BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14154_g1_i2 len=972 path=[6291:0-41 2239:42-971]

Length=972
                                                                      Score     E

ref|XP_010325083.1|  PREDICTED: nuclear pore complex protein Nup8...    352   3e-113   
ref|XP_010325084.1|  PREDICTED: nuclear pore complex protein Nup8...    352   4e-113   
ref|XP_010325085.1|  PREDICTED: nuclear pore complex protein Nup8...    351   7e-113   
ref|XP_006359747.1|  PREDICTED: nuclear pore complex protein Nup8...    354   1e-112   
ref|XP_010325082.1|  PREDICTED: nuclear pore complex protein Nup8...    352   3e-112   
ref|XP_004245163.1|  PREDICTED: nuclear pore complex protein Nup8...    352   1e-111   
ref|XP_009620956.1|  PREDICTED: nuclear pore complex protein Nup85      349   1e-110   
ref|XP_006359748.1|  PREDICTED: nuclear pore complex protein Nup8...    347   6e-110   
ref|XP_009772740.1|  PREDICTED: nuclear pore complex protein Nup85      345   6e-109   
dbj|BAO49744.1|  nuclear pore complex protein Nup75a                    340   3e-107   
dbj|BAO49745.1|  nuclear pore complex protein Nup75b                    339   9e-107   
emb|CDP08158.1|  unnamed protein product                                338   2e-106   
ref|XP_004291177.1|  PREDICTED: nuclear pore complex protein Nup8...    333   9e-105   
ref|XP_009367452.1|  PREDICTED: nuclear pore complex protein Nup85      332   7e-104   
ref|XP_006450697.1|  hypothetical protein CICLE_v10007610mg             325   2e-103   
ref|XP_007225207.1|  hypothetical protein PRUPE_ppa002043mg             329   9e-103   
ref|XP_006450694.1|  hypothetical protein CICLE_v10007610mg             325   1e-102   
gb|KDO79830.1|  hypothetical protein CISIN_1g005153mg                   327   2e-102   
ref|XP_002283798.1|  PREDICTED: nuclear pore complex protein NUP85      327   2e-102   Vitis vinifera
ref|XP_006476034.1|  PREDICTED: nuclear pore complex protein Nup8...    327   4e-102   
ref|XP_008220081.1|  PREDICTED: nuclear pore complex protein Nup85      326   1e-101   
ref|XP_006450696.1|  hypothetical protein CICLE_v10007610mg             325   2e-101   
ref|XP_008393863.1|  PREDICTED: nuclear pore complex protein Nup85      325   2e-101   
ref|XP_008361030.1|  PREDICTED: nuclear pore complex protein Nup8...    325   2e-101   
gb|KDO79829.1|  hypothetical protein CISIN_1g005153mg                   324   6e-101   
ref|XP_006450695.1|  hypothetical protein CICLE_v10007610mg             322   3e-100   
gb|KHG04510.1|  Nuclear pore complex Nup85 -like protein                320   2e-99    
ref|XP_011010428.1|  PREDICTED: nuclear pore complex protein NUP8...    318   1e-98    
ref|XP_010275717.1|  PREDICTED: nuclear pore complex protein Nup8...    314   2e-98    
gb|EYU29282.1|  hypothetical protein MIMGU_mgv1a002126mg                317   2e-98    
gb|KDP34155.1|  hypothetical protein JCGZ_07726                         316   6e-98    
ref|XP_010275714.1|  PREDICTED: nuclear pore complex protein Nup8...    313   6e-97    
ref|XP_010275716.1|  PREDICTED: nuclear pore complex protein Nup8...    313   7e-97    
ref|XP_011091302.1|  PREDICTED: nuclear pore complex protein NUP85      312   2e-96    
ref|XP_002324219.1|  hypothetical protein POPTR_0018s08040g             311   4e-96    Populus trichocarpa [western balsam poplar]
dbj|BAF45348.1|  nucleoporin                                            308   4e-95    Lotus japonicus
ref|XP_007012136.1|  Nucleoporin Nup85-like isoform 1                   306   4e-94    
ref|XP_010436282.1|  PREDICTED: nuclear pore complex protein Nup8...    293   9e-94    
ref|XP_010102397.1|  hypothetical protein L484_010709                   300   7e-92    
ref|XP_006283222.1|  hypothetical protein CARUB_v10004252mg             299   2e-91    
ref|NP_567908.1|  uncharacterized protein                               297   9e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AES58637.2|  Nup85 nucleoporin protein                               297   1e-90    
gb|AAK32793.1|AF361625_1  AT4g32910/F26P21_30                           296   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447320.1|  PREDICTED: nuclear pore complex protein Nup8...    295   5e-90    
ref|XP_010047243.1|  PREDICTED: nuclear pore complex protein Nup8...    293   6e-90    
gb|KCW79106.1|  hypothetical protein EUGRSUZ_C00551                     293   7e-90    
ref|XP_002516506.1|  conserved hypothetical protein                     295   9e-90    Ricinus communis
ref|XP_010047276.1|  PREDICTED: nuclear pore complex protein Nup85      295   1e-89    
emb|CDX75299.1|  BnaA01g04030D                                          294   1e-89    
ref|XP_010432640.1|  PREDICTED: nuclear pore complex protein Nup8...    294   2e-89    
ref|XP_004148390.1|  PREDICTED: nuclear pore complex protein Nup8...    293   2e-89    
ref|XP_010437833.1|  PREDICTED: nuclear pore complex protein Nup85      292   8e-89    
ref|XP_009125264.1|  PREDICTED: nuclear pore complex protein Nup85      291   1e-88    
ref|XP_003550123.1|  PREDICTED: nuclear pore complex protein Nup8...    291   1e-88    
ref|XP_010526106.1|  PREDICTED: nuclear pore complex protein NUP8...    290   7e-88    
ref|XP_010526105.1|  PREDICTED: nuclear pore complex protein NUP8...    289   9e-88    
emb|CDX68920.1|  BnaC01g05330D                                          288   2e-87    
ref|XP_006412412.1|  hypothetical protein EUTSA_v10024536mg             288   3e-87    
ref|XP_004498465.1|  PREDICTED: nuclear pore complex protein Nup8...    286   8e-87    
ref|XP_008445011.1|  PREDICTED: nuclear pore complex protein Nup85      286   1e-86    
gb|KFK29901.1|  hypothetical protein AALP_AA7G193100                    286   1e-86    
gb|EPS63372.1|  hypothetical protein M569_11413                         269   4e-85    
ref|XP_010668417.1|  PREDICTED: nuclear pore complex protein NUP8...    279   9e-84    
ref|XP_002869236.1|  hypothetical protein ARALYDRAFT_491404             275   4e-82    
ref|XP_008810655.1|  PREDICTED: nuclear pore complex protein Nup85      272   4e-81    
ref|XP_010924656.1|  PREDICTED: nuclear pore complex protein NUP8...    264   1e-78    
ref|XP_010924654.1|  PREDICTED: nuclear pore complex protein NUP8...    265   2e-78    
ref|XP_010924653.1|  PREDICTED: nuclear pore complex protein NUP8...    264   2e-78    
ref|XP_006853615.1|  hypothetical protein AMTR_s00056p00051320          265   3e-78    
ref|XP_010924652.1|  PREDICTED: nuclear pore complex protein NUP8...    264   3e-78    
ref|XP_003569792.1|  PREDICTED: nuclear pore complex protein Nup85      263   1e-77    
ref|XP_004969928.1|  PREDICTED: nuclear pore complex protein Nup8...    257   2e-75    
dbj|BAK02879.1|  predicted protein                                      256   5e-75    
tpg|DAA57612.1|  TPA: hypothetical protein ZEAMMB73_995542              246   1e-74    
ref|XP_002456346.1|  hypothetical protein SORBIDRAFT_03g034380          254   2e-74    Sorghum bicolor [broomcorn]
ref|XP_009387645.1|  PREDICTED: nuclear pore complex protein Nup8...    250   3e-73    
ref|NP_001044228.1|  Os01g0746200                                       251   3e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009387644.1|  PREDICTED: nuclear pore complex protein Nup8...    250   6e-73    
ref|NP_001168171.1|  hypothetical protein                               247   1e-71    Zea mays [maize]
gb|EMT33767.1|  hypothetical protein F775_17911                         243   2e-70    
ref|XP_003588386.1|  Nuclear pore complex protein Nup85                 245   3e-70    
emb|CDM84057.1|  unnamed protein product                                238   3e-68    
ref|XP_006646316.1|  PREDICTED: nuclear pore complex protein Nup8...    234   1e-66    
ref|XP_007161497.1|  hypothetical protein PHAVU_001G074100g             219   4e-66    
gb|EEE55373.1|  hypothetical protein OsJ_03432                          227   2e-64    Oryza sativa Japonica Group [Japonica rice]
gb|EMS46015.1|  hypothetical protein TRIUR3_08885                       215   7e-61    
emb|CAA21200.1|  putative protein                                       218   7e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382047.1|  hypothetical protein POPTR_0006s25450g             200   2e-58    
ref|XP_010668426.1|  PREDICTED: nuclear pore complex protein NUP8...    204   3e-56    
ref|XP_010924655.1|  PREDICTED: nuclear pore complex protein NUP8...    202   2e-55    
gb|EEC71467.1|  hypothetical protein OsI_03713                          201   3e-55    Oryza sativa Indica Group [Indian rice]
dbj|BAD87530.1|  putative nucleoporin Nup75                             184   2e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002973301.1|  hypothetical protein SELMODRAFT_413557             152   4e-40    
ref|XP_002976601.1|  hypothetical protein SELMODRAFT_416713             151   6e-40    
ref|XP_002976602.1|  hypothetical protein SELMODRAFT_416715             145   3e-37    
ref|XP_002994277.1|  hypothetical protein SELMODRAFT_432209             143   1e-36    
ref|XP_001770626.1|  predicted protein                                  149   2e-36    
ref|XP_002976603.1|  hypothetical protein SELMODRAFT_416717             138   2e-34    
ref|XP_002976604.1|  hypothetical protein SELMODRAFT_416720             119   8e-29    
ref|XP_002994497.1|  hypothetical protein SELMODRAFT_432414             117   6e-28    
gb|KEH39708.1|  Nup85 nucleoporin protein                             77.4    2e-12    
ref|XP_007161496.1|  hypothetical protein PHAVU_001G074000g           76.3    4e-12    
ref|XP_008804615.1|  PREDICTED: nuclear pore complex protein Nup8...  63.5    1e-08    
ref|XP_011019607.1|  PREDICTED: nuclear pore complex protein NUP85    55.8    1e-06    



>ref|XP_010325083.1| PREDICTED: nuclear pore complex protein Nup85 isoform X3 [Solanum 
lycopersicum]
Length=597

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 221/273 (81%), Gaps = 2/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++  DLAMVPV  E+EN  VV   LRHGLK PIHR S SWA GNTLRV++ RKP 
Sbjct  1    MPGLTSEPDDLAMVPVSLETENQPVVNYPLRHGLKSPIHRLSFSWACGNTLRVSVFRKPQ  60

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
             + A G     G +VVE+ LSN+G EE+DA RWR++AY SVTPFALLQSRK+S++A S+M
Sbjct  61   SETADGEGEAGG-RVVEVKLSNSGDEEVDAARWRRMAYSSVTPFALLQSRKHSLSAASRM  119

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            SLD PPY AEW EHV+EYSKEI+SLL + K  P S+IED K+V+ E+  P CLK AWEL+
Sbjct  120  SLDIPPYKAEWWEHVIEYSKEISSLLSDQKPPPKSIIEDAKSVVNEIAAPVCLKAAWELL  179

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DKQSQ+WI ERLLDWLADY+SLFSGT PT+HSK+VDFQ++LV +Q +E+DP YW+
Sbjct  180  EIFYIDKQSQSWIPERLLDWLADYNSLFSGTLPTIHSKLVDFQQELVGVQVVEDDPNYWD  239

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +SSALAVGWL+TVVKLLRLHGSY+FDQL +RE
Sbjct  240  AMSSALAVGWLETVVKLLRLHGSYRFDQLSSRE  272



>ref|XP_010325084.1| PREDICTED: nuclear pore complex protein Nup85 isoform X4 [Solanum 
lycopersicum]
Length=596

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 221/273 (81%), Gaps = 2/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++  DLAMVPV  E+EN  VV   LRHGLK PIHR S SWA GNTLRV++ RKP 
Sbjct  1    MPGLTSEPDDLAMVPVSLETENQPVVNYPLRHGLKSPIHRLSFSWACGNTLRVSVFRKPQ  60

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
             + A G     G +VVE+ LSN+G EE+DA RWR++AY SVTPFALLQSRK+S++A S+M
Sbjct  61   SETADGEGEAGG-RVVEVKLSNSGDEEVDAARWRRMAYSSVTPFALLQSRKHSLSAASRM  119

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            SLD PPY AEW EHV+EYSKEI+SLL + K  P S+IED K+V+ E+  P CLK AWEL+
Sbjct  120  SLDIPPYKAEWWEHVIEYSKEISSLLSDQKPPPKSIIEDAKSVVNEIAAPVCLKAAWELL  179

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DKQSQ+WI ERLLDWLADY+SLFSGT PT+HSK+VDFQ++LV +Q +E+DP YW+
Sbjct  180  EIFYIDKQSQSWIPERLLDWLADYNSLFSGTLPTIHSKLVDFQQELVGVQVVEDDPNYWD  239

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +SSALAVGWL+TVVKLLRLHGSY+FDQL +RE
Sbjct  240  AMSSALAVGWLETVVKLLRLHGSYRFDQLSSRE  272



>ref|XP_010325085.1| PREDICTED: nuclear pore complex protein Nup85 isoform X5 [Solanum 
lycopersicum]
Length=588

 Score =   351 bits (901),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 221/273 (81%), Gaps = 2/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++  DLAMVPV  E+EN  VV   LRHGLK PIHR S SWA GNTLRV++ RKP 
Sbjct  1    MPGLTSEPDDLAMVPVSLETENQPVVNYPLRHGLKSPIHRLSFSWACGNTLRVSVFRKPQ  60

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
             + A G     G +VVE+ LSN+G EE+DA RWR++AY SVTPFALLQSRK+S++A S+M
Sbjct  61   SETADGEGEAGG-RVVEVKLSNSGDEEVDAARWRRMAYSSVTPFALLQSRKHSLSAASRM  119

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            SLD PPY AEW EHV+EYSKEI+SLL + K  P S+IED K+V+ E+  P CLK AWEL+
Sbjct  120  SLDIPPYKAEWWEHVIEYSKEISSLLSDQKPPPKSIIEDAKSVVNEIAAPVCLKAAWELL  179

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DKQSQ+WI ERLLDWLADY+SLFSGT PT+HSK+VDFQ++LV +Q +E+DP YW+
Sbjct  180  EIFYIDKQSQSWIPERLLDWLADYNSLFSGTLPTIHSKLVDFQQELVGVQVVEDDPNYWD  239

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +SSALAVGWL+TVVKLLRLHGSY+FDQL +RE
Sbjct  240  AMSSALAVGWLETVVKLLRLHGSYRFDQLSSRE  272



>ref|XP_006359747.1| PREDICTED: nuclear pore complex protein Nup85-like isoform X1 
[Solanum tuberosum]
Length=719

 Score =   354 bits (909),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/273 (67%), Positives = 221/273 (81%), Gaps = 2/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++S DLAMVPV PESE   VV   LRHGLK PIHR S SWA GNTLRV++ RKP 
Sbjct  1    MPGLTSESDDLAMVPVSPESEKQPVVIYPLRHGLKSPIHRLSFSWACGNTLRVSVFRKPQ  60

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
             D A G     G +VVE+ LSN+G EE+DA RWR++AY SVTPFALLQSRK+S++A S+M
Sbjct  61   SDKADGDGEAGG-RVVEVKLSNSGDEEVDAARWRRMAYSSVTPFALLQSRKHSLSAASRM  119

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            SLD PPY AEW EH++EYSKEI+SLL + K  P S+IEDPK+V+ E+  P CLK AWEL+
Sbjct  120  SLDIPPYKAEWWEHIIEYSKEISSLLSDRKPPPESIIEDPKSVVNEIAAPMCLKAAWELL  179

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DKQSQ+WI ERLLDWLADY SLFSGT PT+HSK+VDFQ++LV +Q +E DP YW+
Sbjct  180  EIFYVDKQSQSWIPERLLDWLADYSSLFSGTLPTIHSKLVDFQQELVGVQVVEEDPNYWD  239

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +SSALAVGWL+TVVKLLRLHGSY+FDQL +RE
Sbjct  240  AMSSALAVGWLETVVKLLRLHGSYRFDQLSSRE  272



>ref|XP_010325082.1| PREDICTED: nuclear pore complex protein Nup85 isoform X2 [Solanum 
lycopersicum]
Length=668

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 221/273 (81%), Gaps = 2/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++  DLAMVPV  E+EN  VV   LRHGLK PIHR S SWA GNTLRV++ RKP 
Sbjct  1    MPGLTSEPDDLAMVPVSLETENQPVVNYPLRHGLKSPIHRLSFSWACGNTLRVSVFRKPQ  60

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
             + A G     G +VVE+ LSN+G EE+DA RWR++AY SVTPFALLQSRK+S++A S+M
Sbjct  61   SETADGEGEAGG-RVVEVKLSNSGDEEVDAARWRRMAYSSVTPFALLQSRKHSLSAASRM  119

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            SLD PPY AEW EHV+EYSKEI+SLL + K  P S+IED K+V+ E+  P CLK AWEL+
Sbjct  120  SLDIPPYKAEWWEHVIEYSKEISSLLSDQKPPPKSIIEDAKSVVNEIAAPVCLKAAWELL  179

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DKQSQ+WI ERLLDWLADY+SLFSGT PT+HSK+VDFQ++LV +Q +E+DP YW+
Sbjct  180  EIFYIDKQSQSWIPERLLDWLADYNSLFSGTLPTIHSKLVDFQQELVGVQVVEDDPNYWD  239

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +SSALAVGWL+TVVKLLRLHGSY+FDQL +RE
Sbjct  240  AMSSALAVGWLETVVKLLRLHGSYRFDQLSSRE  272



>ref|XP_004245163.1| PREDICTED: nuclear pore complex protein Nup85 isoform X1 [Solanum 
lycopersicum]
Length=719

 Score =   352 bits (903),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 221/273 (81%), Gaps = 2/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++  DLAMVPV  E+EN  VV   LRHGLK PIHR S SWA GNTLRV++ RKP 
Sbjct  1    MPGLTSEPDDLAMVPVSLETENQPVVNYPLRHGLKSPIHRLSFSWACGNTLRVSVFRKPQ  60

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
             + A G     G +VVE+ LSN+G EE+DA RWR++AY SVTPFALLQSRK+S++A S+M
Sbjct  61   SETADGEGEAGG-RVVEVKLSNSGDEEVDAARWRRMAYSSVTPFALLQSRKHSLSAASRM  119

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            SLD PPY AEW EHV+EYSKEI+SLL + K  P S+IED K+V+ E+  P CLK AWEL+
Sbjct  120  SLDIPPYKAEWWEHVIEYSKEISSLLSDQKPPPKSIIEDAKSVVNEIAAPVCLKAAWELL  179

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DKQSQ+WI ERLLDWLADY+SLFSGT PT+HSK+VDFQ++LV +Q +E+DP YW+
Sbjct  180  EIFYIDKQSQSWIPERLLDWLADYNSLFSGTLPTIHSKLVDFQQELVGVQVVEDDPNYWD  239

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +SSALAVGWL+TVVKLLRLHGSY+FDQL +RE
Sbjct  240  AMSSALAVGWLETVVKLLRLHGSYRFDQLSSRE  272



>ref|XP_009620956.1| PREDICTED: nuclear pore complex protein Nup85 [Nicotiana tomentosiformis]
Length=719

 Score =   349 bits (896),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 185/275 (67%), Positives = 218/275 (79%), Gaps = 6/275 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++S DLAMVPV PE EN   V   L HGLK PIHR SISWARGNTL+V++L KP 
Sbjct  1    MPGLTSESDDLAMVPVSPEPENHPAVIYPLHHGLKSPIHRLSISWARGNTLQVSVLGKPQ  60

Query  681  pddaggg--dseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALS  508
             D A         GG+VVE+ LSN+G EE+DA RWR+IAYGSV PFALLQSRK+S++A  
Sbjct  61   SDMATDVDGSEGGGGRVVEVKLSNSGDEEVDAARWRRIAYGSVIPFALLQSRKHSLSA--  118

Query  507  KMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWE  328
             MSLD+PPY A+W EHV+EYSKEINSLLG+ KS P S+IEDPK+V+ E  EP CLK AWE
Sbjct  119  -MSLDNPPYKAQWWEHVIEYSKEINSLLGDRKSPPRSIIEDPKSVVIETAEPMCLKAAWE  177

Query  327  LMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKY  148
            L+E FY DKQSQ+WI ERLLDWLADYD LFSGT PT+HSK VDFQ++L  +Q +E DP Y
Sbjct  178  LLETFYVDKQSQSWIPERLLDWLADYDPLFSGTVPTIHSKFVDFQQELAGVQVVEEDPNY  237

Query  147  WEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            WE ++SAL+VGWL TVVKLLRLHGSY+FDQL +RE
Sbjct  238  WEAIASALSVGWLGTVVKLLRLHGSYRFDQLASRE  272



>ref|XP_006359748.1| PREDICTED: nuclear pore complex protein Nup85-like isoform X2 
[Solanum tuberosum]
Length=717

 Score =   347 bits (891),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 220/273 (81%), Gaps = 4/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++S DLAMVPV PESE   VV   LRHGLK PIHR S SWA GNTLRV++ RKP 
Sbjct  1    MPGLTSESDDLAMVPVSPESEKQPVVIYPLRHGLKSPIHRLSFSWACGNTLRVSVFRKPQ  60

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
             D A G     G +VVE+ LSN+G EE+DA RWR++AY SVTPFALLQSRK+S++A S+M
Sbjct  61   SDKADGDGEAGG-RVVEVKLSNSGDEEVDAARWRRMAYSSVTPFALLQSRKHSLSAASRM  119

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            SLD PPY AEW EH++EYSKEI+SLL + K  P S+IEDPK+V+ E+  P CLK AWEL+
Sbjct  120  SLDIPPYKAEWWEHIIEYSKEISSLLSDRKPPPESIIEDPKSVVNEIAAPMCLKAAWELL  179

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DKQSQ+WI ERLLDWLADY SLFSGT PT+HSK+VDFQ++LV +  +E DP YW+
Sbjct  180  EIFYVDKQSQSWIPERLLDWLADYSSLFSGTLPTIHSKLVDFQQELVGV--VEEDPNYWD  237

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +SSALAVGWL+TVVKLLRLHGSY+FDQL +RE
Sbjct  238  AMSSALAVGWLETVVKLLRLHGSYRFDQLSSRE  270



>ref|XP_009772740.1| PREDICTED: nuclear pore complex protein Nup85 [Nicotiana sylvestris]
Length=719

 Score =   345 bits (884),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 216/275 (79%), Gaps = 6/275 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++S DLAMVPV  E EN   V   L HGLK P+HR SISWARGNTL+V++L KP 
Sbjct  1    MPGLTSESDDLAMVPVSSEPENHPAVIYPLHHGLKSPVHRLSISWARGNTLQVSVLGKPQ  60

Query  681  pddaggg--dseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALS  508
             D A         GG+VVE+ LSN+G E +DA RWR+IAYGSVTPFALLQSRK+S++A  
Sbjct  61   LDTATDVDGGESGGGRVVEVKLSNSGDEVVDAARWRRIAYGSVTPFALLQSRKHSLSA--  118

Query  507  KMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWE  328
             MSLD+PPY A+W EHV+EY KEINSLL + KS P S+IEDPK+V+ E  EP CLK AWE
Sbjct  119  -MSLDNPPYKAQWWEHVIEYGKEINSLLSDRKSPPRSIIEDPKSVVNETAEPMCLKAAWE  177

Query  327  LMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKY  148
            L+E+FY DKQSQ+WI ERLLDWLADYD LFSGT PT+HSK+VDFQ++L  +Q +E DP Y
Sbjct  178  LLEIFYVDKQSQSWIPERLLDWLADYDPLFSGTVPTIHSKLVDFQQELAGVQVVEEDPNY  237

Query  147  WEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            WE ++SAL+VGWL TV KLLRLHGSY+FDQL +RE
Sbjct  238  WEAIASALSVGWLGTVAKLLRLHGSYRFDQLASRE  272



>dbj|BAO49744.1| nuclear pore complex protein Nup75a [Nicotiana benthamiana]
Length=719

 Score =   340 bits (873),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 217/275 (79%), Gaps = 6/275 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++S DLAMVPV PE EN   V   L HGLK PIHR SISWARGNTL+V++L KP 
Sbjct  1    MPGLMSESDDLAMVPVSPEPENHPAVIYPLHHGLKSPIHRLSISWARGNTLQVSVLGKPQ  60

Query  681  pddaggg--dseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALS  508
             D A          G+VVE+ LSN+G EE+DA RWR+IAYGSVTPFALLQS K+S++A  
Sbjct  61   LDTATDVDGQEGGSGRVVEVKLSNSGDEEVDAARWRRIAYGSVTPFALLQSCKHSLSA--  118

Query  507  KMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWE  328
             MSLD+ PY A+W EHV+EY+KEINSLL + KS P S+IEDPK+V+    EP CLK AWE
Sbjct  119  -MSLDNHPYKAQWWEHVIEYTKEINSLLSDRKSPPRSIIEDPKSVVNGTAEPMCLKAAWE  177

Query  327  LMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKY  148
            L+E+FY DK+SQ+WI ERLLDWLADYD LFSGT PT+HSK+VDFQ++L  +Q +E DP Y
Sbjct  178  LLEIFYVDKESQSWIPERLLDWLADYDPLFSGTVPTIHSKLVDFQQELADVQVVEEDPNY  237

Query  147  WEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            WE ++SAL+VGWL TVVKLLRLHGSY+FDQLG+RE
Sbjct  238  WEAIASALSVGWLGTVVKLLRLHGSYRFDQLGSRE  272



>dbj|BAO49745.1| nuclear pore complex protein Nup75b [Nicotiana benthamiana]
Length=719

 Score =   339 bits (869),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 215/275 (78%), Gaps = 6/275 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP-LRHGLKPPIHRASISWARGNTLRVTLLRKPa  682
            MPG+ ++S DLAMVPV  E EN   V   L HGLK PIHR SISW+RGNTL+V++L  P 
Sbjct  1    MPGLTSESDDLAMVPVSSEPENHPAVIYPLHHGLKSPIHRLSISWSRGNTLQVSVLGNPQ  60

Query  681  --pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALS  508
                    G    GG+VVE+ LSN+G EE+DA RWR+IAYGSVTPFALLQSRK+S++A  
Sbjct  61   LDTATDVDGRKGGGGRVVEVKLSNSGYEEVDAARWRRIAYGSVTPFALLQSRKHSLSA--  118

Query  507  KMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWE  328
             MSLD+PPY A+W EHV+EYSKEINS+L + KS P S+IEDPK+VL E  EP CLK AWE
Sbjct  119  -MSLDNPPYKAQWWEHVIEYSKEINSVLSDRKSPPRSIIEDPKSVLNETAEPMCLKAAWE  177

Query  327  LMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKY  148
            L+E+FY DKQSQ+WI E LLDWLADYD LFSGT PT+HSK+VDFQ++L  +Q +E DP Y
Sbjct  178  LLEIFYVDKQSQSWIPESLLDWLADYDPLFSGTVPTIHSKLVDFQQELAVVQVVEEDPNY  237

Query  147  WEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            WE ++SAL+VGWL TV KLLRLHGSY+FDQL +RE
Sbjct  238  WEAIASALSVGWLGTVAKLLRLHGSYRFDQLASRE  272



>emb|CDP08158.1| unnamed protein product [Coffea canephora]
Length=715

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 177/274 (65%), Positives = 211/274 (77%), Gaps = 6/274 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPGM +DS D +   VP         YPL HGLKPPI R SISWARGNTLRVT+LR+P P
Sbjct  1    MPGMTSDSGDHSTSVVPISPNPQPTTYPLNHGLKPPIARLSISWARGNTLRVTVLRQPQP  60

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
              A G +   G KV+E+ LS+    EID  +WR+IAYGSVTPFALLQSRKNS + LSK+S
Sbjct  61   SAANGEEEAGG-KVLEVKLSDNRDGEIDDAQWRRIAYGSVTPFALLQSRKNSTSTLSKIS  119

Query  498  -LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
             LDS     EW +++MEYS+EINSLLGNPK++P+  IED K VLK+V++PTC K AWELM
Sbjct  120  ALDS----TEWWQYIMEYSREINSLLGNPKTSPSLAIEDQKTVLKDVQKPTCFKAAWELM  175

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FYAD+ SQAWI ERLLDWLADYD LFSGT PTVHS++V+FQK+LV  Q +E+ PKYWE
Sbjct  176  EIFYADQHSQAWIPERLLDWLADYDCLFSGTQPTVHSELVNFQKELVTRQAVEDHPKYWE  235

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
             +SS LA+GWL+  VKLLRLHGSY FDQLG+RE 
Sbjct  236  AISSTLAIGWLEIGVKLLRLHGSYDFDQLGSRET  269



>ref|XP_004291177.1| PREDICTED: nuclear pore complex protein Nup85-like [Fragaria 
vesca subsp. vesca]
Length=712

 Score =   333 bits (855),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 177/272 (65%), Positives = 213/272 (78%), Gaps = 7/272 (3%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+A++S DL++V   PE   PVV   + HGLKPPI R SISW+RGNTLRV++LR P+ 
Sbjct  1    MPGVASNSGDLSLVSYSPELPQPVVHS-IHHGLKPPIARLSISWSRGNTLRVSVLRPPSD  59

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
            +D+         +VVE+ LSN  GE  DA +WRKIAYGSVTPFA LQSR+++++ LS MS
Sbjct  60   EDSEASG-----RVVEVKLSNGDGENSDA-KWRKIAYGSVTPFAHLQSRRSTISNLSNMS  113

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            L   PY+ +W E+VMEYSK+INSLLG+  S P  VI+DPK VLK VEEPT +K AWELME
Sbjct  114  LSPSPYSIDWWEYVMEYSKDINSLLGSLDSGPDPVIDDPKMVLKRVEEPTSIKAAWELME  173

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
            +FYADKQSQ W  ERL+DWLADYDSL S THPTVHSK+V+FQ +L +LQ IE+DP YW+V
Sbjct  174  IFYADKQSQPWQLERLVDWLADYDSLLSSTHPTVHSKLVNFQNELSSLQVIEDDPNYWDV  233

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            LSSALAVGW+D VVKLLRLHGSYQ DQLG RE
Sbjct  234  LSSALAVGWIDLVVKLLRLHGSYQLDQLGNRE  265



>ref|XP_009367452.1| PREDICTED: nuclear pore complex protein Nup85 [Pyrus x bretschneideri]
Length=724

 Score =   332 bits (850),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/280 (62%), Positives = 211/280 (75%), Gaps = 11/280 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLR--------HGLKPPIHRASISWARGNTLRV  703
            MPG+A DS D+A      ++        +R        HGL PPI R SISW+RGNTLRV
Sbjct  1    MPGVAYDSGDMAGALGSNDTAMVPHSPEIRQPVVYSLHHGLNPPIARLSISWSRGNTLRV  60

Query  702  TLLRKPapddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNS  523
            ++LR P+ +D+   +     KVVE+ LSN  GE  DA +WR+IAYGSV PFALLQSR++S
Sbjct  61   SVLRPPSGEDSEKDEVGG--KVVEVRLSNGDGENGDA-KWRRIAYGSVPPFALLQSRRSS  117

Query  522  MAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCL  343
            +A+LSK+S+    YN +W E+VMEYSK+INSLLG+ KS P +VIEDPK VL++VEEPT L
Sbjct  118  VASLSKVSMGPSLYNIDWWEYVMEYSKDINSLLGSSKSLPIAVIEDPKMVLRKVEEPTAL  177

Query  342  KGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIE  163
            K AWELME+FYADKQSQ W+ ERL+DWLAD DSL S T PTVHSK+VDFQ +LV LQ IE
Sbjct  178  KAAWELMEIFYADKQSQPWLPERLVDWLADLDSLLSSTQPTVHSKLVDFQNELVELQVIE  237

Query  162  NDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            ++PKYWEVLSSALAVGW++ VVK+LRLHGSYQ  QLG RE
Sbjct  238  DNPKYWEVLSSALAVGWIEIVVKMLRLHGSYQLHQLGNRE  277



>ref|XP_006450697.1| hypothetical protein CICLE_v10007610mg [Citrus clementina]
 gb|ESR63937.1| hypothetical protein CICLE_v10007610mg [Citrus clementina]
Length=538

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 194/244 (80%), Gaps = 5/244 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R  ISW+RGN+LRVT+ ++P+ D           K VE+ L    GE  D
Sbjct  25   LRHGLKPPISRLGISWSRGNSLRVTVFQQPSEDSENEVGG----KAVEVRLDGRDGEISD  80

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSRKNS A+LSK+S  + P++AEW E+V+EYSK+I+SLLGN 
Sbjct  81   A-QWRRIAYGSVSPFALLQSRKNSFASLSKISSTTSPFDAEWWEYVLEYSKDISSLLGNQ  139

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S   S+IEDPK VLK+  EP+ LK AWELME FYADK SQAW+ ERL+DWLADYDSLFS
Sbjct  140  TSTTQSLIEDPKEVLKKDPEPSNLKAAWELMESFYADKLSQAWLPERLVDWLADYDSLFS  199

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVHSK+VDFQKDLV+LQ IE++PKYWEV+SSALAVGWLD VVKLLRLHGSYQ DQL
Sbjct  200  STQETVHSKLVDFQKDLVSLQVIEDEPKYWEVMSSALAVGWLDIVVKLLRLHGSYQLDQL  259

Query  54   GTRE  43
            G RE
Sbjct  260  GNRE  263



>ref|XP_007225207.1| hypothetical protein PRUPE_ppa002043mg [Prunus persica]
 gb|EMJ26406.1| hypothetical protein PRUPE_ppa002043mg [Prunus persica]
Length=724

 Score =   329 bits (843),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 173/281 (62%), Positives = 208/281 (74%), Gaps = 11/281 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLR--------HGLKPPIHRASISWARGNTLRV  703
            MPG+A+ S D        +S     +  LR        HGLKPPI R SISW+RGN LRV
Sbjct  1    MPGVASGSGDTRGASGSNDSSLVPYLPELRQPVVYSLHHGLKPPIGRLSISWSRGNNLRV  60

Query  702  TLLRKPapddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNS  523
            ++LR P+ +D+   +       V L  SN  GE  DA +WR+IAYGSV PFALLQSR++S
Sbjct  61   SVLRPPSAEDSDDVEVGGRVVEVRL--SNGDGETGDA-KWRRIAYGSVPPFALLQSRRSS  117

Query  522  MAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCL  343
            +A+LSKMS+   PYN +W E+VMEYSK+INSLLG+ K+ P  VI+DPK VL+ VEEPT L
Sbjct  118  VASLSKMSMSPSPYNIDWWEYVMEYSKDINSLLGDSKAPPNPVIDDPKTVLRNVEEPTSL  177

Query  342  KGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIE  163
            K AWELMEMFYADKQ Q+W+ ERL+DWLADYDSL S T PTVHSK+VDFQ +LV LQ IE
Sbjct  178  KAAWELMEMFYADKQCQSWLLERLVDWLADYDSLLSSTQPTVHSKLVDFQNELVGLQVIE  237

Query  162  NDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
            ++PKYWEVLSSALAVGW++ VVK+LRLHGSYQF QLG REV
Sbjct  238  DNPKYWEVLSSALAVGWIEIVVKMLRLHGSYQFHQLGNREV  278



>ref|XP_006450694.1| hypothetical protein CICLE_v10007610mg [Citrus clementina]
 gb|ESR63934.1| hypothetical protein CICLE_v10007610mg [Citrus clementina]
Length=619

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 194/244 (80%), Gaps = 5/244 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R  ISW+RGN+LRVT+ ++P+ D           K VE+ L    GE  D
Sbjct  25   LRHGLKPPISRLGISWSRGNSLRVTVFQQPSEDSENEVGG----KAVEVRLDGRDGEISD  80

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSRKNS A+LSK+S  + P++AEW E+V+EYSK+I+SLLGN 
Sbjct  81   A-QWRRIAYGSVSPFALLQSRKNSFASLSKISSTTSPFDAEWWEYVLEYSKDISSLLGNQ  139

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S   S+IEDPK VLK+  EP+ LK AWELME FYADK SQAW+ ERL+DWLADYDSLFS
Sbjct  140  TSTTQSLIEDPKEVLKKDPEPSNLKAAWELMESFYADKLSQAWLPERLVDWLADYDSLFS  199

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVHSK+VDFQKDLV+LQ IE++PKYWEV+SSALAVGWLD VVKLLRLHGSYQ DQL
Sbjct  200  STQETVHSKLVDFQKDLVSLQVIEDEPKYWEVMSSALAVGWLDIVVKLLRLHGSYQLDQL  259

Query  54   GTRE  43
            G RE
Sbjct  260  GNRE  263



>gb|KDO79830.1| hypothetical protein CISIN_1g005153mg [Citrus sinensis]
Length=703

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 194/245 (79%), Gaps = 5/245 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R  ISW+RGN+LRVT+ R+P+ D           K VE+ L    GE  D
Sbjct  25   LRHGLKPPISRLGISWSRGNSLRVTVFRQPSEDSENEVGG----KAVEVRLDGRDGEISD  80

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSRKNS A+LSK+S  + P++AEW E+V+EYSK+I+SLLGN 
Sbjct  81   A-QWRRIAYGSVSPFALLQSRKNSFASLSKISSTTSPFDAEWWEYVLEYSKDISSLLGNQ  139

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S   S+IEDPK VLK+  EP+ LK AWELME FYADK SQAW+ ERL+DWLADYDSLFS
Sbjct  140  TSTTQSLIEDPKEVLKKDPEPSNLKAAWELMESFYADKLSQAWLPERLVDWLADYDSLFS  199

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVHSK+VDFQKDLV+LQ IE++PKYWEV+SSALAVGWLD VVKLLRLHGSYQ DQL
Sbjct  200  STQETVHSKLVDFQKDLVSLQVIEDEPKYWEVMSSALAVGWLDIVVKLLRLHGSYQLDQL  259

Query  54   GTREV  40
            G RE 
Sbjct  260  GNRET  264



>ref|XP_002283798.1| PREDICTED: nuclear pore complex protein NUP85 [Vitis vinifera]
 ref|XP_010648493.1| PREDICTED: nuclear pore complex protein NUP85 [Vitis vinifera]
 emb|CBI20847.3| unnamed protein product [Vitis vinifera]
Length=715

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 213/272 (78%), Gaps = 4/272 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+  DS +  +   P    + V    L HGLKPPI R SISW+RGN LRV++ R+  P
Sbjct  1    MPGLTADSGNALVPLSPEAHVSVVYP--LHHGLKPPISRLSISWSRGNALRVSVFRE-LP  57

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
             ++   D EAGGKVV++ L    GE +D  +WR+IAYGSV+PFALLQSR+NS+ ALSKMS
Sbjct  58   AESSDSDGEAGGKVVQVKLGVADGE-VDDAQWRRIAYGSVSPFALLQSRRNSVLALSKMS  116

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            + S PY+ +W E+VMEYSK+I+SLL N KS P S+I+DPK VLK+VEEPTCLK AW L+E
Sbjct  117  MSSSPYHPDWWEYVMEYSKDISSLLDNAKSLPNSMIDDPKTVLKKVEEPTCLKAAWGLLE  176

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
            +FYADK+SQAW+ ER++DWLADYD LFSGT  TVHSK+V+FQK++V LQ IE+DP+YWEV
Sbjct  177  IFYADKESQAWLPERIVDWLADYDVLFSGTQATVHSKLVEFQKEIVRLQVIEDDPRYWEV  236

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            ++SALAVGWL+ VVKLLRLHGSYQ DQL  RE
Sbjct  237  ITSALAVGWLEIVVKLLRLHGSYQLDQLSNRE  268



>ref|XP_006476034.1| PREDICTED: nuclear pore complex protein Nup85-like [Citrus sinensis]
 gb|KDO79831.1| hypothetical protein CISIN_1g005153mg [Citrus sinensis]
Length=711

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 194/245 (79%), Gaps = 5/245 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R  ISW+RGN+LRVT+ R+P+ D           K VE+ L    GE  D
Sbjct  25   LRHGLKPPISRLGISWSRGNSLRVTVFRQPSEDSENEVGG----KAVEVRLDGRDGEISD  80

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSRKNS A+LSK+S  + P++AEW E+V+EYSK+I+SLLGN 
Sbjct  81   A-QWRRIAYGSVSPFALLQSRKNSFASLSKISSTTSPFDAEWWEYVLEYSKDISSLLGNQ  139

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S   S+IEDPK VLK+  EP+ LK AWELME FYADK SQAW+ ERL+DWLADYDSLFS
Sbjct  140  TSTTQSLIEDPKEVLKKDPEPSNLKAAWELMESFYADKLSQAWLPERLVDWLADYDSLFS  199

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVHSK+VDFQKDLV+LQ IE++PKYWEV+SSALAVGWLD VVKLLRLHGSYQ DQL
Sbjct  200  STQETVHSKLVDFQKDLVSLQVIEDEPKYWEVMSSALAVGWLDIVVKLLRLHGSYQLDQL  259

Query  54   GTREV  40
            G RE 
Sbjct  260  GNRET  264



>ref|XP_008220081.1| PREDICTED: nuclear pore complex protein Nup85 [Prunus mume]
Length=724

 Score =   326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 3/245 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L HGLKPPI R SISW+RGN LRV++LR P+ +D+   +       V L  SN  GE  D
Sbjct  37   LHHGLKPPIGRLSISWSRGNNLRVSVLRPPSAEDSDDVEVGGRVVEVRL--SNGDGETGD  94

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGS  PFALLQSR++S+A+LSKMS+   PYN +W E+VMEYSK+INSLLG+ 
Sbjct  95   A-KWRRIAYGSGPPFALLQSRRSSVASLSKMSMSPSPYNIDWWEYVMEYSKDINSLLGDS  153

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            K+ P  VI+DPK VL+ VEEPT LK AWELMEMFYADKQ Q+W+ ERL+DWLADYDSL S
Sbjct  154  KAPPNPVIDDPKTVLRNVEEPTSLKAAWELMEMFYADKQCQSWLPERLVDWLADYDSLLS  213

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T PTVHSK+VDFQ +LV LQ IE++PKYWEVLSSALAVGW++ VVK+LRLHGSYQF QL
Sbjct  214  STQPTVHSKLVDFQNELVGLQVIEDNPKYWEVLSSALAVGWIEIVVKMLRLHGSYQFHQL  273

Query  54   GTREV  40
            G RE+
Sbjct  274  GNREI  278



>ref|XP_006450696.1| hypothetical protein CICLE_v10007610mg [Citrus clementina]
 gb|ESR63936.1| hypothetical protein CICLE_v10007610mg [Citrus clementina]
Length=711

 Score =   325 bits (833),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 194/245 (79%), Gaps = 5/245 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R  ISW+RGN+LRVT+ ++P+ D           K VE+ L    GE  D
Sbjct  25   LRHGLKPPISRLGISWSRGNSLRVTVFQQPSEDSENEVGG----KAVEVRLDGRDGEISD  80

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSRKNS A+LSK+S  + P++AEW E+V+EYSK+I+SLLGN 
Sbjct  81   A-QWRRIAYGSVSPFALLQSRKNSFASLSKISSTTSPFDAEWWEYVLEYSKDISSLLGNQ  139

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S   S+IEDPK VLK+  EP+ LK AWELME FYADK SQAW+ ERL+DWLADYDSLFS
Sbjct  140  TSTTQSLIEDPKEVLKKDPEPSNLKAAWELMESFYADKLSQAWLPERLVDWLADYDSLFS  199

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVHSK+VDFQKDLV+LQ IE++PKYWEV+SSALAVGWLD VVKLLRLHGSYQ DQL
Sbjct  200  STQETVHSKLVDFQKDLVSLQVIEDEPKYWEVMSSALAVGWLDIVVKLLRLHGSYQLDQL  259

Query  54   GTREV  40
            G RE 
Sbjct  260  GNRET  264



>ref|XP_008393863.1| PREDICTED: nuclear pore complex protein Nup85 [Malus domestica]
Length=724

 Score =   325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/280 (61%), Positives = 206/280 (74%), Gaps = 11/280 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLR--------HGLKPPIHRASISWARGNTLRV  703
            MPG+A DS D        ++        +R        HGL PPI R SISW+RGNTLRV
Sbjct  1    MPGVAYDSGDTPGALGSNDTAMVPYSPEIRQPVVYSJHHGLNPPIARLSISWSRGNTLRV  60

Query  702  TLLRKPapddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNS  523
            ++LR P+ +D+   +     KVVE+ LSN  GE  DA  WR+IAYGSV PFALLQSR++S
Sbjct  61   SVLRPPSGEDSEKDEVGG--KVVEVRLSNGDGENGDA-NWRRIAYGSVPPFALLQSRRSS  117

Query  522  MAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCL  343
            +A+LSK+S+    YN +W E+VMEYSK+INSLLG+ KS P  VIEDPK VL++VEEPT L
Sbjct  118  VASLSKVSMGPSLYNIDWWEYVMEYSKDINSLLGSSKSLPNPVIEDPKMVLRKVEEPTAL  177

Query  342  KGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIE  163
            K AWELME+FYADKQSQ W+ ERL+DWLAD+DSL S T PTVHSK+VDFQ + V LQ IE
Sbjct  178  KAAWELMEIFYADKQSQPWLPERLVDWLADHDSLLSSTQPTVHSKLVDFQNEJVRLQVIE  237

Query  162  NDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            +DPKYW VLSSAL+VGW++ VVK+LRLHGSYQ  QLG RE
Sbjct  238  DDPKYWXVLSSALSVGWIEIVVKMLRLHGSYQLHQLGXRE  277



>ref|XP_008361030.1| PREDICTED: nuclear pore complex protein Nup85-like [Malus domestica]
Length=724

 Score =   325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/280 (61%), Positives = 206/280 (74%), Gaps = 11/280 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLR--------HGLKPPIHRASISWARGNTLRV  703
            MPG+A DS D        ++        +R        HGL PPI R SISW+RGNTLRV
Sbjct  1    MPGVAYDSGDTPGALGSNDTAMVPYSPEIRQPVVYSLHHGLNPPIARLSISWSRGNTLRV  60

Query  702  TLLRKPapddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNS  523
            ++LR P+ +D+   +     KVVE+ LSN  GE  DA  WR+IAYGSV PFALLQSR++S
Sbjct  61   SVLRPPSGEDSEKDEVGG--KVVEVRLSNGDGENGDA-NWRRIAYGSVPPFALLQSRRSS  117

Query  522  MAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCL  343
            +A+LSK+S+    YN +W E+VMEYSK+INSLLG+ KS P  VIEDPK VL++VEEPT L
Sbjct  118  VASLSKVSMGPSLYNIDWWEYVMEYSKDINSLLGSSKSLPNPVIEDPKMVLRKVEEPTAL  177

Query  342  KGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIE  163
            K AWELME+FYADKQSQ W+ ERL+DWLAD+DSL S T PTVHSK+VDFQ + V LQ IE
Sbjct  178  KAAWELMEIFYADKQSQPWLPERLVDWLADHDSLLSSTQPTVHSKLVDFQNEJVRLQVIE  237

Query  162  NDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            +DPKYW VLSSAL+VGW++ VVK+LRLHGSYQ  QLG RE
Sbjct  238  DDPKYWXVLSSALSVGWIEIVVKMLRLHGSYQLHQLGXRE  277



>gb|KDO79829.1| hypothetical protein CISIN_1g005153mg [Citrus sinensis]
Length=710

 Score =   324 bits (830),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 194/245 (79%), Gaps = 6/245 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R  ISW+RGN+LRVT+ R+P+ D           K VE+ L    GE  D
Sbjct  25   LRHGLKPPISRLGISWSRGNSLRVTVFRQPSEDSENEVGG----KAVEVRLDGRDGEISD  80

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSRKNS A+LSK+S  + P++AEW E+V+EYSK+I+SLLGN 
Sbjct  81   A-QWRRIAYGSVSPFALLQSRKNSFASLSKISSTTSPFDAEWWEYVLEYSKDISSLLGNQ  139

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S   S+IEDPK VLK+  EP+ LK AWELME FYADK SQAW+ ERL+DWLADYDSLFS
Sbjct  140  TSTTQSLIEDPKEVLKD-PEPSNLKAAWELMESFYADKLSQAWLPERLVDWLADYDSLFS  198

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVHSK+VDFQKDLV+LQ IE++PKYWEV+SSALAVGWLD VVKLLRLHGSYQ DQL
Sbjct  199  STQETVHSKLVDFQKDLVSLQVIEDEPKYWEVMSSALAVGWLDIVVKLLRLHGSYQLDQL  258

Query  54   GTREV  40
            G RE 
Sbjct  259  GNRET  263



>ref|XP_006450695.1| hypothetical protein CICLE_v10007610mg [Citrus clementina]
 gb|ESR63935.1| hypothetical protein CICLE_v10007610mg [Citrus clementina]
Length=710

 Score =   322 bits (825),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 194/245 (79%), Gaps = 6/245 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R  ISW+RGN+LRVT+ ++P+ D           K VE+ L    GE  D
Sbjct  25   LRHGLKPPISRLGISWSRGNSLRVTVFQQPSEDSENEVGG----KAVEVRLDGRDGEISD  80

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSRKNS A+LSK+S  + P++AEW E+V+EYSK+I+SLLGN 
Sbjct  81   A-QWRRIAYGSVSPFALLQSRKNSFASLSKISSTTSPFDAEWWEYVLEYSKDISSLLGNQ  139

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S   S+IEDPK VLK+  EP+ LK AWELME FYADK SQAW+ ERL+DWLADYDSLFS
Sbjct  140  TSTTQSLIEDPKEVLKD-PEPSNLKAAWELMESFYADKLSQAWLPERLVDWLADYDSLFS  198

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVHSK+VDFQKDLV+LQ IE++PKYWEV+SSALAVGWLD VVKLLRLHGSYQ DQL
Sbjct  199  STQETVHSKLVDFQKDLVSLQVIEDEPKYWEVMSSALAVGWLDIVVKLLRLHGSYQLDQL  258

Query  54   GTREV  40
            G RE 
Sbjct  259  GNRET  263



>gb|KHG04510.1| Nuclear pore complex Nup85 -like protein [Gossypium arboreum]
Length=715

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/272 (62%), Positives = 213/272 (78%), Gaps = 4/272 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+++DS+  A+VP+ PES   VV   LRHGLK PI R SISW+RGN+LRV++   P+ 
Sbjct  1    MPGVSSDSARGALVPLSPESPGAVVYP-LRHGLKSPISRLSISWSRGNSLRVSVFAAPSS  59

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
            D +         KVVE+ L    GE I    WR+IAYGSV+PFALLQSRKN++++LSKMS
Sbjct  60   DGSVNDGDGG--KVVEVKLGGGDGE-ISEAHWRRIAYGSVSPFALLQSRKNAVSSLSKMS  116

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            ++S PY+ +W +++MEYSK+IN+LL N KSA   V++D K+V+ + EEPT LK AWEL+E
Sbjct  117  MNSSPYDGDWWDYIMEYSKDINALLVNQKSASVPVLDDTKSVITKGEEPTSLKAAWELLE  176

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
            MFYA+K S +W+ ERL+DWLADYDSLFSGTHPTVHSK+VDFQK+ V LQ +E+DPKYWEV
Sbjct  177  MFYAEKPSHSWLPERLVDWLADYDSLFSGTHPTVHSKLVDFQKEFVNLQVVEDDPKYWEV  236

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            +SSALAVGWL+ VVK+LRLHGSYQ DQL  RE
Sbjct  237  MSSALAVGWLNIVVKMLRLHGSYQLDQLSNRE  268



>ref|XP_011010428.1| PREDICTED: nuclear pore complex protein NUP85-like [Populus euphratica]
Length=721

 Score =   318 bits (815),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 186/244 (76%), Gaps = 2/244 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L HGLKPPI R SISWARGN LRV+LLR P  +    G+     KVVE+NL +   +  +
Sbjct  32   LHHGLKPPISRVSISWARGNNLRVSLLRNPPSNSDSDGEIGG--KVVEVNLDSGAADVRE  89

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
              +WR+IAYGSVTPFALLQSRKNS + LSK+     P++ +W E+VMEYSK+I  LLGNP
Sbjct  90   PAQWRRIAYGSVTPFALLQSRKNSASILSKLQSSPSPFHLDWWEYVMEYSKDIKELLGNP  149

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            KS    +IEDPK VLK+ EEPT LK AWELMEMFYADK  Q+W+ ERL+DWLADYD L S
Sbjct  150  KSNYNPLIEDPKEVLKKGEEPTSLKAAWELMEMFYADKLCQSWLPERLVDWLADYDCLLS  209

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
            G  P VHSK+V+FQ  LV LQ IE+DPKYWEV+SSALAVGWL+ VVKLLRLHGSYQ DQ+
Sbjct  210  GDQPAVHSKLVEFQGTLVTLQVIEDDPKYWEVISSALAVGWLEIVVKLLRLHGSYQLDQI  269

Query  54   GTRE  43
            G RE
Sbjct  270  GPRE  273



>ref|XP_010275717.1| PREDICTED: nuclear pore complex protein Nup85 isoform X3 [Nelumbo 
nucifera]
Length=585

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 193/248 (78%), Gaps = 5/248 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseag----GKVVELNLSNTGG  607
            L H LK PI R SISW++GN LRV+   K + + +  G   +     GKVVE+ LS+  G
Sbjct  27   LHHDLKAPISRLSISWSKGNCLRVSFFGKKSSNSSAEGSGNSNDQIGGKVVEVKLSSEDG  86

Query  606  EEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSL  427
            E ID  + R+IAYGSV+PFALLQSRKNSM+ LSKMS+ S  Y+ EW EHVMEYSK+IN L
Sbjct  87   E-IDEAQKRRIAYGSVSPFALLQSRKNSMSLLSKMSMGSSTYHVEWWEHVMEYSKDINLL  145

Query  426  LGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYD  247
            LG+PK  P+ VIEDPK VLK +E+PTCLK AWELME+FYADKQSQAW+ E L+DWLADYD
Sbjct  146  LGSPKPLPSPVIEDPKTVLKAMEKPTCLKAAWELMEIFYADKQSQAWLPESLVDWLADYD  205

Query  246  SLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQ  67
            +L S T  TV+SK+VD QK+LV LQ +E++PKYWE +SSALAVGWL+ VVKLLRLHGSYQ
Sbjct  206  NLLSETGTTVYSKLVDLQKELVTLQAVEDNPKYWEGISSALAVGWLEIVVKLLRLHGSYQ  265

Query  66   FDQLGTRE  43
             DQLG RE
Sbjct  266  LDQLGNRE  273



>gb|EYU29282.1| hypothetical protein MIMGU_mgv1a002126mg [Erythranthe guttata]
Length=710

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/276 (60%), Positives = 199/276 (72%), Gaps = 15/276 (5%)
 Frame = -1

Query  858  MPGMATDSSD---LAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRK  688
            MPGM +D+ +   L++VP   +++   V     H   PP  R SISWARGNTLRVTLL+ 
Sbjct  1    MPGMTSDAGEFGSLSVVPHSLDAQAARVYPLRTHRATPPFARLSISWARGNTLRVTLLQS  60

Query  687  PapddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALS  508
                           +VVE+ L+   G EI   RWR+IAYGSV PFALLQSRK+S     
Sbjct  61   DDAVSEQSVGG----EVVEVKLAEADGGEISDARWRRIAYGSVAPFALLQSRKSS-----  111

Query  507  KMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWE  328
               +DS  Y  +W EHVM+YSKEI+SLLGN KS+ T +IEDPK VL+ VEEPT +K AWE
Sbjct  112  ---IDSFHYEKDWWEHVMDYSKEISSLLGNSKSSATPMIEDPKTVLRAVEEPTSVKAAWE  168

Query  327  LMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKY  148
            L+EMFYADKQSQ WI ERLLDWLAD+D LFSGT PTVHSK+V FQK+LV +Q +EN P+Y
Sbjct  169  LLEMFYADKQSQTWIPERLLDWLADFDCLFSGTQPTVHSKLVAFQKELVTIQAVENHPEY  228

Query  147  WEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
            WEV+SSALA+GWLD VVKLLRLHGSY +DQLG+RE+
Sbjct  229  WEVISSALAIGWLDVVVKLLRLHGSYMYDQLGSREI  264



>gb|KDP34155.1| hypothetical protein JCGZ_07726 [Jatropha curcas]
Length=724

 Score =   316 bits (810),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 187/244 (77%), Gaps = 3/244 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPP+ R SISWARGNTL+V++ R+P+ D           KVVE++L   G  E++
Sbjct  36   LRHGLKPPVSRVSISWARGNTLKVSVFRQPSSDADSDELGG---KVVEVSLGGNGDGELN  92

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
              +WR+I+YGSV PFALL SR+NS+++LS M L   PY+ EW E+VMEYSK+I SLL NP
Sbjct  93   DAQWRRISYGSVAPFALLHSRRNSVSSLSNMQLSPSPYHLEWWEYVMEYSKDIGSLLVNP  152

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            KS  + VIEDPK VLK+ EEPTCLK AW+LMEMFYADK SQAW+ ERL+DWLADYDSL S
Sbjct  153  KSLVSPVIEDPKEVLKKGEEPTCLKAAWDLMEMFYADKLSQAWLPERLVDWLADYDSLLS  212

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVH K++ FQ+ LV LQ +E+D KYWEV+SS LAVGWLD  VK+LRLHGSY+ DQL
Sbjct  213  STQATVHLKLLQFQERLVTLQVVEDDSKYWEVISSVLAVGWLDIAVKMLRLHGSYRLDQL  272

Query  54   GTRE  43
              RE
Sbjct  273  SNRE  276



>ref|XP_010275714.1| PREDICTED: nuclear pore complex protein Nup85 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010275715.1| PREDICTED: nuclear pore complex protein Nup85 isoform X1 [Nelumbo 
nucifera]
Length=720

 Score =   313 bits (803),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 193/248 (78%), Gaps = 5/248 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseag----GKVVELNLSNTGG  607
            L H LK PI R SISW++GN LRV+   K + + +  G   +     GKVVE+ LS+  G
Sbjct  27   LHHDLKAPISRLSISWSKGNCLRVSFFGKKSSNSSAEGSGNSNDQIGGKVVEVKLSSEDG  86

Query  606  EEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSL  427
            E ID  + R+IAYGSV+PFALLQSRKNSM+ LSKMS+ S  Y+ EW EHVMEYSK+IN L
Sbjct  87   E-IDEAQKRRIAYGSVSPFALLQSRKNSMSLLSKMSMGSSTYHVEWWEHVMEYSKDINLL  145

Query  426  LGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYD  247
            LG+PK  P+ VIEDPK VLK +E+PTCLK AWELME+FYADKQSQAW+ E L+DWLADYD
Sbjct  146  LGSPKPLPSPVIEDPKTVLKAMEKPTCLKAAWELMEIFYADKQSQAWLPESLVDWLADYD  205

Query  246  SLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQ  67
            +L S T  TV+SK+VD QK+LV LQ +E++PKYWE +SSALAVGWL+ VVKLLRLHGSYQ
Sbjct  206  NLLSETGTTVYSKLVDLQKELVTLQAVEDNPKYWEGISSALAVGWLEIVVKLLRLHGSYQ  265

Query  66   FDQLGTRE  43
             DQLG RE
Sbjct  266  LDQLGNRE  273



>ref|XP_010275716.1| PREDICTED: nuclear pore complex protein Nup85 isoform X2 [Nelumbo 
nucifera]
Length=701

 Score =   313 bits (801),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 204/276 (74%), Gaps = 7/276 (3%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG  +D SD  +   P   +  V    L H LK PI R SISW++GN LRV+   K + 
Sbjct  1    MPGRMSDPSDSLVPFSPDVRDPVVYS--LHHDLKAPISRLSISWSKGNCLRVSFFGKKSS  58

Query  678  ddagggdseag----GKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAAL  511
            + +  G   +     GKVVE+ LS+  GE ID  + R+IAYGSV+PFALLQSRKNSM+ L
Sbjct  59   NSSAEGSGNSNDQIGGKVVEVKLSSEDGE-IDEAQKRRIAYGSVSPFALLQSRKNSMSLL  117

Query  510  SKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAW  331
            SKMS+ S  Y+ EW EHVMEYSK+IN LLG+PK  P+ VIEDPK VLK +E+PTCLK AW
Sbjct  118  SKMSMGSSTYHVEWWEHVMEYSKDINLLLGSPKPLPSPVIEDPKTVLKAMEKPTCLKAAW  177

Query  330  ELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPK  151
            ELME+FYADKQSQAW+ E L+DWLADYD+L S T  TV+SK+VD QK+LV LQ +E++PK
Sbjct  178  ELMEIFYADKQSQAWLPESLVDWLADYDNLLSETGTTVYSKLVDLQKELVTLQAVEDNPK  237

Query  150  YWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            YWE +SSALAVGWL+ VVKLLRLHGSYQ DQLG RE
Sbjct  238  YWEGISSALAVGWLEIVVKLLRLHGSYQLDQLGNRE  273



>ref|XP_011091302.1| PREDICTED: nuclear pore complex protein NUP85 [Sesamum indicum]
Length=710

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/276 (62%), Positives = 201/276 (73%), Gaps = 15/276 (5%)
 Frame = -1

Query  858  MPGMATDSSDL---AMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRK  688
            MPG+ +DS +L   ++VP   +++ P V     H +  P+ R SISWARGNTLRV+LL+ 
Sbjct  1    MPGVTSDSGELNSLSVVPHTLDTQKPRVYPLRLHRVTRPLARLSISWARGNTLRVSLLQ-  59

Query  687  PapddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALS  508
                D    +   GG+VVE+ L +    EI   +WR+IAYGSV PFALLQSRKNSM AL 
Sbjct  60   ---TDDAASEQTPGGEVVEVKLGSADAGEIPEAQWRRIAYGSVAPFALLQSRKNSMDALH  116

Query  507  KMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWE  328
                    Y  +W EHVMEYSKEINSLLGN KS+    IEDPK VLK+VEEPT LK AWE
Sbjct  117  --------YEKDWWEHVMEYSKEINSLLGNTKSSVPPTIEDPKTVLKKVEEPTSLKAAWE  168

Query  327  LMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKY  148
            LMEMFYADKQSQ WI ERLLDWLAD+D LFSGT PTVH+K+V FQ  LV +Q +EN P+Y
Sbjct  169  LMEMFYADKQSQTWIPERLLDWLADFDCLFSGTQPTVHAKLVSFQNKLVTIQAVENHPEY  228

Query  147  WEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
            WE++SSALAVGWLD VVKLLRLHGSY FDQLG+RE+
Sbjct  229  WEIMSSALAVGWLDVVVKLLRLHGSYLFDQLGSREI  264



>ref|XP_002324219.1| hypothetical protein POPTR_0018s08040g [Populus trichocarpa]
 gb|EEF02784.1| hypothetical protein POPTR_0018s08040g [Populus trichocarpa]
Length=720

 Score =   311 bits (797),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 185/244 (76%), Gaps = 3/244 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L HGLKPPI R SISWARGN LRV+LLR P  +    G+     KVVE+NL +   +  +
Sbjct  32   LHHGLKPPISRVSISWARGNNLRVSLLRNPPSNSDSDGEIGG--KVVEVNLDSGAADVRE  89

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
              +WR+IAYGSVTPFALLQSRKNS + LSK+     P++ +W ++VMEYSK+I  LLGNP
Sbjct  90   PAQWRRIAYGSVTPFALLQSRKNSASILSKLQSSPSPFHLDW-QYVMEYSKDIKELLGNP  148

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            KS    +IEDPK VLK+ EEPT LK AWELMEMFYADK  Q+W+ ERL+DWLADYD L S
Sbjct  149  KSNYNPLIEDPKEVLKKGEEPTSLKAAWELMEMFYADKLCQSWLPERLVDWLADYDCLLS  208

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
            G  P VHSK+V+FQ  LV LQ IE+DPKYWEV+SSALAVGWL+ VVKLLRLHGSYQ DQ+
Sbjct  209  GDQPAVHSKLVEFQGTLVTLQVIEDDPKYWEVISSALAVGWLEIVVKLLRLHGSYQLDQI  268

Query  54   GTRE  43
              RE
Sbjct  269  SRRE  272



>dbj|BAF45348.1| nucleoporin [Lotus japonicus]
Length=711

 Score =   308 bits (790),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 192/247 (78%), Gaps = 12/247 (5%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGE--E  601
            L HGL  PI R +ISW+RGN+LRV+L  +P+        S A  KVVE+ LS   GE  E
Sbjct  27   LNHGLSLPISRVAISWSRGNSLRVSLFAEPSATSPDSQASGA--KVVEVKLS---GEDPE  81

Query  600  IDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSP-PYNAEWSEHVMEYSKEINSLL  424
            I    WR+IAYGSVTPFALLQSR++S+AALSK    SP PY+ +W EHV+EYSK+I SLL
Sbjct  82   ISDSNWRRIAYGSVTPFALLQSRRSSLAALSK----SPSPYHVDWWEHVLEYSKDIASLL  137

Query  423  GNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDS  244
            G PK +P  +IEDP A+  + EEPTCLK AWEL+EMFY DK+SQAW+ ERL+DWLAD+DS
Sbjct  138  GGPKLSPGPIIEDPNAIATKCEEPTCLKAAWELLEMFYVDKRSQAWLPERLVDWLADFDS  197

Query  243  LFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQF  64
            LF+ TH T+H K+V+FQK+LV +Q IE+DP+YWEV+SSAL+VGWLD VVK+LRLHGSYQ 
Sbjct  198  LFTSTHETIHGKLVNFQKELVNIQVIEDDPRYWEVMSSALSVGWLDIVVKMLRLHGSYQL  257

Query  63   DQLGTRE  43
            DQL +RE
Sbjct  258  DQLSSRE  264



>ref|XP_007012136.1| Nucleoporin Nup85-like isoform 1 [Theobroma cacao]
 ref|XP_007012137.1| Nucleoporin Nup85-like isoform 1 [Theobroma cacao]
 gb|EOY29755.1| Nucleoporin Nup85-like isoform 1 [Theobroma cacao]
 gb|EOY29756.1| Nucleoporin Nup85-like isoform 1 [Theobroma cacao]
Length=714

 Score =   306 bits (783),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 170/272 (63%), Positives = 211/272 (78%), Gaps = 4/272 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+ +DS   A+V +  ES+   V   L HGLK PI R SISW+RG++LRV++   P+ 
Sbjct  1    MPGVTSDSGGGALVSLSLESQGAAVYP-LHHGLKSPISRLSISWSRGDSLRVSVFAAPSS  59

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
            DD+   D+    +VVE+ L    GE  DA  WRKIAYGSV+PFALLQSRKN  ++LSKMS
Sbjct  60   DDSDKEDAGG--RVVEVKLGGGDGEITDA-NWRKIAYGSVSPFALLQSRKNVASSLSKMS  116

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            + S  Y+ +W E++MEYSK+I++LLGN KSA   VI+DPK+V+ + EEPT LK AWEL+E
Sbjct  117  MKSSRYDVDWWEYIMEYSKDISALLGNRKSASGPVIDDPKSVITKGEEPTSLKAAWELLE  176

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
            MFYA+K SQ+W+ ERL+DWLADYDSLFSGTH TVHSK+VDFQK+LV LQ +E+DPKYWEV
Sbjct  177  MFYAEKPSQSWLPERLVDWLADYDSLFSGTHSTVHSKLVDFQKELVNLQVVEDDPKYWEV  236

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            +SSALAVGWLD VVK+LRLHGSYQ DQL  RE
Sbjct  237  MSSALAVGWLDIVVKMLRLHGSYQLDQLSNRE  268



>ref|XP_010436282.1| PREDICTED: nuclear pore complex protein Nup85-like [Camelina 
sativa]
Length=310

 Score =   293 bits (749),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 159/274 (58%), Positives = 201/274 (73%), Gaps = 6/274 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPGM ++S    +VP   + + PV+   L +GLK P+HR SISW  GN LRVT+L  P  
Sbjct  1    MPGMTSESGGGELVPFTTKEKAPVLYP-LSYGLKSPVHRLSISWGCGNNLRVTVLTNPEL  59

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
             D  G       KVV ++L+   GE  DA R R+IAYGSV+PFALLQSR+NS+++LSKM 
Sbjct  60   RDDDGEAGG---KVVNVSLNGEDGEISDAQR-RRIAYGSVSPFALLQSRRNSISSLSKMD  115

Query  498  LDSPPYN-AEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            +    Y+   W E+VMEYSK+I SLL N  S+P+ +IEDPK+V+K+ EEPT LK AWELM
Sbjct  116  MSPSLYHQTAWWEYVMEYSKDIKSLLSNTISSPSPLIEDPKSVIKDAEEPTSLKAAWELM  175

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FYADK   +W+ ERL+DWL+DYD L S +HPTV+SK+ DFQK+LV LQ IE+DP+YWE
Sbjct  176  ELFYADKTCLSWLPERLVDWLSDYDILLSSSHPTVYSKLQDFQKELVGLQVIEDDPRYWE  235

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
            V+SSAL+VGWL+ VVKLL LHGSYQ DQLG RE 
Sbjct  236  VMSSALSVGWLEIVVKLLHLHGSYQLDQLGNRET  269



>ref|XP_010102397.1| hypothetical protein L484_010709 [Morus notabilis]
 gb|EXB93382.1| hypothetical protein L484_010709 [Morus notabilis]
Length=692

 Score =   300 bits (767),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 197/244 (81%), Gaps = 7/244 (3%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R SISW+RGNTLRV++LR+P+ D   GG      +VVE+NLSN G  EI 
Sbjct  39   LRHGLKPPIARLSISWSRGNTLRVSVLRQPSDDGEAGG------RVVEVNLSN-GDAEIS  91

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
              +WR+IAYGSVTPFALLQSR++S+++LSKMS+    Y+ +W E+VMEYSK+I SLLG+ 
Sbjct  92   DAQWRRIAYGSVTPFALLQSRRSSVSSLSKMSISPSHYHVDWWEYVMEYSKDIVSLLGHR  151

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            KS   +VIEDP+ ++K VEEPT LK AW+LME+FYADKQSQ W+ ERL+DWL DYD L S
Sbjct  152  KSPSGTVIEDPREIVKTVEEPTSLKAAWDLMEIFYADKQSQPWLPERLVDWLTDYDCLLS  211

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  TVHSK+V FQK+LV+LQ IE+ PKYWEV+SSALA+GWL+ VVK+LRLHGSY+ DQL
Sbjct  212  STQTTVHSKLVGFQKELVSLQVIEDYPKYWEVISSALAIGWLELVVKMLRLHGSYELDQL  271

Query  54   GTRE  43
            G RE
Sbjct  272  GNRE  275



>ref|XP_006283222.1| hypothetical protein CARUB_v10004252mg [Capsella rubella]
 gb|EOA16120.1| hypothetical protein CARUB_v10004252mg [Capsella rubella]
Length=715

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 186/245 (76%), Gaps = 4/245 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L +GLK P+HR SISW  GN LRVT+LR P   D  G       KVV ++LS    E  D
Sbjct  28   LSYGLKSPVHRLSISWGCGNNLRVTVLRNPDLRDDDGEAGG---KVVNVSLSGEDSEISD  84

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A R R+IAYGSV+PFALLQSR+NS+++LSKM + S  Y   W E+VMEYSK+I SLL N 
Sbjct  85   AQR-RRIAYGSVSPFALLQSRRNSISSLSKMDMSSSLYQNAWWEYVMEYSKDIKSLLSNT  143

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S+P+ +IEDPK+V+K  EEPT LK AWELME+FYADK   +W+ ERL+DWL+DYD L S
Sbjct  144  ISSPSPLIEDPKSVIKNAEEPTSLKAAWELMELFYADKTCLSWLPERLVDWLSDYDILLS  203

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             +HPT++SK+ DFQK+LV LQ IE+DP+YWEV+S+AL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  204  SSHPTIYSKLQDFQKELVGLQAIEDDPRYWEVMSAALSVGWLEIVVKLLHLHGSYQLDQL  263

Query  54   GTREV  40
            G+RE 
Sbjct  264  GSRET  268



>ref|NP_567908.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8RXH2.1|NUP85_ARATH RecName: Full=Nuclear pore complex protein NUP85; AltName: Full=Nuclear 
pore complex protein NUP75; AltName: Full=Nucleoporin 
75; AltName: Full=Nucleoporin 85 [Arabidopsis thaliana]
 gb|AAL91145.1| putative protein [Arabidopsis thaliana]
 gb|AEE86142.1| uncharacterized protein AT4G32910 [Arabidopsis thaliana]
Length=716

 Score =   297 bits (761),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 199/272 (73%), Gaps = 4/272 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPGM+++S    +V    + + PV+   L +GLK P+HR SISW  GN LRVT+LR P  
Sbjct  1    MPGMSSESGGGELVLFSTKEKTPVLYP-LSYGLKSPVHRLSISWGCGNNLRVTVLRNPEL  59

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
             D   G+     KVV + LS   GE I   +WR+IAYGSV+PFALLQSR+NS+++LSKM 
Sbjct  60   RDDDDGEVGG--KVVNVRLSGEDGE-ISDPQWRRIAYGSVSPFALLQSRRNSISSLSKMD  116

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            + S  Y   W E+VMEYS++I SLL N  S P  +IEDP++V+K  EEPT LK AWELME
Sbjct  117  MSSSLYQTAWWEYVMEYSRDIKSLLSNTISLPAPLIEDPRSVIKNAEEPTSLKAAWELME  176

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
            +FYADK   +W+ ERL+DWL++YD L S +HPT++SK+ DFQK+LV LQ IE+DP+YWEV
Sbjct  177  LFYADKTCLSWLPERLVDWLSEYDILLSSSHPTIYSKLQDFQKELVGLQAIEDDPRYWEV  236

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            ++SAL+VGWL+ VVKLL LHGSYQ DQLG RE
Sbjct  237  MASALSVGWLEIVVKLLHLHGSYQLDQLGHRE  268



>gb|AES58637.2| Nup85 nucleoporin protein [Medicago truncatula]
Length=710

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 181/245 (74%), Gaps = 8/245 (3%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L H L  P+ R +ISW+RGN+LRV+L  +P+     G  +    KV+E+ L   G  EID
Sbjct  28   LHHTLTRPVSRLAISWSRGNSLRVSLFAEPSQTSDAGDGA----KVIEVKLGG-GDPEID  82

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
               WR+IAYGSV PFALLQSR+   +A+S MS     Y  +W EHV++YSKEI SLL  P
Sbjct  83   DADWRRIAYGSVAPFALLQSRR---SAISNMSKSPSTYQLDWWEHVLQYSKEITSLLAGP  139

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            K  P+ +I+DP  ++K+ EEPTCLK AWELME+FY DKQSQAW+ ERL+DWLADYDSLF+
Sbjct  140  KLGPSPIIDDPNEIVKKNEEPTCLKAAWELMEIFYVDKQSQAWLPERLVDWLADYDSLFT  199

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             T  T+H K+VDFQ DLV +Q IE+DP+YWEV+SSAL+VGWLD VVK+LRLHGSYQ DQL
Sbjct  200  STQETIHGKLVDFQNDLVNIQVIEDDPRYWEVMSSALSVGWLDIVVKMLRLHGSYQLDQL  259

Query  54   GTREV  40
              RE+
Sbjct  260  SNREL  264



>gb|AAK32793.1|AF361625_1 AT4g32910/F26P21_30 [Arabidopsis thaliana]
 gb|AAN72255.1| At4g32910/F26P21_30 [Arabidopsis thaliana]
Length=713

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 184/244 (75%), Gaps = 3/244 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L +GLK P+HR SISW  GN LRVT+LR P   D   G+     KVV + LS   GE I 
Sbjct  25   LSYGLKSPVHRLSISWGCGNNLRVTVLRNPELRDDDDGEVGG--KVVNVRLSGEDGE-IS  81

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
              +WR+IAYGSV+PFALLQSR+NS+++LSKM + S  Y   W E+VMEYS++I SLL N 
Sbjct  82   DPQWRRIAYGSVSPFALLQSRRNSISSLSKMDMSSSLYQTAWWEYVMEYSRDIKSLLSNT  141

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S P  +IEDP++V+K  EEPT LK AWELME+FYADK   +W+ ERL+DWL++YD L S
Sbjct  142  ISLPAPLIEDPRSVIKNAEEPTSLKAAWELMELFYADKTCLSWLPERLVDWLSEYDILLS  201

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             +HPT++SK+ DFQK+LV LQ IE+DP+YWEV++SAL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  202  SSHPTIYSKLQDFQKELVGLQAIEDDPRYWEVMASALSVGWLEIVVKLLHLHGSYQLDQL  261

Query  54   GTRE  43
            G RE
Sbjct  262  GHRE  265



>ref|XP_010447320.1| PREDICTED: nuclear pore complex protein Nup85-like [Camelina 
sativa]
Length=715

 Score =   295 bits (756),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 200/272 (74%), Gaps = 5/272 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPGM ++SS   +VP   + + PV+   L +GLK P+HR SISW  GN LRVT+L  P  
Sbjct  1    MPGMTSESSGGELVPFTTKEKAPVLYP-LSYGLKSPVHRLSISWGCGNNLRVTVLTNPEL  59

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
             +  G       KVV ++L+   GE  DA R R+IAYGSV+PFALLQSR+NS+++LSKM 
Sbjct  60   REDDGEAGG---KVVNVSLNGEDGEISDAQR-RRIAYGSVSPFALLQSRRNSISSLSKMD  115

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            +    Y   W E+VMEYSK+I SLL N  S+P+ +IEDP++V+K+ EEPT LK AWELME
Sbjct  116  MSPTLYQTAWWEYVMEYSKDIKSLLSNTISSPSPLIEDPRSVIKDAEEPTSLKAAWELME  175

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
            + YADK   +W+ ERL+DWL+DYD L S +HPTV+SK+ DFQK+LV LQ IE+DP+YWEV
Sbjct  176  LLYADKTCLSWLPERLVDWLSDYDILLSSSHPTVYSKLKDFQKELVGLQVIEDDPRYWEV  235

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            ++SAL+VGWL+ VVKLL LHGSYQ DQLG RE
Sbjct  236  MASALSVGWLEIVVKLLHLHGSYQLDQLGNRE  267



>ref|XP_010047243.1| PREDICTED: nuclear pore complex protein Nup85-like [Eucalyptus 
grandis]
Length=659

 Score =   293 bits (751),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 203/273 (74%), Gaps = 7/273 (3%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIH-RASISWARGNTLRVTLLRKPa  682
            MPG  +DS+    +           VYPLRH + PP+  R S+ WARG++LRV++ ++  
Sbjct  1    MPGATSDSAGGGALVPLSPETKRSPVYPLRHSVGPPVSPRVSVCWARGSSLRVSIFQQ--  58

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
                 GG+ +AGG+VVE+ L N G  EI   +WR+IAYGS++PFA+LQSR+NS++ LS++
Sbjct  59   -RPPPGGEGDAGGEVVEVKL-NGGDGEISDAQWRRIAYGSMSPFAMLQSRRNSVSTLSRI  116

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            S    PY+ +W E VMEYSK+IN+LLG P+S P SVIEDPK V+K+ E+P  LK AWELM
Sbjct  117  S--PSPYHVDWWEFVMEYSKDINALLGGPESTPASVIEDPKTVVKKSEKPASLKAAWELM  174

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DK SQAW+ ERL+DWLADYDSLFSG+  TVHSK+VDFQ +L+ +Q IE++P YWE
Sbjct  175  ELFYVDKLSQAWLPERLVDWLADYDSLFSGSCATVHSKLVDFQNELINIQVIEDNPTYWE  234

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            V+ SALAVGWL+ VVKLL LHGSYQ DQL +RE
Sbjct  235  VIGSALAVGWLEIVVKLLHLHGSYQLDQLSSRE  267



>gb|KCW79106.1| hypothetical protein EUGRSUZ_C00551 [Eucalyptus grandis]
Length=648

 Score =   293 bits (750),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 203/273 (74%), Gaps = 7/273 (3%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIH-RASISWARGNTLRVTLLRKPa  682
            MPG  +DS+    +           VYPLRH + PP+  R S+ WARG++LRV++ ++  
Sbjct  1    MPGATSDSAGGGALVPLSPETKRSPVYPLRHSVGPPVSPRVSVCWARGSSLRVSIFQQ--  58

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
                 GG+ +AGG+VVE+ L N G  EI   +WR+IAYGS++PFA+LQSR+NS++ LS++
Sbjct  59   -RPPPGGEGDAGGEVVEVKL-NGGDGEISDAQWRRIAYGSMSPFAMLQSRRNSVSTLSRI  116

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            S    PY+ +W E VMEYSK+IN+LLG P+S P SVIEDPK V+K+ E+P  LK AWELM
Sbjct  117  S--PSPYHVDWWEFVMEYSKDINALLGGPESTPASVIEDPKTVVKKSEKPASLKAAWELM  174

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DK SQAW+ ERL+DWLADYDSLFSG+  TVHSK+VDFQ +L+ +Q IE++P YWE
Sbjct  175  ELFYVDKLSQAWLPERLVDWLADYDSLFSGSCATVHSKLVDFQNELINIQVIEDNPTYWE  234

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            V+ SALAVGWL+ VVKLL LHGSYQ DQL +RE
Sbjct  235  VIGSALAVGWLEIVVKLLHLHGSYQLDQLSSRE  267



>ref|XP_002516506.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45847.1| conserved hypothetical protein [Ricinus communis]
Length=725

 Score =   295 bits (754),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 187/245 (76%), Gaps = 3/245 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LRHGLKPPI R SIS+ARGN+LR+++ R+P  D     +     KV+E+ L   G  E++
Sbjct  35   LRHGLKPPISRVSISFARGNSLRISVFRQPFSDSDTDSEIGG--KVLEVKLGGNGDGELN  92

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
               WR+IAY SV+P+ALL+SR+N  + LSK+ L   PY+ EW E+VMEYSK+I+S L NP
Sbjct  93   DAYWRRIAYASVSPYALLKSRRNCASNLSKLQLSPSPYHLEWWEYVMEYSKDISSFLVNP  152

Query  414  KSAPTS-VIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLF  238
            KS+    VIEDPK  L++ E PTCL+ AW+LME+FYADK +Q+WI ER++DWL+DYD L 
Sbjct  153  KSSTAGPVIEDPKEFLEKRERPTCLRAAWDLMEIFYADKLAQSWIPERMVDWLSDYDILL  212

Query  237  SGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQ  58
            S T  TV+ K+V+FQ++LV LQ IE++PK+WEV+SSALAVGWL+  VK+LRLHGSYQ DQ
Sbjct  213  SSTQETVYMKLVEFQEELVTLQVIEDNPKFWEVISSALAVGWLEIAVKVLRLHGSYQLDQ  272

Query  57   LGTRE  43
            LG+RE
Sbjct  273  LGSRE  277



>ref|XP_010047276.1| PREDICTED: nuclear pore complex protein Nup85 [Eucalyptus grandis]
 gb|KCW79149.1| hypothetical protein EUGRSUZ_C00596 [Eucalyptus grandis]
 gb|KCW79150.1| hypothetical protein EUGRSUZ_C00596 [Eucalyptus grandis]
Length=714

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 204/273 (75%), Gaps = 7/273 (3%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIH-RASISWARGNTLRVTLLRKPa  682
            MPG  +DS+   ++           VYPLRH + PP+  R S+ WARG++LRV++ ++  
Sbjct  1    MPGATSDSAGGGVLVPLSPETKRCPVYPLRHCVGPPVSPRVSVCWARGSSLRVSIFQQ--  58

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
                 GG+ +AGG+VVE+ L N G  EI   +WR+IAYGS++PFA+LQSR+NS++ LS++
Sbjct  59   -RSPPGGEGDAGGEVVEVKL-NGGDGEISDAQWRRIAYGSMSPFAMLQSRRNSVSTLSRI  116

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            S    PY+ +W E VMEYSK+IN+LLG P+S P SVIEDPK V+K+ E+P  LK AWELM
Sbjct  117  S--PSPYHVDWWEFVMEYSKDINALLGGPESTPASVIEDPKTVVKKSEKPATLKAAWELM  174

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FY DK SQAW+ ERL+DWLADYDSLFSG+  TVHSK+VDFQ +L+ +Q IE++P YWE
Sbjct  175  ELFYVDKLSQAWLPERLIDWLADYDSLFSGSCATVHSKLVDFQNELINIQVIEDNPTYWE  234

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            V+ SALAVGWL+ VVKLL LHGSYQ DQL +RE
Sbjct  235  VIGSALAVGWLEIVVKLLHLHGSYQLDQLSSRE  267



>emb|CDX75299.1| BnaA01g04030D [Brassica napus]
Length=722

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 181/245 (74%), Gaps = 2/245 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LR+GLK   HR SISW  GN LRVT+LR P P +        G +VV + LS   GE  D
Sbjct  33   LRYGLKSRPHRLSISWGCGNNLRVTVLRNPEPREDDEDGEAGG-EVVNVRLSGEDGEIGD  91

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSR+NS+++L KM      Y   W E+VMEYSKEI SLL + 
Sbjct  92   A-QWRRIAYGSVSPFALLQSRRNSISSLFKMDTSPSLYQTAWWEYVMEYSKEIKSLLSDS  150

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S+P  +IEDP++V+K  EEPTCLK AWELMEMFYADK   +W  ERL+DWL+DYD L S
Sbjct  151  VSSPAPLIEDPRSVIKSAEEPTCLKAAWELMEMFYADKTCLSWWPERLVDWLSDYDVLLS  210

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
              HPT++SK+ DFQK+LV LQ IE+DP+YWEV+SSAL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  211  SAHPTIYSKLEDFQKELVGLQAIEDDPRYWEVMSSALSVGWLEIVVKLLHLHGSYQLDQL  270

Query  54   GTREV  40
            G RE 
Sbjct  271  GNRET  275



>ref|XP_010432640.1| PREDICTED: nuclear pore complex protein Nup85-like [Camelina 
sativa]
Length=716

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 201/273 (74%), Gaps = 6/273 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPGM ++S    +VP   + + PV+   L +GLK P+HR SISW  GN LRVT+L  P  
Sbjct  1    MPGMTSESGGGELVPFTTKEKAPVLYP-LSYGLKSPVHRLSISWGCGNNLRVTVLTNPEL  59

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
             D  G       KVV ++L+   GE  DA R R+IAYGSV+PFALLQSR+NS+++LSKM 
Sbjct  60   RDDDGEAGG---KVVNVSLNGEDGEISDAQR-RRIAYGSVSPFALLQSRRNSISSLSKMD  115

Query  498  LDSPPYN-AEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            +    Y+   W E+VMEYSK+I SLL N  S+P+ +IEDPK+V+K+ EEPT LK AWELM
Sbjct  116  MSPSLYHQTAWWEYVMEYSKDIKSLLSNTISSPSPLIEDPKSVIKDAEEPTSLKAAWELM  175

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E+FYADK   +W+ ERL+DWL+DYD L S +HPTV+SK+ DFQK+LV LQ IE+DP+YWE
Sbjct  176  ELFYADKTCLSWLPERLVDWLSDYDILLSSSHPTVYSKLQDFQKELVGLQVIEDDPRYWE  235

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            V+SSAL+VGWL+ VVKLL LHGSYQ DQLG RE
Sbjct  236  VMSSALSVGWLEIVVKLLHLHGSYQLDQLGNRE  268



>ref|XP_004148390.1| PREDICTED: nuclear pore complex protein Nup85-like [Cucumis sativus]
 ref|XP_004162978.1| PREDICTED: nuclear pore complex protein Nup85-like [Cucumis sativus]
 gb|KGN62813.1| hypothetical protein Csa_2G373560 [Cucumis sativus]
Length=720

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 207/273 (76%), Gaps = 3/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLL-RKPa  682
            MPG A+DSS  +   V    E   VVYP+RH LKPPI R SISWARGN+ RV++  + PA
Sbjct  1    MPGPASDSSP-SGALVLSSWEAREVVYPIRHELKPPIARLSISWARGNSFRVSIFTQHPA  59

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
               +   D E GG+V+E+ + N  GE I A  +R+IAYGSV+PFALLQSRK+ ++ LSKM
Sbjct  60   NHTSDSNDGEVGGQVLEVKIRNGDGE-ISAAEFRRIAYGSVSPFALLQSRKHMVSGLSKM  118

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            S+  P +N +  E++ EYSK+I+S++GNPK  P+S IEDP  +LK+VEEPTCLK AWELM
Sbjct  119  SMGLPRFNPDGWEYLAEYSKDISSVIGNPKLIPSSAIEDPLEILKKVEEPTCLKAAWELM  178

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            ++FYADKQS  W++ERL+DWLA+YDS+ S T  T+HSK+VDFQK+L  LQ +E++P+YW+
Sbjct  179  DVFYADKQSHWWLNERLVDWLAEYDSVLSTTQSTIHSKLVDFQKELNNLQVVEDNPRYWD  238

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            V+ SALAVGW + VVK+LRLHGSYQ DQL  RE
Sbjct  239  VILSALAVGWQEIVVKMLRLHGSYQLDQLSRRE  271



>ref|XP_010437833.1| PREDICTED: nuclear pore complex protein Nup85 [Camelina sativa]
Length=715

 Score =   292 bits (747),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 199/272 (73%), Gaps = 5/272 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPGM ++S    +VP   + + PV+   L +GLK P+HR SISW  GN LRVT+L  P  
Sbjct  1    MPGMTSESGGGELVPFSTKEKAPVLYP-LSYGLKSPVHRLSISWGCGNNLRVTVLTNPEL  59

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
             D  G       KVV ++L+   GE  DA R R+IAYGSV+PFALLQSR+NS+++LS+M 
Sbjct  60   RDDDGEAGG---KVVNVSLNGEDGEISDAQR-RRIAYGSVSPFALLQSRRNSISSLSRMD  115

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            +    Y   W E+VMEYSK+I SLL N  S+P  +IEDP++V+K+ EEPT +K AWELME
Sbjct  116  MSPTLYQTAWWEYVMEYSKDIKSLLSNTISSPAPLIEDPRSVIKDAEEPTSIKAAWELME  175

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
            + YADK   +W+ ERL+DWL+DYD L S +HPTV+SK+ DFQK+LV LQTIE+DP+YW+V
Sbjct  176  LLYADKTCLSWLPERLVDWLSDYDILLSSSHPTVYSKLQDFQKELVGLQTIEDDPRYWDV  235

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            ++SAL+VGWL+ VVKLL LHGSYQ DQLG RE
Sbjct  236  MASALSVGWLEIVVKLLHLHGSYQLDQLGNRE  267



>ref|XP_009125264.1| PREDICTED: nuclear pore complex protein Nup85 [Brassica rapa]
Length=722

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 181/245 (74%), Gaps = 2/245 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LR+ LK   HR SISW  GN LRVT+LR P P D   G    G +VV + LS   GE  D
Sbjct  33   LRYSLKSRPHRLSISWGCGNNLRVTVLRNPEPRDDDDGGEAGG-EVVNVRLSGEDGEIGD  91

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSR+NS+++L KM      Y   W E+VMEYSKEI SLL + 
Sbjct  92   A-QWRRIAYGSVSPFALLQSRRNSISSLFKMDTSPSLYQTAWWEYVMEYSKEIKSLLSDS  150

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S+P  +IEDP++V+K  EEPTCLK AWELMEMFYADK   +W  ERL+DWL+DYD L S
Sbjct  151  VSSPAPLIEDPRSVIKSAEEPTCLKAAWELMEMFYADKTCLSWWPERLVDWLSDYDVLLS  210

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
              HPT++SK+ DFQK+LV LQ IE+DP+YWEV+SSAL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  211  SAHPTIYSKLEDFQKELVGLQAIEDDPRYWEVMSSALSVGWLEIVVKLLHLHGSYQLDQL  270

Query  54   GTREV  40
            G RE 
Sbjct  271  GNRET  275



>ref|XP_003550123.1| PREDICTED: nuclear pore complex protein Nup85-like [Glycine max]
Length=698

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 182/246 (74%), Gaps = 18/246 (7%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L HGL PPI R SISWARG++LR++L             + A  KVVE+ L+    E  D
Sbjct  25   LHHGLAPPISRLSISWARGSSLRLSLF------------AGAAAKVVEVKLAGEDSEIPD  72

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSP-PYNAEWSEHVMEYSKEINSLLGN  418
            A  WR+IAYGSV PFALLQSR++S++AL    L +P PY ++W EHV++YSKEI SLLG 
Sbjct  73   A-HWRRIAYGSVAPFALLQSRRSSLSAL----LKTPSPYRSDWWEHVLQYSKEIGSLLGG  127

Query  417  PKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLF  238
            PK   + +IEDP  + K  EEPT LK AWEL+E+FY DKQSQAW+ ERL+DWLADY SLF
Sbjct  128  PKLPASPIIEDPNVIAKRGEEPTSLKAAWELIEIFYVDKQSQAWLPERLVDWLADYASLF  187

Query  237  SGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQ  58
            + TH T+H K+VDFQK+LV +Q IE DP+YW++LSSAL+VGWLD VVK+LRLHGSYQ DQ
Sbjct  188  TSTHETIHGKLVDFQKELVNIQVIEEDPRYWDLLSSALSVGWLDIVVKMLRLHGSYQLDQ  247

Query  57   LGTREV  40
            L  RE+
Sbjct  248  LSNREL  253



>ref|XP_010526106.1| PREDICTED: nuclear pore complex protein NUP85 isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   290 bits (742),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 187/245 (76%), Gaps = 4/245 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L HGLK P+HR SISW  GN LRVT+LR+P   D  G       +V+ + L   G +EI 
Sbjct  34   LCHGLKSPVHRLSISWGCGNNLRVTVLRRPKSCDEDGEAGG---EVLNVRLGG-GDDEIG  89

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
              +WR+IAYGSV+PFALLQSRKN+ ++LSKM++    Y   W E+VMEYSK+I SLL + 
Sbjct  90   EAQWRRIAYGSVSPFALLQSRKNAFSSLSKMNISPSQYQNGWWEYVMEYSKDIKSLLCSS  149

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            KS+   +IEDPKAV+K  E+PT LK AWELME+FYADK S +W+ E+L+DWLADYD LFS
Sbjct  150  KSSGAPLIEDPKAVVKTAEQPTSLKAAWELMEIFYADKPSLSWLPEQLVDWLADYDILFS  209

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             +HPT++SK+VDFQ +LV LQ +E+DP+YWEV+SSAL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  210  SSHPTIYSKLVDFQNELVGLQVVEDDPRYWEVMSSALSVGWLEIVVKLLHLHGSYQLDQL  269

Query  54   GTREV  40
            G REV
Sbjct  270  GNREV  274



>ref|XP_010526105.1| PREDICTED: nuclear pore complex protein NUP85 isoform X1 [Tarenaya 
hassleriana]
Length=723

 Score =   289 bits (740),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 187/245 (76%), Gaps = 4/245 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L HGLK P+HR SISW  GN LRVT+LR+P   D  G       +V+ + L   G +EI 
Sbjct  34   LCHGLKSPVHRLSISWGCGNNLRVTVLRRPKSCDEDGEAGG---EVLNVRLGG-GDDEIG  89

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
              +WR+IAYGSV+PFALLQSRKN+ ++LSKM++    Y   W E+VMEYSK+I SLL + 
Sbjct  90   EAQWRRIAYGSVSPFALLQSRKNAFSSLSKMNISPSQYQNGWWEYVMEYSKDIKSLLCSS  149

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            KS+   +IEDPKAV+K  E+PT LK AWELME+FYADK S +W+ E+L+DWLADYD LFS
Sbjct  150  KSSGAPLIEDPKAVVKTAEQPTSLKAAWELMEIFYADKPSLSWLPEQLVDWLADYDILFS  209

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             +HPT++SK+VDFQ +LV LQ +E+DP+YWEV+SSAL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  210  SSHPTIYSKLVDFQNELVGLQVVEDDPRYWEVMSSALSVGWLEIVVKLLHLHGSYQLDQL  269

Query  54   GTREV  40
            G RE+
Sbjct  270  GNREI  274



>emb|CDX68920.1| BnaC01g05330D [Brassica napus]
Length=722

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 181/245 (74%), Gaps = 2/245 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            LR+GLK   H  SISW  GN LRVT+LR P   D   G    G +VV + LS   GE  D
Sbjct  33   LRYGLKSRPHGLSISWGYGNNLRVTVLRNPESHDDDDGGEAGG-EVVNVRLSAEDGEIGD  91

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSR+NS+++L KM      Y   W E+VMEYSKEI SLL + 
Sbjct  92   A-QWRRIAYGSVSPFALLQSRRNSISSLFKMDTSPSLYQTAWWEYVMEYSKEIKSLLSDS  150

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S+P  +I+DP++V+K  EEPT LK AWELMEMFYADK   +W+ ERL+DWL+DYD L S
Sbjct  151  VSSPAPLIDDPRSVIKNAEEPTSLKAAWELMEMFYADKTCLSWLPERLVDWLSDYDVLLS  210

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             +HPT++SK+ DFQK+LV LQ IE+DP+YWEV+SSAL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  211  SSHPTIYSKLEDFQKELVGLQAIEDDPRYWEVMSSALSVGWLEIVVKLLHLHGSYQLDQL  270

Query  54   GTREV  40
            G RE 
Sbjct  271  GNRET  275



>ref|XP_006412412.1| hypothetical protein EUTSA_v10024536mg [Eutrema salsugineum]
 gb|ESQ53865.1| hypothetical protein EUTSA_v10024536mg [Eutrema salsugineum]
Length=720

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 183/244 (75%), Gaps = 4/244 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L +GLK P+HR SISW  GN LRVT+LR P   D  G        VV + LS   GE  D
Sbjct  33   LHYGLKSPVHRLSISWGCGNNLRVTVLRNPDSRDDDGEVGG---NVVNVRLSGEDGEIGD  89

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSR+NS+++LSKM +    Y   W E+VMEYS++I SLL + 
Sbjct  90   A-QWRRIAYGSVSPFALLQSRRNSISSLSKMDMSPSLYQTSWWEYVMEYSRDIKSLLSSS  148

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S+P  +IEDPK+V+K  EEPT LK AWELME+FYADK   +W+ ERL+DWL+DYD L S
Sbjct  149  ISSPAPLIEDPKSVIKNAEEPTSLKAAWELMEIFYADKTCLSWLPERLVDWLSDYDILLS  208

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             +HPT++SK+ DFQK+LV LQ IE+DP+YWEV+SSAL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  209  SSHPTIYSKLEDFQKELVGLQAIEDDPRYWEVMSSALSVGWLEIVVKLLHLHGSYQLDQL  268

Query  54   GTRE  43
            G RE
Sbjct  269  GNRE  272



>ref|XP_004498465.1| PREDICTED: nuclear pore complex protein Nup85-like [Cicer arietinum]
Length=709

 Score =   286 bits (733),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 188/246 (76%), Gaps = 10/246 (4%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L H L  PI R +ISW+RGN+LRV+L  +P+ +   G  +    KVVE+ L   G  EI 
Sbjct  27   LHHDLARPISRLAISWSRGNSLRVSLFAEPSVNPNTGDGA----KVVEVKLGG-GDPEIT  81

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSP-PYNAEWSEHVMEYSKEINSLLGN  418
               WR+IAYGSV PFALLQSR++S++ LSK    SP PY+ +W EHV++YSK+I SLLG 
Sbjct  82   DADWRRIAYGSVAPFALLQSRRSSLSELSK----SPSPYHLDWWEHVLQYSKDITSLLGG  137

Query  417  PKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLF  238
            PK +P+ +IEDP  ++++ EEPTCLK AWELME+FY DKQSQAW+ ERL+DWLADYDSLF
Sbjct  138  PKLSPSLIIEDPNEIVQKNEEPTCLKAAWELMEIFYVDKQSQAWLPERLVDWLADYDSLF  197

Query  237  SGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQ  58
            + T  T+H K+VDFQ DLV +Q IE+DP+YWEV+SSAL+VGWLD VVK+LRLHGSYQ DQ
Sbjct  198  TSTQETIHGKLVDFQNDLVNIQVIEDDPRYWEVMSSALSVGWLDIVVKMLRLHGSYQLDQ  257

Query  57   LGTREV  40
            L  RE+
Sbjct  258  LSNREL  263



>ref|XP_008445011.1| PREDICTED: nuclear pore complex protein Nup85 [Cucumis melo]
Length=720

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 206/273 (75%), Gaps = 3/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRK-Pa  682
            MPG A+DSS  +   V   SE   VVYP+RH LKPPI R SISWARGN+ RV++ ++   
Sbjct  1    MPGPASDSSP-SGALVLSSSEAREVVYPIRHELKPPIARLSISWARGNSFRVSIFKQHSG  59

Query  681  pddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
               +   D E GG+V+E+ + N  GE I A  +R+IAYGSV+PFALLQSRK+ ++ LSKM
Sbjct  60   NHSSDSNDDEVGGQVLEVKIRNGDGE-ISAAEFRRIAYGSVSPFALLQSRKHMVSGLSKM  118

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
            S+    +N    E++ EYSK+I+ ++GNPKS P+S IEDP  +LK+VEEPTCLK AWELM
Sbjct  119  SMGLSRFNPNGWEYLAEYSKDISLVIGNPKSIPSSAIEDPLEILKKVEEPTCLKAAWELM  178

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            ++FYADKQS  W++ERL+DWLA+YDS+ S T  T+HSK+VDF+K+L  LQ +E++P+YW+
Sbjct  179  DVFYADKQSHWWLNERLVDWLAEYDSVLSTTLSTIHSKLVDFRKELNNLQVVEDNPRYWD  238

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            V+ SALAVGW + VVK+LRLHGSYQ DQL +RE
Sbjct  239  VILSALAVGWQEIVVKMLRLHGSYQLDQLSSRE  271



>gb|KFK29901.1| hypothetical protein AALP_AA7G193100 [Arabis alpina]
Length=716

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 196/273 (72%), Gaps = 4/273 (1%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+ ++S+    +   P +E   VVYPLR+GLK P+H+ SISW  GN LRVT+LR P  
Sbjct  1    MPGLTSESNGGGELVPFPSTEIAPVVYPLRYGLKSPVHKLSISWGCGNNLRVTVLRNPES  60

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
             D  GG       V    LS   GE  DA  WRKIAYGS +PFALLQSR+NS+++ SKM 
Sbjct  61   SDGDGGVGGKVVNVK---LSGEDGEISDA-EWRKIAYGSASPFALLQSRRNSISSFSKMD  116

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            +    Y   W E+VMEYSK+I SLL +  S+P  + EDPK+V+K  EEPT LK AWELME
Sbjct  117  MSPSLYQNAWWEYVMEYSKDIKSLLSSSISSPAPLFEDPKSVIKTSEEPTSLKAAWELME  176

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
            +FYADK  Q+W+ ERL+DWL+DYD L S +HPT++SK+ DFQK+LV LQ IE+DP+YWEV
Sbjct  177  LFYADKTCQSWLPERLIDWLSDYDMLLSSSHPTIYSKLEDFQKELVGLQAIEDDPRYWEV  236

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
            +SSAL+VGWL+ VVKLL LHGSYQ DQLG RE 
Sbjct  237  MSSALSVGWLEIVVKLLHLHGSYQLDQLGNRET  269



>gb|EPS63372.1| hypothetical protein M569_11413, partial [Genlisea aurea]
Length=261

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 190/273 (70%), Gaps = 12/273 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPGM  +  DL++  V   +         R    PP  R S++W RGNTLRV+ L     
Sbjct  1    MPGMTPEYGDLSVSVVEDHNPKVYTFNSRRACHSPP--RLSLAWGRGNTLRVSFLES--E  56

Query  678  ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS  499
            +   G D  +GG+VVE+NLSN  G ++   +WR+IAYGSV PFA+LQSRKNS        
Sbjct  57   ECGSGQDQISGGEVVEVNLSNVDGGDVSDAQWRRIAYGSVAPFAMLQSRKNS--------  108

Query  498  LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELME  319
            +++  Y  +  +HV++YSKEI+SLL +     T  IEDP  +L +VEEPT LK AWEL+ 
Sbjct  109  VNTSKYEKDRWDHVIQYSKEISSLLSSSDPPVTPAIEDPMMILNKVEEPTALKAAWELLV  168

Query  318  MFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEV  139
             FY +KQS+ WI ERLLDWLA++D LFSG+ PTVH K+VDFQ+++VA++ +ENDPKYWEV
Sbjct  169  FFYVEKQSKTWIPERLLDWLAEFDCLFSGSLPTVHGKLVDFQEEVVAIKAVENDPKYWEV  228

Query  138  LSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
            +S+ALAVGWLD VVKLLR+HGSY +DQLGTREV
Sbjct  229  MSAALAVGWLDVVVKLLRMHGSYFYDQLGTREV  261



>ref|XP_010668417.1| PREDICTED: nuclear pore complex protein NUP85 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=722

 Score =   279 bits (713),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 177/247 (72%), Gaps = 3/247 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddag--ggdseagGKVVELNLSNTGGEE  601
            L H L  PI R +ISW+RGN+LR++LL  P+        GD  +GG VVE+ L++  G  
Sbjct  31   LHHSLSSPISRIAISWSRGNSLRLSLLSHPSISTEQPNEGDESSGGSVVEVKLASENGGI  90

Query  600  IDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLG  421
             D  RWRKI YGSV PFA+ Q+RKNS  A SK+       NA+W E+VMEYSKEINSLLG
Sbjct  91   DDNARWRKIVYGSVAPFAMFQNRKNSTFAFSKVP-SGALSNADWWEYVMEYSKEINSLLG  149

Query  420  NPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSL  241
              KS  +   EDP  +L   EE T LK AWEL+E+FYADKQSQAW+ ERL+DWLADYD+L
Sbjct  150  TTKSTASLTFEDPGELLMVDEERTTLKAAWELLELFYADKQSQAWLPERLVDWLADYDNL  209

Query  240  FSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFD  61
            FS T  TV+SK+VD Q  L+ LQ IE+DPKYWE LSSALA+GWLD VVKLLRLHGSYQ +
Sbjct  210  FSETESTVYSKLVDLQHHLMHLQAIEDDPKYWECLSSALALGWLDIVVKLLRLHGSYQLE  269

Query  60   QLGTREV  40
            QLG RE 
Sbjct  270  QLGRRET  276



>ref|XP_002869236.1| hypothetical protein ARALYDRAFT_491404 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45495.1| hypothetical protein ARALYDRAFT_491404 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 183/245 (75%), Gaps = 3/245 (1%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L +GLK P+HR SISW  GN LRVT+LR P   D   GD+    KVV + LS   GE  D
Sbjct  28   LSYGLKSPVHRLSISWGCGNNLRVTVLRNPKLRDDNDGDAGG--KVVNVRLSGEDGEISD  85

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A +WR+IAYGSV+PFALLQSR+NS+++LS M + S  +   W E+VMEYS++I SLL N 
Sbjct  86   A-QWRRIAYGSVSPFALLQSRRNSISSLSMMDMSSSLHQTAWWEYVMEYSRDIKSLLSNT  144

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
             S+P  +IEDP++V+   EEPT LK AWELME+FYADK   +W+ ERL+DWL+ YD L S
Sbjct  145  ISSPAPLIEDPRSVITNAEEPTSLKAAWELMELFYADKTCLSWLPERLVDWLSVYDILLS  204

Query  234  GTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQL  55
             +HPT++SK+ DFQK+LV LQ IE+DP+YW V++SAL+VGWL+ VVKLL LHGSYQ DQL
Sbjct  205  SSHPTIYSKLEDFQKELVGLQAIEDDPRYWGVMASALSVGWLEIVVKLLHLHGSYQLDQL  264

Query  54   GTREV  40
            G RE 
Sbjct  265  GHRET  269



>ref|XP_008810655.1| PREDICTED: nuclear pore complex protein Nup85 [Phoenix dactylifera]
Length=720

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 190/277 (69%), Gaps = 10/277 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+A+D  D  +   P   +  V    +RHG+  PI R  +SW RGN L+V  LR P  
Sbjct  1    MPGLASDPGDSLVPFPPDVRDPVVYP--VRHGVNAPIFRVYVSWTRGNLLQVACLRPPEA  58

Query  678  -----ddagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAA  514
                 ++    D E GGK+VE+ L    GE  +A R R+IAYGSV  FALLQSRKNS+AA
Sbjct  59   DPAGGEEDEVSDEEIGGKIVEVKLGAGDGEISEAQR-RRIAYGSVPAFALLQSRKNSLAA  117

Query  513  LSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGA  334
            +S+MS  S     EW EHV++YS  I+ LLGNP    ++VIEDP+ V++  EEPT LK A
Sbjct  118  MSRMSASS--IRTEWWEHVLDYSHHISDLLGNPMLPSSTVIEDPEMVMQPHEEPTRLKAA  175

Query  333  WELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDP  154
            W+LME+FY DK S  W+ ERL+DWLADYDSL + T  T+HSK+   QK LV LQ +E+DP
Sbjct  176  WQLMEIFYVDKLSLTWLPERLVDWLADYDSLLTRTETTIHSKLAGLQKRLVNLQVVEDDP  235

Query  153  KYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            +YWEV+S ALAVGWLDTVVKLLRLHGSYQ DQLG+RE
Sbjct  236  EYWEVMSLALAVGWLDTVVKLLRLHGSYQLDQLGSRE  272



>ref|XP_010924656.1| PREDICTED: nuclear pore complex protein NUP85-like isoform X5 
[Elaeis guineensis]
Length=666

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 192/278 (69%), Gaps = 13/278 (5%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+A+D  D  +  +P   +  V    +RHG+ PPI R  +SW RGN L+V  LR PA 
Sbjct  1    MPGLASDPGDSLVPFLPDVRDPVVYP--VRHGVNPPIFRVYVSWTRGNFLQVACLRPPAA  58

Query  678  ddag-----ggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAA  514
            + AG       D E GGKVVE+ L   G EEI   + R+IAYGSV  FALLQSRKNS+AA
Sbjct  59   EPAGGEEDGVSDEEIGGKVVEVKL-GAGDEEISEAQRRRIAYGSVPAFALLQSRKNSLAA  117

Query  513  LSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGA  334
            +S+MS  S     EW EHV+EYS+ I+ LLGNP    ++VIEDPK +++  EEPT LK A
Sbjct  118  MSRMSASS--IRTEWWEHVLEYSRHISDLLGNPMLPSSTVIEDPKMIMQPHEEPTTLKAA  175

Query  333  WELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQ-TIEND  157
            W+LME+FY DK S  W+ ERL+DWLADYDSL + T  T+HSKV   QK L +L+  +E+D
Sbjct  176  WQLMEIFYVDKLSSTWLPERLVDWLADYDSLLTET--TIHSKVEGLQKRLSSLKVVVEDD  233

Query  156  PKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            P+YWE +S ALA GWLD VVKLLRLHGSYQ +QLG+RE
Sbjct  234  PEYWEGMSGALAAGWLDAVVKLLRLHGSYQLEQLGSRE  271



>ref|XP_010924654.1| PREDICTED: nuclear pore complex protein NUP85-like isoform X3 
[Elaeis guineensis]
Length=692

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 192/278 (69%), Gaps = 13/278 (5%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+A+D  D  +  +P   +  V    +RHG+ PPI R  +SW RGN L+V  LR PA 
Sbjct  1    MPGLASDPGDSLVPFLPDVRDPVVYP--VRHGVNPPIFRVYVSWTRGNFLQVACLRPPAA  58

Query  678  d-----dagggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAA  514
            +     + G  D E GGKVVE+ L   G EEI   + R+IAYGSV  FALLQSRKNS+AA
Sbjct  59   EPAGGEEDGVSDEEIGGKVVEVKL-GAGDEEISEAQRRRIAYGSVPAFALLQSRKNSLAA  117

Query  513  LSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGA  334
            +S+MS  S     EW EHV+EYS+ I+ LLGNP    ++VIEDPK +++  EEPT LK A
Sbjct  118  MSRMSASS--IRTEWWEHVLEYSRHISDLLGNPMLPSSTVIEDPKMIMQPHEEPTTLKAA  175

Query  333  WELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQ-TIEND  157
            W+LME+FY DK S  W+ ERL+DWLADYDSL + T  T+HSKV   QK L +L+  +E+D
Sbjct  176  WQLMEIFYVDKLSSTWLPERLVDWLADYDSLLTET--TIHSKVEGLQKRLSSLKVVVEDD  233

Query  156  PKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            P+YWE +S ALA GWLD VVKLLRLHGSYQ +QLG+RE
Sbjct  234  PEYWEGMSGALAAGWLDAVVKLLRLHGSYQLEQLGSRE  271



>ref|XP_010924653.1| PREDICTED: nuclear pore complex protein NUP85-like isoform X2 
[Elaeis guineensis]
Length=700

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 192/278 (69%), Gaps = 13/278 (5%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+A+D  D  +  +P   +  V    +RHG+ PPI R  +SW RGN L+V  LR PA 
Sbjct  1    MPGLASDPGDSLVPFLPDVRDPVVYP--VRHGVNPPIFRVYVSWTRGNFLQVACLRPPAA  58

Query  678  ddag-----ggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAA  514
            + AG       D E GGKVVE+ L   G EEI   + R+IAYGSV  FALLQSRKNS+AA
Sbjct  59   EPAGGEEDGVSDEEIGGKVVEVKL-GAGDEEISEAQRRRIAYGSVPAFALLQSRKNSLAA  117

Query  513  LSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGA  334
            +S+MS  S     EW EHV+EYS+ I+ LLGNP    ++VIEDPK +++  EEPT LK A
Sbjct  118  MSRMSASS--IRTEWWEHVLEYSRHISDLLGNPMLPSSTVIEDPKMIMQPHEEPTTLKAA  175

Query  333  WELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQ-TIEND  157
            W+LME+FY DK S  W+ ERL+DWLADYDSL + T  T+HSKV   QK L +L+  +E+D
Sbjct  176  WQLMEIFYVDKLSSTWLPERLVDWLADYDSLLTET--TIHSKVEGLQKRLSSLKVVVEDD  233

Query  156  PKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            P+YWE +S ALA GWLD VVKLLRLHGSYQ +QLG+RE
Sbjct  234  PEYWEGMSGALAAGWLDAVVKLLRLHGSYQLEQLGSRE  271



>ref|XP_006853615.1| hypothetical protein AMTR_s00056p00051320 [Amborella trichopoda]
 gb|ERN15082.1| hypothetical protein AMTR_s00056p00051320 [Amborella trichopoda]
Length=723

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/274 (54%), Positives = 189/274 (69%), Gaps = 6/274 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG A++S+  A+VP  PE +  +V   L HG++ P    SISW+RGN+LRV + R+P+ 
Sbjct  1    MPGRASESATTALVPFVPEVKEQLVYR-LSHGVQTPASSLSISWSRGNSLRVAIFRQPSL  59

Query  678  ddagggdseagG-KVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKM  502
            + +      +G   VVEL +    GE ID VR R+IAYGS   FALLQSR+N + A +  
Sbjct  60   ESSEEMAGNSGEGDVVELRMGVEDGE-IDEVRKRRIAYGSAPAFALLQSRRNLVMASNSF  118

Query  501  SLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELM  322
                   +++W +HV+EYS+ I  LLGN KS+P SVIEDPKA+LK  E+PT  K AWELM
Sbjct  119  G---SSLHSDWWQHVLEYSRHIRDLLGNLKSSPVSVIEDPKALLKSSEKPTSSKAAWELM  175

Query  321  EMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWE  142
            E FY DK S +W+ ERL+DWLADYDSL SGT  TVHSK+   QK LV LQ IE+  +YWE
Sbjct  176  EFFYVDKLSLSWLPERLVDWLADYDSLLSGTDMTVHSKLASLQKKLVELQFIEDSKEYWE  235

Query  141  VLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
             ++SALAVGWLD VVKLLRLHGSYQ DQ+  RE+
Sbjct  236  AIASALAVGWLDIVVKLLRLHGSYQLDQIDNREI  269



>ref|XP_010924652.1| PREDICTED: nuclear pore complex protein NUP85-like isoform X1 
[Elaeis guineensis]
Length=719

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 192/278 (69%), Gaps = 13/278 (5%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+A+D  D  +  +P   +  V    +RHG+ PPI R  +SW RGN L+V  LR PA 
Sbjct  1    MPGLASDPGDSLVPFLPDVRDPVVYP--VRHGVNPPIFRVYVSWTRGNFLQVACLRPPAA  58

Query  678  ddag-----ggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAA  514
            + AG       D E GGKVVE+ L   G EEI   + R+IAYGSV  FALLQSRKNS+AA
Sbjct  59   EPAGGEEDGVSDEEIGGKVVEVKL-GAGDEEISEAQRRRIAYGSVPAFALLQSRKNSLAA  117

Query  513  LSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGA  334
            +S+MS  S     EW EHV+EYS+ I+ LLGNP    ++VIEDPK +++  EEPT LK A
Sbjct  118  MSRMSASS--IRTEWWEHVLEYSRHISDLLGNPMLPSSTVIEDPKMIMQPHEEPTTLKAA  175

Query  333  WELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQ-TIEND  157
            W+LME+FY DK S  W+ ERL+DWLADYDSL + T  T+HSKV   QK L +L+  +E+D
Sbjct  176  WQLMEIFYVDKLSSTWLPERLVDWLADYDSLLTET--TIHSKVEGLQKRLSSLKVVVEDD  233

Query  156  PKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            P+YWE +S ALA GWLD VVKLLRLHGSYQ +QLG+RE
Sbjct  234  PEYWEGMSGALAAGWLDAVVKLLRLHGSYQLEQLGSRE  271



>ref|XP_003569792.1| PREDICTED: nuclear pore complex protein Nup85 [Brachypodium distachyon]
Length=730

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 176/251 (70%), Gaps = 7/251 (3%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPa-pddagggdseagGKVVELNLSNTGG---  607
            +RHG+ PPI R  +SW+ GN L+V  LR+P+  D  G G  E  G+VVE+NL    G   
Sbjct  32   IRHGVAPPIFRVYVSWSSGNLLQVACLRQPSPEDGGGSGSEEVAGRVVEVNLGVGNGSAE  91

Query  606  --EEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS-LDSPPYNAEWSEHVMEYSKEI  436
              +E+D    R+I YGSV  FALLQSRKN++A  + MS + + P +AEW ++V+EYSK I
Sbjct  92   VEKEVDEAEMRRIEYGSVPAFALLQSRKNALAGTAAMSHMQAVPEHAEWWQYVLEYSKTI  151

Query  435  NSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLA  256
              LLGNP S P  +IED +A+LK  E+PT LK AWEL+E+FY DKQ  +W+ ERL+DWLA
Sbjct  152  GYLLGNPDSLPAPMIEDARAILKVKEKPTSLKAAWELLEIFYVDKQLHSWLPERLVDWLA  211

Query  255  DYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHG  76
            DYDSL + T  TV+ K+ +FQK L+ LQ +ENDP YW  LS+AL+VGWLD VV +LR HG
Sbjct  212  DYDSLLTKTDGTVYCKLSNFQKKLINLQIVENDPDYWNGLSAALSVGWLDVVVNMLRFHG  271

Query  75   SYQFDQLGTRE  43
            SYQ DQ+  RE
Sbjct  272  SYQLDQMDNRE  282



>ref|XP_004969928.1| PREDICTED: nuclear pore complex protein Nup85-like [Setaria italica]
Length=728

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/282 (51%), Positives = 184/282 (65%), Gaps = 12/282 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLR---HGLKPPIHRASISWARGNTLRVTLLRK  688
            MPGM TD     +       +      PLR   HG+ PPI R  I+W+ GN L+V  LR 
Sbjct  1    MPGMPTDGGGAIVPFRGEPGQGAPSPPPLRPIRHGVAPPIFRVYINWSSGNLLQVACLRP  60

Query  687  PapddagggdseagGKVVELNLSNTGG------EEIDAVRWRKIAYGSVTPFALLQSRKN  526
            P  +  GG +      VVE+NL + G       EEID    R+I YGSV  FALLQSRKN
Sbjct  61   PNSEGCGGVEVAG--SVVEVNLGSGGNGGAEVEEEIDEAEMRRIEYGSVPAFALLQSRKN  118

Query  525  SMAALSKMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPT  349
            ++A  + MS + S P  AEW ++V+EYSK I +LLGNP S P  +IEDPK +LK  E+PT
Sbjct  119  ALADAAAMSRMSSVPDYAEWWQYVLEYSKTIGNLLGNPDSPPAFMIEDPKTILKVREKPT  178

Query  348  CLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQT  169
             L+ AWEL+E+FY DKQ Q+W+ ERL+DWLAD+DSL S T  TV+SK+ +FQK L+ LQ 
Sbjct  179  SLRAAWELLEIFYVDKQLQSWLPERLVDWLADFDSLLSATESTVYSKLSNFQKKLINLQI  238

Query  168  IENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            +E+DP YW  LS+AL+VGWLD VV +LR HGSYQ DQ+  RE
Sbjct  239  VEDDPDYWNGLSAALSVGWLDIVVNMLRFHGSYQLDQMDNRE  280



>dbj|BAK02879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score =   256 bits (653),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 146/283 (52%), Positives = 186/283 (66%), Gaps = 11/283 (4%)
 Frame = -1

Query  858  MPGMATDSSD--LAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKP  685
            MPGM  DS    +     P  + +   V P+RHG+ PPI R  ISW+ GN L+V  LR P
Sbjct  1    MPGMPADSGGAIVRFSGEPKHAASAPPVRPIRHGVPPPISRVYISWSSGNLLQVACLRPP  60

Query  684  a-pddagggdseagGKVVELNLS----NTGGE---EIDAVRWRKIAYGSVTPFALLQSRK  529
               + AG G  E  G VVE+NL     N G E   E+D    R+I YGSV  FALLQSRK
Sbjct  61   NPEEGAGRGAEEVAGSVVEVNLGVGAGNGGAEVEGEVDDAEMRRIEYGSVPAFALLQSRK  120

Query  528  NSMAALSKMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEP  352
            N++A  + M  + S   +AEW ++V+EYSK I +LLGNP S P  +IEDP+A+LK  E+P
Sbjct  121  NALADAAAMQHMHSVSEHAEWWQYVLEYSKTIGNLLGNPDSLPAFMIEDPRAILKVREKP  180

Query  351  TCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQ  172
            T LK AWEL+E+FY DK+  +W+ ERL+DWLADYDSL + T  TV+ K+ +FQK L+ LQ
Sbjct  181  TSLKAAWELLEIFYVDKELHSWLPERLVDWLADYDSLLTKTDGTVYCKLNNFQKKLINLQ  240

Query  171  TIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +END  YW  LS+AL+VGWLD VV +LR HGSYQ DQ+  RE
Sbjct  241  IVENDDDYWNGLSAALSVGWLDVVVNMLRFHGSYQLDQMDNRE  283



>tpg|DAA57612.1| TPA: hypothetical protein ZEAMMB73_995542 [Zea mays]
Length=398

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 179/281 (64%), Gaps = 10/281 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP---LRHGLKPPIHRASISWARGNTLRVTLLRK  688
            MPGM TD     +       +      P   +RHG+ PPI R  +SW+ GN L+V  LR 
Sbjct  1    MPGMPTDGGGAMVPFTGEPGQGAPPPAPVRPIRHGVAPPIFRIYVSWSSGNLLQVACLRP  60

Query  687  Pap-ddagggdseagGKVVELNLSNTGG----EEIDAVRWRKIAYGSVTPFALLQSRKNS  523
            P      G  +       V L    +GG    E+ID    R+I YGSV  FALLQSRKN+
Sbjct  61   PNSDGGGGTEEVVGSVVEVNLGDGGSGGSEAEEKIDEAEMRRIEYGSVPAFALLQSRKNT  120

Query  522  MAALSKMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTC  346
            +A ++ MS + S P +AEW ++V+EYSK I SLLGNP  +   +IE+PK +LK  E+PT 
Sbjct  121  LADVATMSHVPSVPDHAEWWQYVLEYSKTIGSLLGNPDPS-GFMIEEPKTILKVREKPTS  179

Query  345  LKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTI  166
            L+ AWEL+E+FY DK+ Q W+ ERL+DWLAD+DSL S    TV+SK+ +FQK LV LQ +
Sbjct  180  LRAAWELLEIFYVDKRLQGWLPERLVDWLADFDSLLSTMASTVYSKLSNFQKKLVNLQIV  239

Query  165  ENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            E+DP YW  LS+AL+VGWLD VV +LR HGSYQ DQ+ +RE
Sbjct  240  EDDPDYWNGLSAALSVGWLDIVVNMLRFHGSYQLDQMDSRE  280



>ref|XP_002456346.1| hypothetical protein SORBIDRAFT_03g034380 [Sorghum bicolor]
 gb|EES01466.1| hypothetical protein SORBIDRAFT_03g034380 [Sorghum bicolor]
Length=722

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 180/276 (65%), Gaps = 6/276 (2%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPGM TD     +       +    V P+RHG+ PPI R  +SW+ GN L+V  LR P  
Sbjct  1    MPGMPTDGVGAIVPFTGEPGQGAPPVRPIRHGVPPPIFRIYVSWSSGNLLQVACLRPPNS  60

Query  678  ddagggdseagGKVVELNLSNTGGE---EIDAVRWRKIAYGSVTPFALLQSRKNSMAALS  508
            +  GG +   G  V   NL + G E   +ID    R+I YGSV  FALLQSRKN++A  +
Sbjct  61   EGGGGTEEVVGSVVEV-NLGDGGSEAEEKIDEAEMRRIEYGSVPAFALLQSRKNTLADAA  119

Query  507  KMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAW  331
             MS L S P +AEW ++V+EYSK I +LLGNP   P  +IEDPK +LK  E+PT L+ AW
Sbjct  120  TMSHLPSVPDHAEWWQYVLEYSKTIGNLLGNP-DPPVFMIEDPKTILKVREKPTSLRAAW  178

Query  330  ELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPK  151
            EL+E+FY DK  Q W+ ERL+DWLAD+DSL S    TV+SK+ +FQK L+ LQ +E+DP 
Sbjct  179  ELLEIFYVDKHLQGWLPERLVDWLADFDSLLSTMASTVYSKLSNFQKKLINLQIVEDDPD  238

Query  150  YWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            YW  LS+AL+VGWLD VV +LR HGSYQ DQ+  RE
Sbjct  239  YWNGLSAALSVGWLDIVVNMLRFHGSYQLDQMDNRE  274



>ref|XP_009387645.1| PREDICTED: nuclear pore complex protein Nup85 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=700

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/247 (55%), Positives = 175/247 (71%), Gaps = 6/247 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapd---dagggdseagGKVVELNLSNTGGE  604
            + HG++PP+ R  ++W+RG+ L V  LR+P+P+   +    + EAGGKVVE+ L   G E
Sbjct  28   VHHGVRPPLLRVYVAWSRGSLLHVACLRQPSPEPEPEDSVDEGEAGGKVVEVRL-RAGEE  86

Query  603  EIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLL  424
             I   + R+IAYGSV  FALLQSRKNS+ A+S+MS  S     EW ++V+EYSK I+ LL
Sbjct  87   GISEAQRRRIAYGSVPAFALLQSRKNSLMAMSRMS--SSLLRGEWWQYVLEYSKNISELL  144

Query  423  GNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDS  244
            G  + +   VIEDP+ V++  EEPT LK AWELME+FY DKQS  W+ ERL+DW  DYDS
Sbjct  145  GTRRLSSNMVIEDPRMVVQPSEEPTSLKAAWELMEIFYVDKQSLTWLPERLVDWSEDYDS  204

Query  243  LFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQF  64
            L + T  T+HSK+V+ QK L  ++ +E+DP YWE +SSALAVGWLD VVKLLR HGSYQ 
Sbjct  205  LVTRTELTIHSKLVNMQKKLANVKVVEDDPDYWEGMSSALAVGWLDIVVKLLRFHGSYQL  264

Query  63   DQLGTRE  43
            DQL  RE
Sbjct  265  DQLDNRE  271



>ref|NP_001044228.1| Os01g0746200 [Oryza sativa Japonica Group]
 dbj|BAC05596.1| putative nucleoporin Nup75 [Oryza sativa Japonica Group]
 dbj|BAF06142.1| Os01g0746200 [Oryza sativa Japonica Group]
Length=733

 Score =   251 bits (641),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 172/254 (68%), Gaps = 10/254 (4%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLR--KPapddagggdseagGKVVELNLSN-----  616
            +RHG+ PPI R  +S++ GN L+V  LR   P      G +  +GG+VVE+NL       
Sbjct  32   IRHGVAPPISRVYVSFSSGNLLQVACLRPPNPEGGGDRGAEEVSGGRVVEVNLGGGGSGP  91

Query  615  --TGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS-LDSPPYNAEWSEHVMEYS  445
                 EEID    R+I YGSV  FALLQSRKN++   S MS L S   +AEW ++V+EYS
Sbjct  92   GGADAEEIDEAEMRRIEYGSVPAFALLQSRKNALVDGSGMSRLPSVSEHAEWWQYVLEYS  151

Query  444  KEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLD  265
            K I SLLGNP S    +I+DPK +LK  E+PT LK AWEL+E+F+ DKQ Q W+ ERL+D
Sbjct  152  KTIGSLLGNPDSLSAYMIDDPKMILKVKEKPTSLKAAWELLEIFFVDKQLQTWLPERLVD  211

Query  264  WLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLR  85
            WLADYDSL + T  T++  +++FQK L+ LQ +E+DP YW  LS+AL+VGWLD VV +LR
Sbjct  212  WLADYDSLLTKTENTIYRTLINFQKKLINLQVVEDDPDYWSGLSAALSVGWLDIVVNMLR  271

Query  84   LHGSYQFDQLGTRE  43
             HGSYQ DQ+ +RE
Sbjct  272  FHGSYQLDQMDSRE  285



>ref|XP_009387644.1| PREDICTED: nuclear pore complex protein Nup85 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=719

 Score =   250 bits (639),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 135/247 (55%), Positives = 175/247 (71%), Gaps = 6/247 (2%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapd---dagggdseagGKVVELNLSNTGGE  604
            + HG++PP+ R  ++W+RG+ L V  LR+P+P+   +    + EAGGKVVE+ L   G E
Sbjct  28   VHHGVRPPLLRVYVAWSRGSLLHVACLRQPSPEPEPEDSVDEGEAGGKVVEVRL-RAGEE  86

Query  603  EIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLL  424
             I   + R+IAYGSV  FALLQSRKNS+ A+S+MS  S     EW ++V+EYSK I+ LL
Sbjct  87   GISEAQRRRIAYGSVPAFALLQSRKNSLMAMSRMS--SSLLRGEWWQYVLEYSKNISELL  144

Query  423  GNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDS  244
            G  + +   VIEDP+ V++  EEPT LK AWELME+FY DKQS  W+ ERL+DW  DYDS
Sbjct  145  GTRRLSSNMVIEDPRMVVQPSEEPTSLKAAWELMEIFYVDKQSLTWLPERLVDWSEDYDS  204

Query  243  LFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQF  64
            L + T  T+HSK+V+ QK L  ++ +E+DP YWE +SSALAVGWLD VVKLLR HGSYQ 
Sbjct  205  LVTRTELTIHSKLVNMQKKLANVKVVEDDPDYWEGMSSALAVGWLDIVVKLLRFHGSYQL  264

Query  63   DQLGTRE  43
            DQL  RE
Sbjct  265  DQLDNRE  271



>ref|NP_001168171.1| hypothetical protein [Zea mays]
 gb|ACN27320.1| unknown [Zea mays]
 tpg|DAA57611.1| TPA: hypothetical protein ZEAMMB73_995542 [Zea mays]
Length=733

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 179/281 (64%), Gaps = 10/281 (4%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyP---LRHGLKPPIHRASISWARGNTLRVTLLRK  688
            MPGM TD     +       +      P   +RHG+ PPI R  +SW+ GN L+V  LR 
Sbjct  1    MPGMPTDGGGAMVPFTGEPGQGAPPPAPVRPIRHGVAPPIFRIYVSWSSGNLLQVACLRP  60

Query  687  Pap-ddagggdseagGKVVELNLSNTGG----EEIDAVRWRKIAYGSVTPFALLQSRKNS  523
            P      G  +       V L    +GG    E+ID    R+I YGSV  FALLQSRKN+
Sbjct  61   PNSDGGGGTEEVVGSVVEVNLGDGGSGGSEAEEKIDEAEMRRIEYGSVPAFALLQSRKNT  120

Query  522  MAALSKMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTC  346
            +A ++ MS + S P +AEW ++V+EYSK I SLLGNP  +   +IE+PK +LK  E+PT 
Sbjct  121  LADVATMSHVPSVPDHAEWWQYVLEYSKTIGSLLGNPDPS-GFMIEEPKTILKVREKPTS  179

Query  345  LKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTI  166
            L+ AWEL+E+FY DK+ Q W+ ERL+DWLAD+DSL S    TV+SK+ +FQK LV LQ +
Sbjct  180  LRAAWELLEIFYVDKRLQGWLPERLVDWLADFDSLLSTMASTVYSKLSNFQKKLVNLQIV  239

Query  165  ENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            E+DP YW  LS+AL+VGWLD VV +LR HGSYQ DQ+ +RE
Sbjct  240  EDDPDYWNGLSAALSVGWLDIVVNMLRFHGSYQLDQMDSRE  280



>gb|EMT33767.1| hypothetical protein F775_17911 [Aegilops tauschii]
Length=672

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/284 (50%), Positives = 185/284 (65%), Gaps = 11/284 (4%)
 Frame = -1

Query  858  MPGMATDSSD--LAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKP  685
            MPGM  DS    +     P  + + + V P+RHG+ PPI R  ISW+ GN L+V  LR P
Sbjct  1    MPGMPADSGGAIVPFSGEPKHAASALPVRPIRHGVPPPISRVYISWSSGNLLQVACLRPP  60

Query  684  a-pddagggdseagGKVVELNLSNTGGE-------EIDAVRWRKIAYGSVTPFALLQSRK  529
            +  + AG G  E  G+VVE+NL    G        E+D    R+I YGSV  FALLQSRK
Sbjct  61   SPEEGAGRGAEEVAGRVVEVNLGVGAGNGSAEVEEEVDEAEMRRIEYGSVPAFALLQSRK  120

Query  528  NSMAALSKMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEP  352
            N++A  + M  + S   +AEW ++V+EYSK I +LLGN  S P  +IEDP+A+LK  E+P
Sbjct  121  NALADAAAMQHMHSVSEHAEWWQYVLEYSKTIGNLLGNQDSLPALMIEDPRAILKVREKP  180

Query  351  TCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQ  172
            T LK AWEL+E+FY DK+  +W+ ERL+DWLADYDSL + T  TV+ K+ +FQK L+ LQ
Sbjct  181  TSLKAAWELLEIFYVDKELHSWLPERLVDWLADYDSLLTKTDGTVYFKLNNFQKKLINLQ  240

Query  171  TIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
             +END  YW  LS+AL+VGWLD VV +LR HGSYQ  Q+  RE 
Sbjct  241  IVENDDDYWNGLSAALSVGWLDVVVNMLRFHGSYQLGQMDNRET  284



>ref|XP_003588386.1| Nuclear pore complex protein Nup85 [Medicago truncatula]
Length=919

 Score =   245 bits (626),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/289 (47%), Positives = 173/289 (60%), Gaps = 59/289 (20%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L H L  P+ R +ISW+RGN+LRV+L  +P+     G  +    KV+E+ L   G  EID
Sbjct  28   LHHTLTRPVSRLAISWSRGNSLRVSLFAEPSQTSDAGDGA----KVIEVKLGG-GDPEID  82

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSK----MSLDSPPYNAE-----WS--------  466
               WR+IAYGSV PFALLQSR+++++ +SK      LD    N E     W+        
Sbjct  83   DADWRRIAYGSVAPFALLQSRRSAISNMSKSPSTYQLDCTNKNTEHYTDTWTQKDIDINE  142

Query  465  ---------------------------EHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLK  367
                                       EHV++YSKEI SLL  PK  P+ +I+DP  ++K
Sbjct  143  LDKYMMYDRTLWRHLIHVACPTSGIKWEHVLQYSKEITSLLAGPKLGPSPIIDDPNEIVK  202

Query  366  EVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKD  187
            + EEPTCLK AWELME+FY DKQ  +           DYDSLF+ T  T+H K+VDFQ D
Sbjct  203  KNEEPTCLKAAWELMEIFYVDKQISS----------MDYDSLFTSTQETIHGKLVDFQND  252

Query  186  LVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
            LV +Q IE+DP+YWEV+SSAL+VGWLD VVK+LRLHGSYQ DQL  RE+
Sbjct  253  LVNIQVIEDDPRYWEVMSSALSVGWLDIVVKMLRLHGSYQLDQLSNREL  301



>emb|CDM84057.1| unnamed protein product [Triticum aestivum]
Length=731

 Score =   238 bits (606),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 182/283 (64%), Gaps = 11/283 (4%)
 Frame = -1

Query  858  MPGMATDSSD--LAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKP  685
            MPGM  DS    +     P  + +   V P+RHG+ PPI R  ISW+ GN L+V  LR P
Sbjct  1    MPGMPADSGGAIVPFSGEPKHAASAPPVRPIRHGVPPPISRVYISWSSGNLLQVACLRPP  60

Query  684  apddagggd-seagGKVVELNLSNTGGE-------EIDAVRWRKIAYGSVTPFALLQSRK  529
             P++       E GG+VVE+NL    G        E+D    R+I YGSV  FALLQSRK
Sbjct  61   GPEEGARRGPEEVGGRVVEVNLGVGAGNGSTEVEEEVDEAEMRRIEYGSVPAFALLQSRK  120

Query  528  NSMAALSKMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEP  352
            N++A  + M  + S   +AEW ++V+EYSK I +LLGN    P  +IE+P+A+LK  E+ 
Sbjct  121  NALADAAAMQHMHSVSEHAEWWQYVLEYSKTIGNLLGNQDCLPALMIENPRAILKVREKS  180

Query  351  TCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQ  172
            T LK AWEL+E+FY DK+  +W+ ERL+DWLADYDSL + T  TV+ K+ +FQK L+ LQ
Sbjct  181  TSLKAAWELLEIFYVDKELHSWLPERLVDWLADYDSLLTKTDGTVYFKLNNFQKKLINLQ  240

Query  171  TIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
             +END  YW  LS+AL+VGWLD VV +LR HGSYQ DQ+  RE
Sbjct  241  IVENDDDYWNGLSAALSVGWLDVVVNMLRFHGSYQLDQMDNRE  283



>ref|XP_006646316.1| PREDICTED: nuclear pore complex protein Nup85-like [Oryza brachyantha]
Length=761

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 174/282 (62%), Gaps = 38/282 (13%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagG----------------  643
            +RHG+ PPI R  +S++ GN L+V  LR P  +  G   +E  G                
Sbjct  32   IRHGVAPPISRVYVSFSSGNLLQVACLRPPNQEGGGERRAEEVGGRVVEVACLRPPNQEG  91

Query  642  -----------KVVELNLSNTGG----------EEIDAVRWRKIAYGSVTPFALLQSRKN  526
                       +VVE+NL   G           EEID    R++ YGSV  FALLQSR+N
Sbjct  92   GGERRAEEVGGRVVEVNLGGGGAGAGAGCADVEEEIDEAEMRRVEYGSVPAFALLQSRRN  151

Query  525  SMAALSKMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPT  349
            ++A  + MS + +   +AEW ++V+EYSK IN+LLGN  S P  +I+DPK +LK  E+ T
Sbjct  152  ALADAAAMSRVPAVSEHAEWWQYVLEYSKTINNLLGNTDSLPAFMIDDPKTILKVREKLT  211

Query  348  CLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQT  169
             LK AWEL+E+F+ DKQ Q+W+ ERL+DWLADYDSL + T  TV+  + +FQK L+ LQ 
Sbjct  212  SLKAAWELLEIFFVDKQLQSWLPERLVDWLADYDSLLTKTENTVYRMLSNFQKKLINLQI  271

Query  168  IENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            +E+DP YW  LSSAL+VGWLD VV +LR HGSYQ DQ+ +RE
Sbjct  272  VEDDPDYWNGLSSALSVGWLDIVVNMLRFHGSYQLDQMDSRE  313



>ref|XP_007161497.1| hypothetical protein PHAVU_001G074100g [Phaseolus vulgaris]
 gb|ESW33491.1| hypothetical protein PHAVU_001G074100g [Phaseolus vulgaris]
Length=221

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 144/201 (72%), Gaps = 16/201 (8%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L HGL PPI R SISW+RGN+LR++L             S A  KVVE+ L++   E  D
Sbjct  24   LHHGLAPPICRLSISWSRGNSLRLSLF------------SAAAAKVVEVKLTSEDPEIPD  71

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
            A  WR+IAYGSV PFALLQSR++S++ L K      PY+++W E+V++YSKEI SLLG  
Sbjct  72   A-HWRRIAYGSVAPFALLQSRRSSLSTLMKTP---SPYHSDWWENVLQYSKEIGSLLGGS  127

Query  414  KSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFS  235
            K  P+ +IED K + K  EEPT LK AWEL+E+FY DKQSQAW+ ERL+DWLADYDSLF+
Sbjct  128  KLPPSPIIEDSKTIFKRGEEPTSLKAAWELIEIFYVDKQSQAWLPERLVDWLADYDSLFT  187

Query  234  GTHPTVHSKVVDFQKDLVALQ  172
             TH T+H K+VDFQK+LV +Q
Sbjct  188  STHETIHGKLVDFQKELVNIQ  208



>gb|EEE55373.1| hypothetical protein OsJ_03432 [Oryza sativa Japonica Group]
Length=701

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 146/208 (70%), Gaps = 8/208 (4%)
 Frame = -1

Query  642  KVVELNLSN-------TGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS-LDSP  487
            +VVE+NL            EEID    R+I YGSV  FALLQSRKN++   S MS L S 
Sbjct  46   RVVEVNLGGGGSGPGGADAEEIDEAEMRRIEYGSVPAFALLQSRKNALVDGSGMSRLPSV  105

Query  486  PYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYA  307
              +AEW ++V+EYSK I SLLGNP S    +I+DPK +LK  E+PT LK AWEL+E+F+ 
Sbjct  106  SEHAEWWQYVLEYSKTIGSLLGNPDSLSAYMIDDPKMILKVKEKPTSLKAAWELLEIFFV  165

Query  306  DKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSA  127
            DKQ Q W+ ERL+DWLADYDSL + T  T++  +++FQK L+ LQ +E+DP YW  LS+A
Sbjct  166  DKQLQTWLPERLVDWLADYDSLLTKTENTIYRTLINFQKKLINLQVVEDDPDYWSGLSAA  225

Query  126  LAVGWLDTVVKLLRLHGSYQFDQLGTRE  43
            L+VGWLD VV +LR HGSYQ DQ+ +RE
Sbjct  226  LSVGWLDIVVNMLRFHGSYQLDQMDSRE  253



>gb|EMS46015.1| hypothetical protein TRIUR3_08885 [Triticum urartu]
Length=590

 Score =   215 bits (548),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = -1

Query  582  RKIAYGSVTPFALLQSRKNSMAALSKMS-LDSPPYNAEWSEHVMEYSKEINSLLGNPKSA  406
            R+I YGSV  FALLQSRKN++A  + M  + S   +AEW ++V+EYSK I +LLGN  S 
Sbjct  2    RRIEYGSVPAFALLQSRKNALAEAAAMQHMHSVSEHAEWWQYVLEYSKTIGNLLGNQDSL  61

Query  405  PTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTH  226
            P  +IEDP+A+LK  E+PT LK AWEL+E+FY DK+  +W+ ERL+DWLADYDSL + T 
Sbjct  62   PALMIEDPRAILKVREKPTSLKAAWELLEIFYVDKELHSWLLERLVDWLADYDSLLTKTD  121

Query  225  PTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTR  46
             TV+ K+ +FQK L+ LQ +END  YW  LS+AL+VGWLD VV +LR HGSYQ DQ+  R
Sbjct  122  GTVYCKLNNFQKKLINLQIVENDDDYWNGLSAALSVGWLDVVVNMLRFHGSYQLDQMDNR  181

Query  45   E  43
            E
Sbjct  182  E  182



>emb|CAA21200.1| putative protein [Arabidopsis thaliana]
 emb|CAB80008.1| putative protein [Arabidopsis thaliana]
Length=761

 Score =   218 bits (555),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 130/288 (45%), Positives = 161/288 (56%), Gaps = 75/288 (26%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEID  595
            L +GLK P+HR SISW  GN LRVT+LR P   D   G+     KVV + LS   GE I 
Sbjct  25   LSYGLKSPVHRLSISWGCGNNLRVTVLRNPELRDDDDGEVGG--KVVNVRLSGEDGE-IS  81

Query  594  AVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNP  415
              +WR+IAYGSV+PFALLQSR+NS+++LSKM + S  Y   W E+VMEYS++I SLL N 
Sbjct  82   DPQWRRIAYGSVSPFALLQSRRNSISSLSKMDMSSSLYQTAWWEYVMEYSRDIKSLLSNT  141

Query  414  KSAPTSVIEDPKAVLK---------------------------EVEEPTCLKGAWELMEM  316
             S P  +IEDP++V+K                             EEPT LK AWELME+
Sbjct  142  ISLPAPLIEDPRSVIKVRWSFWFYNWFECGALLMDVPVNIHMQNAEEPTSLKAAWELMEL  201

Query  315  FYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVL  136
            FYADK   +W+ ERL+DWL+                             IE+DP+YWEV+
Sbjct  202  FYADKTCLSWLPERLVDWLS----------------------------AIEDDPRYWEVM  233

Query  135  SSALAVGWLDTV-----------------VKLLRLHGSYQFDQLGTRE  43
            +SAL+VGWL+ V                 VKLL LHGSYQ DQLG RE
Sbjct  234  ASALSVGWLEIVVSTFFLGLGVLCNLILNVKLLHLHGSYQLDQLGHRE  281



>ref|XP_006382047.1| hypothetical protein POPTR_0006s25450g [Populus trichocarpa]
 gb|ERP59844.1| hypothetical protein POPTR_0006s25450g [Populus trichocarpa]
Length=260

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 143/234 (61%), Gaps = 39/234 (17%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppes---enpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRK  688
            MPG+A DS+  A               VVYPL HGLKPPI R SISWARGN LR++    
Sbjct  1    MPGVAADSTTFASGGALVPFVPDTEISVVYPLHHGLKPPISRVSISWARGNNLRIS----  56

Query  687  PapddagggdseagGKVVELNLSNTGGEEI-DAVRWRKIAYGSVTPFALLQSRKNSMAAL  511
                                     G  ++ DA  WR+IAYGSV PFALLQSRKN++++ 
Sbjct  57   -------------------------GAADVRDAEHWRRIAYGSVAPFALLQSRKNAVSSF  91

Query  510  SKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAW  331
            SK+     PY+ +W E+VMEYSK+IN+LLGNPKS  +S+IEDPK VLK+ EEPT LK AW
Sbjct  92   SKLQSSPSPYDLDWWEYVMEYSKDINALLGNPKSNDSSLIEDPKEVLKKFEEPTSLKAAW  151

Query  330  ELMEMFYADKQSQAWISERL-LDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQ  172
            ELMEMFY DK  Q+W+ + L + W      L SG   TVHSK+V+FQ  LV LQ
Sbjct  152  ELMEMFYVDKLCQSWLPDALSIGW-----RLLSGDQLTVHSKLVEFQGKLVTLQ  200



>ref|XP_010668426.1| PREDICTED: nuclear pore complex protein NUP85 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -1

Query  465  EHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAW  286
            E+VMEYSKEINSLLG  KS  +   EDP  +L   EE T LK AWEL+E+FYADKQSQAW
Sbjct  52   EYVMEYSKEINSLLGTTKSTASLTFEDPGELLMVDEERTTLKAAWELLELFYADKQSQAW  111

Query  285  ISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLD  106
            + ERL+DWLADYD+LFS T  TV+SK+VD Q  L+ LQ IE+DPKYWE LSSALA+GWLD
Sbjct  112  LPERLVDWLADYDNLFSETESTVYSKLVDLQHHLMHLQAIEDDPKYWECLSSALALGWLD  171

Query  105  TVVKLLRLHGSYQFDQLGTRE  43
             VVKLLRLHGSYQ +QLG RE
Sbjct  172  IVVKLLRLHGSYQLEQLGRRE  192



>ref|XP_010924655.1| PREDICTED: nuclear pore complex protein NUP85-like isoform X4 
[Elaeis guineensis]
Length=675

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 156/235 (66%), Gaps = 12/235 (5%)
 Frame = -1

Query  858  MPGMATDSSDLAMvpvppesenpvvvyPLRHGLKPPIHRASISWARGNTLRVTLLRKPap  679
            MPG+A+D  D  +  +P   +  V    +RHG+ PPI R  +SW RGN L+V  LR PA 
Sbjct  1    MPGLASDPGDSLVPFLPDVRDPVVYP--VRHGVNPPIFRVYVSWTRGNFLQVACLRPPAA  58

Query  678  ddag-----ggdseagGKVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAA  514
            + AG       D E GGKVVE+ L   G EEI   + R+IAYGSV  FALLQSRKNS+AA
Sbjct  59   EPAGGEEDGVSDEEIGGKVVEVKL-GAGDEEISEAQRRRIAYGSVPAFALLQSRKNSLAA  117

Query  513  LSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGA  334
            +S+MS  S     EW EHV+EYS+ I+ LLGNP    ++VIEDPK +++  EEPT LK A
Sbjct  118  MSRMSASS--IRTEWWEHVLEYSRHISDLLGNPMLPSSTVIEDPKMIMQPHEEPTTLKAA  175

Query  333  WELMEMFYADKQSQAWISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQT  169
            W+LME+FY DK S  W+ ERL+DWLADYDSL + T  T+HSKV   QK L +L+T
Sbjct  176  WQLMEIFYVDKLSSTWLPERLVDWLADYDSLLTET--TIHSKVEGLQKRLSSLKT  228



>gb|EEC71467.1| hypothetical protein OsI_03713 [Oryza sativa Indica Group]
Length=649

 Score =   201 bits (511),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 151/237 (64%), Gaps = 16/237 (7%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLR--KPapddagggdseagGKVVELNLSN-----  616
            +RHG+ PPI R  +S++ GN L+V  LR   P      G +  +GG+VVE+NL       
Sbjct  32   IRHGVAPPISRVYVSFSSGNLLQVACLRPPNPEGGGDRGAEEVSGGRVVEVNLGGGGSGP  91

Query  615  --TGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMS-LDSPPYNAEWSEHVMEYS  445
                 EEID    R+I YGSV  FALLQSRKN++   S MS L S   +AEW ++V+EYS
Sbjct  92   GGADAEEIDEAEMRRIEYGSVPAFALLQSRKNALVDGSGMSRLPSVSEHAEWWQYVLEYS  151

Query  444  KEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLD  265
            K I SLLGNP S    +I+DPK +LK  E+PT LK AWEL+E+F+ DKQ Q W+ ERL+ 
Sbjct  152  KTIGSLLGNPDSLSAYMIDDPKMILKVKEKPTSLKAAWELLEIFFVDKQLQTWLPERLV-  210

Query  264  WLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVK  94
                 D L + T  T++  +++FQK L+ LQ +E+DP YW  LS+AL+VGWLD V +
Sbjct  211  -----DCLLTKTENTIYRTLINFQKKLINLQVVEDDPDYWSGLSAALSVGWLDIVTE  262



>dbj|BAD87530.1| putative nucleoporin Nup75 [Oryza sativa Japonica Group]
Length=602

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  465  EHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAW  286
            ++V+EYSK I SLLGNP S    +I+DPK +LK  E+PT LK AWEL+E+F+ DKQ Q W
Sbjct  14   QYVLEYSKTIGSLLGNPDSLSAYMIDDPKMILKVKEKPTSLKAAWELLEIFFVDKQLQTW  73

Query  285  ISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLD  106
            + ERL+DWLADYDSL + T  T++  +++FQK L+ LQ +E+DP YW  LS+AL+VGWLD
Sbjct  74   LPERLVDWLADYDSLLTKTENTIYRTLINFQKKLINLQVVEDDPDYWSGLSAALSVGWLD  133

Query  105  TVVKLLRLHGSYQFDQLGTRE  43
             VV +LR HGSYQ DQ+ +RE
Sbjct  134  IVVNMLRFHGSYQLDQMDSRE  154



>ref|XP_002973301.1| hypothetical protein SELMODRAFT_413557 [Selaginella moellendorffii]
 gb|EFJ25675.1| hypothetical protein SELMODRAFT_413557 [Selaginella moellendorffii]
Length=252

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 137/250 (55%), Gaps = 48/250 (19%)
 Frame = -1

Query  765  GLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEIDAVR  586
            GL+ P  R  +SW+ GN L+++ +                 +V E++L    GE  DA R
Sbjct  36   GLRDP-GRLWVSWSNGNQLQLSYIENAVGGGG---------RVTEIHL----GEGWDAER  81

Query  585  WRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYN-AEWSEHVMEYSKEINSLLGNPKS  409
             R++AY S+  FALLQ+++               YN  +W EHV+EYSK I S+L  P  
Sbjct  82   -RRLAYDSLPAFALLQNQRQ------------LGYNPGDWWEHVLEYSKSIRSVLDQP--  126

Query  408  APTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGT  229
                       +  + E+ + LK  WEL+E+FY D+ +  W+ ERL+DWLA+YD +    
Sbjct  127  -----------IQGKEEKTSMLKAVWELIEVFYVDRSATWWLPERLVDWLAEYDKVLLSD  175

Query  228  HPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVK-------LLRLHGSY  70
              TVHSKVV FQ+ L  +Q  E+D  YW+ ++SAL+VGWLD VV         LR+HGSY
Sbjct  176  KDTVHSKVVSFQRKLSEIQFPEDDVAYWDAMASALSVGWLDVVVSCKTVRIAFLRMHGSY  235

Query  69   QFDQLGTREV  40
            + DQL  R+V
Sbjct  236  RLDQLDDRQV  245



>ref|XP_002976601.1| hypothetical protein SELMODRAFT_416713 [Selaginella moellendorffii]
 gb|EFJ22270.1| hypothetical protein SELMODRAFT_416713 [Selaginella moellendorffii]
Length=251

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 134/250 (54%), Gaps = 49/250 (20%)
 Frame = -1

Query  765  GLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEIDAVR  586
            GL+ P  R  +SW+ GN L+++ +                 +V E++L    GE  DA R
Sbjct  36   GLRDP-GRLWVSWSNGNQLQLSYIENAVAGGG---------RVTEIHL----GEGWDAER  81

Query  585  WRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYN-AEWSEHVMEYSKEINSLLGNPKS  409
             R++AY S+  FALLQ+++               YN  +W EHV+EYSK I S+L  P  
Sbjct  82   -RRLAYDSLPAFALLQNQRQ------------LGYNPGDWWEHVLEYSKSIRSVLDQPTQ  128

Query  408  APTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGT  229
                            E+ + LK  WEL+E+FY D+ +  W+ ERL+DWLA+YD +    
Sbjct  129  GK--------------EKTSMLKAVWELIEVFYVDRSATWWLPERLVDWLAEYDKVLLSD  174

Query  228  HPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVK-------LLRLHGSY  70
              TVHSKV  FQ+ L  +Q  E+D  YW+ ++SAL+VGWLD VV         LR+HGSY
Sbjct  175  EDTVHSKVASFQRKLSEIQFPEDDVAYWDAMASALSVGWLDVVVSCKTVRIAFLRMHGSY  234

Query  69   QFDQLGTREV  40
            + DQL  R+V
Sbjct  235  RLDQLDDRQV  244



>ref|XP_002976602.1| hypothetical protein SELMODRAFT_416715 [Selaginella moellendorffii]
 gb|EFJ22271.1| hypothetical protein SELMODRAFT_416715 [Selaginella moellendorffii]
Length=268

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 118/209 (56%), Gaps = 38/209 (18%)
 Frame = -1

Query  642  KVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYN-AEWS  466
            +V E++L    GE  DA R R++AY S+  FALLQ+++               YN  +W 
Sbjct  83   RVTEIHL----GEGWDAER-RRLAYDSLPAFALLQNQRQ------------LGYNPGDWW  125

Query  465  EHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAW  286
            EHV+EYSK I S+L  P                  E+ + LK  WEL+E+FY D+ +  W
Sbjct  126  EHVLEYSKSIRSVLDQPTQGKE-------------EKTSMLKAVWELIEVFYVDRSATWW  172

Query  285  ISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLD  106
            + ERL+DWLA YD +      TVHSKVV FQ+ L  +Q  E+D  YW+ ++SAL+VGWLD
Sbjct  173  LPERLVDWLAKYDKVLLIDEDTVHSKVVSFQRKLSEIQFPEDDAAYWDAMASALSVGWLD  232

Query  105  TVVK-------LLRLHGSYQFDQLGTREV  40
             VV         LR+HGSY+ DQL  R+V
Sbjct  233  VVVSCKTVRIAFLRMHGSYRLDQLDDRQV  261



>ref|XP_002994277.1| hypothetical protein SELMODRAFT_432209 [Selaginella moellendorffii]
 gb|EFJ04656.1| hypothetical protein SELMODRAFT_432209 [Selaginella moellendorffii]
Length=268

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 118/209 (56%), Gaps = 38/209 (18%)
 Frame = -1

Query  642  KVVELNLSNTGGEEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYN-AEWS  466
            +V E++L    GE  DA R R++AY S+  FALLQ+++               YN  +W 
Sbjct  83   RVTEIHL----GEGWDAER-RRLAYDSLPAFALLQNQRQ------------LGYNPGDWW  125

Query  465  EHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAW  286
            EHV+EYS+ I S+L  P                  E+ + LK  WEL+E+FY D+ +  W
Sbjct  126  EHVLEYSESIRSVLDQPTQGKE-------------EKTSMLKAVWELIEVFYVDRSATWW  172

Query  285  ISERLLDWLADYDSLFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLD  106
            + ERL+DWLA YD +      TVHSKVV FQ+ L  +Q  E+D  YW+ ++SAL+VGWLD
Sbjct  173  LPERLVDWLAKYDKVLLIDEDTVHSKVVSFQRKLSEIQFPEDDAAYWDAMASALSVGWLD  232

Query  105  TVVK-------LLRLHGSYQFDQLGTREV  40
             VV         LR+HGSY+ DQL  R+V
Sbjct  233  VVVSCKTVRIAFLRMHGSYRLDQLDDRQV  261



>ref|XP_001770626.1| predicted protein [Physcomitrella patens]
 gb|EDQ64609.1| predicted protein [Physcomitrella patens]
Length=742

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 133/242 (55%), Gaps = 13/242 (5%)
 Frame = -1

Query  744  RASISWARGNTLRVTLLRK-------PapddagggdseagGKVVELNLSNTGGEEIDAVR  586
            R  +SW  GNTLR++ L +            +      A G+VVE+ L     + +    
Sbjct  39   RVLVSWGPGNTLRLSYLPQVVRDGDDDMKISSSREGDAANGQVVEVKLGKKDDQPL--AE  96

Query  585  WRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVMEYSKEINSLLGNPKSA  406
             R +AY S   FALLQ++K  M  L      S     +W + V+EYS+ I++ LG     
Sbjct  97   KRALAYSSAQAFALLQNQKQQM--LQSDGGSSRTGTFDWWQAVLEYSQIISATLGPASGP  154

Query  405  PTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGTH  226
            P S  +      K   +PT +K  W+L+E+FY DK   +W+ ERL++WLA YD++ S   
Sbjct  155  PGSATDFSGFPTKASTKPTTVKAIWDLVEIFYVDKNGASWLPERLVEWLASYDAVLSSN-  213

Query  225  PTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTR  46
             T+H+K+   Q+ LV L+  E + +YW+ ++SALAVGWLD  V LLR+HGSYQ DQ+  R
Sbjct  214  -TLHTKLTKLQQRLVNLRFPEEEKEYWDGVASALAVGWLDIAVYLLRMHGSYQHDQIDNR  272

Query  45   EV  40
             V
Sbjct  273  NV  274



>ref|XP_002976603.1| hypothetical protein SELMODRAFT_416717 [Selaginella moellendorffii]
 gb|EFJ22272.1| hypothetical protein SELMODRAFT_416717 [Selaginella moellendorffii]
Length=285

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 130/250 (52%), Gaps = 51/250 (20%)
 Frame = -1

Query  765  GLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLSNTGGEEIDAVR  586
            GL+ P  R  +SW+ GN L+++ +                 +V E++L    GE  DA R
Sbjct  72   GLRDP-GRLWVSWSNGNQLQLSYIENAVGGGG---------RVTEIHL----GEGWDAER  117

Query  585  WRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYN-AEWSEHVMEYSKEINSLLGNPKS  409
                 + S+  FALLQ+++               YN  +W EHV+EYSK I+S+L  P  
Sbjct  118  ----RHDSLPAFALLQNQRQ------------LGYNPGDWWEHVLEYSKSIHSVLDQPTQ  161

Query  408  APTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADKQSQAWISERLLDWLADYDSLFSGT  229
                            E+ +  K  WEL+E+FY D+ +  W+ E L+DWLA+YD +    
Sbjct  162  GKG-------------EKTSMFKAVWELIEVFYVDRSATWWLPECLVDWLAEYDEVLFSD  208

Query  228  HPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSALAVGWLDTV-------VKLLRLHGSY  70
              TVHSKVV FQ+ L  +Q  E+D  +W+ ++SAL+VGWLD V       +  LR+HGSY
Sbjct  209  EDTVHSKVVSFQRKLSEIQFPEDDVAFWDAMASALSVGWLDVVGSCKTVRIAFLRMHGSY  268

Query  69   QFDQLGTREV  40
            + DQL  R+V
Sbjct  269  RLDQLDHRQV  278



>ref|XP_002976604.1| hypothetical protein SELMODRAFT_416720 [Selaginella moellendorffii]
 gb|EFJ22273.1| hypothetical protein SELMODRAFT_416720 [Selaginella moellendorffii]
Length=173

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 88/158 (56%), Gaps = 23/158 (15%)
 Frame = -1

Query  480  NAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADK  301
              +W EHV+EYSK I S+   P               KE E  + LK  WEL+E+FY D+
Sbjct  23   TGDWWEHVLEYSKSIRSVFDQPTQG------------KE-ENTSMLKAVWELIEVFYVDR  69

Query  300  QSQAWISERLLDWLADYDSL---FSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSS  130
             +  W+ ER +DWLA   S+         TVHSKVV FQ+ L  +Q  E+D  YW+ ++S
Sbjct  70   SATWWLPERFVDWLALCRSMTKVLLSDEDTVHSKVVSFQRKLSEIQFPEDDVAYWDAMAS  129

Query  129  ALAVGWLDTVVK-------LLRLHGSYQFDQLGTREVG  37
            AL+VGWLD VV         LR+HGSY+ DQL  R+V 
Sbjct  130  ALSVGWLDVVVSWKTVRIAFLRMHGSYRLDQLDDRQVS  167



>ref|XP_002994497.1| hypothetical protein SELMODRAFT_432414 [Selaginella moellendorffii]
 gb|EFJ04439.1| hypothetical protein SELMODRAFT_432414 [Selaginella moellendorffii]
Length=173

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 89/158 (56%), Gaps = 23/158 (15%)
 Frame = -1

Query  480  NAEWSEHVMEYSKEINSLLGNPKSAPTSVIEDPKAVLKEVEEPTCLKGAWELMEMFYADK  301
              +W EHV+EYSK I S+L  P               KE E  + LK  WEL+E+FY D+
Sbjct  23   TGDWWEHVLEYSKSIRSVLDQPTQG------------KE-ENTSMLKAVWELIEVFYVDR  69

Query  300  QSQAWISERLLDWLADYDSL---FSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSS  130
             +  W+ ERL+DWLA   S+         TVHSKV+ FQ+ L  +Q  E+D  YW+ ++S
Sbjct  70   SATWWLPERLVDWLALCRSMTKVLLSDEDTVHSKVLSFQRKLSEIQFPEDDVAYWDAMAS  129

Query  129  ALAVGWLDTVVK-------LLRLHGSYQFDQLGTREVG  37
            AL+VGWLD VV         LR+HGSY+ DQL   +V 
Sbjct  130  ALSVGWLDVVVSWKTVRIAFLRMHGSYRLDQLDDWQVS  167



>gb|KEH39708.1| Nup85 nucleoporin protein [Medicago truncatula]
Length=526

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -1

Query  177  LQTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFDQLGTREV  40
            L  IE+DP+YWEV+SSAL+VGWLD VVK+LRLHGSYQ DQL  RE+
Sbjct  35   LFVIEDDPRYWEVMSSALSVGWLDIVVKMLRLHGSYQLDQLSNREL  80



>ref|XP_007161496.1| hypothetical protein PHAVU_001G074000g [Phaseolus vulgaris]
 gb|ESW33490.1| hypothetical protein PHAVU_001G074000g [Phaseolus vulgaris]
Length=527

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 8/67 (12%)
 Frame = -1

Query  219  VHSKVVDFQKDLVAL-------QTIENDPKYWEVLSSALAVGWLDTVVKLLRLHGSYQFD  61
            VH ++  F  DL+ L       + IE+DP+YW++LSSAL+VGWLD VVK+LRLHGSYQ D
Sbjct  17   VHHRL-GFCLDLLELRKKEKRGKVIEDDPRYWDLLSSALSVGWLDIVVKMLRLHGSYQLD  75

Query  60   QLGTREV  40
            QL  RE+
Sbjct  76   QLSNREL  82



>ref|XP_008804615.1| PREDICTED: nuclear pore complex protein Nup85-like [Phoenix dactylifera]
Length=177

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 69/145 (48%), Gaps = 17/145 (12%)
 Frame = -1

Query  774  LRHGLKPPIHRASISWARGNTLRVTLLRKPapddagggdseagGKVVELNLS----NTGG  607
            +R G+ PPI    +SW RGN L+V  LR PAPD AG GD     + V   +       G 
Sbjct  27   VRLGVNPPIFHVFVSWTRGNLLQVACLRPPAPDPAGCGDDGVSDEEVVGKVVEVTLGAGD  86

Query  606  EEIDAVRWRKIAYGSVTPFALLQSRKNSMAALSKMSLDSPPYNAEWSEHVM-----EYSK  442
             EI   + R+IAYG V  FALLQ  +     L  + +        +  H M       S 
Sbjct  87   GEIGEAQRRRIAYGPVAAFALLQLEEFPRGYLQNVCV--------FDSHRMVGTCFGVSC  138

Query  441  EINSLLGNPKSAPTSVIEDPKAVLK  367
             IN  LG P+   ++V+EDP+  L+
Sbjct  139  HINDFLGTPRLPSSTVVEDPRMFLQ  163



>ref|XP_011019607.1| PREDICTED: nuclear pore complex protein NUP85 [Populus euphratica]
Length=88

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  243  LFSGTHPTVHSKVVDFQKDLVALQTIENDPKYWEVLSSA  127
            L  G   TVHSK+V+FQ  LVALQ IE+DPKYWEV+ S 
Sbjct  24   LVGGDQLTVHSKLVEFQGKLVALQVIEDDPKYWEVILSG  62



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2121035180950