCRTCPDR
Sbjct  44   ILTRTNGVLGCAQSLLPLHSAVAATRLTSHIQMEARTCCQLSQGTFFCRTCPDR  97



>ref|XP_007199632.1| hypothetical protein PRUPE_ppa013214mg [Prunus persica]
 ref|XP_007199633.1| hypothetical protein PRUPE_ppa013214mg [Prunus persica]
 gb|EMJ00831.1| hypothetical protein PRUPE_ppa013214mg [Prunus persica]
 gb|EMJ00832.1| hypothetical protein PRUPE_ppa013214mg [Prunus persica]
Length=135

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = -3

Query  821  MAGR-YGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R  GSLSR+L+STAR +SLRS P +  LR PT+   R  +        PR  G LGC
Sbjct  39   MAWRSAGSLSRSLVSTARVSSLRSAPPLRRLRPPTVSTPRRLAFAS-----PRNLGELGC  93

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             QSLLP+HS  AA  LTSH+ V AR CCELS GT FCRTC DR
Sbjct  94   IQSLLPMHSVTAATCLTSHLAVNARGCCELSHGT-FCRTCQDR  135



>ref|XP_010271395.1| PREDICTED: uncharacterized protein LOC104607453 isoform X1 [Nelumbo 
nucifera]
Length=100

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS SR+L+S AR  S R   ++    +P L   RLQ RR      PR  G LGCT
Sbjct  1    MAWRSGSFSRSLISAARAPSFRPPRTVPRFSAPPLAAPRLQPRRFAFAN-PRMMGELGCT  59

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QSLLPLHS +AAARLTSH+ V+AR+CCELSQGT FCRTC DR
Sbjct  60   QSLLPLHSVVAAARLTSHLAVDARACCELSQGT-FCRTCQDR  100



>ref|XP_008236399.1| PREDICTED: uncharacterized protein LOC103335169 isoform X3 [Prunus 
mume]
 ref|XP_008236401.1| PREDICTED: uncharacterized protein LOC103335169 isoform X3 [Prunus 
mume]
Length=97

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 66/103 (64%), Gaps = 7/103 (7%)
 Frame = -3

Query  821  MAGR-YGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R  GSLSR+L+STAR +SLRS   +  LR PT+   R  S        PR  G LGC
Sbjct  1    MAWRSAGSLSRSLVSTARVSSLRSALPLRRLRPPTVSTPRRLSFAS-----PRNLGELGC  55

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             QSLLP+HS  AA  LTSH+ V AR CCELS GT FCRTC DR
Sbjct  56   IQSLLPMHSVTAATCLTSHLAVNARGCCELSHGT-FCRTCQDR  97



>ref|XP_008338242.1| PREDICTED: uncharacterized protein LOC103401311 isoform X1 [Malus 
domestica]
Length=96

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = -3

Query  821  MAGR-YGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R  GSLSR+L+STAR +SLR  P +  LR P+L   R           PR  G LGC
Sbjct  1    MAWRSAGSLSRSLVSTARVSSLRLAPPLRRLRPPSLSTPRRLFAS------PRNMGELGC  54

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             QSLLP+H+  AA  LTSH+   AR CCELS GT FCRTC DR
Sbjct  55   IQSLLPMHNVTAATCLTSHLAANARGCCELSHGT-FCRTCQDR  96



>emb|CDP02555.1| unnamed protein product [Coffea canephora]
Length=105

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 68/107 (64%), Gaps = 7/107 (7%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRST-PSISLLRSPTllgqrlqsrrllsGI----LPRTNG  657
            MA R GSLSR+LLS  R ++ RS+ PS+  LR PT          L   +    L R  G
Sbjct  1    MAWR-GSLSRSLLSNVRASTARSSSPSLPRLR-PTSSAPLHGQYALSRRLFSSDLLRNGG  58

Query  656  ILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             L CTQSLLPLHS +AA RLTSHI VEAR+CCELSQG  F RTCP R
Sbjct  59   FLACTQSLLPLHSVVAATRLTSHIAVEARTCCELSQGIIFSRTCPCR  105



>ref|XP_007156753.1| hypothetical protein PHAVU_002G014500g [Phaseolus vulgaris]
 gb|ESW28747.1| hypothetical protein PHAVU_002G014500g [Phaseolus vulgaris]
Length=93

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GSLSR+LLS ART   RS+ S     S   L   L   R     LPRT GILGCT
Sbjct  1    MAWRGGSLSRSLLSAARTIPTRSSASRLQHSSSPSLRSHLLHPRRPLFTLPRTIGILGCT  60

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QSLLPLHSA AAARLTSHI V +R+CCELSQGT
Sbjct  61   QSLLPLHSADAAARLTSHISVGSRACCELSQGT  93



>ref|XP_007199634.1| hypothetical protein PRUPE_ppa013214mg [Prunus persica]
 gb|EMJ00833.1| hypothetical protein PRUPE_ppa013214mg [Prunus persica]
Length=127

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 60/94 (64%), Gaps = 6/94 (6%)
 Frame = -3

Query  821  MAGR-YGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R  GSLSR+L+STAR +SLRS P +  LR PT+   R  +        PR  G LGC
Sbjct  39   MAWRSAGSLSRSLVSTARVSSLRSAPPLRRLRPPTVSTPRRLAFAS-----PRNLGELGC  93

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
             QSLLP+HS  AA  LTSH+ V AR CCELS GT
Sbjct  94   IQSLLPMHSVTAATCLTSHLAVNARGCCELSHGT  127



>ref|XP_010315205.1| PREDICTED: uncharacterized protein LOC101248148 isoform X1 [Solanum 
lycopersicum]
Length=99

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS++R+L S AR ++ RS+P+++ +R+P + G R  +RR      PRT G LGCT
Sbjct  1    MAWR-GSVTRSLTSVARASTSRSSPTVNRVRTPPISGTRSNTRRFSFTS-PRTLGALGCT  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QS LPLH+ +A  RLTSH+ V  R+CCEL  GT F R+C DR
Sbjct  59   QSFLPLHNVVAGTRLTSHLTVNVRACCELYHGT-FQRSCQDR  99



>ref|XP_006346346.1| PREDICTED: uncharacterized protein LOC102598144 isoform X1 [Solanum 
tuberosum]
Length=99

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS++R+L S AR ++ RS+P+++ +R+P +   R  +RR      PRT G LGCT
Sbjct  1    MAWR-GSVTRSLTSVARASTSRSSPTVNRVRTPPISAPRSNTRRFSFTS-PRTLGALGCT  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QS LPLH+ +A  RLTSH+ V  R+CCEL  GT F R+C DR
Sbjct  59   QSFLPLHNVVAGTRLTSHLTVNVRACCELYHGT-FQRSCQDR  99



>ref|XP_010271403.1| PREDICTED: uncharacterized protein LOC104607453 isoform X3 [Nelumbo 
nucifera]
Length=92

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS SR+L+S AR  S R   ++    +P L   RLQ RR      PR  G LGCT
Sbjct  1    MAWRSGSFSRSLISAARAPSFRPPRTVPRFSAPPLAAPRLQPRRFAFAN-PRMMGELGCT  59

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QSLLPLHS +AAARLTSH+ V+AR+CCELSQGT
Sbjct  60   QSLLPLHSVVAAARLTSHLAVDARACCELSQGT  92



>ref|XP_004289748.1| PREDICTED: uncharacterized protein LOC101297787 [Fragaria vesca 
subsp. vesca]
Length=94

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = -3

Query  806  GSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCTQSllp  627
            GSLSR+L S AR +  RS P++  LR PT    R  S        PR  G LGC QSLLP
Sbjct  7    GSLSRSLASAARVSLHRSAPTLRRLRPPTAPAARRFSFTS-----PRNLGELGCAQSLLP  61

Query  626  lhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            + +A      TSH+ V  R+CCELS GT FCRTC DR
Sbjct  62   MRTATCL---TSHLTVNMRACCELSHGT-FCRTCQDR  94



>ref|XP_010647954.1| PREDICTED: uncharacterized protein LOC100260985 isoform X2 [Vitis 
vinifera]
 ref|XP_010647955.1| PREDICTED: uncharacterized protein LOC100260985 isoform X2 [Vitis 
vinifera]
Length=99

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 3/102 (3%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GSLSR+L+STAR +SLRS+P+   +R P L   RLQ+RRL     PR  G LGC 
Sbjct  1    MAWR-GSLSRSLMSTARASSLRSSPAAPRVRPPPLAAPRLQTRRLSFTN-PRNLGELGCV  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QSLLPLH+ +A+ RLTSH+ V+ R+CCEL  GT FCRTC DR
Sbjct  59   QSLLPLHNVMASPRLTSHLSVDVRACCELFHGT-FCRTCQDR  99



>ref|XP_006339840.1| PREDICTED: uncharacterized protein LOC102600630 isoform X2 [Solanum 
tuberosum]
Length=88

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 5/93 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R  S SR LLS++R +++ S+ S+  L     LGQRLQSRR LS IL RTNG+LGC 
Sbjct  1    MARRCMSFSRTLLSSSRPSTVGSSASVQSL-----LGQRLQSRRSLSTILTRTNGVLGCV  55

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QSLLPLHSA+AA RLTSHI++EAR+CC+LSQGT
Sbjct  56   QSLLPLHSAVAATRLTSHIQMEARTCCQLSQGT  88



>ref|XP_010271399.1| PREDICTED: uncharacterized protein LOC104607453 isoform X2 [Nelumbo 
nucifera]
Length=97

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS SR+L+S AR  S R   ++    +P L   RLQ RR      PR  G LGCT
Sbjct  1    MAWRSGSFSRSLISAARAPSFRPPRTVPRFSAPPLAAPRLQPRRFAFAN-PRMMGELGCT  59

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQG  546
            QSLLPLHS +AAARLTSH+ V+AR+CCELSQG
Sbjct  60   QSLLPLHSVVAAARLTSHLAVDARACCELSQG  91



>ref|XP_008338244.1| PREDICTED: uncharacterized protein LOC103401311 isoform X3 [Malus 
domestica]
Length=88

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = -3

Query  821  MAGR-YGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R  GSLSR+L+STAR +SLR  P +  LR P+L   R           PR  G LGC
Sbjct  1    MAWRSAGSLSRSLVSTARVSSLRLAPPLRRLRPPSLSTPRRLFAS------PRNMGELGC  54

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
             QSLLP+H+  AA  LTSH+   AR CCELS GT
Sbjct  55   IQSLLPMHNVTAATCLTSHLAANARGCCELSHGT  88



>ref|XP_008236397.1| PREDICTED: uncharacterized protein LOC103335169 isoform X1 [Prunus 
mume]
Length=126

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = -3

Query  821  MAGR-YGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R  GSLSR+L+STAR +SLRS   +  LR PT+   R  S        PR  G LGC
Sbjct  38   MAWRSAGSLSRSLVSTARVSSLRSALPLRRLRPPTVSTPRRLSFAS-----PRNLGELGC  92

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
             QSLLP+HS  AA  LTSH+ V AR CCELS GT
Sbjct  93   IQSLLPMHSVTAATCLTSHLAVNARGCCELSHGT  126



>ref|XP_006833282.1| hypothetical protein AMTR_s00109p00025370 [Amborella trichopoda]
 gb|ERM98560.1| hypothetical protein AMTR_s00109p00025370 [Amborella trichopoda]
Length=102

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = -3

Query  821  MAGRYG-SLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R+G + SR+L++ AR++   + P    LRSP +       RR L  +  R  G LGC
Sbjct  1    MATRFGYAASRSLMAAARSSIRSAAPRAPRLRSPPITTLPNFHRRRLP-LTSRWMGELGC  59

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             QS++PLH  +A+ARLTSH+ V  R CCELSQG    RTCPDR
Sbjct  60   LQSMVPLHDVIASARLTSHLSVNTRGCCELSQGILLPRTCPDR  102



>ref|XP_010277158.1| PREDICTED: uncharacterized protein LOC104611682 isoform X1 [Nelumbo 
nucifera]
Length=99

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -3

Query  671  PRTNGILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            PRT G LGC QSL+PLHS +AA RLTSH+ V+AR+CCELSQGT FCRTC DR
Sbjct  49   PRTMGELGCIQSLMPLHSVVAAPRLTSHLAVDARACCELSQGT-FCRTCQDR  99



>ref|XP_008236398.1| PREDICTED: uncharacterized protein LOC103335169 isoform X2 [Prunus 
mume]
Length=113

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = -3

Query  821  MAGR-YGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R  GSLSR+L+STAR +SLRS   +  LR PT+   R  S        PR  G LGC
Sbjct  1    MAWRSAGSLSRSLVSTARVSSLRSALPLRRLRPPTVSTPRRLSFAS-----PRNLGELGC  55

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQG  546
             QSLLP+HS  AA  LTSH+ V AR CCELS G
Sbjct  56   IQSLLPMHSVTAATCLTSHLAVNARGCCELSHG  88



>ref|XP_008338243.1| PREDICTED: uncharacterized protein LOC103401311 isoform X2 [Malus 
domestica]
Length=93

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = -3

Query  821  MAGR-YGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R  GSLSR+L+STAR +SLR  P +  LR P+L   R           PR  G LGC
Sbjct  1    MAWRSAGSLSRSLVSTARVSSLRLAPPLRRLRPPSLSTPRRLFAS------PRNMGELGC  54

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQG  546
             QSLLP+H+  AA  LTSH+   AR CCELS G
Sbjct  55   IQSLLPMHNVTAATCLTSHLAANARGCCELSHG  87



>ref|XP_010028392.1| PREDICTED: uncharacterized protein LOC104418683 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028393.1| PREDICTED: uncharacterized protein LOC104418683 isoform X1 [Eucalyptus 
grandis]
Length=103

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 66/107 (62%), Gaps = 9/107 (8%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTAS--LRS--TP-SISLLRSPTllgqrlqsrrllsGILPRTNG  657
            MA R GSLSR+L+S+AR +S   RS  TP S  LLR P     RLQSRRL      R+ G
Sbjct  1    MAWRCGSLSRSLMSSARASSSPFRSSATPLSRPLLRPPPGASPRLQSRRLSFASPSRSMG  60

Query  656  ILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             LGC QSLLPL  A      TSH+ V  R CCELS GT FCRTC DR
Sbjct  61   ELGCVQSLLPLQCAPRL---TSHLSVAVRGCCELSHGT-FCRTCQDR  103



>ref|XP_003517322.1| PREDICTED: uncharacterized protein LOC100807280 [Glycine max]
 gb|KHN36266.1| hypothetical protein glysoja_003389 [Glycine soja]
Length=89

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 61/93 (66%), Gaps = 4/93 (4%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GSLSR++LS ART   RS+ S         L   L   R     LPRT GIL CT
Sbjct  1    MAWRCGSLSRSVLSAARTIPTRSSISPLS----PSLRSHLLHSRRPLNTLPRTVGILVCT  56

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
             SL+PLHSA A+ARLTSHI VE+R+CCELSQGT
Sbjct  57   HSLMPLHSADASARLTSHISVESRACCELSQGT  89



>ref|XP_009398294.1| PREDICTED: uncharacterized protein LOC103982928 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009398295.1| PREDICTED: uncharacterized protein LOC103982928 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009398297.1| PREDICTED: uncharacterized protein LOC103982928 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=99

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS+S +LL+ AR+ S RS  ++  L  P + G RLQ RRL     PR+ G LGC 
Sbjct  1    MAWR-GSISGSLLAAARSYSPRSPHAVRRLPCPPVAGPRLQRRRLPLSP-PRSLGELGCA  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QS LPL+S +AA RLTSH+ V AR+CCELSQGTF  RTC DR
Sbjct  59   QSFLPLYSVVAAPRLTSHLSVSARACCELSQGTFR-RTCQDR  99



>ref|XP_006346348.1| PREDICTED: uncharacterized protein LOC102598144 isoform X3 [Solanum 
tuberosum]
Length=91

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS++R+L S AR ++ RS+P+++ +R+P +   R  +RR      PRT G LGCT
Sbjct  1    MAWR-GSVTRSLTSVARASTSRSSPTVNRVRTPPISAPRSNTRRFSFTS-PRTLGALGCT  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QS LPLH+ +A  RLTSH+ V  R+CCEL  GT
Sbjct  59   QSFLPLHNVVAGTRLTSHLTVNVRACCELYHGT  91



>ref|XP_010941874.1| PREDICTED: uncharacterized protein LOC105060019 isoform X1 [Elaeis 
guineensis]
 ref|XP_010941875.1| PREDICTED: uncharacterized protein LOC105060019 isoform X1 [Elaeis 
guineensis]
Length=101

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 69/104 (66%), Gaps = 5/104 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTAS--LRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILG  648
            MA R GS+SR++L+  R+AS  L S P+   L  P L   RLQ RRL      RT G LG
Sbjct  1    MAWR-GSISRSVLTAGRSASSPLHSPPAAPRLHPPPLAAPRLQRRRLSFAPA-RTLGELG  58

Query  647  CTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            C QSLLPLHS +A  RLTSH+ V AR+CCELSQGTF  RTC DR
Sbjct  59   CVQSLLPLHSVVAVPRLTSHLSVSARACCELSQGTFR-RTCQDR  101



>ref|XP_010315207.1| PREDICTED: uncharacterized protein LOC101248148 isoform X3 [Solanum 
lycopersicum]
Length=91

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS++R+L S AR ++ RS+P+++ +R+P + G R  +RR      PRT G LGCT
Sbjct  1    MAWR-GSVTRSLTSVARASTSRSSPTVNRVRTPPISGTRSNTRRFSFTS-PRTLGALGCT  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QS LPLH+ +A  RLTSH+ V  R+CCEL  GT
Sbjct  59   QSFLPLHNVVAGTRLTSHLTVNVRACCELYHGT  91



>ref|XP_010679562.1| PREDICTED: uncharacterized protein LOC104894897 [Beta vulgaris 
subsp. vulgaris]
Length=92

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS SR+ L+ AR+ ++R + +     SP L      SR       PR   +LGC 
Sbjct  1    MAWRSGSFSRSFLNAARSPTIRPSSAFRRPHSPLLPNSARNSRHFSFTN-PRNVEVLGCI  59

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QSL+P+H+ +A ARLT+HI V+ R+CCELSQGT
Sbjct  60   QSLMPMHNVVADARLTAHIAVDVRACCELSQGT  92



>ref|XP_009408598.1| PREDICTED: uncharacterized protein LOC103990990 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408599.1| PREDICTED: uncharacterized protein LOC103990990 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408600.1| PREDICTED: uncharacterized protein LOC103990990 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=99

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = -3

Query  671  PRTNGILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            PR+ G LGC QS LPL+S +AA  LTSH+ V AR+CCELSQGT FCRTC DR
Sbjct  49   PRSLGALGCAQSFLPLYSVVAAPCLTSHLSVSARACCELSQGT-FCRTCQDR  99



>gb|AFK45136.1| unknown [Medicago truncatula]
Length=90

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 3/93 (3%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GSLSR++ S AR+   RS+   S     + +   L   R     +PR  GILGCT
Sbjct  1    MAWRSGSLSRSIFSAARSIPTRSSLQHSST---SSIRSHLLQPRRPLVTVPRALGILGCT  57

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QSL+PLH+A AAARLTSH+ VE R+CCELSQGT
Sbjct  58   QSLMPLHNADAAARLTSHVSVELRACCELSQGT  90



>emb|CDO97237.1| unnamed protein product [Coffea canephora]
Length=93

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = -3

Query  827  IAMAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILG  648
            +A A R GS+SR+LLSTAR ++ RS P++  +R PTL   RL+ RRL      RT G LG
Sbjct  1    MAAAWR-GSISRSLLSTARASTFRSAPALPRVRPPTLSSLRLRPRRLSFAH-SRTTGELG  58

Query  647  CTQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            C QSL+PL +  A A+LTSH+    R+CCELS GT
Sbjct  59   CAQSLMPLCNLTAGAQLTSHLTANLRACCELSHGT  93



>ref|XP_004511878.1| PREDICTED: uncharacterized protein LOC101504879 [Cicer arietinum]
Length=92

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GSLSR++ S +RT   RS+PS+    S  L    L  RR L  + PRT GILGCT
Sbjct  1    MAWRCGSLSRSIFSASRTIPTRSSPSLQRSSSSLLRSHLLHPRRPLVTV-PRTLGILGCT  59

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QSL+PLH+A AAARLTSHI VE R+CCELSQGT
Sbjct  60   QSLMPLHNADAAARLTSHISVELRACCELSQGT  92



>ref|XP_006346347.1| PREDICTED: uncharacterized protein LOC102598144 isoform X2 [Solanum 
tuberosum]
Length=96

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS++R+L S AR ++ RS+P+++ +R+P +   R  +RR      PRT G LGCT
Sbjct  1    MAWR-GSVTRSLTSVARASTSRSSPTVNRVRTPPISAPRSNTRRFSFTS-PRTLGALGCT  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQG  546
            QS LPLH+ +A  RLTSH+ V  R+CCEL  G
Sbjct  59   QSFLPLHNVVAGTRLTSHLTVNVRACCELYHG  90



>ref|XP_006605985.1| PREDICTED: uncharacterized protein LOC100809521 isoform X5 [Glycine 
max]
 ref|XP_006605986.1| PREDICTED: uncharacterized protein LOC100809521 isoform X6 [Glycine 
max]
 ref|XP_006605987.1| PREDICTED: uncharacterized protein LOC100809521 isoform X7 [Glycine 
max]
Length=98

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLR-SPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R GSLSR+L+STAR +   + PS +L R  P  L       R  S    R  G LGC
Sbjct  1    MAFRSGSLSRSLMSTARASLRPAAPSSTLPRLRPPPLAAPRVQSRRFSMPASRNLGQLGC  60

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            T SLLPL         TSHI V AR+CCELS GTF  R+C DR
Sbjct  61   THSLLPLGITCM----TSHIAVSARACCELSHGTFR-RSCQDR  98



>ref|XP_011088195.1| PREDICTED: uncharacterized protein LOC105169495 isoform X1 [Sesamum 
indicum]
Length=102

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 70/105 (67%), Gaps = 6/105 (6%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISL---LRSPTllgqrlqsrrllsGILPRTNGIL  651
            MA R GSLSR+L+STAR ++ RS+  +S    LR P++   RL  RRL     PRT G L
Sbjct  1    MAWR-GSLSRSLISTARASAFRSSTPLSAPPPLRPPSVSSSRLNPRRLSFSN-PRTLGEL  58

Query  650  GCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            GC QS++PLH+ +A ARLTSH  V  R+ CELS GTF  R+C DR
Sbjct  59   GCIQSIMPLHTMVAGARLTSHSAVNVRAFCELSHGTFR-RSCQDR  102



>ref|XP_010315206.1| PREDICTED: uncharacterized protein LOC101248148 isoform X2 [Solanum 
lycopersicum]
Length=96

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS++R+L S AR ++ RS+P+++ +R+P + G R  +RR      PRT G LGCT
Sbjct  1    MAWR-GSVTRSLTSVARASTSRSSPTVNRVRTPPISGTRSNTRRFSFTS-PRTLGALGCT  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQG  546
            QS LPLH+ +A  RLTSH+ V  R+CCEL  G
Sbjct  59   QSFLPLHNVVAGTRLTSHLTVNVRACCELYHG  90



>ref|XP_007143072.1| hypothetical protein PHAVU_007G041500g [Phaseolus vulgaris]
 gb|ESW15066.1| hypothetical protein PHAVU_007G041500g [Phaseolus vulgaris]
Length=101

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 3/103 (3%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLR-SPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R GS SR+L+S+AR ASLR     +L R  P  +       R  S    R  G LGC
Sbjct  1    MAWRSGSFSRSLVSSAR-ASLRPAAPSALPRLRPPPVTAPRVQSRRFSMPATRNLGQLGC  59

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             +SLLPLHS +A   +TSHI V AR+CCELS GTF  R+C DR
Sbjct  60   IESLLPLHSTMAITCMTSHITVGARACCELSHGTFR-RSCQDR  101



>gb|EYU37616.1| hypothetical protein MIMGU_mgv1a016981mg [Erythranthe guttata]
Length=98

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 64/104 (62%), Gaps = 8/104 (8%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLR--SPTllgqrlqsrrllsGILPRTNGILG  648
            MA R GS+SR+L+STAR+++ RS+  +S  R  +P+      +         PRT G LG
Sbjct  1    MAWR-GSVSRSLMSTARSSAFRSSTPLSAPRRLNPSSRPIPRRLSFSN----PRTLGELG  55

Query  647  CTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            C QSLLP+HS +A   LTSH+ V  R+ CEL  GT F R+C DR
Sbjct  56   CAQSLLPMHSMVAGLGLTSHLAVNVRAYCELYNGT-FQRSCQDR  98



>ref|XP_008813190.1| PREDICTED: uncharacterized protein LOC103723893 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008813191.1| PREDICTED: uncharacterized protein LOC103723893 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008813192.1| PREDICTED: uncharacterized protein LOC103723893 isoform X1 [Phoenix 
dactylifera]
Length=101

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = -3

Query  671  PRTNGILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            PRT G LGC QSLLPLHS +A  RLTSH+ V AR+CCELSQGTF  RTC DR
Sbjct  51   PRTLGELGCAQSLLPLHSVVAVPRLTSHLSVSARACCELSQGTFR-RTCQDR  101



>ref|XP_010488936.1| PREDICTED: uncharacterized protein LOC104766697 isoform X1 [Camelina 
sativa]
Length=98

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 66/106 (62%), Gaps = 12/106 (11%)
 Frame = -3

Query  821  MAGR-YGSLSRALLS-TARTASLRSTPSISL--LRSPTllgqrlqsrrllsGILPRTNGI  654
            MA R  GS +R+ +S TAR+ SLRS PS +L  LR P    +   S         R  G 
Sbjct  1    MAWRSAGSAARSFVSATARSPSLRS-PSRALPRLRPPPSSRRFTFSSPS------RNLGA  53

Query  653  LGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            LGCTQS LPL+S +AA++LTSH+ V  R+ CELS GT F RTCPDR
Sbjct  54   LGCTQSFLPLYSVVAASQLTSHLNVNLRAFCELSNGT-FQRTCPDR  98



>ref|XP_010909759.1| PREDICTED: uncharacterized protein LOC105035766 isoform X1 [Elaeis 
guineensis]
Length=101

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = -3

Query  671  PRTNGILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            PRT G LGC QSLLPLHS +A  RLTSH+ V AR+CCELSQGTF  RTC DR
Sbjct  51   PRTLGELGCAQSLLPLHSVVALPRLTSHLSVSARACCELSQGTFR-RTCQDR  101



>ref|XP_002885949.1| hypothetical protein ARALYDRAFT_480380 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62208.1| hypothetical protein ARALYDRAFT_480380 [Arabidopsis lyrata subsp. 
lyrata]
Length=101

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = -3

Query  821  MAGRY-GSLSRALLS-TARTASLRS-TPSISLLRSPTllgqrlqsrrllsGILPRTNGIL  651
            MA R  GS +R+ +S TAR+ SLRS T ++  LR P       +          R  G L
Sbjct  1    MAWRNAGSAARSFVSATARSPSLRSPTTALPRLRPPQSSLPGRRFTFSSPS---RNLGAL  57

Query  650  GCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            GCTQS LPL+S +AA++LTSH+ V  R+ CELS GT F RTCPDR
Sbjct  58   GCTQSFLPLYSVVAASQLTSHLNVNLRAFCELSNGT-FQRTCPDR  101



>ref|XP_009397298.1| PREDICTED: uncharacterized protein LOC103982185 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=99

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = -3

Query  671  PRTNGILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            PR+ G LGC QS LPL+S +AA RLTSH+ V AR+CCELSQGTF  RTC DR
Sbjct  49   PRSLGQLGCAQSFLPLYSVVAAPRLTSHLSVSARACCELSQGTFR-RTCQDR  99



>gb|KHN42344.1| hypothetical protein glysoja_020056 [Glycine soja]
Length=95

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 60/103 (58%), Gaps = 9/103 (9%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLR-STPSISLLRSPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R GSLSR+L+STAR ASLR + PS +L R    L       R  S    R  G LGC
Sbjct  1    MAFRSGSLSRSLMSTAR-ASLRPAAPSSTLPR--LRLAAPRVQSRRFSMPASRNLGQLGC  57

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            T SLLPL         TSHI V AR+CCELS GTF  R+C DR
Sbjct  58   THSLLPLGITCM----TSHIAVSARACCELSHGTFR-RSCQDR  95



>ref|XP_011030380.1| PREDICTED: uncharacterized protein LOC105129843 isoform X1 [Populus 
euphratica]
Length=98

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 58/104 (56%), Gaps = 8/104 (8%)
 Frame = -3

Query  821  MAGRYG-SLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTN-GILG  648
            MA R G SLSR+L+S AR  + RS+  +  LR P       + +     + P  N G LG
Sbjct  1    MAWRSGGSLSRSLMSAARAPTPRSSAPLPHLRQPP--TSSPRFQSRRLSLAPSRNLGELG  58

Query  647  CTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            CTQS   L   +A+  LTS +    R+ CELS GT FCRTCPDR
Sbjct  59   CTQS---LLPLVASGHLTSRLNANLRAFCELSHGT-FCRTCPDR  98



>gb|KHG11389.1| hypothetical protein F383_14795 [Gossypium arboreum]
Length=884

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -3

Query  812  RYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTN-GILGCTQS  636
            R GSLSR+++S AR  SLR+   +  +R  T    RLQSRRL     P  N G LGC QS
Sbjct  788  RLGSLSRSVMSAARAPSLRTPAPMPRVRLRTSSAPRLQSRRLS--FAPSRNLGELGCVQS  845

Query  635  llplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             LPLH+ +  A LTSH+ V  R+CCELS GT FCR+C DR
Sbjct  846  FLPLHNLVPMACLTSHLTVNVRACCELSHGT-FCRSCQDR  884



>ref|XP_010517947.1| PREDICTED: uncharacterized protein LOC104793303 isoform X1 [Camelina 
sativa]
 ref|XP_010517959.1| PREDICTED: uncharacterized protein LOC104793303 isoform X1 [Camelina 
sativa]
Length=99

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 66/107 (62%), Gaps = 13/107 (12%)
 Frame = -3

Query  821  MAGR--YGSLSRALLS-TARTASLRSTPSISL--LRSPTllgqrlqsrrllsGILPRTNG  657
            MA R   GS +R+ +S TAR+ S+RS PS +L  LR P    +   S         R  G
Sbjct  1    MAWRRSAGSAARSFVSATARSPSIRS-PSTALPRLRPPPSSRRFTFSSPS------RNLG  53

Query  656  ILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
             LGCTQS LPL+S +A+++LTSH+ V  R+ CELS GT F RTCPDR
Sbjct  54   ALGCTQSFLPLYSVVASSQLTSHLNVNLRAFCELSNGT-FQRTCPDR  99



>ref|XP_009592473.1| PREDICTED: uncharacterized protein LOC104089319 isoform X1 [Nicotiana 
tomentosiformis]
Length=93

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 63/102 (62%), Gaps = 9/102 (9%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS++R+L   AR ++ RS+P ++ +R+P +   R  +RR      PRT G LGCT
Sbjct  1    MAWR-GSITRSL---ARVSTSRSSPVLNRVRTPPISAPRSHTRRFSFAT-PRTLGALGCT  55

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            QS LPL +       TSH+ V+ R+CCEL  GT F R+C DR
Sbjct  56   QSFLPLVAGTRL---TSHLTVDVRACCELYHGT-FQRSCQDR  93



>ref|XP_008792611.1| PREDICTED: uncharacterized protein LOC103709161 isoform X2 [Phoenix 
dactylifera]
Length=93

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTAS--LRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILG  648
            MA R GS+SR+LL+TAR++S  +RS  +   LR P L G R+Q RRL     PRT G L 
Sbjct  1    MAWR-GSISRSLLATARSSSSTIRSPAAAPRLRPPPLAGPRVQRRRLSCAP-PRTLGELA  58

Query  647  CTQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            C QSLLPLHS +A   LTSH+ V AR+CCELSQGT
Sbjct  59   CAQSLLPLHSVVAVPCLTSHLSVSARACCELSQGT  93



>ref|XP_003611654.1| hypothetical protein MTR_5g016330 [Medicago truncatula]
Length=103

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GSLSR++ S AR+   RS+   S     + +   L   R     +PR  GILGCT
Sbjct  1    MAWRSGSLSRSIFSAARSIPTRSSLQHSST---SSIRSHLLQPRRPLVTVPRALGILGCT  57

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQG  546
            QSL+PLH+A AAARLTSH+ VE R+CCELSQ 
Sbjct  58   QSLMPLHNADAAARLTSHVSVELRACCELSQA  89



>ref|XP_006298846.1| hypothetical protein CARUB_v10014960mg, partial [Capsella rubella]
 gb|EOA31744.1| hypothetical protein CARUB_v10014960mg, partial [Capsella rubella]
Length=115

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 10/105 (10%)
 Frame = -3

Query  821  MAGR-YGSLSRALLS-TARTASLRS-TPSISLLRSPTllgqrlqsrrllsGILPRTNGIL  651
            MA R  GS +R+ +S TAR+ SLRS T ++  LR P    +   S         R  G+L
Sbjct  18   MAWRSAGSAARSFVSATARSPSLRSPTTALPRLRPPQSSRRFTFSSPS------RNLGVL  71

Query  650  GCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            GCTQS LPL+S +AA++LTSH+ V  R+ CELS GT F RTC DR
Sbjct  72   GCTQSFLPLYSVVAASQLTSHLNVNLRAFCELSNGT-FQRTCQDR  115



>gb|AES94612.2| hypothetical protein MTR_5g016330 [Medicago truncatula]
Length=129

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 60/91 (66%), Gaps = 3/91 (3%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GSLSR++ S AR+   RS+   S   S + +   L   R     +PR  GILGCT
Sbjct  1    MAWRSGSLSRSIFSAARSIPTRSSLQHS---STSSIRSHLLQPRRPLVTVPRALGILGCT  57

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQ  549
            QSL+PLH+A AAARLTSH+ VE R+CCELSQ
Sbjct  58   QSLMPLHNADAAARLTSHVSVELRACCELSQ  88



>ref|XP_007206187.1| hypothetical protein PRUPE_ppa013887mg [Prunus persica]
 gb|EMJ07386.1| hypothetical protein PRUPE_ppa013887mg [Prunus persica]
Length=98

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = -3

Query  779  TARTASLRSTPSIS-LLRSPTllgqrlqsrrllsGILPRTNGILGCTQSllplhsalaaa  603
            TAR +++RS+PSIS L RSP    +    R L S  LP     L C QSL+PLHSALA+A
Sbjct  16   TARASTIRSSPSISSLPRSPLHNLRTSSRRSLFS--LPVNVSQLACAQSLMPLHSALASA  73

Query  602  rLTSHIEVEARSCCELSQGT  543
            RLTSHI VEAR CCELSQGT
Sbjct  74   RLTSHISVEARHCCELSQGT  93



>ref|XP_003631688.1| PREDICTED: uncharacterized protein LOC100260985 isoform X4 [Vitis 
vinifera]
Length=91

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 12/98 (12%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISL-----LRSPTllgqrlqsrrllsGILPRTNG  657
            MA R GSLSR+L+STAR +SLRS+P+        L +P L  +RL          PR  G
Sbjct  1    MAWR-GSLSRSLMSTARASSLRSSPAAPRVRPPPLAAPRLQTRRLSFTN------PRNLG  53

Query  656  ILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
             LGC QSLLPLH+ +A+ RLTSH+ V+ R+CCEL  GT
Sbjct  54   ELGCVQSLLPLHNVMASPRLTSHLSVDVRACCELFHGT  91



>ref|XP_008792610.1| PREDICTED: uncharacterized protein LOC103709161 isoform X1 [Phoenix 
dactylifera]
Length=107

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 4/98 (4%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTAS--LRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILG  648
            MA R GS+SR+LL+TAR++S  +RS  +   LR P L G R+Q RRL     PRT G L 
Sbjct  1    MAWR-GSISRSLLATARSSSSTIRSPAAAPRLRPPPLAGPRVQRRRLSCAP-PRTLGELA  58

Query  647  CTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFC  534
            C QSLLPLHS +A   LTSH+ V AR+CCELSQ    C
Sbjct  59   CAQSLLPLHSVVAVPCLTSHLSVSARACCELSQENAVC  96



>ref|XP_010941883.1| PREDICTED: uncharacterized protein LOC105060019 isoform X5 [Elaeis 
guineensis]
Length=93

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTAS--LRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILG  648
            MA R GS+SR++L+  R+AS  L S P+   L  P L   RLQ RRL      RT G LG
Sbjct  1    MAWR-GSISRSVLTAGRSASSPLHSPPAAPRLHPPPLAAPRLQRRRLSFAPA-RTLGELG  58

Query  647  CTQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            C QSLLPLHS +A  RLTSH+ V AR+CCELSQGT
Sbjct  59   CVQSLLPLHSVVAVPRLTSHLSVSARACCELSQGT  93



>ref|XP_010467279.1| PREDICTED: uncharacterized protein LOC104747348 isoform X1 [Camelina 
sativa]
Length=98

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 65/106 (61%), Gaps = 12/106 (11%)
 Frame = -3

Query  821  MAGR-YGSLSRALLS-TARTASLRSTPSISL--LRSPTllgqrlqsrrllsGILPRTNGI  654
            MA R  GS +R+ +S TAR+ SLRS PS +L  LR P    +   S         R  G 
Sbjct  1    MAWRSAGSAARSFVSATARSPSLRS-PSTALPRLRPPPSSRRFTFSSPS------RNLGA  53

Query  653  LGCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            LGCTQS LPL+S +AA++LTSH+ V  R+ CELS GT F RTC DR
Sbjct  54   LGCTQSFLPLYSVVAASQLTSHLNVNLRAFCELSNGT-FQRTCQDR  98



>ref|XP_009398299.1| PREDICTED: uncharacterized protein LOC103982928 isoform X5 [Musa 
acuminata subsp. malaccensis]
Length=91

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLRSPTllgqrlqsrrllsGILPRTNGILGCT  642
            MA R GS+S +LL+ AR+ S RS  ++  L  P + G RLQ RRL     PR+ G LGC 
Sbjct  1    MAWR-GSISGSLLAAARSYSPRSPHAVRRLPCPPVAGPRLQRRRLPLSP-PRSLGELGCA  58

Query  641  QSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            QS LPL+S +AA RLTSH+ V AR+CCELSQGT
Sbjct  59   QSFLPLYSVVAAPRLTSHLSVSARACCELSQGT  91



>ref|NP_001077892.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001077893.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC06357.1| uncharacterized protein AT2G15000 [Arabidopsis thaliana]
 gb|AEC06358.1| uncharacterized protein AT2G15000 [Arabidopsis thaliana]
Length=101

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 62/105 (59%), Gaps = 7/105 (7%)
 Frame = -3

Query  821  MAGRY-GSLSRALLS-TARTASLRS-TPSISLLRSPTllgqrlqsrrllsGILPRTNGIL  651
            MA R  GS +R+ +S TAR+ SLRS T ++  LR P       +          R  G L
Sbjct  1    MAWRNAGSAARSFVSATARSPSLRSPTTALPRLRPPQSSLPSRRFTFSSPS---RNLGAL  57

Query  650  GCTQSllplhsalaaarLTSHIEVEARSCCELSQGTFFCRTCPDR  516
            GCTQS LPL+S +A ++LTSH+ V  R+ CELS GT F RTC DR
Sbjct  58   GCTQSFLPLYSVVATSQLTSHLNVNLRAFCELSNGT-FQRTCQDR  101



>ref|XP_003555972.1| PREDICTED: uncharacterized protein LOC100809521 isoformX3 [Glycine 
max]
Length=90

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLR-STPSISLLR-SPTllgqrlqsrrllsGILPRTNGILG  648
            MA R GSLSR+L+STAR ASLR + PS +L R  P  L       R  S    R  G LG
Sbjct  1    MAFRSGSLSRSLMSTAR-ASLRPAAPSSTLPRLRPPPLAAPRVQSRRFSMPASRNLGQLG  59

Query  647  CTQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            CT SLLPL         TSHI V AR+CCELS GT
Sbjct  60   CTHSLLPLGITCM----TSHIAVSARACCELSHGT  90



>ref|XP_011088196.1| PREDICTED: uncharacterized protein LOC105169495 isoform X2 [Sesamum 
indicum]
Length=94

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISL---LRSPTllgqrlqsrrllsGILPRTNGIL  651
            MA R GSLSR+L+STAR ++ RS+  +S    LR P++   RL  RRL     PRT G L
Sbjct  1    MAWR-GSLSRSLISTARASAFRSSTPLSAPPPLRPPSVSSSRLNPRRLSFSN-PRTLGEL  58

Query  650  GCTQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            GC QS++PLH+ +A ARLTSH  V  R+ CELS GT
Sbjct  59   GCIQSIMPLHTMVAGARLTSHSAVNVRAFCELSHGT  94



>ref|XP_007143075.1| hypothetical protein PHAVU_007G041500g [Phaseolus vulgaris]
 gb|ESW15069.1| hypothetical protein PHAVU_007G041500g [Phaseolus vulgaris]
Length=93

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = -3

Query  821  MAGRYGSLSRALLSTARTASLRSTPSISLLR-SPTllgqrlqsrrllsGILPRTNGILGC  645
            MA R GS SR+L+S+AR ASLR     +L R  P  +       R  S    R  G LGC
Sbjct  1    MAWRSGSFSRSLVSSAR-ASLRPAAPSALPRLRPPPVTAPRVQSRRFSMPATRNLGQLGC  59

Query  644  TQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
             +SLLPLHS +A   +TSHI V AR+CCELS GT
Sbjct  60   IESLLPLHSTMAITCMTSHITVGARACCELSHGT  93



>ref|XP_010277159.1| PREDICTED: uncharacterized protein LOC104611682 isoform X2 [Nelumbo 
nucifera]
Length=91

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  671  PRTNGILGCTQSllplhsalaaarLTSHIEVEARSCCELSQGT  543
            PRT G LGC QSL+PLHS +AA RLTSH+ V+AR+CCELSQGT
Sbjct  49   PRTMGELGCIQSLMPLHSVVAAPRLTSHLAVDARACCELSQGT  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1875420020936