BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14127_g1_i2 len=1457 path=[1:0-1057 1059:1058-1456]

Length=1457
                                                                      Score     E

ref|XP_009792762.1|  PREDICTED: uncharacterized protein LOC104239...    559   0.0      
ref|XP_004248191.1|  PREDICTED: uncharacterized protein LOC101245590    554   0.0      
ref|XP_006364102.1|  PREDICTED: uncharacterized protein LOC102586362    553   0.0      
ref|XP_009626511.1|  PREDICTED: uncharacterized protein LOC104117204    553   0.0      
gb|AAR28998.1|  CMV 1a interacting protein 1                            551   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009792763.1|  PREDICTED: uncharacterized protein LOC104239...    541   0.0      
gb|EYU30785.1|  hypothetical protein MIMGU_mgv1a008621mg                514   2e-177   
ref|XP_003607569.1|  Menaquinone biosynthesis methyltransferase ubiE    511   5e-176   
emb|CAN60805.1|  hypothetical protein VITISV_020683                     509   5e-176   Vitis vinifera
ref|XP_004505506.1|  PREDICTED: uncharacterized protein LOC101513404    511   6e-176   
ref|XP_004505505.1|  PREDICTED: uncharacterized protein LOC101512...    510   1e-175   
emb|CBI21965.3|  unnamed protein product                                509   2e-175   
gb|ACJ85067.1|  unknown                                                 507   2e-174   Medicago truncatula
ref|XP_011015846.1|  PREDICTED: uncharacterized protein LOC105119406    504   3e-173   
ref|XP_011002521.1|  PREDICTED: uncharacterized protein LOC105109497    504   3e-173   
ref|XP_010035844.1|  PREDICTED: uncharacterized protein LOC104424986    504   5e-173   
gb|EPS72916.1|  hypothetical protein M569_01837                         499   2e-171   
ref|XP_002325578.1|  hypothetical protein POPTR_0019s11940g             498   9e-171   Populus trichocarpa [western balsam poplar]
ref|XP_010689878.1|  PREDICTED: uncharacterized protein LOC104903...    498   1e-170   
ref|XP_004505504.1|  PREDICTED: uncharacterized protein LOC101512...    496   2e-169   
gb|KDP31787.1|  hypothetical protein JCGZ_12248                         493   5e-169   
ref|XP_007048668.1|  S-adenosyl-L-methionine-dependent methyltran...    492   2e-168   
ref|XP_006446768.1|  hypothetical protein CICLE_v10015734mg             488   5e-167   
gb|KHG04685.1|  Malonyl-CoA O-methyltransferase BioC                    487   2e-166   
ref|XP_007132899.1|  hypothetical protein PHAVU_011G134400g             486   3e-166   
gb|KHN07753.1|  Demethylmenaquinone methyltransferase                   483   8e-166   
ref|XP_009396994.1|  PREDICTED: uncharacterized protein LOC103981...    484   4e-165   
gb|KHN09219.1|  Demethylmenaquinone methyltransferase                   483   8e-165   
ref|XP_003539964.1|  PREDICTED: uncharacterized protein LOC100788294    482   1e-164   
ref|XP_010279097.1|  PREDICTED: uncharacterized protein LOC104613100    482   2e-164   
ref|XP_003527390.1|  PREDICTED: uncharacterized protein LOC100785497    482   2e-164   
gb|ABB46958.2|  CMV 1a interacting protein 1, putative, expressed       480   7e-164   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064252.1|  Os10g0181600                                       480   8e-164   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66646.1|  hypothetical protein OsI_32910                          479   2e-163   Oryza sativa Indica Group [Indian rice]
ref|XP_002468229.1|  hypothetical protein SORBIDRAFT_01g042150          476   2e-162   Sorghum bicolor [broomcorn]
ref|XP_006662228.1|  PREDICTED: uncharacterized protein LOC102700742    476   2e-162   
ref|XP_006828793.1|  hypothetical protein AMTR_s00001p00117690          476   3e-162   
gb|KHN07754.1|  Demethylmenaquinone methyltransferase                   473   8e-162   
ref|XP_003527391.1|  PREDICTED: uncharacterized protein LOC100786025    474   3e-161   
ref|XP_004983347.1|  PREDICTED: uncharacterized protein LOC101786...    471   2e-160   
ref|XP_008456428.1|  PREDICTED: uncharacterized protein LOC103496371    467   8e-159   
ref|NP_001150888.1|  CMV 1a interacting protein 1                       467   1e-158   Zea mays [maize]
gb|AFW68873.1|  CMV 1a interacting protein 1                            466   2e-158   
gb|KGN47274.1|  hypothetical protein Csa_6G241450                       461   5e-156   
ref|XP_004150323.1|  PREDICTED: uncharacterized protein LOC101215871    460   7e-156   
ref|XP_004171483.1|  PREDICTED: uncharacterized LOC101215871            459   8e-156   
ref|XP_003573821.1|  PREDICTED: uncharacterized protein LOC100842468    459   3e-155   
ref|XP_004983346.1|  PREDICTED: uncharacterized protein LOC101786...    456   6e-154   
dbj|BAJ90190.1|  predicted protein                                      453   3e-153   
gb|ABK26289.1|  unknown                                                 454   4e-153   Picea sitchensis
ref|XP_008643783.1|  PREDICTED: CMV 1a interacting protein 1 isof...    448   2e-151   
emb|CDP15918.1|  unnamed protein product                                431   4e-145   
emb|CDP15915.1|  unnamed protein product                                427   2e-143   
gb|EYU30786.1|  hypothetical protein MIMGU_mgv1a008621mg                417   7e-140   
gb|AAK70623.1|AC091238_1  Unknown protein                               413   4e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011098030.1|  PREDICTED: uncharacterized protein LOC105176814    420   5e-137   
ref|XP_010689879.1|  PREDICTED: uncharacterized protein LOC104903...    403   4e-135   
ref|XP_002280009.3|  PREDICTED: uncharacterized protein LOC100245387    413   3e-134   Vitis vinifera
ref|XP_001782124.1|  predicted protein                                  402   3e-133   
ref|XP_009396995.1|  PREDICTED: uncharacterized protein LOC103981...    397   1e-131   
ref|XP_006469031.1|  PREDICTED: uncharacterized protein LOC102611255    392   2e-126   
ref|NP_001168523.1|  uncharacterized protein LOC100382303               379   1e-125   Zea mays [maize]
ref|XP_002987852.1|  hypothetical protein SELMODRAFT_126718             378   9e-124   
ref|XP_002993775.1|  hypothetical protein SELMODRAFT_137556             371   3e-121   
gb|KDO63335.1|  hypothetical protein CISIN_1g048398mg                   343   1e-111   
ref|XP_006446769.1|  hypothetical protein CICLE_v10015734mg             343   2e-111   
gb|AFK44059.1|  unknown                                                 335   4e-109   
gb|ACN34935.1|  unknown                                                 315   2e-101   Zea mays [maize]
gb|EMS47184.1|  hypothetical protein TRIUR3_15391                       308   1e-98    
ref|XP_003082466.1|  CMV 1a interacting protein 1 (ISS)                 298   1e-92    
emb|CDP22262.1|  unnamed protein product                                289   5e-91    
ref|XP_008673835.1|  PREDICTED: LOW QUALITY PROTEIN: 2-methoxy-6-...    288   6e-91    
ref|XP_006582768.1|  PREDICTED: 2-methoxy-6-polyprenyl-1,4-benzoq...    288   1e-90    
ref|XP_001420871.1|  predicted protein                                  290   9e-90    Ostreococcus lucimarinus CCE9901
gb|AFK47519.1|  unknown                                                 280   1e-87    
ref|XP_002499845.1|  CMV 1a interacting protein 1                       282   8e-87    Micromonas commoda
ref|XP_005645620.1|  S-adenosyl-L-methionine-dependent methyltran...    292   2e-86    
ref|WP_015139374.1|  methylase                                          278   9e-86    
ref|WP_039726564.1|  methyltransferase type 11                          278   1e-85    
ref|WP_010997189.1|  methyltransferase type 11                          278   1e-85    
ref|WP_017711872.1|  hypothetical protein                               278   1e-85    
ref|WP_026736377.1|  methyltransferase type 11                          276   5e-85    
ref|WP_011317726.1|  methyltransferase type 11                          275   2e-84    
ref|XP_007511288.1|  predicted protein                                  274   1e-83    
ref|WP_012307394.1|  methyltransferase type 11                          273   1e-83    
ref|WP_036477770.1|  methyltransferase type 11                          272   2e-83    
ref|WP_012629073.1|  methyltransferase type 11                          272   3e-83    
ref|WP_015195860.1|  type 11 methyltransferase                          271   6e-83    
ref|WP_017661081.1|  hypothetical protein                               271   7e-83    
ref|WP_030006346.1|  methyltransferase type 11                          270   1e-82    
ref|WP_019506330.1|  hypothetical protein                               270   2e-82    
ref|WP_008312293.1|  methylase involved in ubiquinone/menaquinone...    270   2e-82    
ref|WP_024546396.1|  methyltransferase type 11                          270   2e-82    
ref|WP_006619102.1|  methyltransferase type 11                          269   4e-82    
ref|WP_016870021.1|  methyltransferase type 11                          268   9e-82    
ref|XP_005850400.1|  hypothetical protein CHLNCDRAFT_50738              268   1e-81    
ref|WP_017290335.1|  methyltransferase type 11                          267   2e-81    
ref|WP_019492255.1|  methyltransferase type 11                          267   2e-81    
ref|WP_026719287.1|  methyltransferase type 11                          266   3e-81    
ref|WP_036012284.1|  methyltransferase type 11                          267   3e-81    
ref|WP_009782151.1|  methyltransferase type 11                          266   6e-81    
ref|WP_006623621.1|  MULTISPECIES: methyltransferase type 11            265   8e-81    
ref|WP_015135034.1|  type 11 methyltransferase                          265   8e-81    
ref|WP_038080437.1|  methyltransferase type 11                          265   1e-80    
ref|WP_016864390.1|  methyltransferase type 11                          264   2e-80    
ref|WP_027846301.1|  methyltransferase type 11                          264   3e-80    
ref|WP_015785346.1|  methyltransferase type 11                          263   4e-80    
ref|WP_015957408.1|  methyltransferase type 11                          263   7e-80    
ref|WP_009459356.1|  MULTISPECIES: methyltransferase type 11            262   1e-79    
ref|WP_015112774.1|  type 11 methyltransferase                          262   1e-79    
ref|WP_006509471.1|  methylase involved in ubiquinone/menaquinone...    263   1e-79    
ref|WP_017297188.1|  hypothetical protein                               261   2e-79    
ref|WP_008177988.1|  methyltransferase type 11                          261   3e-79    
ref|WP_009784338.1|  methyltransferase type 11                          261   3e-79    
ref|WP_013192499.1|  methyltransferase type 11                          261   5e-79    
ref|WP_026786296.1|  methyltransferase type 11                          261   5e-79    
gb|KEI68914.1|  Ubiquinone/menaquinone biosynthesis methyltransfe...    261   5e-79    
ref|WP_015217053.1|  Methyltransferase type 11                          260   6e-79    
ref|WP_015149087.1|  methylase                                          260   7e-79    
ref|WP_015190107.1|  Methyltransferase type 11                          259   9e-79    
ref|WP_036833270.1|  methyltransferase type 11                          259   3e-78    
ref|WP_036842508.1|  methyltransferase type 11                          258   3e-78    
ref|WP_026793351.1|  MULTISPECIES: methyltransferase type 11            258   3e-78    
ref|WP_027254655.1|  methyltransferase type 11                          258   4e-78    
ref|WP_026797961.1|  methyltransferase type 11                          258   7e-78    
ref|WP_023068497.1|  methyltransferase domain protein                   257   1e-77    
ref|WP_023068644.1|  ubiE/COQ5 methyltransferase family protein         256   2e-77    
ref|WP_016858521.1|  methyltransferase type 11                          256   3e-77    
ref|WP_013325384.1|  methyltransferase type 11                          255   4e-77    
ref|WP_027248784.1|  methyltransferase type 11                          255   5e-77    
gb|KEI66782.1|  Ubiquinone/menaquinone biosynthesis methyltransfe...    256   5e-77    
ref|WP_009459965.1|  MULTISPECIES: methyltransferase type 11            254   8e-77    
ref|WP_016868626.1|  methyltransferase type 11                          254   2e-76    
ref|WP_026785596.1|  methyltransferase type 11                          254   2e-76    
ref|WP_006529401.1|  methylase involved in ubiquinone/menaquinone...    254   2e-76    
ref|WP_015206026.1|  methylase involved in ubiquinone/menaquinone...    253   2e-76    
ref|WP_007354559.1|  MULTISPECIES: methyltransferase type 11            253   3e-76    
ref|WP_013334559.1|  methyltransferase type 11                          252   9e-76    
ref|WP_015138585.1|  methylase                                          251   1e-75    
ref|WP_026796279.1|  methyltransferase type 11                          251   1e-75    
ref|WP_026723064.1|  methyltransferase type 11                          251   1e-75    
ref|WP_017651933.1|  methyltransferase type 11                          251   2e-75    
ref|XP_002525119.1|  Adaptin ear-binding coat-associated protein,...    258   2e-75    Ricinus communis
ref|WP_006198202.1|  methyltransferase type 11                          251   3e-75    
ref|WP_012164401.1|  methyltransferase type 11                          251   3e-75    
ref|WP_035992450.1|  methyltransferase type 11                          251   3e-75    
ref|WP_010472917.1|  methyltransferase type 11                          251   4e-75    
ref|WP_015200982.1|  type 11 methyltransferase                          250   4e-75    
ref|WP_008274501.1|  methyltransferase type 11                          250   8e-75    
ref|WP_015143974.1|  methylase                                          249   1e-74    
ref|WP_017308856.1|  methyltransferase type 11                          248   2e-74    
ref|WP_035157188.1|  methyltransferase type 11                          248   2e-74    
ref|WP_012597070.1|  methyltransferase type 11                          248   4e-74    
ref|WP_016879044.1|  methyltransferase type 11                          248   4e-74    
ref|WP_026734363.1|  methyltransferase type 11                          247   8e-74    
ref|WP_009547805.1|  MULTISPECIES: methyltransferase type 11            247   9e-74    
ref|WP_006616870.1|  methyltransferase type 11                          246   1e-73    
ref|WP_014277197.1|  hypothetical protein                               246   1e-73    
ref|WP_015784950.1|  methyltransferase type 11                          246   1e-73    
ref|WP_019489134.1|  methyltransferase type 11                          246   2e-73    
ref|WP_015129944.1|  type 11 methyltransferase                          246   2e-73    
ref|WP_019500193.1|  hypothetical protein                               246   2e-73    
ref|WP_016953434.1|  methyltransferase type 11                          245   5e-73    
ref|WP_039752269.1|  methyltransferase type 11                          244   5e-73    
ref|WP_011319866.1|  methyltransferase type 11                          244   7e-73    
ref|WP_006625035.1|  MULTISPECIES: methyltransferase type 11            244   8e-73    
ref|WP_017322048.1|  methyltransferase type 11                          243   2e-72    
ref|WP_038087080.1|  methyltransferase type 11                          243   4e-72    
ref|WP_010996243.1|  methyltransferase type 11                          242   6e-72    
ref|WP_015148229.1|  methylase                                          241   9e-72    
ref|WP_015121590.1|  methylase                                          240   2e-71    
ref|WP_015175324.1|  Methyltransferase type 11                          240   3e-71    
ref|WP_027843812.1|  methyltransferase type 11                          240   3e-71    
ref|WP_015226513.1|  type 11 methyltransferase                          240   4e-71    
ref|WP_015113628.1|  type 11 methyltransferase                          239   6e-71    
ref|WP_007306809.1|  methyltransferase type 11                          239   8e-71    
ref|WP_021833434.1|  hypothetical protein                               239   9e-71    
ref|WP_006098440.1|  methyltransferase type 11                          239   1e-70    
ref|WP_021831023.1|  hypothetical protein                               239   1e-70    
ref|WP_029638148.1|  methyltransferase type 11 [                        238   1e-70    
ref|WP_015193439.1|  Methyltransferase type 11                          238   1e-70    
ref|WP_009344078.1|  methyltransferase type 11                          238   2e-70    
ref|WP_012409340.1|  methyltransferase type 11                          238   2e-70    
ref|WP_010477816.1|  methyltransferase type 11                          238   2e-70    
ref|WP_006632690.1|  methyltransferase type 11                          238   2e-70    
ref|WP_026099878.1|  methyltransferase type 11                          238   3e-70    
ref|WP_013192336.1|  methyltransferase type 11                          237   4e-70    
ref|WP_015166468.1|  type 11 methyltransferase                          237   7e-70    
ref|WP_012626190.1|  methyltransferase type 11                          235   2e-69    
ref|WP_035150741.1|  methyltransferase type 11                          235   3e-69    
ref|WP_017317911.1|  methyltransferase type 11                          235   3e-69    
ref|WP_007307752.1|  methyltransferase type 11                          234   6e-69    
ref|WP_007312806.1|  methyltransferase type 11                          234   7e-69    
ref|WP_021830996.1|  hypothetical protein                               234   8e-69    
ref|WP_019507106.1|  hypothetical protein                               234   9e-69    
ref|WP_015215491.1|  Methyltransferase type 11                          233   1e-68    
ref|WP_017744239.1|  methyltransferase type 11                          233   1e-68    
dbj|BAJ88688.1|  predicted protein                                      232   1e-68    
ref|WP_008276030.1|  methyltransferase type 11                          233   2e-68    
ref|WP_012161686.1|  methyltransferase type 11                          233   2e-68    
ref|WP_006276903.1|  methyltransferase type 11                          233   2e-68    
ref|WP_036008702.1|  methyltransferase type 11                          232   3e-68    
ref|WP_009556100.1|  methylase involved in ubiquinone/menaquinone...    232   4e-68    
ref|WP_039713026.1|  methyltransferase type 11                          232   4e-68    
ref|WP_017299303.1|  hypothetical protein                               233   5e-68    
ref|WP_015954613.1|  methyltransferase type 11                          232   5e-68    
ref|WP_011612473.1|  methyltransferase type 11                          231   9e-68    
ref|WP_015202475.1|  type 11 methyltransferase                          230   2e-67    
ref|WP_028089869.1|  methyltransferase type 11                          230   2e-67    
ref|WP_015166964.1|  methylase                                          229   2e-67    
ref|WP_017715750.1|  hypothetical protein                               229   3e-67    
ref|XP_005846678.1|  hypothetical protein CHLNCDRAFT_35970              231   3e-67    
ref|WP_009628996.1|  Methyltransferase type 11                          229   4e-67    
ref|WP_028954313.1|  methyltransferase type 11                          229   5e-67    
ref|WP_027403064.1|  methyltransferase type 11                          229   5e-67    
ref|WP_015157482.1|  type 11 methyltransferase                          229   6e-67    
ref|WP_028083080.1|  methyltransferase type 11                          229   7e-67    
dbj|GAL92902.1|  hypothetical protein N44_01589                         228   8e-67    
ref|WP_024750299.1|  methyltransferase type 11                          228   9e-67    
gb|AFW68876.1|  hypothetical protein ZEAMMB73_796332                    223   1e-66    
ref|WP_037224344.1|  methyltransferase type 11                          228   1e-66    
ref|WP_008315062.1|  methylase involved in ubiquinone/menaquinone...    229   2e-66    
ref|WP_009546876.1|  methyltransferase type 11                          228   2e-66    
ref|WP_024544740.1|  methyltransferase type 11                          227   4e-66    
ref|WP_018396185.1|  hypothetical protein                               227   4e-66    
emb|CDN16863.1|  SAM (and some other nucleotide) binding motif:Ge...    228   4e-66    
ref|WP_011143466.1|  methyltransferase type 11                          226   5e-66    
ref|WP_002744668.1|  methyltransferase domain protein                   226   5e-66    
ref|WP_002736498.1|  methyltransferase type 11                          226   9e-66    
ref|WP_002767286.1|  methyltransferase type 11                          226   1e-65    
ref|WP_017290444.1|  hypothetical protein                               225   1e-65    
ref|WP_002803544.1|  methyltransferase type 11                          225   1e-65    
ref|WP_008203012.1|  methyltransferase type 11                          225   2e-65    
ref|WP_002783982.1|  Genome sequencing data, contig C301                225   2e-65    
ref|WP_036480685.1|  methyltransferase type 11                          224   2e-65    
ref|WP_022603788.1|  methylase involved in ubiquinone/menaquinone...    224   3e-65    
ref|WP_002757824.1|  methyltransferase type 11                          224   5e-65    
ref|WP_002795667.1|  methyltransferase type 11                          223   7e-65    
ref|WP_012265085.1|  methyltransferase type 11                          223   7e-65    
ref|WP_002789851.1|  methyltransferase type 11                          223   9e-65    
gb|EDX86634.1|  Methyltransferase domain family                         223   1e-64    Synechococcus sp. PCC 7335
ref|WP_038016107.1|  methyltransferase type 11                          224   1e-64    
ref|WP_021835782.1|  hypothetical protein                               222   2e-64    
gb|EHJ11327.1|  hypothetical protein CWATWH0003_3931                    222   2e-64    
ref|WP_015171516.1|  type 11 methyltransferase                          221   6e-64    
ref|WP_011378292.1|  methyltransferase type 11                          221   7e-64    
ref|WP_011244349.1|  methyltransferase type 11                          221   8e-64    
ref|WP_006509897.1|  methylase involved in ubiquinone/menaquinone...    220   1e-63    
ref|WP_015220798.1|  type 11 methyltransferase                          220   1e-63    
ref|XP_002958397.1|  hypothetical protein VOLCADRAFT_84448              219   1e-63    
dbj|BAM50260.1|  hypothetical protein BEST7613_1329                     220   1e-63    
ref|WP_030006863.1|  methyltransferase type 11                          219   2e-63    
ref|WP_010874343.1|  methyltransferase type 11                          220   3e-63    
gb|AIE75315.1|  hypothetical protein D082_27870                         219   7e-63    
ref|WP_012307957.1|  methyltransferase type 11                          218   1e-62    
ref|WP_008234722.1|  hypothetical protein                               216   4e-62    
tpg|DAA53897.1|  TPA: hypothetical protein ZEAMMB73_149801              218   1e-61    
gb|KHN09216.1|  hypothetical protein glysoja_036444                     211   3e-61    
ref|WP_015158202.1|  methylase involved in ubiquinone/menaquinone...    214   3e-61    
ref|WP_006515884.1|  methylase involved in ubiquinone/menaquinone...    210   1e-59    
ref|WP_017324038.1|  hypothetical protein                               209   2e-59    
ref|WP_015133012.1|  type 11 methyltransferase                          207   8e-59    
ref|WP_017306242.1|  hypothetical protein                               207   1e-58    
ref|WP_015221408.1|  type 11 methyltransferase                          207   1e-58    
ref|WP_007099125.1|  SAM-dependent methyltransferase                    207   1e-58    
tpg|DAA60693.1|  TPA: hypothetical protein ZEAMMB73_608833              207   2e-58    
ref|WP_023071132.1|  hypothetical protein                               204   3e-57    
ref|XP_002968820.1|  hypothetical protein SELMODRAFT_90177              203   4e-57    
ref|WP_017293259.1|  hypothetical protein                               203   5e-57    
ref|XP_001764443.1|  predicted protein                                  202   8e-57    
ref|WP_038552669.1|  SAM-dependent methyltransferase                    200   7e-56    
gb|AII48318.1|  SAM-dependent methyltransferase                         200   8e-56    
ref|WP_038547138.1|  SAM-dependent methyltransferase                    197   6e-55    
ref|WP_015109123.1|  methylase                                          196   4e-54    
ref|WP_006172662.1|  SAM-dependent methyltransferase                    195   5e-54    
ref|XP_005652307.1|  S-adenosyl-L-methionine-dependent methyltran...    194   1e-53    
gb|EWM28201.1|  methyltransferase type 11                               196   1e-53    
ref|WP_006854013.1|  SAM-dependent methyltransferase                    194   1e-53    
ref|WP_028952990.1|  SAM-dependent methyltransferase                    194   1e-53    
ref|WP_006909764.1|  SAM-dependent methyltransferase                    194   2e-53    
gb|AII46326.1|  SAM-dependent methyltransferase                         193   2e-53    
ref|WP_011934187.1|  SAM-dependent methyltransferase                    192   8e-53    
ref|WP_011936681.1|  SAM-dependent methyltransferase                    192   1e-52    
ref|WP_011620526.1|  SAM-dependent methyltransferase                    191   1e-52    
ref|XP_005848081.1|  hypothetical protein CHLNCDRAFT_35272              191   3e-52    
ref|WP_006042989.1|  SAM-dependent methyltransferase                    190   4e-52    
ref|WP_021833537.1|  hypothetical protein                               185   6e-51    
gb|KEF40854.1|  SAM-dependent methyltransferase                         187   7e-51    
ref|WP_035833704.1|  SAM-dependent methyltransferase                    186   1e-50    
ref|XP_003055307.1|  predicted protein                                  181   2e-50    
ref|XP_001696599.1|  hypothetical protein CHLREDRAFT_126738             184   7e-50    
gb|AFW75746.1|  hypothetical protein ZEAMMB73_594819                    186   8e-50    
ref|XP_005538504.1|  hypothetical protein, conserved                    182   2e-48    
ref|WP_011129134.1|  SAM-dependent methyltransferase                    180   2e-48    
ref|XP_002950151.1|  hypothetical protein VOLCADRAFT_90465              181   6e-48    
emb|CBJ30227.1|  Methyltransferase type 11                              177   2e-46    
gb|EEC66645.1|  hypothetical protein OsI_32909                          165   7e-45    
gb|AFW68874.1|  hypothetical protein ZEAMMB73_796332                    157   9e-42    
ref|XP_002506444.1|  predicted protein                                  162   1e-41    
ref|XP_005537574.1|  similar to bacterial putative methyl transfe...    166   2e-41    
ref|XP_003062065.1|  predicted protein                                  160   3e-41    
emb|CBN78409.1|  SAM-dependent methyltransferases                       158   1e-39    
emb|CBJ49027.1|  conserved unknown protein                              149   4e-36    
gb|EPF23641.1|  hypothetical protein MAESPC_01139                       139   3e-35    
gb|AFG57842.1|  hypothetical protein 0_2107_01                          135   8e-35    
emb|CBJ29946.1|  conserved unknown protein                              142   1e-34    
gb|AFG57837.1|  hypothetical protein 0_2107_01                          133   5e-34    
ref|XP_002536231.1|  conserved hypothetical protein                     130   1e-32    
ref|WP_015148945.1|  methylase                                          132   3e-31    
ref|XP_002290336.1|  predicted protein                                  126   1e-28    
gb|EJK77418.1|  hypothetical protein THAOC_00753                        125   2e-28    
ref|WP_009783604.1|  methyltransferase type 11                          120   3e-27    
ref|XP_002183321.1|  predicted protein                                  118   3e-27    
ref|WP_023066737.1|  methyltransferase domain protein                   119   7e-27    
ref|WP_007353343.1|  MULTISPECIES: methyltransferase type 11            119   1e-26    
ref|WP_015181633.1|  methylase                                          117   5e-26    
ref|WP_015229583.1|  methylase                                          116   6e-26    
ref|WP_035404462.1|  hypothetical protein                               114   2e-25    
ref|WP_036006788.1|  methyltransferase type 11                          114   2e-25    
emb|CDP15917.1|  unnamed protein product                                108   2e-25    
ref|XP_005778842.1|  hypothetical protein EMIHUDRAFT_205436             116   3e-25    
ref|WP_039714146.1|  methyltransferase type 11                          114   3e-25    
ref|WP_017322109.1|  methyltransferase type 11                          114   3e-25    
ref|WP_015225343.1|  type 11 methyltransferase                          114   4e-25    
ref|WP_010997677.1|  methyltransferase type 11                          113   9e-25    
ref|WP_015155584.1|  type 11 methyltransferase                          113   1e-24    
emb|CDP15914.1|  unnamed protein product                                107   2e-24    
ref|XP_005782468.1|  hypothetical protein EMIHUDRAFT_55170              112   2e-24    
ref|WP_017654251.1|  hypothetical protein                               112   3e-24    
ref|WP_038021251.1|  methyltransferase type 11                          111   4e-24    
ref|WP_006102338.1|  methyltransferase type 11                          111   4e-24    
ref|WP_039725510.1|  methyltransferase type 11                          111   5e-24    
ref|WP_017287944.1|  hypothetical protein                               110   1e-23    
ref|WP_013321950.1|  methyltransferase type 11                          109   2e-23    
ref|WP_009457216.1|  MULTISPECIES: methyltransferase type 11            109   2e-23    
ref|WP_036616355.1|  methyltransferase type 11                          108   3e-23    
ref|WP_038088770.1|  methyltransferase type 11                          109   3e-23    
gb|EKQ69231.1|  methylase involved in ubiquinone/menaquinone bios...    108   4e-23    
ref|WP_016878109.1|  hypothetical protein                               108   4e-23    
ref|WP_008188920.1|  methyltransferase type 11                          107   8e-23    
ref|WP_015210080.1|  methylase involved in ubiquinone/menaquinone...    107   1e-22    
ref|WP_015191042.1|  Methyltransferase type 11                          107   1e-22    
ref|WP_026731339.1|  methyltransferase type 11                          107   2e-22    
ref|WP_018397089.1|  hypothetical protein                               106   2e-22    
ref|WP_017745810.1|  methyltransferase type 11                          106   2e-22    
ref|WP_006345282.1|  type 11 methyltransferase                          107   3e-22    
ref|WP_015194309.1|  Methyltransferase type 11                          106   3e-22    
ref|WP_015127635.1|  type 11 methyltransferase                          106   3e-22    
ref|WP_035153649.1|  methyltransferase type 11                          105   4e-22    
ref|WP_016870455.1|  methyltransferase type 11                          106   4e-22    
ref|WP_019508972.1|  hypothetical protein                               105   5e-22    
ref|WP_036478011.1|  methyltransferase type 11                          105   5e-22    
ref|WP_022608611.1|  methylase involved in ubiquinone/menaquinone...    105   5e-22    
ref|WP_016873395.1|  methyltransferase type 11                          105   6e-22    
ref|WP_033374868.1|  methyltransferase type 11                          105   6e-22    
ref|WP_026722834.1|  methyltransferase type 11                          105   8e-22    
ref|WP_011613751.1|  type 11 methyltransferase                          104   9e-22    
ref|WP_015160417.1|  methylase involved in ubiquinone/menaquinone...    103   1e-21    
ref|WP_015175083.1|  Methyltransferase type 11                          104   1e-21    
ref|WP_026097596.1|  methyltransferase type 11                          104   1e-21    
ref|WP_015142996.1|  methylase                                          104   1e-21    
ref|WP_015196791.1|  type 11 methyltransferase                          104   2e-21    
ref|WP_017309372.1|  methyltransferase type 11                          103   4e-21    
ref|WP_019491948.1|  hypothetical protein                               103   4e-21    
ref|WP_039780452.1|  methyltransferase type 11                          102   4e-21    
ref|WP_015956276.1|  methyltransferase type 11                          102   4e-21    
ref|WP_016859947.1|  methyltransferase type 11                          102   5e-21    
ref|WP_012162520.1|  methyltransferase type 11                          102   6e-21    
ref|WP_030421763.1|  methyltransferase                                  103   7e-21    
ref|WP_006508154.1|  methylase involved in ubiquinone/menaquinone...    101   7e-21    
ref|WP_010474473.1|  methyltransferase type 11                          102   7e-21    
ref|WP_039748332.1|  methyltransferase type 11                          102   8e-21    
ref|WP_027844201.1|  methyltransferase type 11                          102   8e-21    
ref|XP_005758726.1|  hypothetical protein EMIHUDRAFT_77326              101   8e-21    
ref|WP_011144354.1|  methyltransferase type 11                          101   1e-20    
ref|WP_006195840.1|  methyltransferase type 11                          102   1e-20    
ref|WP_015118937.1|  methylase                                          101   1e-20    
ref|WP_017319416.1|  methyltransferase type 11                          101   2e-20    
ref|WP_029633870.1|  methyltransferase type 11 [                        101   2e-20    
ref|WP_012412629.1|  methyltransferase type 11                          101   2e-20    
ref|WP_035985220.1|  methyltransferase type 11                          100   2e-20    
ref|WP_017297095.1|  hypothetical protein                               100   4e-20    
ref|WP_006633823.1|  methyltransferase type 11                          100   4e-20    
ref|WP_008233118.1|  SAM-dependent methyltransferases                   100   4e-20    
ref|WP_011320141.1|  methyltransferase type 11                        99.8    6e-20    
ref|WP_037224137.1|  methyltransferase type 11                        99.4    8e-20    
gb|EWM30643.1|  methyltransferase type 11                             98.6    9e-20    
ref|WP_017717844.1|  hypothetical protein                             99.4    1e-19    
ref|WP_015137677.1|  methylase                                        97.8    3e-19    
ref|WP_027844128.1|  methyltransferase type 11                        97.4    3e-19    
ref|WP_015170229.1|  type 11 methyltransferase                        97.4    3e-19    
ref|WP_006102921.1|  methyltransferase type 11                        96.7    4e-19    
ref|WP_008049678.1|  methyltransferase type 11                        96.3    8e-19    
ref|WP_006624779.1|  MULTISPECIES: methyltransferase type 11          96.3    8e-19    
ref|WP_012627196.1|  methyltransferase type 11                        94.0    5e-18    
ref|WP_019507691.1|  hypothetical protein                             93.6    6e-18    
ref|WP_033303754.1|  hypothetical protein                             90.9    7e-18    
ref|WP_006620020.1|  methyltransferase type 11                        93.6    8e-18    
gb|EWM64949.1|  methyltransferase UbiE/COQ5 family protein            94.7    9e-18    
ref|WP_019493043.1|  methyltransferase                                92.8    3e-17    
ref|WP_012628424.1|  type 11 methyltransferase                        91.3    3e-17    
ref|WP_012165620.1|  methyltransferase                                92.4    4e-17    
ref|WP_036902754.1|  methyltransferase                                91.3    8e-17    
ref|WP_038279501.1|  hypothetical protein                             91.3    8e-17    
ref|WP_009547702.1|  methyltransferase type 11                        89.7    8e-17    
ref|WP_034518944.1|  hypothetical protein                             87.4    1e-16    
ref|WP_012362038.1|  methyltransferase type 11                        89.7    1e-16    
ref|WP_034901713.1|  hypothetical protein                             88.6    2e-16    
gb|EWM63113.1|  LigA protein                                          90.5    2e-16    
ref|WP_036482591.1|  methyltransferase type 11                        88.6    3e-16    
ref|WP_030499083.1|  methyltransferase                                89.7    3e-16    
gb|EWM30641.1|  methyltransferase type 11                             85.1    3e-16    
gb|EAZ91935.1|  hypothetical protein CY0110_29709                     87.8    3e-16    
ref|WP_035798893.1|  methyltransferase type 11                        88.2    4e-16    
gb|KEO98528.1|  hypothetical protein EH32_05285                       89.0    5e-16    
ref|WP_018400362.1|  hypothetical protein                             89.0    6e-16    
ref|WP_036485583.1|  methyltransferase                                88.6    7e-16    
ref|WP_030631949.1|  MULTISPECIES: methyltransferase                  88.6    7e-16    
ref|WP_012195581.1|  methyltransferase                                88.6    8e-16    
ref|WP_013476399.1|  methyltransferase                                88.2    9e-16    
ref|WP_028443414.1|  methyltransferase                                88.2    1e-15    
ref|WP_037881613.1|  methyltransferase                                88.2    1e-15    
ref|WP_013286887.1|  MULTISPECIES: methyltransferase                  88.2    1e-15    
ref|WP_015119313.1|  methylase                                        87.8    1e-15    
gb|KEO98517.1|  hypothetical protein EH32_05230                       87.8    1e-15    
ref|WP_006510554.1|  methylase involved in ubiquinone/menaquinone...  86.7    1e-15    
ref|WP_006455471.1|  methyltransferase                                87.8    2e-15    
gb|EPF23640.1|  hypothetical protein MAESPC_01138                     83.6    2e-15    
ref|WP_035991145.1|  methyltransferase                                87.0    2e-15    
dbj|GAM05184.1|  type 11 methyltransferase                            86.7    3e-15    
ref|WP_027300762.1|  hypothetical protein                             87.0    3e-15    
ref|WP_019504785.1|  hypothetical protein                             86.7    3e-15    
ref|WP_034901707.1|  hypothetical protein                             83.2    3e-15    
ref|WP_039392232.1|  hypothetical protein                             83.2    4e-15    
ref|WP_006277302.1|  methyltransferase                                86.3    4e-15    
ref|XP_009035326.1|  hypothetical protein AURANDRAFT_71115            88.6    4e-15    
ref|WP_011244002.1|  methyltransferase                                86.3    5e-15    
ref|WP_012362435.1|  methyltransferase                                86.3    5e-15    
ref|WP_026732390.1|  methyltransferase                                85.9    5e-15    
ref|WP_009543585.1|  methyltransferase                                85.9    6e-15    
ref|WP_036917839.1|  MULTISPECIES: methyltransferase                  85.9    6e-15    
emb|CCQ68803.1|  SAM-dependent methyltransferases                     86.3    6e-15    
ref|WP_038276380.1|  methyltransferase                                85.5    8e-15    
ref|WP_029013522.1|  methyltransferase type 11                        85.9    1e-14    
ref|WP_021836923.1|  SAM-dependent methyltransferases                 85.5    1e-14    
ref|WP_021831118.1|  SAM-dependent methyltransferases                 85.5    1e-14    
ref|WP_007308078.1|  methyltransferase                                85.5    1e-14    
ref|WP_036532470.1|  methyltransferase type 11                        84.3    1e-14    
ref|WP_015199082.1|  type 11 methyltransferase                        84.7    1e-14    
ref|WP_038015933.1|  hypothetical protein                             84.7    1e-14    
ref|WP_015954233.1|  methyltransferase                                84.7    2e-14    
ref|WP_015164123.1|  type 11 methyltransferase                        84.7    2e-14    
ref|WP_038652135.1|  methyltransferase                                84.0    3e-14    
ref|WP_023066922.1|  methyltransferase domain protein                 84.0    3e-14    
ref|XP_002185688.1|  predicted protein                                83.6    3e-14    
ref|WP_017324805.1|  hypothetical protein                             83.6    4e-14    
ref|WP_015229550.1|  methylase                                        83.6    4e-14    
ref|WP_011125192.1|  MULTISPECIES: methyltransferase                  83.2    4e-14    
ref|WP_039713632.1|  methyltransferase                                82.8    6e-14    
ref|WP_036481608.1|  methyltransferase type 11                        83.2    6e-14    
ref|WP_039781590.1|  methyltransferase                                82.8    6e-14    
ref|WP_015181221.1|  methylase                                        83.2    6e-14    
ref|WP_015225085.1|  type 11 methyltransferase                        82.8    7e-14    
ref|WP_010478689.1|  methyltransferase                                82.8    7e-14    
ref|WP_007679046.1|  type 11 methyltransferase                        83.2    7e-14    
ref|WP_015148371.1|  methylase                                        82.4    8e-14    
ref|WP_002806066.1|  methyltransferase                                82.4    8e-14    
ref|WP_009783482.1|  type 12 methyltransferase                        82.8    9e-14    
ref|WP_036045526.1|  methyltransferase                                82.4    9e-14    
ref|WP_015206297.1|  methylase involved in ubiquinone/menaquinone...  81.6    1e-13    
ref|WP_036907185.1|  methyltransferase                                81.6    1e-13    
ref|WP_017659619.1|  hypothetical protein                             81.6    2e-13    
ref|WP_039393517.1|  methyltransferase type 11                        82.0    2e-13    
dbj|GAM06694.1|  type 11 methyltransferase                            81.6    2e-13    
ref|WP_023065686.1|  ubiE/COQ5 methyltransferase family protein       81.6    2e-13    
ref|WP_015212566.1|  Methyltransferase type 11                        81.3    2e-13    
ref|WP_006618331.1|  methyltransferase                                81.3    2e-13    
ref|WP_011823482.1|  methyltransferase                                81.3    2e-13    
ref|WP_012007674.1|  methyltransferase                                81.3    2e-13    
ref|WP_011613206.1|  methyltransferase                                80.9    3e-13    
ref|WP_032521456.1|  methyltransferase                                80.9    3e-13    
dbj|GAM05180.1|  type 11 methyltransferase                            80.5    3e-13    
ref|WP_013676265.1|  methyltransferase                                80.5    4e-13    
ref|WP_035799450.1|  methyltransferase                                80.1    4e-13    
ref|WP_006509011.1|  methylase involved in ubiquinone/menaquinone...  78.6    4e-13    
gb|EAZ90800.1|  UbiE/COQ5 methyltransferase                           80.5    4e-13    
ref|WP_017302852.1|  hypothetical protein                             80.1    5e-13    
ref|WP_011293674.1|  methyltransferase                                79.7    6e-13    
ref|WP_015140324.1|  methylase                                        79.7    6e-13    
ref|WP_026098599.1|  methyltransferase                                79.7    6e-13    
ref|WP_012410516.1|  type 12 methyltransferase                        80.1    6e-13    
ref|WP_039392231.1|  hypothetical protein                             76.6    7e-13    
ref|WP_015156651.1|  type 11 methyltransferase                        79.7    7e-13    
ref|WP_009633099.1|  methylase involved in ubiquinone/menaquinone...  79.7    7e-13    
ref|WP_025968029.1|  methyltransferase                                79.7    7e-13    
ref|WP_017298446.1|  fibrillarin-like rRNA methylase                  79.7    7e-13    
ref|WP_007097746.1|  methyltransferase                                79.7    7e-13    
ref|WP_038072550.1|  methyltransferase                                79.7    8e-13    
ref|WP_008317369.1|  methylase involved in ubiquinone/menaquinone...  79.7    8e-13    
ref|XP_003064607.1|  predicted protein                                77.8    8e-13    



>ref|XP_009792762.1| PREDICTED: uncharacterized protein LOC104239740 isoform X1 [Nicotiana 
sylvestris]
Length=367

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/384 (74%), Positives = 324/384 (84%), Gaps = 17/384 (4%)
 Frame = +1

Query  94    MAMAFCATSKLNSTLNPALFTSTKDAVVIHDPLKRVTPARTsggsirvaasgsgsgapaa  273
             MA +F    KL+ T+NP  FT TK            +P R +   +    S S SG    
Sbjct  1     MAFSF----KLD-TVNPIFFTITK------------SPIRRNRSVLAFKLSASSSGNAQI  43

Query  274   VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
              E +EEGQLERPRW+GETPLSR VGALISFKPL+S+LK+GARQVFISTAEKTNIPWREM 
Sbjct  44    AEAFEEGQLERPRWTGETPLSRLVGALISFKPLFSILKLGARQVFISTAEKTNIPWREMT  103

Query  454   KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
             KEIL+SDVYKE+ESIQN ++ YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP+
Sbjct  104   KEILDSDVYKELESIQNPAIAYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMVRRAIPN  163

Query  634   ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
             A+SL+EA+Q+VRGNWLDAIEKHH+QYS  F+IRDILDIGCS+GVST  LA RYPSA +TG
Sbjct  164   ASSLEEANQIVRGNWLDAIEKHHQQYSADFSIRDILDIGCSVGVSTGYLADRYPSAKVTG  223

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             LDLSPYFLAVAQ+KEK R+++ NP  WIHANGE+TGLPSKSFDLVSI+YVFHECPERAIR
Sbjct  224   LDLSPYFLAVAQYKEKKRNQRKNPLSWIHANGENTGLPSKSFDLVSIAYVFHECPERAIR  283

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE  1173
             N+V ESFR+LRPGGT ++TDNSPKSK LQELPPVLFTLMKSTEPFLDEYYLTDLERVM+E
Sbjct  284   NLVKESFRILRPGGTVAITDNSPKSKILQELPPVLFTLMKSTEPFLDEYYLTDLERVMKE  343

Query  1174  AGFVNVQSVLTDPRHRTVTATVPY  1245
              GF NVQ+VLTDPRHRTVTATVPY
Sbjct  344   TGFANVQTVLTDPRHRTVTATVPY  367



>ref|XP_004248191.1| PREDICTED: uncharacterized protein LOC101245590 [Solanum lycopersicum]
Length=381

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/388 (73%), Positives = 329/388 (85%), Gaps = 11/388 (3%)
 Frame = +1

Query  94    MAMAFCATSKLNSTLNPALFTSTKDAVVIHDPLKRVTPART----sggsirvaasgsgsg  261
             MA +F    KLN++ NP+ FT T ++  IHDPL ++   R        +   ++S S S 
Sbjct  1     MAFSF----KLNTS-NPSFFTITNNS--IHDPLLKIAAKRRILGFKLSASSSSSSSSSSS  53

Query  262   apaaVEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPW  441
             +  + EV+EEGQLERPRWSGETPLSR VG LIS KPL+S+LK+GARQVFISTAEKTNIPW
Sbjct  54    SSRSAEVFEEGQLERPRWSGETPLSRLVGTLISIKPLFSILKLGARQVFISTAEKTNIPW  113

Query  442   REMAKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLR  621
              EM KEIL SDVYKE+ESI+N ++ YPDYYL+PFHAYDEGNLSWLAAAEA+ ATM+M  R
Sbjct  114   TEMTKEILNSDVYKELESIENPAIVYPDYYLNPFHAYDEGNLSWLAAAEADAATMSMVRR  173

Query  622   AIPDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSA  801
             AIP+A+SLDEA+Q+VRGNWLDAIEKHH+QYS  F+IRDILDIGCS+GVST  LA R+PSA
Sbjct  174   AIPNASSLDEANQIVRGNWLDAIEKHHQQYSADFSIRDILDIGCSVGVSTGYLADRFPSA  233

Query  802   NLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPE  981
              +TGLDLSPYFL+VAQ+KEK R+++ NP  WIHANGE+TGLPS+SFDLVSI YVFHECPE
Sbjct  234   KVTGLDLSPYFLSVAQYKEKKRNQRKNPISWIHANGENTGLPSESFDLVSIPYVFHECPE  293

Query  982   RAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLER  1161
             RAIRN+V ESFRLLRPGGT ++TDNSPKSK LQELPPVLFTLMKSTEPFLDEYYLTDLER
Sbjct  294   RAIRNIVKESFRLLRPGGTVAITDNSPKSKILQELPPVLFTLMKSTEPFLDEYYLTDLER  353

Query  1162  VMREAGFVNVQSVLTDPRHRTVTATVPY  1245
             V++E GF NVQ+VLTDPRHRTVTATVPY
Sbjct  354   VIKETGFANVQTVLTDPRHRTVTATVPY  381



>ref|XP_006364102.1| PREDICTED: uncharacterized protein LOC102586362 [Solanum tuberosum]
Length=378

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/385 (74%), Positives = 330/385 (86%), Gaps = 8/385 (2%)
 Frame = +1

Query  94    MAMAFCATSKLNSTLNPALFTSTKDAVVIHDPLKRV-TPARTsggsirvaasgsgsgapa  270
             MA +F    KL+ T NP+ FT T  +  IHDPL ++ T  R  G  +  ++S S S +  
Sbjct  1     MAFSF----KLD-TANPSFFTITNKS--IHDPLLKIATKRRILGFKVSASSSSSSSSSSR  53

Query  271   aVEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREM  450
             + EV+EEGQLERPRWSGETPLSR VG LIS KPL+S+LK+GARQVFISTAEKTNIPW EM
Sbjct  54    SAEVFEEGQLERPRWSGETPLSRLVGTLISIKPLFSILKLGARQVFISTAEKTNIPWTEM  113

Query  451   AKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIP  630
              KEIL+SDVYKE+ESI+N ++ YPDYYL+PFHAYDEGNLSWLAAAEA+ ATM+M  RAIP
Sbjct  114   TKEILDSDVYKELESIENPAIVYPDYYLNPFHAYDEGNLSWLAAAEADAATMSMVRRAIP  173

Query  631   DANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLT  810
             +A+SL+EA+Q+VRGNWLDAIEKHH+QYS  F+IRDILDIGCS+GVST  LA R+PSA +T
Sbjct  174   NASSLEEANQIVRGNWLDAIEKHHQQYSADFSIRDILDIGCSVGVSTGYLADRFPSAKVT  233

Query  811   GLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAI  990
             GLDLSPYFL+VAQ+KEK R+++ NP  WIHANGE+TGLPS+SFDLVSI YVFHECPERAI
Sbjct  234   GLDLSPYFLSVAQYKEKKRNQRKNPISWIHANGENTGLPSESFDLVSIPYVFHECPERAI  293

Query  991   RNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMR  1170
             RN+V ESFRLLRPGGT ++TDNSPKSK LQELPPVLFTLMKSTEPFLDEYYLTDLERV++
Sbjct  294   RNIVKESFRLLRPGGTIAITDNSPKSKILQELPPVLFTLMKSTEPFLDEYYLTDLERVIK  353

Query  1171  EAGFVNVQSVLTDPRHRTVTATVPY  1245
             E GF NVQ+VLTDPRHRTVTATVPY
Sbjct  354   ETGFANVQTVLTDPRHRTVTATVPY  378



>ref|XP_009626511.1| PREDICTED: uncharacterized protein LOC104117204 [Nicotiana tomentosiformis]
Length=392

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/323 (82%), Positives = 295/323 (91%), Gaps = 0/323 (0%)
 Frame = +1

Query  277   EVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAK  456
             E +EEGQLERPRW+GETPLSR VGALISFKPL+S+LK+GARQV ISTAEKTNIPWREM K
Sbjct  70    EAFEEGQLERPRWTGETPLSRLVGALISFKPLFSILKLGARQVLISTAEKTNIPWREMTK  129

Query  457   EILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDA  636
             EIL+SDVYKE+ESIQN ++ YPDYYL+PFHAYDEGNLSWLAAAE E ATM+M  RAIP+A
Sbjct  130   EILDSDVYKELESIQNPAIVYPDYYLNPFHAYDEGNLSWLAAAEVEAATMSMVRRAIPNA  189

Query  637   NSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGL  816
             +SL+EA+Q+VRGNWLDAIEKHH+QYSG  +IRDILDIGCS+GVST  LA RYP A +TGL
Sbjct  190   SSLEEANQIVRGNWLDAIEKHHQQYSGDLSIRDILDIGCSVGVSTGYLADRYPFAKVTGL  249

Query  817   DLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRN  996
             DLSPYFLAVAQ+KEK R  + NP  WIHANGE+TGLPSKSFDLVSI+YVFHECPERAIRN
Sbjct  250   DLSPYFLAVAQYKEKKRSERKNPISWIHANGENTGLPSKSFDLVSIAYVFHECPERAIRN  309

Query  997   VVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREA  1176
             +V ESFR+LRPGGT ++TDNSPKSK LQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE 
Sbjct  310   LVKESFRILRPGGTVAITDNSPKSKILQELPPVLFTLMKSTEPFLDEYYLTDLERVMRET  369

Query  1177  GFVNVQSVLTDPRHRTVTATVPY  1245
             GF NVQ+VLTDPRHRTVTATVPY
Sbjct  370   GFANVQTVLTDPRHRTVTATVPY  392



>gb|AAR28998.1| CMV 1a interacting protein 1 [Nicotiana tabacum]
Length=369

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/323 (82%), Positives = 295/323 (91%), Gaps = 0/323 (0%)
 Frame = +1

Query  277   EVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAK  456
             E +EEGQLERPRW+GETPLSR VGALISFKPL+S+LK+GARQV ISTAEKTNIPWREM K
Sbjct  47    EAFEEGQLERPRWTGETPLSRLVGALISFKPLFSILKLGARQVLISTAEKTNIPWREMTK  106

Query  457   EILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDA  636
             EIL+SDVYKE+ESIQN ++ YPDYYL+PFHAYDEGNLSWLAAAE E ATM+M  RAIP+A
Sbjct  107   EILDSDVYKELESIQNPAIVYPDYYLNPFHAYDEGNLSWLAAAEVEAATMSMVRRAIPNA  166

Query  637   NSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGL  816
             +SL+EA+Q+VRGNWLDAIEKHH+QYSG  +IRDILDIGCS+GVST  LA RYP A +TGL
Sbjct  167   SSLEEANQIVRGNWLDAIEKHHQQYSGDLSIRDILDIGCSVGVSTGYLADRYPFAKVTGL  226

Query  817   DLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRN  996
             DLSPYFLAVAQ+KEK R  + NP  WIHANGE+TGLPSKSFDLVSI+YVFHECPERAIRN
Sbjct  227   DLSPYFLAVAQYKEKKRSERKNPISWIHANGENTGLPSKSFDLVSIAYVFHECPERAIRN  286

Query  997   VVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREA  1176
             +V ESFR+LRPGGT ++TDNSPKSK LQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE 
Sbjct  287   LVKESFRILRPGGTVAITDNSPKSKILQELPPVLFTLMKSTEPFLDEYYLTDLERVMRET  346

Query  1177  GFVNVQSVLTDPRHRTVTATVPY  1245
             GF NVQ+VLTDPRHRTVTATVPY
Sbjct  347   GFANVQTVLTDPRHRTVTATVPY  369



>ref|XP_009792763.1| PREDICTED: uncharacterized protein LOC104239740 isoform X2 [Nicotiana 
sylvestris]
Length=360

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/384 (73%), Positives = 318/384 (83%), Gaps = 24/384 (6%)
 Frame = +1

Query  94    MAMAFCATSKLNSTLNPALFTSTKDAVVIHDPLKRVTPARTsggsirvaasgsgsgapaa  273
             MA +F    KL+ T+NP  FT TK            +P R +   +    S S SG    
Sbjct  1     MAFSF----KLD-TVNPIFFTITK------------SPIRRNRSVLAFKLSASSSGNAQI  43

Query  274   VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
              E +EEGQLERPRW+GETPLSR VGALISFKPL+S+LK+GARQVFISTAEKTNIPWREM 
Sbjct  44    AEAFEEGQLERPRWTGETPLSRLVGALISFKPLFSILKLGARQVFISTAEKTNIPWREMT  103

Query  454   KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
             KEIL+SDVYKE+ESIQN ++ YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP+
Sbjct  104   KEILDSDVYKELESIQNPAIAYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMVRRAIPN  163

Query  634   ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
             A+SL+EA+Q+VRGNWLDAIEKHH+QYS  F+IRDILDIGCS+GVST  LA RYPSA +TG
Sbjct  164   ASSLEEANQIVRGNWLDAIEKHHQQYSADFSIRDILDIGCSVGVSTGYLADRYPSAKVTG  223

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             LDLSPYFLAVAQ+KEK R+++ NP  WIHANGE+TGLPSKSFDLVSI+YVFHECPERAIR
Sbjct  224   LDLSPYFLAVAQYKEKKRNQRKNPLSWIHANGENTGLPSKSFDLVSIAYVFHECPERAIR  283

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE  1173
             N+V ESFR+LRPGGT ++TDNS       ELPPVLFTLMKSTEPFLDEYYLTDLERVM+E
Sbjct  284   NLVKESFRILRPGGTVAITDNS-------ELPPVLFTLMKSTEPFLDEYYLTDLERVMKE  336

Query  1174  AGFVNVQSVLTDPRHRTVTATVPY  1245
              GF NVQ+VLTDPRHRTVTATVPY
Sbjct  337   TGFANVQTVLTDPRHRTVTATVPY  360



>gb|EYU30785.1| hypothetical protein MIMGU_mgv1a008621mg [Erythranthe guttata]
Length=368

 Score =   514 bits (1325),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 248/321 (77%), Positives = 285/321 (89%), Gaps = 0/321 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEGQLERP+W+GETPLSR VGALISFKPLYSLLK+GARQV ISTAEKT+IPWR+M  EI
Sbjct  47    YEEGQLERPKWTGETPLSRLVGALISFKPLYSLLKLGARQVLISTAEKTSIPWRDMTNEI  106

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             L+SDVYKE ++I++ S+ YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP+A+S
Sbjct  107   LDSDVYKEKDAIEDSSIVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMVRRAIPNASS  166

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             LDEA+Q+VRGNWL AIE HH QYSG  +I+DILDIGCS+GVSTR +  ++PSA +TGLDL
Sbjct  167   LDEANQIVRGNWLQAIETHHNQYSGYSSIQDILDIGCSVGVSTRFILDKFPSAKVTGLDL  226

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ+ +K R++     +WIH NGE+TGLPSKSFDLVSI+YVFHECPERAI+N+ 
Sbjct  227   SPYFLAVAQYNDKRRNQGKEKVKWIHGNGENTGLPSKSFDLVSIAYVFHECPERAIKNMA  286

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGTF+VTDNSPKSK LQEL PVLFTLMKSTEPFLDEYYLTDLE  +   GF
Sbjct  287   KEAFRLLRPGGTFAVTDNSPKSKILQELSPVLFTLMKSTEPFLDEYYLTDLEATLELVGF  346

Query  1183  VNVQSVLTDPRHRTVTATVPY  1245
             VNVQ+VLTDPRHRTVTATVPY
Sbjct  347   VNVQTVLTDPRHRTVTATVPY  367



>ref|XP_003607569.1| Menaquinone biosynthesis methyltransferase ubiE [Medicago truncatula]
 gb|AES89766.1| CMV 1a interacting protein [Medicago truncatula]
Length=370

 Score =   511 bits (1317),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 246/320 (77%), Positives = 285/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+L RP+W+GETPLSR V ALISFKPLYS+LK+GARQVFISTAEK NIPWREM KEI
Sbjct  50    YEEGKLVRPKWTGETPLSRMVRALISFKPLYSILKLGARQVFISTAEKNNIPWREMTKEI  109

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES VYKE++SIQNQSL YPDYYL+PFHAYDEGNL+WLAAAEAE AT +M  RAIP A+S
Sbjct  110   LESQVYKELDSIQNQSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATKSMVRRAIPTASS  169

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             ++EA+Q++RGNWL+AIE+HH Q+S    I DILDIGCS+GVS+R LA ++P+AN+ GLD+
Sbjct  170   VEEATQIMRGNWLNAIEQHHLQHSQTSMIGDILDIGCSVGVSSRFLADKFPTANVIGLDM  229

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEK+   + NP +WIHANGEDTGLPSKSFDLVSISYVFHECP RAI NVV
Sbjct  230   SPYFLAVAQHKEKSGTPRKNPIKWIHANGEDTGLPSKSFDLVSISYVFHECPARAIVNVV  289

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGTF++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYYLTD++  +REAGF
Sbjct  290   KEAFRLLRPGGTFAMTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYLTDMDETLREAGF  349

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VN++S+LTDPRH T+TATVP
Sbjct  350   VNIKSILTDPRHVTLTATVP  369



>emb|CAN60805.1| hypothetical protein VITISV_020683 [Vitis vinifera]
Length=324

 Score =   509 bits (1312),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 249/320 (78%), Positives = 280/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEGQLERP W+GETPLSR VGA+ISFKPLYS+LK+GARQV ISTAEKTNIPWREM  EI
Sbjct  4     YEEGQLERPNWAGETPLSRLVGAIISFKPLYSVLKLGARQVLISTAEKTNIPWREMTNEI  63

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LESDVYKEMESI+N S+ YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RA PDA+S
Sbjct  64    LESDVYKEMESIENPSVVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMVRRATPDASS  123

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             L+EA+++VRGNWL AIE+HH QYSG   +RDILD+GCS+GVSTR LA ++PSA +TGLDL
Sbjct  124   LEEANKIVRGNWLQAIERHHLQYSGNSTVRDILDVGCSVGVSTRFLADKFPSAKVTGLDL  183

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQFKEK R  + N   W+HANGED+GLPSKSFD+ S++YV HECP RAI  +V
Sbjct  184   SPYFLAVAQFKEKERASRKNLINWVHANGEDSGLPSKSFDIASMAYVLHECPARAIVGLV  243

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYYLTDLE  MREAGF
Sbjct  244   REAFRLLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYLTDLEGRMREAGF  303

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VNV +VLTD RHRTVT TVP
Sbjct  304   VNVTTVLTDKRHRTVTGTVP  323



>ref|XP_004505506.1| PREDICTED: uncharacterized protein LOC101513404 [Cicer arietinum]
Length=370

 Score =   511 bits (1316),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 245/323 (76%), Positives = 282/323 (87%), Gaps = 0/323 (0%)
 Frame = +1

Query  274   VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
             V  YEEG+L RP+W+GETPLSR V ALISFKPLYS+LK+GARQV ISTAEK NIPWREM 
Sbjct  47    VGSYEEGKLVRPKWTGETPLSRMVRALISFKPLYSILKLGARQVLISTAEKNNIPWREMT  106

Query  454   KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
             KEILES VYKEM++IQN SL YPDYYL+PFHAYDEGNL+WLAAAEAE AT +M  RAIP+
Sbjct  107   KEILESQVYKEMDTIQNHSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATKSMVRRAIPN  166

Query  634   ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
             A+S+DEA+Q++RGNWL AIE+HH Q+S    I DILDIGCS+GVS+RCLA ++P+AN+TG
Sbjct  167   ASSIDEATQILRGNWLQAIEQHHLQHSQTSMISDILDIGCSVGVSSRCLADKFPTANVTG  226

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             LDLSPYFLAVAQ KEK    + NP +WIHANGEDTGLPSKSFDLVSI+YVFHECP RAI 
Sbjct  227   LDLSPYFLAVAQHKEKRGAPRKNPIKWIHANGEDTGLPSKSFDLVSIAYVFHECPARAIV  286

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE  1173
             NVV E+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYYLTD++  + E
Sbjct  287   NVVKEAFRLLRPGGTLAMTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYLTDMDETLME  346

Query  1174  AGFVNVQSVLTDPRHRTVTATVP  1242
             AGFVN+ S+LT+PRH T+TATVP
Sbjct  347   AGFVNITSILTNPRHVTLTATVP  369



>ref|XP_004505505.1| PREDICTED: uncharacterized protein LOC101512863 isoform X2 [Cicer 
arietinum]
Length=370

 Score =   510 bits (1314),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 245/323 (76%), Positives = 282/323 (87%), Gaps = 0/323 (0%)
 Frame = +1

Query  274   VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
             V  YEEG+L RP+W+GETPLSR V ALISFKPLYS+LK+GARQV ISTAEK NIPWREM 
Sbjct  47    VGSYEEGKLVRPKWTGETPLSRMVRALISFKPLYSILKLGARQVLISTAEKNNIPWREMT  106

Query  454   KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
             KEILES VYKEM++IQN SL YPDYYL+PFHAYDEGNL+WLAAAEAE AT +M  RAIP+
Sbjct  107   KEILESQVYKEMDTIQNHSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATKSMVRRAIPN  166

Query  634   ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
             A+S+DEA+Q++RGNWL AIE+HH Q+S    I DILDIGCS+GVS+RCLA ++P+AN+TG
Sbjct  167   ASSIDEATQILRGNWLQAIEQHHLQHSQTSMISDILDIGCSVGVSSRCLADKFPTANVTG  226

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             LDLSPYFLAVAQ KEK    + NP +WIHANGEDTGLPSKSFDLVSI+YVFHECP RAI 
Sbjct  227   LDLSPYFLAVAQHKEKRGAPRKNPIKWIHANGEDTGLPSKSFDLVSIAYVFHECPARAIV  286

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE  1173
             NVV E+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYYLTD++  + E
Sbjct  287   NVVKEAFRLLRPGGTLAMTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYLTDMDETLME  346

Query  1174  AGFVNVQSVLTDPRHRTVTATVP  1242
             AGFVN+ S+LT+PRH T+TATVP
Sbjct  347   AGFVNITSILTNPRHVTLTATVP  369



>emb|CBI21965.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   509 bits (1312),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 249/320 (78%), Positives = 280/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEGQLERP W+GETPLSR VGA+ISFKPLYS+LK+GARQV ISTAEKTNIPWREM  EI
Sbjct  53    YEEGQLERPNWAGETPLSRLVGAIISFKPLYSVLKLGARQVLISTAEKTNIPWREMTNEI  112

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LESDVYKEMESI+N S+ YPDYY +PFHAYDEGNLSWLAAAEAE ATM+M  RA PDA+S
Sbjct  113   LESDVYKEMESIENPSVVYPDYYSNPFHAYDEGNLSWLAAAEAEAATMSMVRRATPDASS  172

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             L+EA+++VRGNWL AIE+HH QYSG   +RDILD+GCS+GVSTR LA ++PSA +TGLDL
Sbjct  173   LEEANKIVRGNWLQAIERHHLQYSGNSTVRDILDVGCSVGVSTRFLADKFPSAKVTGLDL  232

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQFKEK R  + N   W+HANGED+GLPSKSFD+VS++YV HECP RAI  +V
Sbjct  233   SPYFLAVAQFKEKERASRKNLINWVHANGEDSGLPSKSFDIVSMAYVLHECPARAIVGLV  292

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYYLTDLE  MREAGF
Sbjct  293   REAFRLLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYLTDLEGRMREAGF  352

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VNV +VLTD RHRTVT TVP
Sbjct  353   VNVTTVLTDKRHRTVTGTVP  372



>gb|ACJ85067.1| unknown [Medicago truncatula]
Length=370

 Score =   507 bits (1305),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/320 (76%), Positives = 283/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+L RP+W+GETPLSR V ALISFKPLYS+LK+GARQVFISTAEK NIPWREM KEI
Sbjct  50    YEEGKLVRPKWTGETPLSRMVRALISFKPLYSILKLGARQVFISTAEKNNIPWREMTKEI  109

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES VYKE++SIQNQSL YPDYYL+PFHAYDEGNL+WLAAAEAE AT +M  RAIP A+S
Sbjct  110   LESQVYKELDSIQNQSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATKSMVRRAIPTASS  169

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             ++EA+Q++RGNWL+AIE+HH Q+S    I DILDIGCS+GVS+R LA ++P+AN+ GLD+
Sbjct  170   VEEATQIMRGNWLNAIEQHHLQHSQTSMIGDILDIGCSVGVSSRFLADKFPTANVIGLDM  229

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEK+   + NP +WIHANGEDTGLP KSFDLVSISYVFHECP RAI NVV
Sbjct  230   SPYFLAVAQHKEKSGTPRKNPIKWIHANGEDTGLPFKSFDLVSISYVFHECPARAIVNVV  289

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FR LRPGGTF++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYYLTD++  +REAGF
Sbjct  290   KEAFRFLRPGGTFAMTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYLTDMDETLREAGF  349

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VN++S+LTDPRH T+TATVP
Sbjct  350   VNIKSILTDPRHVTLTATVP  369



>ref|XP_011015846.1| PREDICTED: uncharacterized protein LOC105119406 [Populus euphratica]
Length=365

 Score =   504 bits (1298),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 244/320 (76%), Positives = 281/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             +EEG+LERP+WSG+TPLSR VGALI+FKPL S+LK+GARQV I TAEK NIPWREM KEI
Sbjct  45    FEEGKLERPKWSGQTPLSRLVGALIAFKPLSSVLKLGARQVLIRTAEKGNIPWREMTKEI  104

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LESDVYKE+ESIQN SL YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP+A++
Sbjct  105   LESDVYKELESIQNHSLVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMVRRAIPNAST  164

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             +DEA+QVVRGNWL AIE+HH QYSG   IRDILDIGCS+GVSTR LA ++PSAN+TGLDL
Sbjct  165   VDEANQVVRGNWLQAIEQHHLQYSGTAMIRDILDIGCSVGVSTRFLADKFPSANVTGLDL  224

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SP+FL+VAQFKEK    + NP +W+HAN EDTG P +SFDLVS+SYVFHECPERAI N++
Sbjct  225   SPHFLSVAQFKEKKVGPRKNPIKWMHANAEDTGFPPQSFDLVSVSYVFHECPERAIVNIL  284

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT  V+D SPKSK LQE+ PVLFTL+KSTEPFLDEY+LTDLE  M EAGF
Sbjct  285   KEAFRLLRPGGTIVVSDQSPKSKILQEMSPVLFTLLKSTEPFLDEYHLTDLEGRMEEAGF  344

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             + VQ+ LTDPRHRT+TATVP
Sbjct  345   IEVQTGLTDPRHRTLTATVP  364



>ref|XP_011002521.1| PREDICTED: uncharacterized protein LOC105109497 [Populus euphratica]
Length=365

 Score =   504 bits (1297),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 244/320 (76%), Positives = 281/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             +EEG+LERP+WSG+TPLSR VGALI+FKPL S+LK+GARQV I TAEK NIPWREM KEI
Sbjct  45    FEEGKLERPKWSGQTPLSRLVGALIAFKPLSSVLKLGARQVLIRTAEKGNIPWREMTKEI  104

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LESDVYKE+ESIQN SL YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP+A++
Sbjct  105   LESDVYKELESIQNPSLVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMVRRAIPNAST  164

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             +DEA+QVVRGNWL AIE+HH QYSG   IRDILDIGCS+GVSTR LA ++PSAN+TGLDL
Sbjct  165   VDEANQVVRGNWLQAIEQHHLQYSGTTMIRDILDIGCSVGVSTRFLADKFPSANVTGLDL  224

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SP+FL+VAQFKEK    + NP +W+HAN EDTG P +SFDLVS+SYVFHECPERAI N++
Sbjct  225   SPHFLSVAQFKEKKVGSRKNPIKWMHANAEDTGFPPQSFDLVSVSYVFHECPERAIVNIL  284

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT  V+D SPKSK LQE+ PVLFTL+KSTEPFLDEY+LTDLE  M EAGF
Sbjct  285   KEAFRLLRPGGTIVVSDQSPKSKILQEMSPVLFTLLKSTEPFLDEYHLTDLEGRMEEAGF  344

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             + VQ+ LTDPRHRT+TATVP
Sbjct  345   IEVQTGLTDPRHRTLTATVP  364



>ref|XP_010035844.1| PREDICTED: uncharacterized protein LOC104424986 [Eucalyptus grandis]
 gb|KCW47314.1| hypothetical protein EUGRSUZ_K01102 [Eucalyptus grandis]
 gb|KCW47315.1| hypothetical protein EUGRSUZ_K01102 [Eucalyptus grandis]
Length=370

 Score =   504 bits (1297),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 244/325 (75%), Positives = 282/325 (87%), Gaps = 1/325 (0%)
 Frame = +1

Query  274   VEV-YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREM  450
             VEV YE+GQLERP+W+GETPLSR VGA+ISFKP+YSLLK+GARQV ISTAEK  +PWREM
Sbjct  46    VEVAYEKGQLERPKWAGETPLSRLVGAVISFKPVYSLLKLGARQVLISTAEKNGVPWREM  105

Query  451   AKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIP  630
              ++ILESDVYKE+ESIQN SL YPDYYLSPFHAYDEGNLSW+AAAEAEPAT +M +RA+P
Sbjct  106   TRQILESDVYKELESIQNPSLVYPDYYLSPFHAYDEGNLSWMAAAEAEPATTSMSIRAVP  165

Query  631   DANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLT  810
             DA S DEA+QVVRGNWL+AIEKHH+Q+SG   +RDILDIGCS+G+ST  LA+ +PSA +T
Sbjct  166   DAKSADEATQVVRGNWLEAIEKHHRQHSGGSMVRDILDIGCSVGISTGYLANTFPSAKVT  225

Query  811   GLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAI  990
             GLDLSPYFL+VAQF E+ R ++T P +WIHANGEDTGLPSKSFDL SIS +FHECP RA 
Sbjct  226   GLDLSPYFLSVAQFNERKRSQRTAPIQWIHANGEDTGLPSKSFDLASISLMFHECPTRAT  285

Query  991   RNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMR  1170
              NV+ ESFRLLRPGGT ++ D +P SK LQ L PVLFTL+KSTEP LDEYYLTDLE  +R
Sbjct  286   TNVIKESFRLLRPGGTIAIMDQAPSSKVLQNLSPVLFTLLKSTEPHLDEYYLTDLEGTLR  345

Query  1171  EAGFVNVQSVLTDPRHRTVTATVPY  1245
             EAGFVNV  VLTD RHRTVTA+VP+
Sbjct  346   EAGFVNVTEVLTDSRHRTVTASVPH  370



>gb|EPS72916.1| hypothetical protein M569_01837 [Genlisea aurea]
Length=367

 Score =   499 bits (1286),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 242/321 (75%), Positives = 281/321 (88%), Gaps = 1/321 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             +EEG+LERPRW+GETP+SR VGALISFKPLYS++K+GARQV ISTAEKTNIPWR+M +EI
Sbjct  47    FEEGRLERPRWTGETPISRLVGALISFKPLYSVMKLGARQVLISTAEKTNIPWRDMTREI  106

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LESDVY+E +++++ S+ YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP A+S
Sbjct  107   LESDVYEEKDAVEDSSIVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMIRRAIPYASS  166

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             LDEA+Q+VRGNWL AIE HH +YSG   IRDILDIGCS+GVSTRCLA R+PSA +TGLDL
Sbjct  167   LDEANQIVRGNWLQAIESHHHKYSGNREIRDILDIGCSVGVSTRCLAERFPSAKVTGLDL  226

Query  823   SPYFLAVAQFKEKNRDRKTNPT-RWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             SP+F+AVAQ+K+K   ++  P  RWIH NGE TGLPS SFDLVS+SYVFHECPERAIRN+
Sbjct  227   SPFFVAVAQYKDKKSQQRKEPVIRWIHGNGESTGLPSGSFDLVSVSYVFHECPERAIRNI  286

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             V E FRLLR GGTF+VTDNSPKSK LQEL PVLFTLMKSTEPFLDEYYL D+E +M+  G
Sbjct  287   VKEVFRLLRSGGTFAVTDNSPKSKILQELSPVLFTLMKSTEPFLDEYYLCDVEGMMQRVG  346

Query  1180  FVNVQSVLTDPRHRTVTATVP  1242
              VNV+S LTDPRH T+TATVP
Sbjct  347   LVNVKSSLTDPRHTTITATVP  367



>ref|XP_002325578.1| hypothetical protein POPTR_0019s11940g [Populus trichocarpa]
 gb|EEE99959.1| hypothetical protein POPTR_0019s11940g [Populus trichocarpa]
Length=365

 Score =   498 bits (1281),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 242/320 (76%), Positives = 279/320 (87%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             +EEG+LERP+WSG+TPLSR VGALI+FKPL S+LK+GARQV I TAEK NIPWREM KEI
Sbjct  45    FEEGKLERPKWSGQTPLSRLVGALIAFKPLSSVLKLGARQVLIRTAEKGNIPWREMTKEI  104

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LESDVYKE+E IQN SL YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP+A++
Sbjct  105   LESDVYKELEGIQNPSLVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMVRRAIPNAST  164

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             +DEA+QVVRGNWL AIE+HH QYSG   IRDILDIGCS+GVSTR LA ++PSAN+TGLDL
Sbjct  165   VDEANQVVRGNWLQAIEQHHLQYSGTTMIRDILDIGCSVGVSTRFLADKFPSANVTGLDL  224

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SP+FL+VAQFKEK    + NP +W+HAN EDTG P +SFDLVS+SYVFHECPERAI N++
Sbjct  225   SPHFLSVAQFKEKKIGPRKNPIKWMHANAEDTGFPPQSFDLVSVSYVFHECPERAIVNIL  284

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+F LLRPGGT  V+D SPKSK LQE+ PVLFTL+KSTEPFLDEY+LTDLE  M EAGF
Sbjct  285   KEAFGLLRPGGTIVVSDQSPKSKILQEMSPVLFTLLKSTEPFLDEYHLTDLEGRMEEAGF  344

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             + VQ+ LTDPRHRT+TATVP
Sbjct  345   IKVQTGLTDPRHRTLTATVP  364



>ref|XP_010689878.1| PREDICTED: uncharacterized protein LOC104903532 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=364

 Score =   498 bits (1281),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 245/320 (77%), Positives = 277/320 (87%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG LERP+WSG+TPLSR VGALISFKPLYS +K GARQ  ISTAEKTNI WREM KEI
Sbjct  44    YEEGTLERPKWSGKTPLSRLVGALISFKPLYSAMKFGARQALISTAEKTNIRWREMTKEI  103

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VYKEMES+QN ++ YP+YYL+PFHAYDEGNLSWLAAAEAEPAT+++  RAIPDA+S
Sbjct  104   LESEVYKEMESVQNPNIVYPNYYLNPFHAYDEGNLSWLAAAEAEPATLSITRRAIPDASS  163

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             LDEA +VVRGNWL  IEKHH+QYS    + +ILDIGCSIG STR LA +YPSAN+TGLDL
Sbjct  164   LDEAIEVVRGNWLRVIEKHHQQYSQNSTVGNILDIGCSIGWSTRFLADKYPSANVTGLDL  223

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQFKEK+R  +     WIHANGEDTGLP+KSFDL+SI+YV HECP +A  N+V
Sbjct  224   SPYFLAVAQFKEKSRPSRGKCINWIHANGEDTGLPAKSFDLISIAYVLHECPAKATVNLV  283

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++TDNSPKSKKLQEL PVLFTLMKSTEPFLDEYYL DLE  + EAGF
Sbjct  284   KEAFRLLRPGGTIAITDNSPKSKKLQELSPVLFTLMKSTEPFLDEYYLLDLEATLSEAGF  343

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
              +V +VLTDPRHRTVTATVP
Sbjct  344   THVHTVLTDPRHRTVTATVP  363



>ref|XP_004505504.1| PREDICTED: uncharacterized protein LOC101512863 isoform X1 [Cicer 
arietinum]
Length=398

 Score =   496 bits (1276),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 247/353 (70%), Positives = 284/353 (80%), Gaps = 30/353 (8%)
 Frame = +1

Query  274   VEV--YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWRE  447
             VEV  YEEG+L RP+W+GETPLSR V ALISFKPLYS+LK+GARQV ISTAEK NIPWRE
Sbjct  45    VEVGSYEEGKLVRPKWTGETPLSRMVRALISFKPLYSILKLGARQVLISTAEKNNIPWRE  104

Query  448   MAKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAI  627
             M KEILES VYKEM++IQN SL YPDYYL+PFHAYDEGNL+WLAAAEAE AT +M  RAI
Sbjct  105   MTKEILESQVYKEMDTIQNHSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATKSMVRRAI  164

Query  628   PDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANL  807
             P+A+S+DEA+Q++RGNWL AIE+HH Q+S    I DILDIGCS+GVS+RCLA ++P+AN+
Sbjct  165   PNASSIDEATQILRGNWLQAIEQHHLQHSQTSMISDILDIGCSVGVSSRCLADKFPTANV  224

Query  808   TGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERA  987
             TGLDLSPYFLAVAQ KEK    + NP +WIHANGEDTGLPSKSFDLVSI+YVFHECP RA
Sbjct  225   TGLDLSPYFLAVAQHKEKRGAPRKNPIKWIHANGEDTGLPSKSFDLVSIAYVFHECPARA  284

Query  988   IRNVVNESFRLLRPGGTFSVTDNS----------------------------PKSKKLQE  1083
             I NVV E+FRLLRPGGT ++TDNS                            PKSK LQE
Sbjct  285   IVNVVKEAFRLLRPGGTLAMTDNSVYKILIMFFFNKKIMFLSQTLIFFFLLQPKSKVLQE  344

Query  1084  LPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTATVP  1242
             L PVLFTLMKSTEPFLDEYYLTD++  + EAGFVN+ S+LT+PRH T+TATVP
Sbjct  345   LSPVLFTLMKSTEPFLDEYYLTDMDETLMEAGFVNITSILTNPRHVTLTATVP  397



>gb|KDP31787.1| hypothetical protein JCGZ_12248 [Jatropha curcas]
Length=362

 Score =   493 bits (1269),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 243/321 (76%), Positives = 279/321 (87%), Gaps = 0/321 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LE P+W+G+TPLSR VGALISFKPL ++LK GARQV ISTAEK NIPWREM++EI
Sbjct  42    YEEGKLEMPKWAGQTPLSRLVGALISFKPLSAVLKFGARQVLISTAEKRNIPWREMSREI  101

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LESDV KE+E++QN S+ YPDYYLSPFHAYDEGNLSWLAAAEAEPATM+M  RAIPDA++
Sbjct  102   LESDVCKELENVQNPSITYPDYYLSPFHAYDEGNLSWLAAAEAEPATMSMVRRAIPDAST  161

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             L+EA+QV+RGNWLDAIE+HH + SG   I DILD+GCS+GVSTR LA ++PSA +TGLDL
Sbjct  162   LEEANQVMRGNWLDAIEQHHLRCSGNSMISDILDVGCSVGVSTRFLADKFPSAKVTGLDL  221

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQFKEKN   + NP RWIHANGEDTGLPSKS+DLVS + V HECPERAI  + 
Sbjct  222   SPYFLAVAQFKEKNGTPRKNPIRWIHANGEDTGLPSKSYDLVSFAAVLHECPERAIVGLF  281

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT S+TD +PKSK LQEL PVLFTL KSTEPFLDEYYLTD+E  ++E GF
Sbjct  282   KEAFRLLRPGGTISLTDQAPKSKILQELSPVLFTLFKSTEPFLDEYYLTDIEGRLKEVGF  341

Query  1183  VNVQSVLTDPRHRTVTATVPY  1245
             VNV SVLTDPRH TVTATVP+
Sbjct  342   VNVHSVLTDPRHLTVTATVPH  362



>ref|XP_007048668.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX92825.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=375

 Score =   492 bits (1267),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 239/322 (74%), Positives = 277/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
              YEEG LE P+W+GETPLSR V AL+SFKPLYSLLK+GARQV ISTAEK NIPWREM++E
Sbjct  52    AYEEGNLEMPKWAGETPLSRLVKALVSFKPLYSLLKLGARQVLISTAEKNNIPWREMSRE  111

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             ILESDVYKE+ SI+N SL+YPDYYLSPFHAYDEGNLSWLAAAEAE ATM++  RAIP A+
Sbjct  112   ILESDVYKELHSIENPSLQYPDYYLSPFHAYDEGNLSWLAAAEAEVATMSVARRAIPHAS  171

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA++ +RGNWL  IE+HH ++SG   I +I+DIGCS+GVSTR LA ++PSA +TGLD
Sbjct  172   SIEEATKELRGNWLQVIEQHHMKHSGS-TIENIIDIGCSVGVSTRFLADKFPSAKVTGLD  230

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFL+VAQFKEK R  + NP RWIHA GE TGLPSKSFDLVS SYVFHECPERAI  +
Sbjct  231   LSPYFLSVAQFKEKKRASRENPIRWIHAAGEHTGLPSKSFDLVSFSYVFHECPERAIIAL  290

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             V E+FRLLRPGGT  +TD SPKSK LQEL P LFTL+KSTEPFL+EYYLTDLE  +RE G
Sbjct  291   VTEAFRLLRPGGTIVLTDQSPKSKILQELSPALFTLLKSTEPFLNEYYLTDLEGRLREVG  350

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVN+Q+VLTDPRH T+TATVP+
Sbjct  351   FVNIQTVLTDPRHMTMTATVPH  372



>ref|XP_006446768.1| hypothetical protein CICLE_v10015734mg [Citrus clementina]
 gb|ESR60008.1| hypothetical protein CICLE_v10015734mg [Citrus clementina]
Length=358

 Score =   488 bits (1256),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 239/324 (74%), Positives = 276/324 (85%), Gaps = 2/324 (1%)
 Frame = +1

Query  274   VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
             V  YEEGQLERP+W+GETPLSR VGALISFKP+ ++LK GARQV ISTAEK +IPWR M 
Sbjct  37    VATYEEGQLERPKWAGETPLSRLVGALISFKPISAVLKFGARQVLISTAEKNDIPWRAMT  96

Query  454   KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
             KEILESDVYKEMESIQN+S+ YPDYYL+PFHAYD+GNLSWLAAAEAE A ++M  RA+P 
Sbjct  97    KEILESDVYKEMESIQNRSVVYPDYYLNPFHAYDDGNLSWLAAAEAEAANLSMTRRAMPY  156

Query  634   ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
             A+S+D+A+ V+RGNWL AIEKHH+QY+G    RDILDIGCS+GVST+CLA ++PSA +TG
Sbjct  157   ASSVDKANDVMRGNWLQAIEKHHQQYAG--ETRDILDIGCSVGVSTKCLADKFPSAKVTG  214

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             LDLSPYFLAVAQ KEK    + NP  W+HA GED+GLPSKSFD+VS+SYV HECPER I 
Sbjct  215   LDLSPYFLAVAQLKEKKGGPRKNPISWVHAIGEDSGLPSKSFDVVSLSYVLHECPERTII  274

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE  1173
              ++ E+FRLLRPGGT ++ D +PKSK LQEL PVLFTLMKSTEPFLDEY LTDLE   RE
Sbjct  275   ALLKEAFRLLRPGGTIALNDIAPKSKILQELSPVLFTLMKSTEPFLDEYCLTDLEGRTRE  334

Query  1174  AGFVNVQSVLTDPRHRTVTATVPY  1245
             AGFVNV SVLTDPRHRTVT TVP+
Sbjct  335   AGFVNVTSVLTDPRHRTVTGTVPH  358



>gb|KHG04685.1| Malonyl-CoA O-methyltransferase BioC [Gossypium arboreum]
Length=374

 Score =   487 bits (1254),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 237/322 (74%), Positives = 277/322 (86%), Gaps = 0/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
              Y+EG  ERP+W+ ETP SR V ALISFKP YSLLK+GARQV ISTAEK NIPWREM KE
Sbjct  50    AYKEGDRERPKWADETPFSRLVEALISFKPFYSLLKLGARQVLISTAEKNNIPWREMTKE  109

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             ILESDVYKE+++IQN SL+YPDYYLSPFHAYDEGNLSWLAAAEAE ATM+M  RAIP A 
Sbjct  110   ILESDVYKELKTIQNTSLQYPDYYLSPFHAYDEGNLSWLAAAEAEVATMSMTRRAIPYAP  169

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S +EA+Q +RGNW+ AI++HH ++SG   I++I+DIGCS+GVSTR LA  +PSA +TGLD
Sbjct  170   SNEEATQEMRGNWVQAIKQHHMKHSGNVTIQNIVDIGCSVGVSTRFLADEFPSAKVTGLD  229

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFL+VAQ+KEK R  + NP RWIHA GE+TGLPSKSFDLVS SYVFHECPERAI  +
Sbjct  230   LSPYFLSVAQYKEKKRPPRKNPIRWIHAAGENTGLPSKSFDLVSFSYVFHECPERAIIAL  289

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             VNE+FRLLRPGGT ++TD +PKSK LQEL P LFTLMKSTEPFL+EYYLTDLE  +REAG
Sbjct  290   VNEAFRLLRPGGTLAITDQAPKSKILQELSPALFTLMKSTEPFLNEYYLTDLEERLREAG  349

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVN++++LTDPRH T+TATVP+
Sbjct  350   FVNMKTLLTDPRHMTMTATVPH  371



>ref|XP_007132899.1| hypothetical protein PHAVU_011G134400g [Phaseolus vulgaris]
 gb|ESW04893.1| hypothetical protein PHAVU_011G134400g [Phaseolus vulgaris]
Length=374

 Score =   486 bits (1252),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 281/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LERP+W+GETPLSR V ALISFKPLYS+LK+GAR+VFISTAEK NIPWR+MAKE+
Sbjct  54    YEEGKLERPKWAGETPLSRLVQALISFKPLYSVLKLGARRVFISTAEKNNIPWRQMAKEV  113

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VY+EM+SIQNQSL YPDYYL+PFHAY+EGNL+WLAAAEAE ATM+M  RA+P+A+S
Sbjct  114   LESEVYREMDSIQNQSLVYPDYYLNPFHAYEEGNLTWLAAAEAEAATMSMVRRALPNASS  173

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             L+EA+Q++RGNWL AIE+HH QYS    + DILDIGCS+G+ST+ LA ++P+A +TGLDL
Sbjct  174   LEEATQILRGNWLHAIEQHHIQYSESSVVNDILDIGCSVGISTKYLADKFPTAKVTGLDL  233

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEK    +  P RWIHANGEDTGLPSKSFDLVS+++V HECP R I N+V
Sbjct  234   SPYFLAVAQHKEKRAMPRKIPVRWIHANGEDTGLPSKSFDLVSLAFVLHECPTRVILNLV  293

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++TD S KSK LQEL PVLFTL+KSTEPFLDEYYLTD++  +REAGF
Sbjct  294   REAFRLLRPGGTLALTDFSLKSKVLQELSPVLFTLIKSTEPFLDEYYLTDMDETLREAGF  353

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VN+ S+LTDP+H T+TATVP
Sbjct  354   VNITSILTDPKHVTITATVP  373



>gb|KHN07753.1| Demethylmenaquinone methyltransferase [Glycine soja]
Length=323

 Score =   483 bits (1244),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 233/320 (73%), Positives = 277/320 (87%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LERP+W GETPLSR V ALISFKPLYS+LK+GAR+  ISTAEK NIPWR+MAKEI
Sbjct  4     YEEGKLERPKWVGETPLSRLVQALISFKPLYSVLKLGARRALISTAEKNNIPWRQMAKEI  63

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VY+E+++IQNQSL YPDYYL+PFHAYDEGNL+WLAAAEAE AT+++  RAIPDA+S
Sbjct  64    LESEVYRELDNIQNQSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATLSIAKRAIPDASS  123

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
               EA+Q++RGNWL AIE+HH QYS    I DILDIGCS+G+STR LA ++P+A +TGLDL
Sbjct  124   TQEANQILRGNWLRAIEQHHMQYSESSVINDILDIGCSVGISTRYLADKFPTAKVTGLDL  183

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEKN   +  P RWIHANGEDTGLPSKSF+LVSI++V HECP RAI N+V
Sbjct  184   SPYFLAVAQHKEKNAPPRKFPVRWIHANGEDTGLPSKSFNLVSIAFVVHECPARAIVNLV  243

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++ D++ KSK LQEL PVLFTL+KSTEPFLDEYYLTD++  +REAGF
Sbjct  244   REAFRLLRPGGTLALVDSTTKSKVLQELSPVLFTLLKSTEPFLDEYYLTDMDETLREAGF  303

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
              N+ S+LTDPRH T+TATVP
Sbjct  304   GNITSILTDPRHVTITATVP  323



>ref|XP_009396994.1| PREDICTED: uncharacterized protein LOC103981946 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=374

 Score =   484 bits (1245),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 235/319 (74%), Positives = 273/319 (86%), Gaps = 0/319 (0%)
 Frame = +1

Query  289   EGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILE  468
             EG+LE PRW+GET LSRF+GALISFKPL+S++K+GARQ+ I  AEKTNIPWREM  EIL 
Sbjct  55    EGELELPRWAGETSLSRFIGALISFKPLFSVMKLGARQLLIGNAEKTNIPWREMTNEILN  114

Query  469   SDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLD  648
             SDVYKEMES+QN SL YPDYYL+PFHAYDEGNLSWLAAAEAE ATM++   A+PDA ++D
Sbjct  115   SDVYKEMESVQNPSLVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSIAKLAVPDAPTVD  174

Query  649   EASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSP  828
             EA+++VRG WL AIE H KQYSG   I DILDIGCSIGVSTR LA  +PSAN+TGLDLSP
Sbjct  175   EANKIVRGKWLKAIENHLKQYSGNSEINDILDIGCSIGVSTRYLAEMFPSANVTGLDLSP  234

Query  829   YFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNE  1008
             YFL+VAQ+KEK +  +  P RWIHANGE TGLPSKSFDLVS++YV HECP RA   +VNE
Sbjct  235   YFLSVAQYKEKKKAARIKPIRWIHANGECTGLPSKSFDLVSLAYVLHECPRRATIGLVNE  294

Query  1009  SFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVN  1188
             +FRLLRPGGT +VTDNSPKSK LQEL P  FTL+KSTEPFLDEYYL DLE+ MR+AGFV+
Sbjct  295   AFRLLRPGGTIAVTDNSPKSKVLQELSPAKFTLLKSTEPFLDEYYLLDLEKTMRDAGFVS  354

Query  1189  VQSVLTDPRHRTVTATVPY  1245
             V++++T PRHRTVTATVP+
Sbjct  355   VRTIMTSPRHRTVTATVPH  373



>gb|KHN09219.1| Demethylmenaquinone methyltransferase [Glycine soja]
Length=366

 Score =   483 bits (1242),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 277/320 (87%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LERP+W GETPLSR V ALISFKPL+S+LK+GAR+  ISTAEK NIPWR+MA+EI
Sbjct  46    YEEGKLERPKWVGETPLSRLVQALISFKPLFSVLKLGARRALISTAEKNNIPWRKMAQEI  105

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VY+E+ESIQNQSL YPDYYL+PFHAY+EGNL+WLAAAEAE ATM+M  RA+PDA+S
Sbjct  106   LESEVYRELESIQNQSLVYPDYYLNPFHAYEEGNLTWLAAAEAEAATMSMARRALPDASS  165

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             + EA+Q++RGNWL AIE+HH QYS    I DILDIGCS+G+STR LA ++P+A +TGLDL
Sbjct  166   IQEANQILRGNWLHAIEQHHMQYSESCVIDDILDIGCSVGISTRYLADKFPTAKVTGLDL  225

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEK    +  P +WIHANGEDTGLPSKSFDLVSI++V HECP R I N+V
Sbjct  226   SPYFLAVAQHKEKRAMPRKFPIKWIHANGEDTGLPSKSFDLVSIAFVLHECPTRVIVNLV  285

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++TD S KSK LQEL PVLFTL+KSTEPFLDEYYLTD++  +REAGF
Sbjct  286   REAFRLLRPGGTLALTDFSLKSKVLQELSPVLFTLVKSTEPFLDEYYLTDMDETLREAGF  345

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VN+ S+LTDPRH T+TATVP
Sbjct  346   VNITSILTDPRHVTITATVP  365



>ref|XP_003539964.1| PREDICTED: uncharacterized protein LOC100788294 [Glycine max]
Length=373

 Score =   482 bits (1241),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 277/320 (87%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LERP+W GETPLSR V ALISFKPL+S+LK+GAR+  ISTAEK NIPWR+MA+EI
Sbjct  53    YEEGKLERPKWVGETPLSRLVQALISFKPLFSVLKLGARRALISTAEKNNIPWRKMAQEI  112

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VY+E+ESIQNQSL YPDYYL+PFHAY+EGNL+WLAAAEAE ATM+M  RA+PDA+S
Sbjct  113   LESEVYRELESIQNQSLVYPDYYLNPFHAYEEGNLTWLAAAEAEAATMSMARRALPDASS  172

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             + EA+Q++RGNWL AIE+HH QYS    I DILDIGCS+G+STR LA ++P+A +TGLDL
Sbjct  173   IQEANQILRGNWLHAIEQHHMQYSESCVIDDILDIGCSVGISTRYLADKFPTAKVTGLDL  232

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEK    +  P +WIHANGEDTGLPSKSFDLVSI++V HECP R I N+V
Sbjct  233   SPYFLAVAQHKEKRAMPRKFPIKWIHANGEDTGLPSKSFDLVSIAFVLHECPTRVIVNLV  292

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++TD S KSK LQEL PVLFTL+KSTEPFLDEYYLTD++  +REAGF
Sbjct  293   REAFRLLRPGGTLALTDFSLKSKVLQELSPVLFTLVKSTEPFLDEYYLTDMDETLREAGF  352

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VN+ S+LTDPRH T+TATVP
Sbjct  353   VNITSILTDPRHVTITATVP  372



>ref|XP_010279097.1| PREDICTED: uncharacterized protein LOC104613100 [Nelumbo nucifera]
Length=377

 Score =   482 bits (1241),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 230/320 (72%), Positives = 276/320 (86%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             +EEG+LERPRW GETPLSR VGALISF+PL+S++K+GARQV ISTAEKTNIPWR+M +EI
Sbjct  58    FEEGKLERPRWVGETPLSRLVGALISFRPLFSIMKLGARQVLISTAEKTNIPWRKMTEEI  117

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             L+S+VYKE++SIQ+ S+ YPDYYL+PFHAYDEGNLSWLAAAEAE ATM++  RA+P  +S
Sbjct  118   LDSEVYKELDSIQDSSVVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSIAKRAVPHTSS  177

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             +DEA ++VRGNWL AIE+++ Q+S    ++DILD+GCS+GVSTR LA ++P A +TGLDL
Sbjct  178   VDEAYEIVRGNWLQAIEQYYLQHSSNPMMKDILDVGCSVGVSTRFLADKFPRAKVTGLDL  237

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQFKEK R  + NP RW+HANGE TGLPS+SFDLVS++YV HECP RAI  +V
Sbjct  238   SPYFLAVAQFKEKERAPRKNPIRWVHANGEATGLPSESFDLVSLAYVLHECPRRAIIGLV  297

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGG  ++TDNSPKSK +QEL PVLFTLMKSTEPFLDEYYLTDLE  MRE GF
Sbjct  298   KEAFRLLRPGGMIALTDNSPKSKIIQELSPVLFTLMKSTEPFLDEYYLTDLEETMREVGF  357

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VNV ++LTDPRHRTV   VP
Sbjct  358   VNVHTILTDPRHRTVMGMVP  377



>ref|XP_003527390.1| PREDICTED: uncharacterized protein LOC100785497 [Glycine max]
Length=373

 Score =   482 bits (1240),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/320 (73%), Positives = 276/320 (86%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LERP+W GETPLSR V ALISFKP YS+LK+GAR+  ISTAEK NIPWR+MAKEI
Sbjct  54    YEEGKLERPKWVGETPLSRLVQALISFKPFYSVLKLGARRALISTAEKNNIPWRQMAKEI  113

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VY+E+++IQNQSL YPDYYL+PFHAYDEGNL+WLAAAEAE AT+++  RAIPDA+S
Sbjct  114   LESEVYRELDNIQNQSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATLSIAKRAIPDASS  173

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
               EA+Q++RGNWL AIE+HH QYS    I DILDIGCS+G+STR LA ++P+A +TGLDL
Sbjct  174   TQEANQILRGNWLRAIEQHHMQYSESSVINDILDIGCSVGISTRYLADKFPTAKVTGLDL  233

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEKN   +  P RWIHANGEDTGLPSKSF+LVSI++V HECP RAI N+V
Sbjct  234   SPYFLAVAQHKEKNAPPRKFPIRWIHANGEDTGLPSKSFNLVSIAFVVHECPARAIVNLV  293

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++ D++ KSK LQEL PVLFTL+KSTEPFLDEYYLTD++  +REAGF
Sbjct  294   REAFRLLRPGGTLALVDSTTKSKVLQELSPVLFTLLKSTEPFLDEYYLTDMDETLREAGF  353

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
              N+ S+LTDPRH T+TATVP
Sbjct  354   GNITSILTDPRHVTITATVP  373



>gb|ABB46958.2| CMV 1a interacting protein 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG99586.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50659.1| hypothetical protein OsJ_30889 [Oryza sativa Japonica Group]
Length=364

 Score =   480 bits (1236),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 235/322 (73%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGETPLSR VGALI+FKPLYSL+K+ +R+V I TAEK+N+PWREM K+
Sbjct  44    VPKEGSLERPAWSGETPLSRLVGALIAFKPLYSLMKLASREVIIRTAEKSNVPWREMTKQ  103

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  + I++ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAIPDA 
Sbjct  104   VLESDVYEVFDRIRDLNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPDAG  163

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+AIE+HH +YSG   I DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  164   SIEEANQIVRGNWLNAIEEHHLKYSGNCQINDILDIGCSVGVSTRYLAEKFPSARTVGLD  223

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  KE+   R+ NP RW+HANGE TGLPS SFDLVS++YV HECP RAI  +
Sbjct  224   LSPYFLAVAAHKEEKLSRQ-NPIRWVHANGEATGLPSNSFDLVSLAYVCHECPARAITGL  282

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             VNE+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  MR+AG
Sbjct  283   VNEAFRLLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETMRQAG  342

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV S+LTDPRHRTVTATVP+
Sbjct  343   FVNVHSILTDPRHRTVTATVPF  364



>ref|NP_001064252.1| Os10g0181600 [Oryza sativa Japonica Group]
 dbj|BAF26166.1| Os10g0181600, partial [Oryza sativa Japonica Group]
Length=361

 Score =   480 bits (1235),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 235/322 (73%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGETPLSR VGALI+FKPLYSL+K+ +R+V I TAEK+N+PWREM K+
Sbjct  41    VPKEGSLERPAWSGETPLSRLVGALIAFKPLYSLMKLASREVIIRTAEKSNVPWREMTKQ  100

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  + I++ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAIPDA 
Sbjct  101   VLESDVYEVFDRIRDLNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPDAG  160

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+AIE+HH +YSG   I DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  161   SIEEANQIVRGNWLNAIEEHHLKYSGNCQINDILDIGCSVGVSTRYLAEKFPSARTVGLD  220

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  KE+   R+ NP RW+HANGE TGLPS SFDLVS++YV HECP RAI  +
Sbjct  221   LSPYFLAVAAHKEEKLSRQ-NPIRWVHANGEATGLPSNSFDLVSLAYVCHECPARAITGL  279

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             VNE+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  MR+AG
Sbjct  280   VNEAFRLLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETMRQAG  339

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV S+LTDPRHRTVTATVP+
Sbjct  340   FVNVHSILTDPRHRTVTATVPF  361



>gb|EEC66646.1| hypothetical protein OsI_32910 [Oryza sativa Indica Group]
Length=364

 Score =   479 bits (1233),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/322 (73%), Positives = 275/322 (85%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGETPLSR VG LI+FKPLYSL+K+ +R+V I TAEK+N+PWREM K+
Sbjct  44    VPKEGSLERPAWSGETPLSRLVGGLIAFKPLYSLMKLASREVIIRTAEKSNVPWREMTKQ  103

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  + I++ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAIPDA 
Sbjct  104   VLESDVYEVFDRIRDLNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPDAG  163

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+AIE+HH +YSG   I DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  164   SIEEANQIVRGNWLNAIEEHHLKYSGNCQINDILDIGCSVGVSTRYLAEKFPSARTVGLD  223

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  KE+   R+ NP RW+HANGE TGLPS SFDLVS++YV HECP RAI  +
Sbjct  224   LSPYFLAVAAHKEEKLSRQ-NPIRWVHANGEATGLPSNSFDLVSLAYVCHECPARAITGL  282

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             VNE+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  MR+AG
Sbjct  283   VNEAFRLLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETMRQAG  342

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV S+LTDPRHRTVTATVP+
Sbjct  343   FVNVHSILTDPRHRTVTATVPF  364



>ref|XP_002468229.1| hypothetical protein SORBIDRAFT_01g042150 [Sorghum bicolor]
 gb|EER95227.1| hypothetical protein SORBIDRAFT_01g042150 [Sorghum bicolor]
Length=362

 Score =   476 bits (1226),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 236/322 (73%), Positives = 272/322 (84%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGETPLSR VGALI+FKPLYSLLK+ +R+V I TAEK+NIPWREM KE
Sbjct  42    VPQEGALERPAWSGETPLSRLVGALIAFKPLYSLLKLASREVIIRTAEKSNIPWREMTKE  101

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  E IQ+ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAIPDA 
Sbjct  102   VLESDVYEVFERIQDPNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPDAT  161

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+ IE+HH +YSG   + DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  162   SIEEANQIVRGNWLNVIEEHHVKYSGNCQVNDILDIGCSVGVSTRYLAEKFPSAQAVGLD  221

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  KE+   R  NP RW+HANGE TGLPS SFDLVS++YV HECP RAI  +
Sbjct  222   LSPYFLAVAAQKEEKLLRP-NPIRWVHANGEATGLPSDSFDLVSLAYVCHECPARAITGL  280

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             V E+FR+LRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  MR+ G
Sbjct  281   VKEAFRVLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETMRKVG  340

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV S+LTDPRHRTVTATVPY
Sbjct  341   FVNVCSILTDPRHRTVTATVPY  362



>ref|XP_006662228.1| PREDICTED: uncharacterized protein LOC102700742 [Oryza brachyantha]
Length=363

 Score =   476 bits (1226),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 232/320 (73%), Positives = 274/320 (86%), Gaps = 1/320 (0%)
 Frame = +1

Query  286   EEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEIL  465
             +EG LERP WSGETPLSR VGALI+FKPLYSL+K+ +R+V I TAEK+NIPWREM K++L
Sbjct  45    QEGSLERPAWSGETPLSRLVGALIAFKPLYSLMKLASREVIIRTAEKSNIPWREMTKQVL  104

Query  466   ESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSL  645
             ESDVY+  + I++ +L YPDYYLSPFHAYDEGNLSWLAAAEAEPATM++  RAIPDA S+
Sbjct  105   ESDVYELFDRIRDLNLVYPDYYLSPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPDAGSI  164

Query  646   DEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLS  825
             +EA+Q+VRGNWL+A+E+HH +YSG   I DILD+GCS+GVSTR LA ++PSA   GLDLS
Sbjct  165   EEANQIVRGNWLNAVEEHHLKYSGNCQINDILDVGCSVGVSTRYLAEKFPSAKAVGLDLS  224

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PYFLAVA  KE+   RK NP RW+HANGE TGLPS SFDLVS++YV HECP RAI  +VN
Sbjct  225   PYFLAVAAHKEEKLSRK-NPIRWVHANGESTGLPSNSFDLVSLAYVCHECPARAITGLVN  283

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPF+DEYY+ DLE  M++AGFV
Sbjct  284   EAFRLLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFIDEYYMLDLEETMKQAGFV  343

Query  1186  NVQSVLTDPRHRTVTATVPY  1245
             NV S+LTDPRHRTVT TVP+
Sbjct  344   NVHSILTDPRHRTVTGTVPF  363



>ref|XP_006828793.1| hypothetical protein AMTR_s00001p00117690 [Amborella trichopoda]
 gb|ERM96209.1| hypothetical protein AMTR_s00001p00117690 [Amborella trichopoda]
Length=365

 Score =   476 bits (1225),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 231/319 (72%), Positives = 269/319 (84%), Gaps = 0/319 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LERPRW+GETPLSR V A+I FKPLYS+LK GARQVFISTA+K  IPW EM K+I
Sbjct  44    YEEGELERPRWAGETPLSRIVAAIIEFKPLYSILKFGARQVFISTAQKKEIPWVEMRKQI  103

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             + SDVYKE  ++++ SL YPDYYL PFHAYDEGNLSWLAAAEAEPATM+M LRAIP+A+S
Sbjct  104   MSSDVYKEKAAVEDPSLVYPDYYLKPFHAYDEGNLSWLAAAEAEPATMSMALRAIPEASS  163

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
              +EA+ V+RGNWLDAI++HH Q++    I+DILDIGCSIG+ST  L  +YPSA +TGLDL
Sbjct  164   AEEANSVMRGNWLDAIKRHHLQFAKGCEIKDILDIGCSIGISTTFLVEKYPSAKVTGLDL  223

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ+KE  R  + NP RW+HANGE TGL S SFDLVS++YV HECP+RA  N+V
Sbjct  224   SPYFLAVAQYKETRRPPRKNPIRWVHANGESTGLSSASFDLVSLAYVIHECPQRATINLV  283

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGG  ++TDNSPKSKKLQ+L PVLFTLMKSTEPFLDEYY  +LE  MR  GF
Sbjct  284   KEAFRLLRPGGMIAITDNSPKSKKLQDLSPVLFTLMKSTEPFLDEYYTLNLEETMRRVGF  343

Query  1183  VNVQSVLTDPRHRTVTATV  1239
             VNVQS+LTDPRHRTVT TV
Sbjct  344   VNVQSLLTDPRHRTVTGTV  362



>gb|KHN07754.1| Demethylmenaquinone methyltransferase [Glycine soja]
Length=324

 Score =   473 bits (1218),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 275/320 (86%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LERP+W GETPLSR V ALISFKPL+S+LK+G+R+  ISTAEK NIPWR+MAKEI
Sbjct  4     YEEGKLERPKWVGETPLSRLVQALISFKPLFSVLKLGSRRALISTAEKNNIPWRQMAKEI  63

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VY+E+++IQNQSL YPDYYL+PFHAYDEGNL+WLAAAEAE ATM++  RA+PDA+S
Sbjct  64    LESEVYRELDNIQNQSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATMSIARRAVPDASS  123

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
               EA +++RGNWL AIE+HH QYS  F I DILDIGCSIG+STR LA +YP+A +TGLDL
Sbjct  124   TQEAIKILRGNWLRAIEQHHIQYSESFVINDILDIGCSIGISTRYLADKYPTAKVTGLDL  183

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEK+   +  P RWIHANGE+TGLPSKSF+LVSI++VFHECP R I N+V
Sbjct  184   SPYFLAVAQNKEKSAPPRKFPIRWIHANGENTGLPSKSFNLVSIAFVFHECPTRVIVNIV  243

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++ D+S KSK +QEL PVLFTL K TEPF+DE+YLTD++  +REAGF
Sbjct  244   REAFRLLRPGGTLALIDSSMKSKVVQELSPVLFTLYKCTEPFIDEFYLTDMDETLREAGF  303

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VN+ S+LT PRH T+TATVP
Sbjct  304   VNITSILTSPRHATITATVP  323



>ref|XP_003527391.1| PREDICTED: uncharacterized protein LOC100786025 [Glycine max]
Length=374

 Score =   474 bits (1219),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 274/320 (86%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG+LERP+W GETPLSR V ALISFKPL+S+LK+G+R+  ISTAEK NIPWR+MAKEI
Sbjct  54    YEEGKLERPKWVGETPLSRLVQALISFKPLFSVLKLGSRRALISTAEKNNIPWRQMAKEI  113

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VY+E+++IQNQSL YPDYYL+PFHAYDEGNL+WLAAAEAE ATM++  RA+PDA+S
Sbjct  114   LESEVYRELDNIQNQSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATMSIARRAVPDASS  173

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
               EA +++RGNWL AIE+HH QYS  F I DILDIGCSIG+STR LA +YP+A +TGLDL
Sbjct  174   TQEAIKILRGNWLRAIEQHHIQYSESFVINDILDIGCSIGISTRYLADKYPTAKVTGLDL  233

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ KEK+   +  P RWIHANGEDTGLPSKSF+LVSI++VFHECP R I N+V
Sbjct  234   SPYFLAVAQHKEKSAPPRKFPIRWIHANGEDTGLPSKSFNLVSIAFVFHECPTRVIVNIV  293

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FRLLRPGGT ++ D+S KSK +QEL PVLFTL K TEPF+DE+YLTD++  +REAGF
Sbjct  294   REAFRLLRPGGTLALIDSSMKSKVVQELSPVLFTLYKCTEPFIDEFYLTDMDETLREAGF  353

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             VN+ S+LT PRH T+TAT P
Sbjct  354   VNITSILTSPRHATITATAP  373



>ref|XP_004983347.1| PREDICTED: uncharacterized protein LOC101786045 isoform X2 [Setaria 
italica]
Length=362

 Score =   471 bits (1213),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 273/322 (85%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGETPLSR VGALI+FKPLYSL+K+ +R+V I TAEK+NIPWREM K+
Sbjct  42    VPQEGALERPAWSGETPLSRLVGALIAFKPLYSLMKLASREVIIRTAEKSNIPWREMTKK  101

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  E I++ +L YP+YYLSPFHAYDEGNLSWLAAAEAEPATM++  RAIP+A 
Sbjct  102   VLESDVYEVFERIRDPNLVYPNYYLSPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPEAT  161

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+AIE+HH +YSG   I DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  162   SIEEANQIVRGNWLNAIEEHHLKYSGNCQINDILDIGCSVGVSTRYLAEKFPSAQAVGLD  221

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  +E+   R+ NP RW+HANGE TGLPS SFDLVS++YV HECP RAI  +
Sbjct  222   LSPYFLAVAAQREEKLSRQ-NPIRWVHANGEATGLPSDSFDLVSLAYVCHECPARAITGL  280

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             V E+FR+LRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  MR+ G
Sbjct  281   VKEAFRVLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETMRQVG  340

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             F+NV S+LTD RHRTVTATVPY
Sbjct  341   FINVCSILTDARHRTVTATVPY  362



>ref|XP_008456428.1| PREDICTED: uncharacterized protein LOC103496371 [Cucumis melo]
Length=365

 Score =   467 bits (1202),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 227/323 (70%), Positives = 270/323 (84%), Gaps = 1/323 (0%)
 Frame = +1

Query  274   VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
             V VYEEG+LERP WSG+TPLSR VGALISFKPLYS+LK+GARQV ISTAEK NI WR++ 
Sbjct  43    VGVYEEGRLERPNWSGQTPLSRLVGALISFKPLYSILKLGARQVLISTAEKKNISWRKLT  102

Query  454   KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
              ++LESDVYKE++S+QN S+ YPDYYL PFHAYDEGNLSWLAAAE +PATM+M +RA+P 
Sbjct  103   SDVLESDVYKELDSVQNPSIVYPDYYLKPFHAYDEGNLSWLAAAEVQPATMSMIMRAVPT  162

Query  634   ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
             A+S+DEA ++V GNWL  IE+HH +YSG   I DILDIGCS+G  TR LA ++P+A +TG
Sbjct  163   ASSVDEAKEIVFGNWLRRIEEHHLKYSGN-PILDILDIGCSVGFGTRQLADKFPTAKVTG  221

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             LDLSPYFLAVAQ+ +K +  + N  RW+H NGEDTGLPS+SFDL+SISYV HECP  AI 
Sbjct  222   LDLSPYFLAVAQYMDKKKTPRKNAIRWLHGNGEDTGLPSRSFDLLSISYVLHECPHVAIV  281

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE  1173
             N++ ESFRLLRPGGT  +TD + KSK +QEL PVLFTL+KSTEP+LDEY+LTDLE  MRE
Sbjct  282   NIIRESFRLLRPGGTIVITDQASKSKVVQELSPVLFTLLKSTEPYLDEYHLTDLEEKMRE  341

Query  1174  AGFVNVQSVLTDPRHRTVTATVP  1242
              GFVNV S LTDPRH T+TATVP
Sbjct  342   IGFVNVTSRLTDPRHVTITATVP  364



>ref|NP_001150888.1| CMV 1a interacting protein 1 [Zea mays]
 gb|ACG40800.1| CMV 1a interacting protein 1 [Zea mays]
Length=359

 Score =   467 bits (1201),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 232/322 (72%), Positives = 269/322 (84%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGET LSR VGALI+FKPLYS+LK+ +R+V I TAEK+NIPWREM KE
Sbjct  39    VPQEGALERPAWSGETTLSRLVGALIAFKPLYSVLKLASREVIIRTAEKSNIPWREMTKE  98

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  E IQ+ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAIP+A 
Sbjct  99    VLESDVYEVFERIQDPNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPEAT  158

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+ IE+HH +YSG   + DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  159   SIEEANQIVRGNWLNVIEEHHLKYSGNCQVNDILDIGCSVGVSTRYLAEKFPSAQAVGLD  218

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  KE+   R   P RW+HANGE TGL S SFDLVS++YV HECP RAI  +
Sbjct  219   LSPYFLAVAAQKEEKLSRP-KPIRWVHANGEATGLSSDSFDLVSLAYVCHECPARAITAL  277

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             V E+FR+LRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  MR+ G
Sbjct  278   VKEAFRVLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETMRKVG  337

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV SVLTDPRHRTVTATVPY
Sbjct  338   FVNVCSVLTDPRHRTVTATVPY  359



>gb|AFW68873.1| CMV 1a interacting protein 1 [Zea mays]
Length=359

 Score =   466 bits (1200),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 269/322 (84%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGET LSR VGALI+FKPLY++LK+ +R+V I TAEK+NIPWREM KE
Sbjct  39    VPQEGALERPAWSGETTLSRLVGALIAFKPLYAVLKLASREVIIRTAEKSNIPWREMTKE  98

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  E IQ+ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAIP+A 
Sbjct  99    VLESDVYEVFERIQDPNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPEAT  158

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+ IE+HH +YSG   + DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  159   SIEEANQIVRGNWLNVIEEHHLKYSGNCQVNDILDIGCSVGVSTRYLAEKFPSAQAVGLD  218

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  KE+   R   P RW+HANGE TGL S SFDLVS++YV HECP RAI  +
Sbjct  219   LSPYFLAVAAQKEEKLSRP-KPIRWVHANGEATGLSSDSFDLVSLAYVCHECPARAITGL  277

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             V E+FR+LRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  MR+ G
Sbjct  278   VKEAFRVLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETMRKVG  337

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV SVLTDPRHRTVTATVPY
Sbjct  338   FVNVCSVLTDPRHRTVTATVPY  359



>gb|KGN47274.1| hypothetical protein Csa_6G241450 [Cucumis sativus]
Length=393

 Score =   461 bits (1186),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 225/322 (70%), Positives = 268/322 (83%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             VYEEG+LERP WSG+TPLSR VGALISFKPLYS+LK+GARQV ISTAEK NI WR++  +
Sbjct  73    VYEEGRLERPDWSGQTPLSRLVGALISFKPLYSILKLGARQVLISTAEKKNISWRKLTSD  132

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             ILESDVYKE++S+QN S+ YPDYYL PFHAYD+GNLSWLAAAE +PATM+M +RA+P A+
Sbjct  133   ILESDVYKELDSVQNPSIVYPDYYLKPFHAYDDGNLSWLAAAEVQPATMSMIMRAVPTAS  192

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S+DEA ++V GNWL  I++HH +YSG   I DILDIGCSIG  TR LA  +P+A +TGLD
Sbjct  193   SVDEAKEIVFGNWLRRIKEHHLKYSGN-PILDILDIGCSIGFGTRQLADEFPTAKVTGLD  251

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVAQ+ +K +  + N  RW+H NGEDTGLPS+SFDL+SISYV HECP  AI N+
Sbjct  252   LSPYFLAVAQYMDKKKAPRRNAIRWLHGNGEDTGLPSRSFDLLSISYVLHECPHVAIVNI  311

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             + ESFRLLRPGGT  +TD + KSK +QEL PVLFTL+KSTEP LDEY+LTDLE  M+E G
Sbjct  312   IKESFRLLRPGGTIVITDQASKSKVVQELSPVLFTLLKSTEPHLDEYHLTDLEEKMKEIG  371

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV S LTDPRH T+TATVP+
Sbjct  372   FVNVTSRLTDPRHVTITATVPF  393



>ref|XP_004150323.1| PREDICTED: uncharacterized protein LOC101215871 [Cucumis sativus]
Length=365

 Score =   460 bits (1183),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 225/322 (70%), Positives = 268/322 (83%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             VYEEG+LERP WSG+TPLSR VGALISFKPLYS+LK+GARQV ISTAEK NI WR++  +
Sbjct  45    VYEEGRLERPDWSGQTPLSRLVGALISFKPLYSILKLGARQVLISTAEKKNISWRKLTSD  104

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             ILESDVYKE++S+QN S+ YPDYYL PFHAYD+GNLSWLAAAE +PATM+M +RA+P A+
Sbjct  105   ILESDVYKELDSVQNPSIVYPDYYLKPFHAYDDGNLSWLAAAEVQPATMSMIMRAVPTAS  164

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S+DEA ++V GNWL  I++HH +YSG   I DILDIGCSIG  TR LA  +P+A +TGLD
Sbjct  165   SVDEAKEIVFGNWLRRIKEHHLKYSGN-PILDILDIGCSIGFGTRQLADEFPTAKVTGLD  223

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVAQ+ +K +  + N  RW+H NGEDTGLPS+SFDL+SISYV HECP  AI N+
Sbjct  224   LSPYFLAVAQYMDKKKAPRRNAIRWLHGNGEDTGLPSRSFDLLSISYVLHECPHVAIVNI  283

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             + ESFRLLRPGGT  +TD + KSK +QEL PVLFTL+KSTEP LDEY+LTDLE  M+E G
Sbjct  284   IKESFRLLRPGGTIVITDQASKSKVVQELSPVLFTLLKSTEPHLDEYHLTDLEEKMKEIG  343

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV S LTDPRH T+TATVP+
Sbjct  344   FVNVTSRLTDPRHVTITATVPF  365



>ref|XP_004171483.1| PREDICTED: uncharacterized LOC101215871 [Cucumis sativus]
Length=365

 Score =   459 bits (1182),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 225/322 (70%), Positives = 268/322 (83%), Gaps = 1/322 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             VYEEG+LERP WSG+TPLSR VGALISFKPLYS+LK+GARQV ISTAEK NI WR++  +
Sbjct  45    VYEEGRLERPDWSGQTPLSRLVGALISFKPLYSILKLGARQVLISTAEKKNISWRKLTSD  104

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             ILESDVYKE++S+QN S+ YPDYYL PFHAYD+GNLSWLAAAE +PATM+M +RA+P A+
Sbjct  105   ILESDVYKELDSVQNPSIVYPDYYLEPFHAYDDGNLSWLAAAEVQPATMSMIMRAVPTAS  164

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S+DEA ++V GNWL  I++HH +YSG   I DILDIGCSIG  TR LA  +P+A +TGLD
Sbjct  165   SVDEAKEIVFGNWLRRIKEHHLKYSGN-PILDILDIGCSIGFGTRQLADEFPTAKVTGLD  223

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVAQ+ +K +  + N  RW+H NGEDTGLPS+SFDL+SISYV HECP  AI N+
Sbjct  224   LSPYFLAVAQYMDKKKAPRRNAIRWLHGNGEDTGLPSRSFDLLSISYVLHECPHVAIVNI  283

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             + ESFRLLRPGGT  +TD + KSK +QEL PVLFTL+KSTEP LDEY+LTDLE  M+E G
Sbjct  284   IKESFRLLRPGGTIVITDQASKSKVVQELSPVLFTLLKSTEPHLDEYHLTDLEEKMKEIG  343

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV S LTDPRH T+TATVP+
Sbjct  344   FVNVTSRLTDPRHVTITATVPF  365



>ref|XP_003573821.1| PREDICTED: uncharacterized protein LOC100842468 [Brachypodium 
distachyon]
Length=373

 Score =   459 bits (1180),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 223/319 (70%), Positives = 267/319 (84%), Gaps = 1/319 (0%)
 Frame = +1

Query  286   EEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEIL  465
             +EG LERP WSGETP+SR VGALI+FKPLY+L+K+ +R+V I TAEK NIPWREM K++L
Sbjct  47    QEGALERPAWSGETPVSRLVGALIAFKPLYALMKLASREVIIRTAEKANIPWREMTKKVL  106

Query  466   ESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSL  645
             ESDVY+  E I++ +L YPDYYLSPFHAYDEGNLSWLAAAEAE AT+++  RAIP+A S+
Sbjct  107   ESDVYEVFERIRDPNLVYPDYYLSPFHAYDEGNLSWLAAAEAEAATLSIAKRAIPEATSI  166

Query  646   DEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLS  825
             +EA+Q+VRGNW++AIE+HH +YSG   I DILDIGCS+GVSTR LA R+PSA   GLDLS
Sbjct  167   EEANQIVRGNWMNAIEEHHLKYSGHRQINDILDIGCSVGVSTRYLADRFPSAKAVGLDLS  226

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PYFLAVA  KE+   R+ +P RW+HANGE+TGL    FD+VS++YV HECP RAI  +V 
Sbjct  227   PYFLAVAAQKEEKMSRQ-HPIRWVHANGEETGLSPDLFDVVSLAYVCHECPARAIHGLVK  285

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  + +AGFV
Sbjct  286   EAFRLLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEEALSQAGFV  345

Query  1186  NVQSVLTDPRHRTVTATVP  1242
             NV S+ TDPRHRTVTATVP
Sbjct  346   NVHSIFTDPRHRTVTATVP  364



>ref|XP_004983346.1| PREDICTED: uncharacterized protein LOC101786045 isoform X1 [Setaria 
italica]
Length=391

 Score =   456 bits (1173),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 230/351 (66%), Positives = 274/351 (78%), Gaps = 30/351 (9%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGETPLSR VGALI+FKPLYSL+K+ +R+V I TAEK+NIPWREM K+
Sbjct  42    VPQEGALERPAWSGETPLSRLVGALIAFKPLYSLMKLASREVIIRTAEKSNIPWREMTKK  101

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  E I++ +L YP+YYLSPFHAYDEGNLSWLAAAEAEPATM++  RAIP+A 
Sbjct  102   VLESDVYEVFERIRDPNLVYPNYYLSPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPEAT  161

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+AIE+HH +YSG   I DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  162   SIEEANQIVRGNWLNAIEEHHLKYSGNCQINDILDIGCSVGVSTRYLAEKFPSAQAVGLD  221

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  +E+   R+ NP RW+HANGE TGLPS SFDLVS++YV HECP RAI  +
Sbjct  222   LSPYFLAVAAQREEKLSRQ-NPIRWVHANGEATGLPSDSFDLVSLAYVCHECPARAITGL  280

Query  1000  VNESFRLLRPGGTFSVTDNSPKSK-----------------------------KLQELPP  1092
             V E+FR+LRPGGT ++TDNSPKSK                             ++QEL P
Sbjct  281   VKEAFRVLRPGGTIALTDNSPKSKVLQVSFITIFPPHLLLFYLHYRMTDNIAMQIQELSP  340

Query  1093  VLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTATVPY  1245
             VLFTLMKSTEPFLDEYY+ DLE  MR+ GF+NV S+LTD RHRTVTATVPY
Sbjct  341   VLFTLMKSTEPFLDEYYMLDLEETMRQVGFINVCSILTDARHRTVTATVPY  391



>dbj|BAJ90190.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85278.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92042.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96740.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=363

 Score =   453 bits (1165),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 269/322 (84%), Gaps = 4/322 (1%)
 Frame = +1

Query  286   EEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEIL  465
             +EG LERP WSGETP+SR V ALI+ KPLYSL+K+ +R+V I TAEK+NIPWREM K++L
Sbjct  44    QEGSLERPAWSGETPVSRLVAALIAIKPLYSLMKLASREVIIRTAEKSNIPWREMTKKVL  103

Query  466   ESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSL  645
             ESDVY+  E I++ ++ YPDYYLSPFHAYDEGNLSWLAAAEAE AT+++  RAIP+A ++
Sbjct  104   ESDVYEVFERIRDPNIVYPDYYLSPFHAYDEGNLSWLAAAEAEAATLSIAKRAIPEATTI  163

Query  646   DEASQVVRGNWLDAIEKHHKQYSG--CFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             +EA+++VRGNW++AIE+HH +YSG  C  I DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  164   EEANRIVRGNWMNAIEEHHLKYSGGNC-QINDILDIGCSVGVSTRYLAEKFPSAKAVGLD  222

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFL+VA  KE+   R+ NP RW+HANGE TGLP  SFD+VS++YV HECP RAI  +
Sbjct  223   LSPYFLSVAAQKEEQLSRQ-NPIRWVHANGEATGLPPNSFDVVSLAYVCHECPARAIIGL  281

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
               E+FRLLRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  + +AG
Sbjct  282   AKEAFRLLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEDALSQAG  341

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV SVLTDPRHRTVTATVPY
Sbjct  342   FVNVCSVLTDPRHRTVTATVPY  363



>gb|ABK26289.1| unknown [Picea sitchensis]
Length=387

 Score =   454 bits (1167),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 217/320 (68%), Positives = 263/320 (82%), Gaps = 0/320 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             + EG+L+RPRWSG+TP+SR V ALI+ KP+Y+L+K+GARQV ISTAEK  I WR+M +EI
Sbjct  66    FIEGELDRPRWSGDTPISRLVAALIAIKPVYNLMKLGARQVLISTAEKNGIAWRDMTREI  125

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             LES+VYKE E I+N S+ YPDYYL PFHAY++GNLSW AAAE E ATM+M  RA+P A S
Sbjct  126   LESEVYKEKELIENPSIVYPDYYLKPFHAYEQGNLSWEAAAEVEAATMSMIRRAMPSAAS  185

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             L+EA++++RGNWL AIE HH + SG   I DILD+GCS+GVSTR LA ++P AN+ GLDL
Sbjct  186   LEEATRLLRGNWLQAIEDHHTKNSGGLGIADILDVGCSVGVSTRFLADKFPLANVIGLDL  245

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAV Q+KEK R  +  P +WIHANGE TGLPS SFD+VS SYV HECP+ AIR ++
Sbjct  246   SPYFLAVGQYKEKIRPLREKPIKWIHANGEATGLPSASFDIVSFSYVMHECPQTAIRGLL  305

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E++R+LRPGGT ++TDNSPKSK LQ LPPVLFTLMKSTEP LDEYYL D+E  M E GF
Sbjct  306   KEAYRVLRPGGTVALTDNSPKSKILQNLPPVLFTLMKSTEPHLDEYYLLDMENTMVETGF  365

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             +NV+SVLTDPRHRTVT +VP
Sbjct  366   INVRSVLTDPRHRTVTGSVP  385



>ref|XP_008643783.1| PREDICTED: CMV 1a interacting protein 1 isoform X1 [Zea mays]
Length=352

 Score =   448 bits (1152),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 225/322 (70%), Positives = 263/322 (82%), Gaps = 8/322 (2%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGET LSR VGALI+FKPLY++LK+ +R+V I TAEK+NIPWREM KE
Sbjct  39    VPQEGALERPAWSGETTLSRLVGALIAFKPLYAVLKLASREVIIRTAEKSNIPWREMTKE  98

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  E IQ+ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAIP+A 
Sbjct  99    VLESDVYEVFERIQDPNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPEAT  158

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+ IE+HH +YSG   + DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  159   SIEEANQIVRGNWLNVIEEHHLKYSGNCQVNDILDIGCSVGVSTRYLAEKFPSAQAVGLD  218

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  KE+   R   P RW+HANGE TGL S SFDLVS++YV HECP RAI  +
Sbjct  219   LSPYFLAVAAQKEEKLSRP-KPIRWVHANGEATGLSSDSFDLVSLAYVCHECPARAITGL  277

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
             V E+FR+LRPGGT ++TDNS       EL PVLFTLMKSTEPFLDEYY+ DLE  MR+ G
Sbjct  278   VKEAFRVLRPGGTIALTDNS-------ELSPVLFTLMKSTEPFLDEYYMLDLEETMRKVG  330

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV SVLTDPRHRTVTATVPY
Sbjct  331   FVNVCSVLTDPRHRTVTATVPY  352



>emb|CDP15918.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   431 bits (1109),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 225/338 (67%), Positives = 272/338 (80%), Gaps = 8/338 (2%)
 Frame = +1

Query  100   MAFCATSKL---NSTLNPALFTSTKDAVV-IHDPLKRVTPARTsggsirvaasgsgsgap  267
             MAFCA SKL   N  +  ++ +S+ D VV  HD ++R    R        A++   SG  
Sbjct  1     MAFCAQSKLSNPNLCIKTSVGSSSTDNVVGHHDSIRR----RKRMMVKMTASTSGSSGQG  56

Query  268   aaVEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWRE  447
             ++   +EEGQLERPRW+GETPLSR VGALISF+PL+S++K GARQV ISTAEKTNIPWRE
Sbjct  57    SSTVAFEEGQLERPRWTGETPLSRLVGALISFRPLFSIMKFGARQVLISTAEKTNIPWRE  116

Query  448   MAKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAI  627
             M ++ILESDVYKEM SI++ SL YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAI
Sbjct  117   MTRQILESDVYKEMGSIEDPSLVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMMRRAI  176

Query  628   PDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANL  807
             P A+SLDEA+QVVRGNWL+AIE+HH++YS    +R ILDIGCS+GVSTRCLA ++P+A +
Sbjct  177   PYASSLDEANQVVRGNWLNAIEEHHQKYSEDNIVRQILDIGCSVGVSTRCLADKFPNARV  236

Query  808   TGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERA  987
             TGLDLSPYFLAVAQ+KEK  + + NP  W+HANGE TGLPSKSFD++SI+YVFHECPERA
Sbjct  237   TGLDLSPYFLAVAQYKEKKSNPRMNPICWVHANGESTGLPSKSFDILSIAYVFHECPERA  296

Query  988   IRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLF  1101
             I+NVV E+ RLLRPGGTF++TDNSPKSK LQ    +LF
Sbjct  297   IKNVVREALRLLRPGGTFAITDNSPKSKILQASSLLLF  334



>emb|CDP15915.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   427 bits (1099),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 270/334 (81%), Gaps = 7/334 (2%)
 Frame = +1

Query  100   MAFCATSKL---NSTLNPALFTSTKDAVV-IHDPLKRVTP---ARTsggsirvaasgsgs  258
             MAFCA SKL   N  +  ++ +S+ D V   HD L+R  P   A++       A++   S
Sbjct  1     MAFCAQSKLSNLNLWIKTSVGSSSSDNVGGHHDSLRRRAPKIRAKSRMMVKMTASTSGSS  60

Query  259   gapaaVEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIP  438
             G  ++   +EEGQLERPRW+GETPLSR VGALISF+PL+S++K GARQV ISTAEKTNIP
Sbjct  61    GQGSSTVAFEEGQLERPRWTGETPLSRLVGALISFRPLFSIMKFGARQVLISTAEKTNIP  120

Query  439   WREMAKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameL  618
             WREM ++ILESDVYKEM SI++ SL YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  
Sbjct  121   WREMTRQILESDVYKEMGSIEDPSLVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMMR  180

Query  619   RAIPDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS  798
             RAIP A+SLDEA+QVVRGNWL+AIE+HH++YS    +R ILDIGCS+GVSTRCLA ++P+
Sbjct  181   RAIPYASSLDEANQVVRGNWLNAIEEHHQKYSEDNIVRQILDIGCSVGVSTRCLADKFPN  240

Query  799   ANLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECP  978
             A +TGLDLSPYFLAVAQ+KEK    + NP  W+HANGE TGLPSKS D++SI+YVFHECP
Sbjct  241   ARVTGLDLSPYFLAVAQYKEKKSSPRMNPICWVHANGESTGLPSKSSDILSIAYVFHECP  300

Query  979   ERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQ  1080
             ERAI+N+V E+FRLLRPGGTF++TDNSPKSK LQ
Sbjct  301   ERAIKNMVREAFRLLRPGGTFAITDNSPKSKILQ  334



>gb|EYU30786.1| hypothetical protein MIMGU_mgv1a008621mg [Erythranthe guttata]
Length=322

 Score =   417 bits (1073),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 201/266 (76%), Positives = 236/266 (89%), Gaps = 0/266 (0%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEGQLERP+W+GETPLSR VGALISFKPLYSLLK+GARQV ISTAEKT+IPWR+M  EI
Sbjct  47    YEEGQLERPKWTGETPLSRLVGALISFKPLYSLLKLGARQVLISTAEKTSIPWRDMTNEI  106

Query  463   LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
             L+SDVYKE ++I++ S+ YPDYYL+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP+A+S
Sbjct  107   LDSDVYKEKDAIEDSSIVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSMVRRAIPNASS  166

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
             LDEA+Q+VRGNWL AIE HH QYSG  +I+DILDIGCS+GVSTR +  ++PSA +TGLDL
Sbjct  167   LDEANQIVRGNWLQAIETHHNQYSGYSSIQDILDIGCSVGVSTRFILDKFPSAKVTGLDL  226

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ+ +K R++     +WIH NGE+TGLPSKSFDLVSI+YVFHECPERAI+N+ 
Sbjct  227   SPYFLAVAQYNDKRRNQGKEKVKWIHGNGENTGLPSKSFDLVSIAYVFHECPERAIKNMA  286

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQ  1080
              E+FRLLRPGGTF+VTDNSPKSK LQ
Sbjct  287   KEAFRLLRPGGTFAVTDNSPKSKILQ  312



>gb|AAK70623.1|AC091238_1 Unknown protein [Oryza sativa Japonica Group]
 gb|AAL76194.1|AC092173_6 Unknown protein [Oryza sativa Japonica Group]
Length=332

 Score =   413 bits (1062),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/322 (66%), Positives = 249/322 (77%), Gaps = 33/322 (10%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
             V +EG LERP WSGETPLSR VGALI+FKPLYSL+K+ +R+V I TAEK+N+PWREM K+
Sbjct  44    VPKEGSLERPAWSGETPLSRLVGALIAFKPLYSLMKLASREVIIRTAEKSNVPWREMTKQ  103

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             +LESDVY+  + I++ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAIPDA 
Sbjct  104   VLESDVYEVFDRIRDLNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAIPDAG  163

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S++EA+Q+VRGNWL+AIE+HH +YSG   I DILDIGCS+GVSTR LA ++PSA   GLD
Sbjct  164   SIEEANQIVRGNWLNAIEEHHLKYSGNCQINDILDIGCSVGVSTRYLAEKFPSARTVGLD  223

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVA  KE+   R+ NP RW+HANGE TGLPS SFDLVS++YV            
Sbjct  224   LSPYFLAVAAHKEEKLSRQ-NPIRWVHANGEATGLPSNSFDLVSLAYV------------  270

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
                                 PKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  MR+AG
Sbjct  271   --------------------PKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETMRQAG  310

Query  1180  FVNVQSVLTDPRHRTVTATVPY  1245
             FVNV S+LTDPRHRTVTATVP+
Sbjct  311   FVNVHSILTDPRHRTVTATVPF  332



>ref|XP_011098030.1| PREDICTED: uncharacterized protein LOC105176814 [Sesamum indicum]
Length=608

 Score =   420 bits (1080),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 219/327 (67%), Positives = 259/327 (79%), Gaps = 8/327 (2%)
 Frame = +1

Query  100   MAFCATSKLNSTLNPALFTSTKDAVVIHDPLKRVTPARTsggsirvaasgsgsgapaaVE  279
             MA    SKL S +N +  TST+         KR  PAR    S R +  G        V 
Sbjct  1     MALSTISKL-SNVNTSAVTSTRSRYPNSSTRKRSAPARIRTASERSSGGGM-------VA  52

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
              +EEG+ ERPRW+GET LSR VG+LISFKPLYS+LK+GARQV ISTAEK NIPWR+M KE
Sbjct  53    DFEEGEPERPRWTGETALSRLVGSLISFKPLYSVLKLGARQVLISTAEKGNIPWRDMTKE  112

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             ILESDVY E ++I++ S+ YPDYYL+PFHAYDEGNLSWLAAAEAE ATM++  RAIP A+
Sbjct  113   ILESDVYSEKDAIEDPSIVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSIAKRAIPSAS  172

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             S+DEA+Q+VRGNWL AIE HH++YSG   IR+ILDIGCS+GVSTR LA ++PSA +TGLD
Sbjct  173   SVDEANQIVRGNWLQAIESHHQKYSGNSTIREILDIGCSVGVSTRFLADKFPSAKVTGLD  232

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVAQ+K+   ++ T P RWIHANGE+TGLPSKSFDLVSI+YVFHECPERAI+N+
Sbjct  233   LSPYFLAVAQYKDNKINQGTEPIRWIHANGENTGLPSKSFDLVSIAYVFHECPERAIKNM  292

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQ  1080
             V E+FRLLRPGGTF+VTDNSPKSK LQ
Sbjct  293   VKEAFRLLRPGGTFAVTDNSPKSKILQ  319



>ref|XP_010689879.1| PREDICTED: uncharacterized protein LOC104903532 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=266

 Score =   403 bits (1035),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 229/265 (86%), Gaps = 0/265 (0%)
 Frame = +1

Query  448   MAKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAI  627
             M KEILES+VYKEMES+QN ++ YP+YYL+PFHAYDEGNLSWLAAAEAEPAT+++  RAI
Sbjct  1     MTKEILESEVYKEMESVQNPNIVYPNYYLNPFHAYDEGNLSWLAAAEAEPATLSITRRAI  60

Query  628   PDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANL  807
             PDA+SLDEA +VVRGNWL  IEKHH+QYS    + +ILDIGCSIG STR LA +YPSAN+
Sbjct  61    PDASSLDEAIEVVRGNWLRVIEKHHQQYSQNSTVGNILDIGCSIGWSTRFLADKYPSANV  120

Query  808   TGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERA  987
             TGLDLSPYFLAVAQFKEK+R  +     WIHANGEDTGLP+KSFDL+SI+YV HECP +A
Sbjct  121   TGLDLSPYFLAVAQFKEKSRPSRGKCINWIHANGEDTGLPAKSFDLISIAYVLHECPAKA  180

Query  988   IRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVM  1167
               N+V E+FRLLRPGGT ++TDNSPKSKKLQEL PVLFTLMKSTEPFLDEYYL DLE  +
Sbjct  181   TVNLVKEAFRLLRPGGTIAITDNSPKSKKLQELSPVLFTLMKSTEPFLDEYYLLDLEATL  240

Query  1168  REAGFVNVQSVLTDPRHRTVTATVP  1242
              EAGF +V +VLTDPRHRTVTATVP
Sbjct  241   SEAGFTHVHTVLTDPRHRTVTATVP  265



>ref|XP_002280009.3| PREDICTED: uncharacterized protein LOC100245387 [Vitis vinifera]
Length=606

 Score =   413 bits (1062),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/267 (76%), Positives = 232/267 (87%), Gaps = 0/267 (0%)
 Frame = +1

Query  280   VYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKE  459
              YEEGQLERP W+GETPLSR VGA+ISFKPLYS+LK+GARQV ISTAEKTNIPWREM  E
Sbjct  52    AYEEGQLERPNWAGETPLSRLVGAIISFKPLYSVLKLGARQVLISTAEKTNIPWREMTNE  111

Query  460   ILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             ILESDVYKEMESI+N S+ YPDYY +PFHAYDEGNLSWLAAAEAE ATM+M  RA PDA+
Sbjct  112   ILESDVYKEMESIENPSVVYPDYYSNPFHAYDEGNLSWLAAAEAEAATMSMVRRATPDAS  171

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             SL+EA+++VRGNWL AIE+HH QYSG   +RDILD+GCS+GVSTR LA ++PSA +TGLD
Sbjct  172   SLEEANKIVRGNWLQAIERHHLQYSGNSTVRDILDVGCSVGVSTRFLADKFPSAKVTGLD  231

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPYFLAVAQFKEK R  + N   W+HANGED+GLPSKSFD+VS++YV HECP RAI  +
Sbjct  232   LSPYFLAVAQFKEKERASRKNLINWVHANGEDSGLPSKSFDIVSMAYVLHECPARAIVGL  291

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQ  1080
             V E+FRLLRPGGT ++TDNSPKSK LQ
Sbjct  292   VREAFRLLRPGGTIALTDNSPKSKVLQ  318



>ref|XP_001782124.1| predicted protein [Physcomitrella patens]
 gb|EDQ53068.1| predicted protein [Physcomitrella patens]
Length=365

 Score =   402 bits (1033),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 244/322 (76%), Gaps = 4/322 (1%)
 Frame = +1

Query  289   EGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILE  468
             EG L+RPR++G  PLSRFV +LI+ KPL+ ++K+ ARQVFI TAEK  + WR MA EIL 
Sbjct  44    EGDLDRPRYTGNDPLSRFVSSLIAIKPLFDVMKLVARQVFIRTAEKNGVDWRGMANEILA  103

Query  469   SDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLD  648
             SDVY E E ++N+SL YPDYYL  FHAY+EGNLSW AA+E  PAT++M LR  P A S  
Sbjct  104   SDVYVEKELLENKSLVYPDYYLKEFHAYEEGNLSWEAASEVAPATLSMMLRTTPTAKSAA  163

Query  649   EASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSP  828
             EA+QV+R  WL AI  HH+ YSG   +  +LDIGCSIG STR LA  +P A++TGLDLSP
Sbjct  164   EATQVLRSAWLQAISSHHQMYSGGQGVSSVLDIGCSIGDSTRELADWFPDAHVTGLDLSP  223

Query  829   YFLAVAQFKEKNRDR----KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRN  996
             YFLAVAQ+ EK R      +  P  W+HANGE TGLPS SFD+VS+++V HECP+ AIR 
Sbjct  224   YFLAVAQYMEKQRISSGLGRRRPISWVHANGECTGLPSSSFDVVSLAFVIHECPQHAIRG  283

Query  997   VVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREA  1176
             ++ E+ RLL+PGGT S+TDNSPKSK LQ LPP +FTLMKSTEP++DEY+  DLE  M + 
Sbjct  284   LLKEALRLLKPGGTVSLTDNSPKSKVLQNLPPAIFTLMKSTEPWMDEYFTFDLEGEMEKI  343

Query  1177  GFVNVQSVLTDPRHRTVTATVP  1242
             GF+NV S++T+PRHRTVT T P
Sbjct  344   GFMNVNSIMTNPRHRTVTGTAP  365



>ref|XP_009396995.1| PREDICTED: uncharacterized protein LOC103981946 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   397 bits (1019),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/264 (74%), Positives = 224/264 (85%), Gaps = 0/264 (0%)
 Frame = +1

Query  289   EGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILE  468
             EG+LE PRW+GET LSRF+GALISFKPL+S++K+GARQ+ I  AEKTNIPWREM  EIL 
Sbjct  55    EGELELPRWAGETSLSRFIGALISFKPLFSVMKLGARQLLIGNAEKTNIPWREMTNEILN  114

Query  469   SDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLD  648
             SDVYKEMES+QN SL YPDYYL+PFHAYDEGNLSWLAAAEAE ATM++   A+PDA ++D
Sbjct  115   SDVYKEMESVQNPSLVYPDYYLNPFHAYDEGNLSWLAAAEAEAATMSIAKLAVPDAPTVD  174

Query  649   EASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSP  828
             EA+++VRG WL AIE H KQYSG   I DILDIGCSIGVSTR LA  +PSAN+TGLDLSP
Sbjct  175   EANKIVRGKWLKAIENHLKQYSGNSEINDILDIGCSIGVSTRYLAEMFPSANVTGLDLSP  234

Query  829   YFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNE  1008
             YFL+VAQ+KEK +  +  P RWIHANGE TGLPSKSFDLVS++YV HECP RA   +VNE
Sbjct  235   YFLSVAQYKEKKKAARIKPIRWIHANGECTGLPSKSFDLVSLAYVLHECPRRATIGLVNE  294

Query  1009  SFRLLRPGGTFSVTDNSPKSKKLQ  1080
             +FRLLRPGGT +VTDNSPKSK LQ
Sbjct  295   AFRLLRPGGTIAVTDNSPKSKVLQ  318



>ref|XP_006469031.1| PREDICTED: uncharacterized protein LOC102611255 [Citrus sinensis]
Length=590

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/269 (71%), Positives = 227/269 (84%), Gaps = 2/269 (1%)
 Frame = +1

Query  274   VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
             V  YEEGQLERP+W+GETPLSR VGALISFKP+ ++LK GARQV ISTAEK +IPWR M 
Sbjct  37    VATYEEGQLERPKWAGETPLSRLVGALISFKPISAVLKFGARQVLISTAEKNDIPWRAMT  96

Query  454   KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
             KEILESDVYKEMESIQN+S+ YP YYL+PFHAYD+GNLSWLAAAEAE A ++M  RAIP 
Sbjct  97    KEILESDVYKEMESIQNRSIVYPAYYLNPFHAYDDGNLSWLAAAEAEAADLSMTRRAIPY  156

Query  634   ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
             A+S+D+A+ V+RGNWL AIEKHH+QY+G   IRDILDIGCS+GVST+CLA ++PSA +TG
Sbjct  157   ASSVDKANDVMRGNWLQAIEKHHQQYAG--EIRDILDIGCSVGVSTKCLADKFPSAKVTG  214

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             LDLSPYFLAVAQ KEK    + NP  W+HA GED+GLPSKSFD+VS+ YV HECPER I 
Sbjct  215   LDLSPYFLAVAQLKEKKGGPRKNPISWVHAIGEDSGLPSKSFDVVSLRYVLHECPERTII  274

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQ  1080
              ++ E+FRLLRPGGT ++ D +PKSK LQ
Sbjct  275   ALLKEAFRLLRPGGTIALNDIAPKSKILQ  303



>ref|NP_001168523.1| uncharacterized protein LOC100382303 [Zea mays]
 gb|ACN28520.1| unknown [Zea mays]
 gb|ACR38298.1| unknown [Zea mays]
Length=265

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/266 (72%), Positives = 221/266 (83%), Gaps = 1/266 (0%)
 Frame = +1

Query  448   MAKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAI  627
             M KE+LESDVY+  E IQ+ +L YPDYYL+PFHAYDEGNLSWLAAAEAEPATM++  RAI
Sbjct  1     MTKEVLESDVYEVFERIQDPNLVYPDYYLNPFHAYDEGNLSWLAAAEAEPATMSIAKRAI  60

Query  628   PDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANL  807
             P+A S++EA+Q+VRGNWL+ IE+HH +YSG   + DILDIGCS+GVSTR LA ++PSA  
Sbjct  61    PEATSIEEANQIVRGNWLNVIEEHHLKYSGNCQVNDILDIGCSVGVSTRYLAEKFPSAQA  120

Query  808   TGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERA  987
              GLDLSPYFLAVA  KE+   R   P RW+HANGE TGL S SFDLVS++YV HECP RA
Sbjct  121   VGLDLSPYFLAVAAQKEEKLSRP-KPIRWVHANGEATGLSSDSFDLVSLAYVCHECPARA  179

Query  988   IRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVM  1167
             I  +V E+FR+LRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE  M
Sbjct  180   ITGLVKEAFRVLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEETM  239

Query  1168  REAGFVNVQSVLTDPRHRTVTATVPY  1245
             R+ GFVNV SVLTDPRHRTVTATVPY
Sbjct  240   RKVGFVNVCSVLTDPRHRTVTATVPY  265



>ref|XP_002987852.1| hypothetical protein SELMODRAFT_126718 [Selaginella moellendorffii]
 gb|EFJ11155.1| hypothetical protein SELMODRAFT_126718 [Selaginella moellendorffii]
Length=373

 Score =   378 bits (970),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 243/325 (75%), Gaps = 6/325 (2%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG L++PR+SG+ PLSR V  LIS  PL++ ++   RQVF+ TAEK  IPWR ++ +I
Sbjct  43    YEEGALKQPRYSGDEPLSRLVSGLISIGPLFAAMQFAGRQVFLRTAEKKGIPWRSLSSQI  102

Query  463   LESDVYK-EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             L S+  K E E ++N+S+ YP+YYL  FHAY +GNL W AA+EAE ATM+M  RA+P A 
Sbjct  103   LGSEEIKAEKELVENKSIVYPEYYLQKFHAYTKGNLCWEAASEAEVATMSMVRRALPAAE  162

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             + +EA +V+RGNW+ A+E +H Q S    +  +LD+GCS+G+ST  LA  +PSA +TGLD
Sbjct  163   TTEEALEVLRGNWIRALESYHSQNS-VLPVSQVLDVGCSVGLSTIYLAEAFPSAQITGLD  221

Query  820   LSPYFLAVAQFKEKNR----DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERA  987
             LSPYFLAVAQ KEK R      + NP RW HANGE TG PS +FD+VSI+YV HECP  A
Sbjct  222   LSPYFLAVAQHKEKQRIADGKLQRNPIRWHHANGEHTGFPSCTFDIVSIAYVIHECPVHA  281

Query  988   IRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVM  1167
              + ++ E++R+L+PGGT ++TDNSPKSK LQ LPPVLFTL KSTEP+LD+YY  DLE  M
Sbjct  282   TKGLLKEAYRVLKPGGTIAITDNSPKSKILQSLPPVLFTLQKSTEPWLDDYYGLDLEEAM  341

Query  1168  REAGFVNVQSVLTDPRHRTVTATVP  1242
             REAGF++V + LTDPRHRTV  TVP
Sbjct  342   REAGFISVCARLTDPRHRTVNGTVP  366



>ref|XP_002993775.1| hypothetical protein SELMODRAFT_137556 [Selaginella moellendorffii]
 gb|EFJ05194.1| hypothetical protein SELMODRAFT_137556 [Selaginella moellendorffii]
Length=373

 Score =   371 bits (953),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 240/325 (74%), Gaps = 6/325 (2%)
 Frame = +1

Query  283   YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
             YEEG L++PR+SG+ PLSR V  LIS  PL++ ++   RQVF+ TAEK  IPWR ++ +I
Sbjct  43    YEEGALKQPRYSGDEPLSRLVSGLISIGPLFAAMQFAGRQVFLRTAEKKGIPWRSLSSQI  102

Query  463   LESD-VYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN  639
             L S+ +  E E ++N+S+ YP+YYL  FHAY +GNL W AA+EAE ATM+M  R +P A 
Sbjct  103   LNSEEIRAEKELVENKSIVYPEYYLQKFHAYTKGNLCWEAASEAEVATMSMVRRTLPAAE  162

Query  640   SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLD  819
             + +EA +V+RGNW+ A+E +H Q S    +  +LD+GCS+G+ST  LA  +PSA +TGLD
Sbjct  163   TTEEALEVLRGNWIRALESYHSQNS-VLPVSQVLDVGCSVGLSTIYLAEAFPSAQVTGLD  221

Query  820   LSPYFLAVAQFKEKNR----DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERA  987
             LSPYFLAVAQ KEK R      + NP RW HANGE TG PS +FD+VSI+YV HEC   A
Sbjct  222   LSPYFLAVAQHKEKQRIADGKLQRNPIRWRHANGEHTGFPSCTFDIVSIAYVIHECAVHA  281

Query  988   IRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVM  1167
              + ++ E++R+L+PGGT ++TDNSPKSK LQ LPPVLFTL KSTEP+LD+YY  DLE  M
Sbjct  282   TKGLLKEAYRILKPGGTIAITDNSPKSKILQSLPPVLFTLQKSTEPWLDDYYGLDLEEAM  341

Query  1168  REAGFVNVQSVLTDPRHRTVTATVP  1242
             REAGF+ V S LT+PRHRTV  TVP
Sbjct  342   REAGFICVCSRLTNPRHRTVNGTVP  366



>gb|KDO63335.1| hypothetical protein CISIN_1g048398mg [Citrus sinensis]
Length=280

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 198/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  274  VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
            V  YEEGQLERP+W+GETPLSR VGALISFKP+ ++LK GARQV ISTAEK +IPWR M 
Sbjct  37   VATYEEGQLERPKWAGETPLSRLVGALISFKPISAVLKFGARQVLISTAEKNDIPWRAMT  96

Query  454  KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
            KEILESDVYKEMESIQN+S+ YP YYL+PFHAYD+GNLSWLAAAEAE A ++M  RAIP 
Sbjct  97   KEILESDVYKEMESIQNRSIVYPAYYLNPFHAYDDGNLSWLAAAEAEAADLSMTRRAIPY  156

Query  634  ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
            A+S+D+A+ V+RGNWL AIEKHH+QY+G   IRDILDIGCS+GVST+CLA ++PSA +TG
Sbjct  157  ASSVDKANDVMRGNWLQAIEKHHQQYAG--EIRDILDIGCSVGVSTKCLADKFPSAKVTG  214

Query  814  LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYV  963
            LDLSPYFLAVAQ KEK    + NP  W+HA GED+GLPSKSFD+VS+SYV
Sbjct  215  LDLSPYFLAVAQLKEKKGGPRKNPISWVHAIGEDSGLPSKSFDVVSLSYV  264



>ref|XP_006446769.1| hypothetical protein CICLE_v10015734mg [Citrus clementina]
 gb|ESR60009.1| hypothetical protein CICLE_v10015734mg [Citrus clementina]
Length=280

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 198/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  274  VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
            V  YEEGQLERP+W+GETPLSR VGALISFKP+ ++LK GARQV ISTAEK +IPWR M 
Sbjct  37   VATYEEGQLERPKWAGETPLSRLVGALISFKPISAVLKFGARQVLISTAEKNDIPWRAMT  96

Query  454  KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
            KEILESDVYKEMESIQN+S+ YPDYYL+PFHAYD+GNLSWLAAAEAE A ++M  RA+P 
Sbjct  97   KEILESDVYKEMESIQNRSVVYPDYYLNPFHAYDDGNLSWLAAAEAEAANLSMTRRAMPY  156

Query  634  ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
            A+S+D+A+ V+RGNWL AIEKHH+QY+G    RDILDIGCS+GVST+CLA ++PSA +TG
Sbjct  157  ASSVDKANDVMRGNWLQAIEKHHQQYAG--ETRDILDIGCSVGVSTKCLADKFPSAKVTG  214

Query  814  LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYV  963
            LDLSPYFLAVAQ KEK    + NP  W+HA GED+GLPSKSFD+VS+SYV
Sbjct  215  LDLSPYFLAVAQLKEKKGGPRKNPISWVHAIGEDSGLPSKSFDVVSLSYV  264



>gb|AFK44059.1| unknown [Medicago truncatula]
Length=234

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = +1

Query  619   RAIPDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS  798
             RAIP A+S++EA+Q++RGNWL+AIE+HH Q+S    I DILDIGCS+GVS+R LA ++P+
Sbjct  26    RAIPTASSVEEATQIMRGNWLNAIEQHHLQHSQTSMIGDILDIGCSVGVSSRFLADKFPT  85

Query  799   ANLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECP  978
             AN+ GLD+SPYFLAVAQ KEK+   + NP +WIHANGEDTGLP KSFDLVSISYVFHECP
Sbjct  86    ANVIGLDMSPYFLAVAQHKEKSGTPRKNPIKWIHANGEDTGLPFKSFDLVSISYVFHECP  145

Query  979   ERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLE  1158
              RAI NVV E+FR LRPGGTF++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYYLTD++
Sbjct  146   ARAIVNVVKEAFRFLRPGGTFAMTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYLTDMD  205

Query  1159  RVMREAGFVNVQSVLTDPRHRTVTATVP  1242
               +REAGFVN++S+LTDPRH T+TATVP
Sbjct  206   ETLREAGFVNIKSILTDPRHVTLTATVP  233



>gb|ACN34935.1| unknown [Zea mays]
 gb|AFW68875.1| hypothetical protein ZEAMMB73_796332 [Zea mays]
Length=213

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 172/209 (82%), Gaps = 1/209 (0%)
 Frame = +1

Query  619   RAIPDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS  798
             RAIP+A S++EA+Q+VRGNWL+ IE+HH +YSG   + DILDIGCS+GVSTR LA ++PS
Sbjct  6     RAIPEATSIEEANQIVRGNWLNVIEEHHLKYSGNCQVNDILDIGCSVGVSTRYLAEKFPS  65

Query  799   ANLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECP  978
             A   GLDLSPYFLAVA  KE+   R   P RW+HANGE TGL S SFDLVS++YV HECP
Sbjct  66    AQAVGLDLSPYFLAVAAQKEEKLSRP-KPIRWVHANGEATGLSSDSFDLVSLAYVCHECP  124

Query  979   ERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLE  1158
              RAI  +V E+FR+LRPGGT ++TDNSPKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE
Sbjct  125   ARAITGLVKEAFRVLRPGGTIALTDNSPKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLE  184

Query  1159  RVMREAGFVNVQSVLTDPRHRTVTATVPY  1245
               MR+ GFVNV SVLTDPRHRTVTATVPY
Sbjct  185   ETMRKVGFVNVCSVLTDPRHRTVTATVPY  213



>gb|EMS47184.1| hypothetical protein TRIUR3_15391 [Triticum urartu]
Length=234

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 197/268 (74%), Gaps = 36/268 (13%)
 Frame = +1

Query  448   MAKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAI  627
             M +++LESDVY+  E I++  + YPDYYLSPFHAYDEGNLSWLAAAEAE AT+++  RAI
Sbjct  1     MTRKVLESDVYEVFERIRDPDIVYPDYYLSPFHAYDEGNLSWLAAAEAEAATLSIAKRAI  60

Query  628   PDANSLDEASQVVRGNWLDAIEKHHKQYSG--CFAIRDILDIGCSIGVSTRCLASRYPSA  801
             P+A S++EA+Q+VRGNW++AIE+HH +YSG  C  I DILDIGCS+GVSTR LA R+PSA
Sbjct  61    PEATSIEEANQIVRGNWMNAIEEHHLKYSGENC-QINDILDIGCSVGVSTRYLAERFPSA  119

Query  802   NLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPE  981
                GLDLSPYFLAVA  KE+   R+ NP RW+HANGE TGLP  SFD+VS++YV      
Sbjct  120   KAVGLDLSPYFLAVAAQKEEQLSRQ-NPIRWVHANGEATGLPPNSFDVVSLAYV------  172

Query  982   RAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLER  1161
                                       PKSK LQEL PVLFTLMKSTEPFLDEYY+ DLE 
Sbjct  173   --------------------------PKSKVLQELSPVLFTLMKSTEPFLDEYYMLDLEE  206

Query  1162  VMREAGFVNVQSVLTDPRHRTVTATVPY  1245
              + +AGFVNV SVLTDPRHRTVTATVPY
Sbjct  207   ALSQAGFVNVCSVLTDPRHRTVTATVPY  234



>ref|XP_003082466.1| CMV 1a interacting protein 1 (ISS) [Ostreococcus tauri]
 emb|CAL57412.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=373

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 213/317 (67%), Gaps = 7/317 (2%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLY-SLLKIGARQVFISTAEKTNIPWREMAKEI-LESDV  477
             +P W+G+  LS+ V A IS + LY +++K  AR+  I+TAEK  I WRE AK +    D+
Sbjct  56    KPDWAGDDVLSKLVDAAISNELLYENVMKPMARRTLINTAEKNGIAWREEAKALEANPDI  115

Query  478   YKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIP-DANSLDEA  654
             +   ESI++ SL+YP+YYL PFHAY EGNL WLAA EA  AT +M LR  P D  + + A
Sbjct  116   HAAFESIKDDSLKYPEYYLKPFHAYAEGNLCWLAATEARSATYSMALRVWPKDRITAETA  175

Query  655   SQVVRGNWLDAIEKH---HKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLS  825
              Q +R ++ D I KH   H   +G    R ILD+GCS+G+STR ++  +PSA + GLDLS
Sbjct  176   QQRLRDSYTDTIRKHRETHNASTGEAEPRKILDVGCSVGMSTRYISDAFPSAEVIGLDLS  235

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA   +K  +     T W+H  GEDT  P  +FD+VS+++V HECPE A   ++ 
Sbjct  236   PYMLAVASVSDKGEEGSERRT-WVHGKGEDTKYPENTFDVVSLAFVIHECPENATAALMR  294

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+L+PGGTF +TDN+P+S  +Q LPP LFTLMKSTEP  +EYY  D+++++R+AGF 
Sbjct  295   EAHRILKPGGTFVMTDNNPQSPVIQNLPPALFTLMKSTEPHSNEYYTIDVQQMLRDAGFE  354

Query  1186  NVQSVLTDPRHRTVTAT  1236
             +V    TDPRHRTV  +
Sbjct  355   HVHQEQTDPRHRTVCGS  371



>emb|CDP22262.1| unnamed protein product, partial [Coffea canephora]
Length=247

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 184/222 (83%), Gaps = 3/222 (1%)
 Frame = +1

Query  181  HDPLKRVTP---ARTsggsirvaasgsgsgapaaVEVYEEGQLERPRWSGETPLSRFVGA  351
            HD L+R  P   A++       A++   +G  ++   +EEGQLERPRW+GETPLSR VGA
Sbjct  26   HDSLRRRAPKSRAKSRMMVKMTASTSGSTGQGSSTVAFEEGQLERPRWTGETPLSRLVGA  85

Query  352  LISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSLEYPDYY  531
            LISF+PL+S++K GARQV IS+AEKTNIPWREM ++ILESDVYKEM+SI++ SL YPDYY
Sbjct  86   LISFRPLFSIMKFGARQVLISSAEKTNIPWREMTRQILESDVYKEMDSIEDPSLVYPDYY  145

Query  532  LSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIEKHHKQY  711
            L+PFHAYDEGNLSWLAAAEAE ATM+M  RAIP A+SLDEA+Q+VRGNWL+ IE+HH++Y
Sbjct  146  LNPFHAYDEGNLSWLAAAEAEAATMSMMRRAIPYASSLDEANQIVRGNWLNTIEEHHQKY  205

Query  712  SGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFL  837
            S    +R+ILDIGCS+GVSTRCLA ++P+A +TGLDLSPYFL
Sbjct  206  SEDNIVREILDIGCSVGVSTRCLADKFPNARVTGLDLSPYFL  247



>ref|XP_008673835.1| PREDICTED: LOW QUALITY PROTEIN: 2-methoxy-6-polyprenyl-1,4-benzoquinol 
methylase, mitochondrial-like [Zea mays]
Length=206

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 163/209 (78%), Gaps = 8/209 (4%)
 Frame = +1

Query  619   RAIPDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS  798
             RAIP+A S++EA+Q+VRGNWL+ IE+HH +Y G   + DILDIGCS+GVSTR L  ++PS
Sbjct  6     RAIPEATSIEEANQIVRGNWLNVIEEHHLKYLGSSQVNDILDIGCSVGVSTRYLVEKFPS  65

Query  799   ANLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECP  978
             A   GLDLSPYFLAV   KE+   R   P RW+HANGE TGL S SFDLVS++YV HECP
Sbjct  66    AQAVGLDLSPYFLAVEAQKEEKLSRP-KPIRWVHANGEATGLSSDSFDLVSLAYVCHECP  124

Query  979   ERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLE  1158
              RAI  +V E+FR+LRPGGT ++TDNS       EL PVLFTLMKSTEPFLDEYY+ DLE
Sbjct  125   ARAITRLVKEAFRVLRPGGTIALTDNS-------ELSPVLFTLMKSTEPFLDEYYMLDLE  177

Query  1159  RVMREAGFVNVQSVLTDPRHRTVTATVPY  1245
               MR+ GFVNV SVLTDPR+RT+TATVPY
Sbjct  178   ETMRKVGFVNVCSVLTDPRYRTITATVPY  206



>ref|XP_006582768.1| PREDICTED: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, 
mitochondrial-like [Glycine max]
Length=232

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 164/208 (79%), Gaps = 1/208 (0%)
 Frame = +1

Query  619   RAIPDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS  798
             RA+PDA+S+ EA+Q++ GNWL AIE+HH ++S    I DILDIGCS+G+STR L  ++ +
Sbjct  25    RALPDASSIQEANQILHGNWLRAIEQHHIEHSESSVINDILDIGCSVGISTRYLVDKFHT  84

Query  799   ANLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECP  978
             A +TGLDLSPYFLAVAQ KEK       P RWIHANGEDTGLPSKSFDLVSI++V HECP
Sbjct  85    AKVTGLDLSPYFLAVAQHKEKRTSPGKFPKRWIHANGEDTGLPSKSFDLVSIAFVLHECP  144

Query  979   ERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLE  1158
              R I  +V E+FRLL PGGT  +TD     K LQEL PVLFTL+KSTE FLDEYYLTD++
Sbjct  145   TRVIVTLVREAFRLLWPGGTLDLTDFLVY-KVLQELSPVLFTLVKSTEAFLDEYYLTDMD  203

Query  1159  RVMREAGFVNVQSVLTDPRHRTVTATVP  1242
               +REAGFVN+ S+LTDPRH T+TATVP
Sbjct  204   ETLREAGFVNITSILTDPRHVTITATVP  231



>ref|XP_001420871.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99164.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=363

 Score =   290 bits (742),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 212/317 (67%), Gaps = 8/317 (3%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLY-SLLKIGARQVFISTAEKTNIPWREMAKEILESD--  474
             +P W+G+  LS+ V A IS + LY +++K  AR+  I TAEK  I WR+ AK  LE D  
Sbjct  46    KPDWAGDDALSKLVDAAISNELLYENIMKPMARRTLIQTAEKNGIQWRDEAKR-LEGDSR  104

Query  475   VYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIP-DANSLDE  651
             VY+  E+I++ S+EYP+YYL PFHAY EGNL WLAA EA  AT +M LR  P D  + + 
Sbjct  105   VYEAFEAIKDDSIEYPEYYLKPFHAYSEGNLCWLAATEARSATYSMALRVWPKDRITAET  164

Query  652   ASQVVRGNWLDAIEKHHKQYSGCFAI--RDILDIGCSIGVSTRCLASRYPSANLTGLDLS  825
             A Q +R ++ D +  H ++Y+    +  + ILD+GCS+G+STR L+  +P A + GLDLS
Sbjct  165   AQQRLRDSYTDTVRAHREKYNEATDVEPKKILDVGCSVGMSTRYLSEAFPQAEIVGLDLS  224

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA   ++  +     T W+H  GEDT     +FD+VS+++V HECPE A   ++ 
Sbjct  225   PYMLAVASVSDQGVEGSERRT-WVHGKGEDTKYSDATFDIVSLAFVIHECPENATAALMK  283

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+L+PGGTF +TDN+P+S  +Q+LPP LFTLMKSTEP  +EYY  D+++++  AGF 
Sbjct  284   EAHRVLKPGGTFVMTDNNPQSPVIQKLPPALFTLMKSTEPHSNEYYTIDVQQMLTNAGFE  343

Query  1186  NVQSVLTDPRHRTVTAT  1236
             NV    TDPRHRTV  +
Sbjct  344   NVHQEQTDPRHRTVCGS  360



>gb|AFK47519.1| unknown [Medicago truncatula]
Length=239

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  283  YEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI  462
            YEEG+L RP+W+GETPLSR V ALISFKPLYS+LK+GARQVFISTAEK NIPWREM KEI
Sbjct  50   YEEGKLVRPKWTGETPLSRMVRALISFKPLYSILKLGARQVFISTAEKNNIPWREMTKEI  109

Query  463  LESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANS  642
            LES VYKE++SIQNQSL YPDYYL+PFHAYDEGNL+WLAAAEAE AT +M  RAIP A+S
Sbjct  110  LESQVYKELDSIQNQSLVYPDYYLNPFHAYDEGNLTWLAAAEAEAATKSMVRRAIPTASS  169

Query  643  LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
            ++EA+Q++RGNWL+AIE+HH Q+S    I DILDIGCS+GVS+R LA ++P+AN+ GLD+
Sbjct  170  VEEATQIMRGNWLNAIEQHHLQHSQTSMIGDILDIGCSVGVSSRFLADKFPTANVIGLDM  229

Query  823  SPYF  834
            SPYF
Sbjct  230  SPYF  233



>ref|XP_002499845.1| CMV 1a interacting protein 1 [Micromonas sp. RCC299]
 gb|ACO61103.1| CMV 1a interacting protein 1 [Micromonas sp. RCC299]
Length=360

 Score =   282 bits (722),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 215/318 (68%), Gaps = 11/318 (3%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLY-SLLKIGARQVFISTAEKTNIPWREMAKEIL-ESDV  477
             +P W+G+  LS+ V A IS K LY  ++K  AR+  I+TAEK  + WR++A+E+  E  V
Sbjct  46    KPDWAGDDLLSKVVDAAISNKVLYEGIMKPMARRTLINTAEKNGVAWRDIAEELGNEPAV  105

Query  478   YKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIP-DANSLDEA  654
              +  + I+N+S+EYP+YYL PFHAY EGNL W AA EAEPAT +M LR  P D  + D A
Sbjct  106   KQAFDEIENKSVEYPEYYLQPFHAYAEGNLCWQAAVEAEPATYSMALRVWPKDRITADAA  165

Query  655   SQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYF  834
              + +R ++  A+  H  +Y G      I+D+GCS+G+STR ++  +P++ + GLDLSPY 
Sbjct  166   QKRLRDSYTGALRAHVDEYYGKEP-DTIVDVGCSVGISTRYISDAFPNSKMVGLDLSPYM  224

Query  835   LAVAQFK---EKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             LAVA+ +   E   +R+T    W+H  GEDT +   S D+VS+++V HECPE A R ++ 
Sbjct  225   LAVAKHRDEGEPGSERRT----WVHGKGEDTKMADNSVDIVSLAFVIHECPEYATRALMT  280

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+L+PGG F +TDN+PKS  +Q LPP LFTLMKSTEP  +EYY  D+E ++RE GF 
Sbjct  281   EAARILKPGGVFVMTDNNPKSPVIQNLPPALFTLMKSTEPHSNEYYTIDIEGMLRECGFE  340

Query  1186  NVQSVLTDPRHRTVTATV  1239
             +V +  TDPRHRTV  ++
Sbjct  341   HVHTENTDPRHRTVLGSL  358



>ref|XP_005645620.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21076.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=736

 Score =   292 bits (747),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 208/299 (70%), Gaps = 5/299 (2%)
 Frame = +1

Query  343   VGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILES-DVYKEMESIQNQSLEY  519
             V A IS KPL++++K+ A+QV  STAEK  IPW    +++  + +V+   E +++++LEY
Sbjct  434   VNAAISIKPLFAVMKLAAKQVLKSTAEKNGIPWDSTVQQLQNTPEVFSIREELEDKALEY  493

Query  520   PDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQVVRGNWLDAIEK  696
             PDYYL  FHAYDEGNL+WLAA E E AT +M LR  PD   + ++A   +RGN  +AI+ 
Sbjct  494   PDYYLQKFHAYDEGNLNWLAAFEVESATYSMALRTFPDQPLTPEQAHAQLRGNIHEAIQD  553

Query  697   HHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDRK  876
               +Q  G   + D LD+GCS G+STR LA  +P+A +TGLDLSP+FLAVA+++E+ R  +
Sbjct  554   FSRQ-RGARQVHDALDLGCSAGLSTRALAEAFPAAQITGLDLSPHFLAVAEYRERKRKAE  612

Query  877   TNPTR--WIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
                 R  ++HAN EDT LPS SFDLVS S+  HE P +AI  ++ E+ RLLRPGG   + 
Sbjct  613   GESRRICYVHANLEDTRLPSASFDLVSSSFTIHELPPQAICALIAEARRLLRPGGVLLLA  672

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
             DN+P+SK +Q LPP LFTLMKSTEP+ D YY  D+E  MR+AGFV+V++   D RHR V
Sbjct  673   DNNPRSKTIQNLPPALFTLMKSTEPWSDLYYAMDVEAAMRDAGFVHVETREADHRHRAV  731



>ref|WP_015139374.1| methylase [Nostoc sp. PCC 7524]
 ref|YP_007076536.1| methylase [Nostoc sp. PCC 7524]
 gb|AFY48939.1| methylase involved in ubiquinone/menaquinone biosynthesis [Nostoc 
sp. PCC 7524]
Length=316

 Score =   278 bits (711),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 203/320 (63%), Gaps = 17/320 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE+ LS FV  LI  KP+Y ++K  ARQV I TAEK  IPWR+  + + +S   +
Sbjct  6     KPDWAGESLLSNFVNLLIQTKPIYGVMKHQARQVLIKTAEKNGIPWRKNYEALQKSGAKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              + ++ N  + YPDYY  PFHAY EGNL W AA E E AT AM LR  P  N + ++A  
Sbjct  66    LLSAVTNPRVVYPDYYNVPFHAYSEGNLCWEAAFETESATYAMALRVWPQENLTWEDAHA  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLA------SRYPSANLTGLDL  822
              +RG + DA+E +     G   +RDILDIGCS+GVST  L        RYP     GLDL
Sbjct  126   RLRGTFHDALETY-----GPRQVRDILDIGCSVGVSTLALHRYYQRRERYP-VRTVGLDL  179

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPY LAVA    + RD  +    WIH   E+TGLP  SFDLV+I +V HE P  A +++ 
Sbjct  180   SPYMLAVA----RTRDVNSEIAEWIHGRAENTGLPDNSFDLVTIQFVTHELPSYASQDIF  235

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+ RLLRPGG  ++ DN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  D+E  +++ GF
Sbjct  236   AEARRLLRPGGYIALVDNNPRSPVIQNLPPVLFTLMKSTEPWSDQYYSFDIEAALQKVGF  295

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
             +   +V +DPRHRT+ A  P
Sbjct  296   LEPVTVPSDPRHRTIIARKP  315



>ref|WP_039726564.1| methyltransferase type 11 [Lyngbya confervoides]
 gb|KIF14756.1| methyltransferase type 11 [Aphanocapsa montana BDHKU210001]
 gb|KIF39676.1| methyltransferase type 11 [Lyngbya confervoides BDU141951]
Length=318

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 202/319 (63%), Gaps = 14/319 (4%)
 Frame = +1

Query  301   ERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVY  480
             ++P W+G+  LS+ V  LI  KPLY+L+K  ARQV I TAEK  IPWR+   E   + V 
Sbjct  7     QKPAWAGDDFLSQVVNRLIQTKPLYALMKRQARQVLIKTAEKNGIPWRQTCAEYEAAGVA  66

Query  481   KEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQ  660
               ++ +QN  + YPDYY  PFHAY+ GNL W AA EAE AT +M LR  PD     +A+Q
Sbjct  67    DRIDQVQNPQVTYPDYYQVPFHAYEAGNLCWQAAFEAESATYSMALRVWPDETLTPQAAQ  126

Query  661   -VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRYPSANLTGLDLS  825
               +R ++   + ++  Q      ++D LD+GCS+G+ST    R L  R P+    GLDLS
Sbjct  127   DRLRHSFHQVLAEYLPQ-----PVQDALDMGCSVGISTLTLHRWLQQRSPTVRTIGLDLS  181

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             P+ L VAQ     RD +   T+W+H   EDTGLPS SFDL+S+ +V HE P  A R +  
Sbjct  182   PHMLTVAQ----ARDIQHEITQWLHVAAEDTGLPSHSFDLISLQFVTHELPRTAARAIFQ  237

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E++RLLRPGGT ++ DN+PKS  +Q LPPV+FTLMKSTEP+ D+YY  D+E  + + G+ 
Sbjct  238   EAWRLLRPGGTLAIADNNPKSPVIQNLPPVIFTLMKSTEPWSDDYYTFDIEAALADLGYE  297

Query  1186  NVQSVLTDPRHRTVTATVP  1242
              V +  TDPRHR + A  P
Sbjct  298   RVVTHETDPRHRAILAQKP  316



>ref|WP_010997189.1| methyltransferase type 11 [Nostoc sp. PCC 7120]
 ref|NP_487078.1| hypothetical protein alr3038 [Nostoc sp. PCC 7120]
 dbj|BAB74737.1| alr3038 [Nostoc sp. PCC 7120]
Length=316

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 200/320 (63%), Gaps = 17/320 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE+ LS FV  LI  KP+Y ++K  ARQV I TAEK  IPWR+  + +  S   K
Sbjct  6     KPDWAGESLLSNFVNLLIQTKPIYGVMKQQARQVLIKTAEKNGIPWRKNYEALQVSPAKK  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQV  663
              + ++ N  + YPDYY  PFHAY EGNL W AA E E AT AM LR  P  N   EA+  
Sbjct  66    LLAAVTNPHVIYPDYYKVPFHAYTEGNLCWDAAFETESATYAMALRVWPQENLTWEAAHA  125

Query  664   -VRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLA------SRYPSANLTGLDL  822
              +RG + DA+E +  Q      +RDILDIGCS+GVST  L        RYP     GLDL
Sbjct  126   RLRGTFHDALETYAPQ-----QVRDILDIGCSVGVSTLALHRYYQRRERYP-VRTVGLDL  179

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPY LAVA    K RD  +  + W+HA  E+TGLP KSFDLV+I +V HE P    + + 
Sbjct  180   SPYMLAVA----KTRDVNSEISEWLHARAENTGLPDKSFDLVTIQFVTHELPGYVSQEIF  235

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+ RLLRPGG  ++ DN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  D+E  ++  GF
Sbjct  236   AEAKRLLRPGGYIALVDNNPRSPVIQNLPPVLFTLMKSTEPWSDDYYTFDIEAALQAVGF  295

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
                 +V +DPRHRT+ A  P
Sbjct  296   APPITVPSDPRHRTIIARKP  315



>ref|WP_017711872.1| hypothetical protein [Prochlorothrix hollandica]
Length=325

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 200/316 (63%), Gaps = 15/316 (5%)
 Frame = +1

Query  313   WSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEME  492
             W+GE  LSR V  LI  KPLY+L+K  ARQV I TAEK  +PWRE A+ + +S V   +E
Sbjct  17    WAGEDWLSRGVNLLIQTKPLYNLMKHQARQVLIKTAEKKGVPWREKAQTLAKSGVLDRLE  76

Query  493   SIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQVVR  669
             ++ N ++ YPDYY  PFHAYDEGNL W AA EAE AT AM LR     + S  EA   +R
Sbjct  77    AMTNPAIVYPDYYKVPFHAYDEGNLCWPAAFEAESATYAMGLRVWTQTDLSAAEAQHRLR  136

Query  670   GNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTR-----CLASRYPSANLTGLDLSPYF  834
              ++  A+E H  +      +RD+LD+GCS+G+STR     C   +  +    GLDLSPY 
Sbjct  137   HSFHQALEPHLPE-----VVRDVLDVGCSVGLSTRTLHQYCQERQSQTVRTVGLDLSPYM  191

Query  835   LAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESF  1014
             L VAQ      D + +  +WIH   E TGLP +SFD+V++ +V HE P  A   +  E +
Sbjct  192   LTVAQ----ELDTENSIDQWIHGLAEQTGLPDQSFDVVTLQFVIHELPREASTAIFQECW  247

Query  1015  RLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQ  1194
             RLLRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  D+E  ++  GF    
Sbjct  248   RLLRPGGCLALVDNNPKSAVIQNLPPVLFTLMKSTEPWSDDYYTFDVEEALQTVGFTEPV  307

Query  1195  SVLTDPRHRTVTATVP  1242
             +V +DPRHRT+TA  P
Sbjct  308   TVPSDPRHRTITALKP  323



>ref|WP_026736377.1| methyltransferase type 11 [Fischerella sp. PCC 9605]
Length=316

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 199/319 (62%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LSRFV  LI  +P+Y+L+K  ARQV I TAEK  IPWR+  + +  S V +
Sbjct  6     KPDWAGEGLLSRFVNLLIQTRPIYNLMKHQARQVLIKTAEKNGIPWRKNCETLEASGVKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              +    N S+ YPDYY  PFHAY EGNL W AA EA  AT +M LR  P  N + + A +
Sbjct  66    RLTETVNSSIVYPDYYQVPFHAYSEGNLCWQAALEAPSATYSMALRVWPKENLTWEVAHE  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +RG++   +  +  Q      +RDILDIGCS+G+ST  L   Y           GLDLS
Sbjct  126   RLRGSFHQVLATYGPQ-----QVRDILDIGCSVGISTLALHRYYQKKQNHPVRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K  D K   + W+HA GEDT LP+ SFDLV++ +V HE P  A + +  
Sbjct  181   PYMLAVA----KILDVKGEISEWLHATGEDTRLPNNSFDLVTLQFVTHELPHYASKQIFA  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY+ D+E  ++  GF 
Sbjct  237   EALRLLRPGGYIALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDDYYMFDIEAALQTVGFE  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+ +  P
Sbjct  297   QPVTVASDPRHRTIISCKP  315



>ref|WP_011317726.1| methyltransferase type 11 [Anabaena variabilis]
 ref|YP_321391.1| hypothetical protein Ava_0872 [Anabaena variabilis ATCC 29413]
 gb|ABA20496.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=316

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 199/320 (62%), Gaps = 17/320 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE+ LS FV  LI  KP+Y ++K  ARQV I TAEK  IPWR+  + +  S   K
Sbjct  6     KPDWAGESLLSNFVNLLIQTKPIYGVMKQQARQVLIKTAEKNGIPWRKNYEALQASPAKK  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              + ++ N  + YPDYY  PFHAY EGNL W AA E E AT AM LR  P  N + + A  
Sbjct  66    LLAAVTNPHVIYPDYYKVPFHAYTEGNLCWDAAFETESATYAMALRVWPQENLTWEAAHD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLA------SRYPSANLTGLDL  822
              +RG + DA+E +  Q      +RDILDIGCS+G+ST  L        RYP     GLDL
Sbjct  126   RLRGTFHDALETYAPQ-----QVRDILDIGCSVGISTLALHRYYQRRERYP-VRTVGLDL  179

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPY LAVA    K RD  +  + W+HA  E+TGL  KSFDLV+I +V HE P    + + 
Sbjct  180   SPYMLAVA----KTRDVNSEISEWLHARAENTGLSDKSFDLVTIQFVTHELPSYVSQEIF  235

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+ RLLRPGG  ++ DN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  D+E  ++  GF
Sbjct  236   AEAKRLLRPGGYIALVDNNPRSPVIQNLPPVLFTLMKSTEPWSDDYYTFDIEAALQAVGF  295

Query  1183  VNVQSVLTDPRHRTVTATVP  1242
                 +V +DPRHRT+ A  P
Sbjct  296   APPVTVPSDPRHRTIIARKP  315



>ref|XP_007511288.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66848.1| predicted protein [Bathycoccus prasinos]
Length=340

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/317 (46%), Positives = 211/317 (67%), Gaps = 5/317 (2%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYS-LLKIGARQVFISTAEKTNIPWREMAKEILESD-V  477
             +P W+G+  LS+ V A IS K LY  ++K  AR+  I TAEK  I WRE+A+E+ + + +
Sbjct  24    KPDWAGDDILSKAVDAAISNKFLYEVIMKPMARKTLIDTAEKNGIKWREVAEELQKDERL  83

Query  478   YKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEA  654
               +   I+  S+EYP+YYL PFHAY EGNL WLAA EAE AT +M LR  P    +  EA
Sbjct  84    QAKFNEIEISSMEYPEYYLKPFHAYTEGNLCWLAACEAESATYSMALRVYPKERITAMEA  143

Query  655   SQVVRGNWLDAIEKHHKQYSGCFAIRD-ILDIGCSIGVSTRCLASRYPSANLTGLDLSPY  831
              Q +R ++   +  H ++Y+      + I+DIGCS+G+STR ++ ++PSA   G+DLSP+
Sbjct  144   QQRLRDSYTTTLRDHREKYNATNVEPEVIVDIGCSVGMSTRYISRQFPSAKTIGMDLSPH  203

Query  832   FLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNES  1011
              LAVA  +++ ++  ++   W+H  GEDT +   S D+VS+++V HECPE A   ++ E+
Sbjct  204   MLAVASLRDE-QETDSSQRVWVHGKGEDTKMADNSVDVVSLAFVIHECPETATDALMKEA  262

Query  1012  FRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNV  1191
             FR+LRPGGTF +TDN+P+S  +Q+LPP LFTLMKSTEP  +EYY  ++  +++  GF + 
Sbjct  263   FRILRPGGTFIMTDNNPQSAVIQKLPPALFTLMKSTEPHSNEYYTINVVNMLKANGFEHA  322

Query  1192  QSVLTDPRHRTVTATVP  1242
                 TDPRHRTV A+ P
Sbjct  323   HQEQTDPRHRTVLASKP  339



>ref|WP_012307394.1| methyltransferase type 11 [Synechococcus sp. PCC 7002]
 ref|YP_001735027.1| hypothetical protein SYNPCC7002_A1783 [Synechococcus sp. PCC 
7002]
 gb|ACA99771.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
Length=318

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 200/320 (63%), Gaps = 15/320 (5%)
 Frame = +1

Query  301   ERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVY  480
             E+P W+GE  LSR V  LI  KPLY+L+K  AR+V I TAEK  +PWR+  KE+ +S   
Sbjct  9     EKPDWAGEDWLSRLVNRLIQTKPLYALMKQQARRVLIKTAEKNGVPWRQTVKELEQSPAK  68

Query  481   KEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQ  660
             +  + I N  L+YPDYY  PFHAY+EGNL W AA EA PAT AM LR         E +Q
Sbjct  69    QYFQDIANPHLDYPDYYRVPFHAYNEGNLCWQAAFEAAPATAAMALRVWKTEPLTPEVAQ  128

Query  661   V-VRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRY----PSANLTGLDLS  825
               +R ++LD +E++  Q      + ++LDIGCS+G+ST  L  R     P+  +TGLDLS
Sbjct  129   ARLRNSFLDVLEQYLPQ-----NVNEVLDIGCSVGISTFALLERLQAKNPAVEVTGLDLS  183

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             P+ LAVA+ ++KN+       +W H   E T      FDL+++ +V HE P +A R +  
Sbjct  184   PHMLAVAKVQDKNQ-----AVQWCHGKAETTEFTDDRFDLITLQFVLHELPNQATREIFQ  238

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E  R+LRPGG  ++ DN+PKS  +Q LPP LF LMKSTEP+ DEYY  D+E  ++E GF 
Sbjct  239   ECRRILRPGGCLAIVDNNPKSPVIQGLPPALFVLMKSTEPWSDEYYTFDVESTLKEVGFD  298

Query  1186  NVQSVLTDPRHRTVTATVPY  1245
                +V +DPRHRT+ A  P+
Sbjct  299   YRTTVASDPRHRTIIAHKPF  318



>ref|WP_036477770.1| methyltransferase type 11 [Myxosarcina sp. GI1]
Length=318

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/320 (47%), Positives = 197/320 (62%), Gaps = 15/320 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSR V   I  KP+YSL+K  ARQV I TAEK  I WRE  +E+ +S+   
Sbjct  8     KPSWAGDDILSRLVNLAIRTKPIYSLMKHQARQVIIKTAEKNGISWRENYRELEQSEAKA  67

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++S+ N  L YPDYYL PFHAYD GNL W AA EA  AT +M LR   D   +   A  
Sbjct  68    LLDSVTNHKLVYPDYYLVPFHAYDRGNLCWEAAFEATSATYSMPLRVWKDEKLTWQTAHT  127

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCL-----ASRYPSANLTGLDLS  825
              +R ++ D + +    Y+G   + DILD+GCS+G+ST  L     A +  S    GLDLS
Sbjct  128   RLRHSFYDIVAR----YTGD-RLTDILDLGCSVGISTLALHHYVAAKQNSSPRTVGLDLS  182

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA+  +K ++     +RW+H   EDT LPS SFDLV++ +V HE P +A   +  
Sbjct  183   PYMLAVAKINDKQQE----ISRWLHGLAEDTRLPSNSFDLVTLQFVLHELPRQATTAIFK  238

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E  R+L+PGG   + DN P S  +Q LPPVLFTLMKSTEP+ D+YY  DLE  M++ GF 
Sbjct  239   EVLRILKPGGVIGIVDNDPASPVIQNLPPVLFTLMKSTEPWSDDYYTFDLEAAMQQVGFD  298

Query  1186  NVQSVLTDPRHRTVTATVPY  1245
                +V +DPRHRT+    PY
Sbjct  299   YKTTVASDPRHRTLIGIKPY  318



>ref|WP_012629073.1| methyltransferase type 11 [Cyanothece sp. PCC 7425]
 ref|YP_002484378.1| type 11 methyltransferase [Cyanothece sp. PCC 7425]
 gb|ACL46017.1| Methyltransferase type 11 [Cyanothece sp. PCC 7425]
Length=323

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/320 (46%), Positives = 203/320 (63%), Gaps = 15/320 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSR V  LI  KPLY+L+K  ARQV I TAEK  +PWR+  +E+  + + +
Sbjct  13    KPAWAGDDLLSRCVNLLIQTKPLYALMKQQARQVLIKTAEKNGVPWRKRYEELEAAGIQQ  72

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++  + N +++YPDYY  PFHAY++GNL W AA EAE AT AM LR   +   +  EA +
Sbjct  73    QVTQVTNAAVQYPDYYRVPFHAYEDGNLCWQAAFEAEAATHAMALRVWKNEPLTWQEAQE  132

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +RG++   + +   Q      ++DILDIGCS+G+S+  L   Y S         GLDLS
Sbjct  133   RLRGSFHQILAQTIAQ-----PVQDILDIGCSVGISSLALHRFYQSRQEGPVRTVGLDLS  187

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVAQ+    RD +    +WIHAN E T LP + FDLV++ +V HE P +    +  
Sbjct  188   PYMLAVAQY----RDVQREIAQWIHANAEATDLPDRCFDLVTLQFVTHELPGQVTTTIFR  243

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FRLLR GG  ++ DN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  +LE  M+  GF 
Sbjct  244   EAFRLLRSGGYLAIVDNNPQSPVIQNLPPVLFTLMKSTEPWSDDYYTFNLEAAMQTTGFE  303

Query  1186  NVQSVLTDPRHRTVTATVPY  1245
              + +V +DPRHRT+    PY
Sbjct  304   EILTVPSDPRHRTILGRKPY  323



>ref|WP_015195860.1| type 11 methyltransferase [Calothrix parietina]
 ref|YP_007135174.1| type 11 methyltransferase [Calothrix sp. PCC 6303]
 gb|AFY99201.1| Methyltransferase type 11 [Calothrix sp. PCC 6303]
Length=315

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 200/316 (63%), Gaps = 15/316 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LS+FV  LI  KPLY+L+K  ARQV I TAEK  +PWR+  + +  S   +
Sbjct  6     KPDWAGQDYLSKFVNLLIQTKPLYNLMKQQARQVIIKTAEKNGVPWRKNYEHLALSGAKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++ +I N S++YPDYY  PFHAY EGNL W AA EA  AT +M LR   +   + + A  
Sbjct  66    QLATITNPSIQYPDYYQVPFHAYSEGNLCWKAAFEAPSATYSMALRVWKNEPLTWEAAHN  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSAN-----LTGLDLS  825
              +RG++ D +  H  Q      +RDILDIGCS+G+ST  L   Y  +        GLDLS
Sbjct  126   RLRGSFHDMLALHAPQ-----TVRDILDIGCSVGISTLTLHRYYQQSQNHPVRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA+  + N +     ++W+HA  E+TGL   SFDLV++ +V HE P +A   +  
Sbjct  181   PYMLAVAKILDTNAEI----SQWLHAKAENTGLADNSFDLVTLQFVTHELPHQASVEIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ DEYY  D+E  + + GF 
Sbjct  237   EALRVLRPGGYLALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDEYYTFDIEESLDKIGFE  296

Query  1186  NVQSVLTDPRHRTVTA  1233
               ++  +DPRHRT+ A
Sbjct  297   KPKTFASDPRHRTIIA  312



>ref|WP_017661081.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=316

 Score =   271 bits (692),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 199/319 (62%), Gaps = 17/319 (5%)
 Frame = +1

Query  298   LERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDV  477
             L +P W+G+  LSR V  LI    LY ++K  AR+V I TAE+  IPWR+    +  SDV
Sbjct  6     LNKPAWAGDDWLSRLVNQLIQTPFLYRVMKQQARRVMIRTAERNGIPWRDRVAALETSDV  65

Query  478   YKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEA  654
                 + + N ++ YPDYY  PFHAYDEGNL WLAA EAEPAT AM LR  P  N S D A
Sbjct  66    KALADRLTNANVTYPDYYNVPFHAYDEGNLCWLAAFEAEPATYAMALRVTPKENLSPDVA  125

Query  655   SQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRY------PSANLTGL  816
                +R ++ D ++KH      C+ +RD+LD+GCSIG+STR L  RY        AN+ GL
Sbjct  126   YDRLRTSFYDIVDKHL-----CYPVRDVLDVGCSIGMSTRSL-HRYLRSRQSEPANIIGL  179

Query  817   DLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRN  996
             DLSP  LAVAQ    + D      RW+H   E T  P  SFDLV++ ++ HE P  A   
Sbjct  180   DLSPQMLAVAQ----HLDSDNEIDRWVHGLAEATEFPDNSFDLVTLQFILHELPNAATEA  235

Query  997   VVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREA  1176
             +  E+ R+LRPGG  ++ DN+PKSK +Q LPP LF LMKSTEP+ DEYY  D+E  +++ 
Sbjct  236   IFKEARRILRPGGIIAIADNNPKSKVIQNLPPALFVLMKSTEPWSDEYYTFDVEATLQKL  295

Query  1177  GFVNVQSVLTDPRHRTVTA  1233
             GF ++++  +DPRHR + A
Sbjct  296   GFEHLETAPSDPRHRAIVA  314



>ref|WP_030006346.1| methyltransferase type 11 [Synechococcus sp. NKBG042902]
Length=318

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 199/319 (62%), Gaps = 15/319 (5%)
 Frame = +1

Query  301   ERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVY  480
             E+P W+GE  LSR V  LI  KPLY+L+K  AR+V I TAEK  +PWR++ +E+ +S   
Sbjct  9     EKPDWAGEDWLSRLVNRLIQTKPLYALMKQQARRVLIKTAEKNGVPWRQIVQELEQSPAK  68

Query  481   KEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQ  660
             +  + I N  L+YPDYY  PFHAY+EGNL W AA EA PAT AM LR         E +Q
Sbjct  69    QYFQDIANPHLDYPDYYQVPFHAYNEGNLCWQAAFEAAPATAAMALRVWKTEPLTPEVAQ  128

Query  661   V-VRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRY----PSANLTGLDLS  825
               +R ++LD +E++  Q      + + LDIGCS+G+ST  L  R     P+  +TGLDLS
Sbjct  129   ARLRNSFLDVLEQYLPQ-----NVNEALDIGCSVGISTFALLERLQAKNPAVKVTGLDLS  183

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             P+ LAVA+ ++KN+       +W H   E T      FDL+++ +V HE P +A R +  
Sbjct  184   PHMLAVAKVQDKNQ-----AVQWCHGKAETTEFTDDRFDLITLQFVLHELPNQATREIFQ  238

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E  R+LRPGG  ++ DN+PKS  +Q LPP LF LMKSTEP+ DEYY  D+E  ++E GF 
Sbjct  239   ECRRILRPGGCLAIVDNNPKSPVIQGLPPALFVLMKSTEPWSDEYYTFDVESTLKEVGFD  298

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+ A  P
Sbjct  299   YRTTVASDPRHRTIIAHKP  317



>ref|WP_019506330.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=319

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 198/319 (62%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LSRFV  LI  KP+Y +++  ARQV I TAEK  IPWR+  +E+ +S    
Sbjct  9     KPDWAGEDLLSRFVNLLIQIKPIYGIMQSQARQVLIKTAEKNGIPWRKNYQELEQSGAKS  68

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              + ++ N  L YP+YY  PFHAYD GNL W AA EA  AT +M LR   + N S  EA Q
Sbjct  69    LLATLTNPDLVYPEYYQVPFHAYDRGNLCWQAAFEAASATYSMGLRVWKNENLSWQEAQQ  128

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRYPSA-NLTGLDLS  825
              +R +    +E    QY+    + DILD+GCS+GVST    R  + +  SA N  GLDLS
Sbjct  129   RLRHSCYQILE----QYTPT-RVTDILDLGCSVGVSTLALHRYFSQKQDSAINAIGLDLS  183

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVAQ      D +   ++W+H  GE TGL   S DLV++ +V HE P +A + +  
Sbjct  184   PYMLAVAQ----TTDTQQEISQWLHGLGESTGLADNSLDLVTLQFVIHELPRQATKQIFR  239

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E FR+L+PGG   + DN+P S  +Q LPPVLFTLMKSTEP+ D+YY  D+E  ++EAGF 
Sbjct  240   EVFRILKPGGVIGIVDNNPASPVIQGLPPVLFTLMKSTEPWSDDYYTFDVEAAIQEAGFD  299

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+    P
Sbjct  300   YQTTVASDPRHRTIIGIKP  318



>ref|WP_008312293.1| methylase involved in ubiquinone/menaquinone biosynthesis [Leptolyngbya 
sp. PCC 6406]
Length=323

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 195/316 (62%), Gaps = 15/316 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSR V  LI  KPLY+L+K  ARQV I TAEK  IPWR+      +S V  
Sbjct  6     KPAWAGDDWLSRLVNVLIGTKPLYALMKRQARQVLIKTAEKNGIPWRQTRTHWEDSGVCD  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQ-  660
              +  + N  + YPDYY  PFHAY EGNL W AA EAEPAT AM LR  P      +A+Q 
Sbjct  66    RISGVTNPKVTYPDYYKMPFHAYGEGNLCWQAAFEAEPATYAMALRIWPQEPLTWQAAQD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANL-----TGLDLS  825
              +R ++  A+  H     G   ++D+LDIGCS+G+ST  L   Y    L      GLDLS
Sbjct  126   RLRHSFHQALVDH-----GPTQVQDVLDIGCSVGISTLSLHRFYCQRQLQHPRTIGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY L VAQ ++  R+      +WIHA  E TGLP  SFDL+++ +V HE P  A R +  
Sbjct  181   PYMLTVAQARDTAREID----QWIHAQAEATGLPDASFDLITLQFVTHELPRTATRAIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E  RLLRP GT ++TDN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  D+E  + E GF 
Sbjct  237   ECLRLLRPSGTLAITDNNPRSTVIQNLPPVLFTLMKSTEPWSDDYYTFDIEAALEEIGFQ  296

Query  1186  NVQSVLTDPRHRTVTA  1233
                ++ TDPRHRT+ A
Sbjct  297   PPVTLATDPRHRTILA  312



>ref|WP_024546396.1| methyltransferase type 11 [Synechococcus sp. NKBG15041c]
Length=318

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 198/319 (62%), Gaps = 15/319 (5%)
 Frame = +1

Query  301   ERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVY  480
             E+P W+GE  LSR V  LI  KPLY+L+K  AR+V I TAEK  +PWR++ K++ +S+  
Sbjct  9     EKPDWAGEDWLSRLVNRLIQTKPLYALMKQQARRVLIKTAEKNGVPWRQIVKDLEKSEAQ  68

Query  481   KEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQ  660
             +  + +    L YPDYY  PFHAY EGNL W AA EA PAT AM LR   +     E +Q
Sbjct  69    QYFQELTKPDLGYPDYYQVPFHAYSEGNLCWQAAFEAAPATAAMALRVWKNEPLTPEVAQ  128

Query  661   V-VRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRY----PSANLTGLDLS  825
               +R ++LD +E+H  Q      +   LD+GCS+G+ST  L  R     P+  +TGLDLS
Sbjct  129   ARLRNSFLDVLEQHLPQ-----EVNRALDLGCSVGISTFALLKRLQEKNPAVQMTGLDLS  183

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA+ ++K ++      +W H   E T   +  FD+V++ +V HE P +A R +  
Sbjct  184   PYMLAVAKVQDKAQE-----VQWCHGKAEATDFAANHFDVVTLQFVLHELPNQATREIFQ  238

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E  R+LRPGG  ++ DN+PKS  +Q LPP LF LMKSTEP+ DEYY  D+E  +++ GF 
Sbjct  239   ECLRILRPGGCLAIVDNNPKSPVIQGLPPALFVLMKSTEPWSDEYYTFDVESTLKQVGFD  298

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+ A  P
Sbjct  299   YQTTVASDPRHRTIIARKP  317



>ref|WP_006619102.1| methyltransferase type 11 [Arthrospira platensis]
 ref|YP_005070779.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI92241.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR54149.1| methyltransferase type 11 [Arthrospira platensis str. Paraca]
Length=317

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 200/319 (63%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G   LS+FV  LI  KP++S++K  AR+V I TAEK  IPWRE  +++  SDV  
Sbjct  8     KPDWAGGDFLSQFVNLLIQTKPIFSVMKYQARRVLIKTAEKKGIPWRETYQQLEGSDVKA  67

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              +  I + ++ YPDYY  PFHAYD+GNL W AA EAE AT +M LR  P  + S   A +
Sbjct  68    LLPEITDTTVVYPDYYQVPFHAYDDGNLCWKAAFEAESATYSMALRVWPKEDLSWLTAQE  127

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYP-----SANLTGLDLS  825
              +R ++   +E +         +RDILDIGCS+G+ST+ L + Y      S    GLDLS
Sbjct  128   RLRHSFHQVLENYSPN-----PVRDILDIGCSVGISTQALHNYYQHRQETSIRTVGLDLS  182

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY L+VA    K RD +   + W HAN E+TG    SFD+V++ ++ HE P  A RN+  
Sbjct  183   PYMLSVA----KMRDTEGKISEWKHANAENTGFADDSFDVVTLQFLIHELPRTATRNIFK  238

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LR  G  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  D+E  + E+GF 
Sbjct  239   EALRILRSHGVLAIVDNNPKSAVIQNLPPVLFTLMKSTEPWTDDYYTFDVETTLSESGFD  298

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V TDPRHRT+ A  P
Sbjct  299   YQTTVETDPRHRTIIAIKP  317



>ref|WP_016870021.1| methyltransferase type 11 [Fischerella muscicola]
Length=316

 Score =   268 bits (684),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 195/319 (61%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+FV  LI  +P+Y+L+K  ARQV I TAEK  +PWR+  + +  S V +
Sbjct  6     KPDWAGEGLLSQFVNLLIQTRPIYNLMKHQARQVIIKTAEKNGVPWRKNYESLAASGVKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++  I + S+ YPDYY  PFHAY EGNL W AA EA  AT +M LR  P    + + A  
Sbjct  66    QLTEIVDSSIVYPDYYQVPFHAYSEGNLCWQAALEAPSATYSMALRVWPKEKLTWETAHD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSAN-----LTGLDLS  825
              +R  +   +  +  Q      +RDILDIGCS+G+ST  L   Y           GLDLS
Sbjct  126   RLRDTFHQVLATYGPQ-----EVRDILDIGCSVGISTLALHRFYQKKQNHPVRTIGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K  D     ++W+HA GEDT L S SFDLV++ +V HE P  A + +  
Sbjct  181   PYMLAVA----KTLDVNCEISQWLHAKGEDTKLQSNSFDLVTLQFVTHELPHYASKAIFT  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  D+E  + E GF 
Sbjct  237   EALRLLRPGGCIALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDDYYSFDIEAALEEVGFK  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+ +  P
Sbjct  297   KPVTVASDPRHRTIISCKP  315



>ref|XP_005850400.1| hypothetical protein CHLNCDRAFT_50738 [Chlorella variabilis]
 gb|EFN58298.1| hypothetical protein CHLNCDRAFT_50738 [Chlorella variabilis]
Length=342

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 195/314 (62%), Gaps = 26/314 (8%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSR V A I+FKPL++L+K+GARQ   STAEK  +PW    +E+ +S+V++
Sbjct  51    KPDWTGDDTLSRVVNAAINFKPLFALMKLGARQTMKSTAEKAGVPWSANVRELEQSEVFQ  110

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
               E I+++ L YPDYY  PFH Y+EGNL+WLAA E EPA+  M LR       +  +A  
Sbjct  111   IKEEIEDKGLAYPDYYTVPFHGYNEGNLNWLAAFEVEPASDVMALRVWKTEQLTPLQAMT  170

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLA  840
              +R     AI     ++     +RD++DIGCS+GVSTR LA+ +P A             
Sbjct  171   RLRKAIYTAIRAFQARHD-LREVRDMIDIGCSVGVSTRWLAAEWPQAQ------------  217

Query  841   VAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRL  1020
                     R R     R++HAN E TGLP  SFDLV++ +V HECP RAI  +V E  RL
Sbjct  218   --------RQR----IRYMHANMESTGLPDASFDLVAVQFVAHECPGRAIEGLVRECRRL  265

Query  1021  LRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSV  1200
             LRPGGT ++ DN+P+SK +Q LPPVLFTLMKSTEP  DEYY  D+E  M+  G   V +V
Sbjct  266   LRPGGTLALCDNNPRSKVIQNLPPVLFTLMKSTEPHSDEYYQYDIEGCMQAQGLQGVGTV  325

Query  1201  LTDPRHRTVTATVP  1242
              +DPRHR +   +P
Sbjct  326   ESDPRHRVILGYLP  339



>ref|WP_017290335.1| methyltransferase type 11 [Leptolyngbya boryana]
Length=315

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 201/319 (63%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSR V  LI  +P+Y+++K  ARQV I TAE+  +PWR+  +E+  +++  
Sbjct  6     KPAWAGDDFLSRCVNLLIQTQPVYAVMKQQARQVLIKTAERNGVPWRKRVEELATAEIEH  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
                 + NQ + YPDYY  PFHAY+ GNL W AA EAEPAT AM LR   D   + +EA  
Sbjct  66    SAAQLTNQKVSYPDYYQVPFHAYEHGNLCWQAAFEAEPATHAMALRVWKDEPLTWEEAQA  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +RG++   + ++ +Q      ++DILDIGCSIG+ST  L   Y +         GLDLS
Sbjct  126   RLRGSFHQVLAQNIQQ-----PVQDILDIGCSIGLSTIALHRFYQNRQQQQVRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVAQ+++ +R+     ++WIHAN E T LP  S DL++I +V HE P  A   +  
Sbjct  181   PYMLAVAQYRDGDREI----SQWIHANAEATELPDCSLDLITIQFVLHELPRYATIAIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG   + DN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  ++E  +   GF 
Sbjct  237   EALRLLRPGGHLGIVDNNPQSPVIQNLPPVLFTLMKSTEPWSDDYYTFNVETALESVGFE  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
              V +V +DPRHRT+    P
Sbjct  297   QVTTVASDPRHRTILGCKP  315



>ref|WP_019492255.1| methyltransferase type 11 [Calothrix sp. PCC 7103]
Length=319

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 199/317 (63%), Gaps = 15/317 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+FV  LI  +P+Y ++K  AR+V I TAEK  +PWR+  + + +S + +
Sbjct  6     KPDWAGEDLLSQFVNLLIQTEPIYKVMKHQARRVLIKTAEKNGVPWRQNYEHLEKSGIKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              + +I N  + YP YY  PFHAY EGNL W AA EA  AT +M LR   +   + + A  
Sbjct  66    NLAAITNPQITYPKYYQVPFHAYSEGNLCWQAAFEAPSATYSMALRVWKNEPLTWEVAHN  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSAN-----LTGLDLS  825
              +RG++ D +  +     G   ++DILDIGCS+G+ST  L   Y           GLDLS
Sbjct  126   RLRGSFHDVLGIY-----GPKQVKDILDIGCSVGISTLTLHRYYEKKQNHPVRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K  D K   ++W+HA  EDT LP  SFDLV++ +V HE P  A R +  
Sbjct  181   PYMLAVA----KTLDTKNEISQWLHALAEDTKLPDNSFDLVTLQFVTHELPRVASRAIFK  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FRL+RPGG  ++ DN+PKSK +Q LPPVLFTLMKSTEP+ DEYY  ++E  ++E GF 
Sbjct  237   EAFRLVRPGGAIAIVDNNPKSKVIQNLPPVLFTLMKSTEPWSDEYYTFNIEEELQEVGFE  296

Query  1186  NVQSVLTDPRHRTVTAT  1236
                +V +DPRHRT+ A+
Sbjct  297   APLTVESDPRHRTIVAS  313



>ref|WP_026719287.1| methyltransferase type 11 [Fischerella sp. PCC 9431]
Length=316

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 202/319 (63%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+FV  LI  KP+Y+L+K  ARQV I TAEK  IPWR+  + +  S V +
Sbjct  6     KPDWAGEGLLSQFVNLLIQTKPIYNLMKHQARQVIIKTAEKNGIPWRKNYETLAASGVTQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++  I + ++ YPDYY  PFHAY +GNL W AA EA  AT +M LR  P    + + A  
Sbjct  66    QLAEIVDSNIVYPDYYQVPFHAYSQGNLCWQAALEAPSATYSMALRVWPKEKLTWEVAHD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +RG++   +  +  Q      + DILDIGCS+G+ST  L   Y        +  GLDLS
Sbjct  126   RLRGSFHQVLATYGPQ-----KVNDILDIGCSVGISTLTLHRFYQKKQNHPVHTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             P+ LAVA++ + N +     ++WIH  GE+TGL S SFDLVS+ +V HE P  A + +  
Sbjct  181   PHMLAVAKYLDVNSEI----SQWIHGRGENTGLQSNSFDLVSLQFVTHELPHYASKAIFA  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  D++  ++E GF 
Sbjct  237   EALRLLRPGGCIALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDDYYSFDVKAGLQEVGFN  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+ ++ P
Sbjct  297   KPVTVASDPRHRTIISSKP  315



>ref|WP_036012284.1| methyltransferase type 11 [Leptolyngbya sp. JSC-1]
Length=324

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 148/325 (46%), Positives = 200/325 (62%), Gaps = 15/325 (5%)
 Frame = +1

Query  286   EEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEIL  465
             +  QL +P W+G+  LSR V  LI  KPLY+++K  ARQV I TAEK  IPWR+  + + 
Sbjct  3     QTNQLPKPAWAGDDLLSRCVNRLIQTKPLYAVMKQQARQVLIKTAEKNGIPWRQNYEALA  62

Query  466   ESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-S  642
                + +++  + N  + YPDYY  PFHAY+ GNL W AA EAE AT AM LR     + S
Sbjct  63    NLGIQQQLGQLTNPRITYPDYYRVPFHAYEAGNLCWQAAFEAESATHAMALRVWKQESLS  122

Query  643   LDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCL-----ASRYPSANL  807
               EA   +RG++   +  H  Q      ++DILDIGCS+G+ST  L     AS+      
Sbjct  123   WQEAQARLRGSFHQVLAAHIAQ-----PVQDILDIGCSVGISTLALHRFYQASQTIPVRT  177

Query  808   TGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERA  987
              GLDLSPY LAVAQ +++NR+  T    W+HAN E T LP+ SFDL+++ +V HE P  A
Sbjct  178   VGLDLSPYMLAVAQQRDENREIST----WMHANAEATELPANSFDLITLQFVIHELPRTA  233

Query  988   IRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVM  1167
                +  E+ RLLRP G  +V DN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  D+E  +
Sbjct  234   TVAIFREALRLLRPQGYLAVVDNNPQSPVIQNLPPVLFTLMKSTEPWSDDYYTFDVEAAI  293

Query  1168  REAGFVNVQSVLTDPRHRTVTATVP  1242
                G   + +  +DPRHRT+ +  P
Sbjct  294   CSVGLEPIITTASDPRHRTILSRKP  318



>ref|WP_009782151.1| methyltransferase type 11 [Lyngbya sp. PCC 8106]
 gb|EAW39191.1| hypothetical protein L8106_04596 [Lyngbya sp. PCC 8106]
Length=314

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 200/319 (63%), Gaps = 16/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G   LSR V  LI   P+YS++K  ARQV I TAEK  IPWR+  +++  S+V  
Sbjct  6     KPDWAGGDVLSRLVNVLIKTPPIYSVMKHQARQVLIKTAEKNGIPWRKHYQQLAASEVKN  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
                 I NQ++ YPDYY  PFHAY+ GNL W AA EAE AT +M LR   +   + + A +
Sbjct  66    IFSEINNQNIIYPDYYQKPFHAYEAGNLCWKAAFEAESATYSMGLRVWKNEQITWETAHE  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCL-----ASRYPSANLTGLDLS  825
              +R ++   ++ +  +     ++  +LDIGCS+GVSTR L      + +P+    GLDLS
Sbjct  126   RLRFSFHQVLQDYLPK-----SVNHVLDIGCSVGVSTRSLHHYLQQNSHPNVQTIGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA+ ++   +      RW HAN E+TG P  SFD+V++ ++ HE P +A RN+  
Sbjct  181   PYMLAVAKHQDTQAE-----IRWKHANAENTGFPDNSFDVVTLQFLIHELPRQATRNIFQ  235

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E  R+LRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  ++E  +++ GF 
Sbjct  236   EVLRILRPGGCLALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDDYYTFEVEAALKDIGFE  295

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+    P
Sbjct  296   YKTTVASDPRHRTIIGIKP  314



>ref|WP_006623621.1| MULTISPECIES: methyltransferase type 11 [Arthrospira]
 gb|EDZ94245.1| Methyltransferase type 11 [Arthrospira maxima CS-328]
 emb|CCE18714.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 gb|EKD08523.1| methyltransferase type 11 [Arthrospira platensis C1]
 emb|CDM97437.1| Methyltransferase type 11 [Arthrospira sp. PCC 8005]
Length=317

 Score =   265 bits (678),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 196/319 (61%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G   LS+FV  LI  KP+++L+K  AR+V I TAEK  IPWRE  +++  S V  
Sbjct  8     KPDWAGGDFLSQFVNLLIQTKPIFNLMKYQARRVLIKTAEKKGIPWRETYQQLEGSGVTA  67

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              +  I + ++ YPDYY  PFHAYDEGNL W AA EAE AT +M LR  P  + S   A +
Sbjct  68    LLPEITDTTVVYPDYYQVPFHAYDEGNLCWKAAFEAESATYSMALRVWPKEDLSWLTAQE  127

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYP-----SANLTGLDLS  825
              +R ++   +E +         + DILDIGCS+G+ST+ L S Y      S    GLDLS
Sbjct  128   RLRHSFHQVLENYSPN-----PVHDILDIGCSVGISTQALHSYYQHRQETSIRTVGLDLS  182

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY L+VA    K RD +   + W HAN E+TG P  SFD+V++ +V HE P  A R +  
Sbjct  183   PYMLSVA----KMRDTQGKISEWKHANAENTGFPDDSFDVVTLQFVIHELPRTATRKIFK  238

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LR  G  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  D+E  + E G  
Sbjct  239   EALRILRSHGVLAIVDNNPKSAVIQNLPPVLFTLMKSTEPWTDDYYTFDVETALSECGLN  298

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                ++ TDPRHRT+ A  P
Sbjct  299   YQTTIETDPRHRTIIAIKP  317



>ref|WP_015135034.1| type 11 methyltransferase [Leptolyngbya sp. PCC 7376]
 ref|YP_007072117.1| type 11 methyltransferase [Leptolyngbya sp. PCC 7376]
 gb|AFY39283.1| Methyltransferase type 11 [Leptolyngbya sp. PCC 7376]
Length=318

 Score =   265 bits (678),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 196/319 (61%), Gaps = 15/319 (5%)
 Frame = +1

Query  301   ERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVY  480
             E+P W+GE  LSR V  LI  KPLY+L+K  ARQV I TAEK  IPWR+  K+  +    
Sbjct  9     EKPDWAGEDWLSRLVNLLIRTKPLYNLMKYQARQVLIKTAEKNGIPWRQTVKDFDKDQAE  68

Query  481   KEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQ  660
             +  + I +  L+YP+YY  PFHAYDEGNL W AA EA PAT +M LR   +       +Q
Sbjct  69    QCFQEIVDLELDYPEYYNVPFHAYDEGNLCWKAAFEAAPATESMALRVWKNEPLTPAVAQ  128

Query  661   V-VRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLAS----RYPSANLTGLDLS  825
               +R  +L+ + ++         + D+LDIGCS+G+ST  L +    R P     GLDLS
Sbjct  129   ARLRSTFLEVMAEYLPD-----QVNDVLDIGCSVGISTMALDTFLKERSPQIQTVGLDLS  183

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA+ ++       N  +W H   E TG    SFD++++ +V HE P +A +++  
Sbjct  184   PYMLAVAKIRDSE-----NKVQWQHGKAESTGFVDNSFDVITMQFVLHELPNQATKDIFQ  238

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E  R+LRPGG F++ DN+PKS  +Q LPP LF LMKSTEP+ DEYY  D+E  ++++GF 
Sbjct  239   ECLRILRPGGCFAIVDNNPKSPVIQSLPPALFVLMKSTEPWSDEYYTFDVEDNLKQSGFD  298

Query  1186  NVQSVLTDPRHRTVTATVP  1242
              + +V +DPRHRT+ A  P
Sbjct  299   YLTTVPSDPRHRTIIARKP  317



>ref|WP_038080437.1| methyltransferase type 11 [Tolypothrix bouteillei]
 gb|KIE06875.1| methyltransferase type 11 [Tolypothrix bouteillei VB521301]
Length=316

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 193/319 (61%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+FV  LI  KP+Y L+K  AR V I TAEK  IPWR+  + +  S V +
Sbjct  6     KPDWAGENMLSKFVNLLIQTKPIYKLMKHQARLVLIKTAEKNGIPWRKNYEALKSSGVKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++  + N  + YPDYY  PFHAY EGNL W AA E E AT +M LR  P  N +   A  
Sbjct  66    QLAKVTNPDIVYPDYYKVPFHAYTEGNLCWDAAFETESATYSMALRVWPKENLTCSVAHA  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSAN-----LTGLDLS  825
              +RG++   +  +     G   +RDILDIGCS+G+ST  L   Y           GLDLS
Sbjct  126   RLRGSFHQVLATY-----GPSEVRDILDIGCSVGISTLALHRYYQQKQEHPVRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY L VA+  + N +       WIHA  EDT L   SFDLV++ +V HE P  A + +  
Sbjct  181   PYMLTVARHLDVNDEI----AEWIHAQAEDTKLLDNSFDLVTLQFVTHELPGYASKAIFA  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG  ++ DN+PKS+ +Q LPPVLFTLMKSTEP+ D+YY  D+E+ + + GF 
Sbjct  237   EALRLLRPGGAIALVDNNPKSQVIQNLPPVLFTLMKSTEPWSDDYYTFDIEKTLSDVGFA  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+ +  P
Sbjct  297   QPITVASDPRHRTIVSRKP  315



>ref|WP_016864390.1| methyltransferase type 11 [Fischerella muscicola]
Length=316

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 197/319 (62%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+FV  LI  KP+Y+L+K  ARQV I TAEK  +PWR+  + +  S V  
Sbjct  6     KPDWAGEGLLSQFVNLLIQTKPIYNLMKHQARQVIIKTAEKNGVPWRKNYETLAASGVTH  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              +E I + ++ YPDY+  PFHAY EGNL W AA EA  AT +M LR  P  N + + A  
Sbjct  66    RLEEITDSNIVYPDYFQVPFHAYSEGNLCWQAALEAPSATYSMALRVWPKENLTWEVAHD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +RG++   +  +  Q      + DILDIGCS+G+ST  L   Y        +  GLDLS
Sbjct  126   RLRGSFHQVLATYGPQ-----EVNDILDIGCSVGISTLTLHRFYQKKQNHPVHTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             P+ L VA    K+ D     + WIH  GE+T L S SFDLVS+ +V HE P  A + + +
Sbjct  181   PHMLTVA----KSLDVNNEISEWIHGKGEETRLQSNSFDLVSLQFVTHELPHYASKAIFS  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  D+E  + E GF 
Sbjct  237   EALRLLRPGGCIALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDDYYSFDIEAGLEEVGFN  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+ ++ P
Sbjct  297   KPVTVASDPRHRTIISSKP  315



>ref|WP_027846301.1| methyltransferase type 11 [Mastigocoleus testarum]
Length=319

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/322 (46%), Positives = 196/322 (61%), Gaps = 18/322 (6%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LSR V  +I  KP+Y+L+K  ARQV I TAEK  +PWRE  ++   S + +
Sbjct  6     KPDWAGEDLLSRCVNLMIQTKPIYALMKHQARQVIIKTAEKKGVPWRENYEKFQASGIKE  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSL--DEAS  657
             ++  + N  + YPDYY  PFHAY EGNL W AA EA  AT +M LR  P    L  + A 
Sbjct  66    KLGEVINPDVVYPDYYQVPFHAYPEGNLCWKAAFEAPSATYSMGLRVWPKEKDLTWEVAQ  125

Query  658   QVVRGNWLDAI--EKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYP-----SANLTGL  816
             + +R ++   +   K+H        ++DILDIGCS+G+ST  L   Y      +    GL
Sbjct  126   ERLRSSFHQVLANSKYHPP-----QVKDILDIGCSVGISTLTLHRYYQDKQTDAVRTVGL  180

Query  817   DLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRN  996
             DLSPY LAVA    K  D K   ++W+HA  E+TGLP  SFDLV++ +V HE P  A + 
Sbjct  181   DLSPYMLAVA----KEIDVKGEISQWLHARAENTGLPDDSFDLVTLQFVTHELPGTASKQ  236

Query  997   VVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREA  1176
             +  E  RLLRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  D+E  +   
Sbjct  237   IFQEVLRLLRPGGCIALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDDYYTFDIEETLHSV  296

Query  1177  GFVNVQSVLTDPRHRTVTATVP  1242
             GF    +V +DPRHRT+ A  P
Sbjct  297   GFKEPVTVASDPRHRTIIAKKP  318



>ref|WP_015785346.1| methyltransferase type 11 [Cyanothece sp. PCC 8802]
 ref|YP_003140051.1| type 11 methyltransferase [Cyanothece sp. PCC 8802]
 gb|ACV03216.1| Methyltransferase type 11 [Cyanothece sp. PCC 8802]
Length=315

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 195/316 (62%), Gaps = 15/316 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LSRFV  LI  KPLY L+K  ARQV I+TA K  IPWRE  +++ +S    
Sbjct  6     KPDWAGEDFLSRFVNRLIESKPLYRLMKNQARQVLINTATKKGIPWREDCQKLEKSPAKS  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQ-  660
              +E I N  + YPDYYL PFHAYDEGNL W AA EA+ AT +M LR   + +   E +Q 
Sbjct  66    LLEEITNPDVIYPDYYLVPFHAYDEGNLCWQAAFEADSATHSMALRVWKNEDLTPEVAQN  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRY-----PSANLTGLDLS  825
              +RG++ + +E +  +      +RD+LDIGCS+GVST  +   Y      +    GLDLS
Sbjct  126   RLRGSFHEILEDYSPK-----VVRDVLDIGCSVGVSTLSVHRYYCQRQQETVRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA+ K    D +     W+H   E T  P  SFD+++I ++ HE P +A   +  
Sbjct  181   PYMLAVAKVK----DEQQEIAAWVHGLAETTEFPDNSFDVITIQFLLHELPGKASTAIFA  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG   + DN+PKS  +Q LPP LF LMKSTEP+ D+YY  D+E  ++E GF 
Sbjct  237   EALRILRPGGVLGIVDNNPKSPVIQNLPPALFVLMKSTEPWSDDYYTFDVESALKEVGFE  296

Query  1186  NVQSVLTDPRHRTVTA  1233
                ++ +DPRHRT+ A
Sbjct  297   YKTTLPSDPRHRTIIA  312



>ref|WP_015957408.1| methyltransferase type 11 [Cyanothece sp. PCC 8801]
 ref|YP_002374447.1| type 11 methyltransferase [Cyanothece sp. PCC 8801]
 gb|ACK68291.1| Methyltransferase type 11 [Cyanothece sp. PCC 8801]
Length=315

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 195/316 (62%), Gaps = 15/316 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LSRFV  LI  KPLY L+K  ARQV I+TA K  IPWRE  +++ +S    
Sbjct  6     KPDWAGEDFLSRFVNRLIESKPLYRLMKNQARQVLINTATKKGIPWREDCQKLEKSPAKS  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQ-  660
              +E I N  + YPDYYL PFHAYDEGNL W AA EA+ AT +M LR   + +   E +Q 
Sbjct  66    LLEEITNPDVIYPDYYLVPFHAYDEGNLCWPAAFEADSATHSMALRVWKNEDLTPEVAQN  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRY-----PSANLTGLDLS  825
              +RG++ + +E +  +      +RD+LDIGCS+GVST  +   Y      +    GLDLS
Sbjct  126   RLRGSFHEILEDYSPK-----VVRDVLDIGCSVGVSTLSVHRYYCQRQQETVRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA+ K    D +     W+H   E T  P  SFD+++I ++ HE P +A   +  
Sbjct  181   PYMLAVAKVK----DEQQEIAAWVHGLAETTEFPDNSFDVITIQFLLHELPGKASTAIFA  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG   + DN+PKS  +Q LPP LF LMKSTEP+ D+YY  D+E  ++E GF 
Sbjct  237   EALRILRPGGVLGIVDNNPKSPVIQNLPPALFVLMKSTEPWSDDYYTFDVESALKEVGFE  296

Query  1186  NVQSVLTDPRHRTVTA  1233
                ++ +DPRHRT+ A
Sbjct  297   YKTTLPSDPRHRTIIA  312



>ref|WP_009459356.1| MULTISPECIES: methyltransferase type 11 [Fischerella]
 gb|EHC09335.1| Methyltransferase type 11 [Fischerella sp. JSC-11]
Length=316

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 195/319 (61%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+FV  LI  KP+Y+L+K  ARQV I TAE   +PWR+  + ++ S V +
Sbjct  6     KPDWAGEGLLSQFVNLLIQTKPIYNLMKHQARQVIIKTAENNGVPWRKNYESLVASGVKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++  I + S+ YPDYY  PFHAY +GNL W AA EA  AT +M LR  P    + + A  
Sbjct  66    QLTEIVDSSIVYPDYYQVPFHAYSQGNLCWQAALEAPSATYSMALRVWPQEKLTWETAHD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSAN-----LTGLDLS  825
              +R  +   +  +  Q      +++ILDIGCS+G+ST  L   Y           GLDLS
Sbjct  126   RLRDTFHQVLATYGPQ-----EVKNILDIGCSVGISTLALHRFYQKKQSHPVRTIGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K  D     ++W+HA GEDT L S SFDLV++ +V HE P  A + +  
Sbjct  181   PYMLAVA----KTLDVNGEISQWLHAKGEDTKLQSNSFDLVTLQFVTHELPHYASKAIFT  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  D+E  + E GF 
Sbjct  237   EALRLLRPGGCIALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDDYYSFDMEAALEEVGFS  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+ +  P
Sbjct  297   KPVTVDSDPRHRTIISRKP  315



>ref|WP_015112774.1| type 11 methyltransferase [Nostoc sp. PCC 7107]
 ref|YP_007049705.1| type 11 methyltransferase [Nostoc sp. PCC 7107]
 gb|AFY42555.1| Methyltransferase type 11 [Nostoc sp. PCC 7107]
Length=316

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 195/319 (61%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE+ LS+FV  LI  KP+Y+++K  ARQV I+TAEK  IPWR+ A+ +      +
Sbjct  6     KPDWAGESILSKFVNLLIHTKPVYNVMKYQARQVLITTAEKNGIPWRKNAEALQGLMTKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQV  663
              + ++ N  + YP+YY  PFHAY EGNL W AA EAE AT AM LR  P  N   EA+  
Sbjct  66    LLGAVTNPEVVYPEYYKVPFHAYAEGNLCWEAAFEAESATYAMSLRVWPQENLTWEAAHG  125

Query  664   -VRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSAN-----LTGLDLS  825
              +RG + D +  +     G   +++ILD+GCSIG+ST  L   Y           GLDLS
Sbjct  126   RLRGTFHDVLAAY-----GPLQVKEILDMGCSIGLSTMALHRYYQEKQEQPIRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K RD     ++W+H   E TGLP  SFDLV++ +V HE P  A + +  
Sbjct  181   PYMLAVA----KARDVNNEISQWVHGRAEKTGLPDNSFDLVTLQFVCHELPSYASKEIFA  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG  ++ DN+P+S  +Q LPP LFTLMKSTEP+ D+YY  D++  + E GF 
Sbjct  237   EAKRLLRPGGYIALVDNNPRSPVIQNLPPALFTLMKSTEPWSDDYYGFDIQAALEEVGFS  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                 V +DPRHRT+    P
Sbjct  297   PTIEVASDPRHRTIIGKKP  315



>ref|WP_006509471.1| methylase involved in ubiquinone/menaquinone biosynthesis [Xenococcus 
sp. PCC 7305]
 gb|ELS03418.1| methylase involved in ubiquinone/menaquinone biosynthesis [Xenococcus 
sp. PCC 7305]
Length=335

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 198/318 (62%), Gaps = 18/318 (6%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSRFV  LI  KP YS++K  AR+V ISTAEK  IPWR+  +E+  S+V +
Sbjct  25    KPDWAGDDLLSRFVNLLIKTKPFYSIMKGQARRVLISTAEKNGIPWRKNYQELANSEVKE  84

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSL--DEAS  657
                +I +  L YPDYY  PFHAYDEGNL W AA EAE AT++M LR   +   L    A 
Sbjct  85    LYNAIADAELVYPDYYQVPFHAYDEGNLCWQAAFEAESATLSMGLRVWKNEPGLTWQVAQ  144

Query  658   QVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSAN------LTGLD  819
               +R ++   +EK+         ++DILDIGCS+G+ST  L  RY SA         GLD
Sbjct  145   DRLRNSFYQIVEKYTNN-----PLQDILDIGCSVGISTLAL-HRYFSAQQDLPITTIGLD  198

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPY LAVA    K RD +   ++W H+  E T     SFDLV++ ++ HE P +A + +
Sbjct  199   LSPYMLAVA----KKRDEQQEISQWFHSKAEKTKFADNSFDLVTLQFLVHELPRKATQEI  254

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
               E FR+LRPGG  ++ DN+P S  +Q LPPVLFTLMKSTEP+ D+YY  ++E+ + + G
Sbjct  255   FTEMFRILRPGGVIAIVDNNPASPVIQNLPPVLFTLMKSTEPWSDDYYTFNIEQSLVDTG  314

Query  1180  FVNVQSVLTDPRHRTVTA  1233
             F    +V +DPRHR + A
Sbjct  315   FNYQTTVASDPRHRAIIA  332



>ref|WP_017297188.1| hypothetical protein [Nodosilinea nodulosa]
Length=318

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 195/318 (61%), Gaps = 17/318 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSR V   I    LY+L+K  AR+V I TAEK  + WR+   ++    + +
Sbjct  7     KPDWAGDDLLSRLVNRAIQTPVLYALMKRQARRVLIQTAEKNGVAWRQTCVDLDTPALRQ  66

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++ + N ++ YPDYY  PFHAY EGNL W AA EA PAT AM LR  P  N S  EA  
Sbjct  67    RLDELTNPAVVYPDYYQVPFHAYSEGNLCWQAAFEAAPATYAMALRVWPQENLSWQEAQA  126

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANL-------TGLD  819
              +R ++L+ ++++     G   + DILD+GCS+G+ST  +   Y   N         GLD
Sbjct  127   RLRQSFLNVLDQY-----GPAQVHDILDVGCSVGISTMAIHRHYAQKNAPTNPVRTVGLD  181

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPY LAVAQF+    D +    +W+H   E TG P  SFD+V++ +V HE P +A R +
Sbjct  182   LSPYMLAVAQFQ----DTQHEIAQWVHGAAESTGFPDASFDVVTMQFVTHELPRQAGRAI  237

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
               E+ RLLRPGG  ++ DN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  DLE  + E G
Sbjct  238   FAEALRLLRPGGALAIVDNNPQSPVIQALPPVLFTLMKSTEPWSDDYYTFDLEMALTEVG  297

Query  1180  FVNVQSVLTDPRHRTVTA  1233
             F    +V +DPRHRT+ A
Sbjct  298   FEPPVTVPSDPRHRTLVA  315



>ref|WP_008177988.1| methyltransferase type 11 [Moorea producens]
 gb|EGJ35546.1| methylase involved in ubiquinone/menaquinone biosynthesis [Moorea 
producens 3L]
Length=315

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 186/324 (57%), Gaps = 25/324 (8%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSRFV  LI  KP+Y +++  ARQV I TAEK  I WR+  +E+ +S    
Sbjct  6     KPDWAGDDLLSRFVNLLIDTKPIYKVMQHQARQVLIKTAEKNGIEWRKNYQELEKSGAKT  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQV  663
              +  I N SL YPDYY  PFHAYD+GNL W AA EA  AT AM LR  P           
Sbjct  66    LLSEITNPSLVYPDYYKVPFHAYDQGNLCWEAAFEAASATQAMGLRVWPKE---------  116

Query  664   VRGNWLDAIEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYP-----SANLT  810
              +  WL A E+    +           + D+LDIGCS+G+ST  L   Y           
Sbjct  117   -KLTWLSAQERLRSSFHQVLGEYNPEIVTDVLDIGCSVGISTLALHRYYSRIKKGKIRTV  175

Query  811   GLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAI  990
             GLDLSPY LAVA    K  D+    + WIH  GE+T LP  SFD+V++  V HE P +A 
Sbjct  176   GLDLSPYMLAVA----KTMDQTAEISEWIHGKGEETSLPDNSFDVVTLQLVLHELPHQAT  231

Query  991   RNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMR  1170
               + +E+ R+LRPGG   V DN+P S  +Q LPP LF LMKSTEP+ D+YY  D+E  M 
Sbjct  232   EEIFSEALRILRPGGCLGVVDNNPASPVIQNLPPALFVLMKSTEPWSDDYYSFDVEGAMI  291

Query  1171  EAGFVNVQSVLTDPRHRTVTATVP  1242
             + GF    +V +DPRHRT+ AT P
Sbjct  292   KVGFDYQTTVASDPRHRTIIATKP  315



>ref|WP_009784338.1| methyltransferase type 11 [Lyngbya sp. PCC 8106]
 gb|EAW37098.1| hypothetical protein L8106_19001 [Lyngbya sp. PCC 8106]
Length=309

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 190/303 (63%), Gaps = 8/303 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SRFV   ++ KPL++L K  ARQ+ I  AEK  +PWR+ A+ +L  +   E   + N  L
Sbjct  13    SRFVNGFLAVKPLFNLAKHQARQMMIERAEKLGVPWRQQAEALLSRNWDNEFNQVHNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YYL PFHAYDEGNLSW AA E E A  A+  +  P+A    E    +R ++ D ++
Sbjct  73    NYPEYYLRPFHAYDEGNLSWQAAVEVEVAAYAVHAKIWPEAGV--EGDHRLRQSYNDVLQ  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
              H         ++DI+D+GCS+G+ST  L + YP+A +TG+DLSPYFLAVAQ+  +   +
Sbjct  131   AHLPT-----DLQDIVDLGCSVGMSTLTLQNLYPTAKITGVDLSPYFLAVAQYNSQKWQK  185

Query  874   KTNPT-RWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
             +  P   W+HA  E T LP KSFDLVS+  + HE P+ A + +  E+ R+LRPGG  +V 
Sbjct  186   QGYPQPTWVHAPAEATNLPKKSFDLVSLCLICHELPQVATQQIFQEARRILRPGGYIAVM  245

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +P S+ +  +PP +FTL+KSTEP+LDEY+  +LE+ + + GF  V      PRHRT  
Sbjct  246   DMNPHSEVITRMPPFVFTLLKSTEPYLDEYFSLNLEQTLTDTGFQLVTLNYNSPRHRTAI  305

Query  1231  ATV  1239
             A V
Sbjct  306   AKV  308



>ref|WP_013192499.1| methyltransferase type 11 [Trichormus azollae]
 ref|YP_003722610.1| type 11 methyltransferase ['Nostoc azollae' 0708]
 gb|ADI65487.1| Methyltransferase type 11 ['Nostoc azollae' 0708]
Length=319

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 200/316 (63%), Gaps = 15/316 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE+ LS+FV  LI+ KP+Y+L+K  AR+V I TAEK  IPW +   ++  S V +
Sbjct  6     KPDWAGESLLSQFVNLLINTKPIYNLMKQQARRVMIKTAEKNGIPWGKSYNKLETSGVKQ  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             +++   N  + YPDYY  PFHAY EGNL W AA EA  AT A+ LR  P  N + + A +
Sbjct  66    KLKENTNPKVVYPDYYKVPFHAYAEGNLCWQAAFEAPSATYAVALRVWPKENITWETAHR  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +R ++ + + K+  Q      ++DILDIGCS+G+ST  L   Y        +  GLDLS
Sbjct  126   RLRSSFHEVLAKYVTQ-----DVQDILDIGCSVGISTLTLHRYYQQKQNHPVHTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY L+VA    K  D     ++W+H   E+T LP +SFDLV++ ++ HE P  A + +  
Sbjct  181   PYMLSVA----KELDTYNEISQWLHTQAENTELPDQSFDLVTLQFITHELPGFASKAIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG+ ++ DN+PKS  +Q LPP+LFTLMKSTEP+ D YY+ D+E  ++  GF 
Sbjct  237   EALRLLRPGGSLAIVDNNPKSSVIQNLPPILFTLMKSTEPWSDNYYMFDIEECLKSVGFQ  296

Query  1186  NVQSVLTDPRHRTVTA  1233
              + +V +D RHRT+ A
Sbjct  297   VLTTVASDTRHRTIVA  312



>ref|WP_026786296.1| methyltransferase type 11 [Planktothrix rubescens]
Length=315

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 204/319 (64%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LS+ V  LI  KPLYSL+K+ AR+V I TAEK  + WR+  +E+  S+  +
Sbjct  6     KPDWAGKDFLSQIVNVLIKTKPLYSLMKLQARKVLIKTAEKNGVQWRKTCQELDTSEAKE  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++S+ N +++YPDYY  PFHAYDEGNL WLAA EAEPAT AM LR  P    + + A  
Sbjct  66    LLKSVTNPNIKYPDYYQVPFHAYDEGNLCWLAAYEAEPATKAMGLRVWPKEQITWETAEH  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRY-PSANLTGLDLS  825
              +R ++ + + K+  +      + ++LDIGCS+G+ST    R L  +Y  +    GLDLS
Sbjct  126   RLRSSFHEILGKYSPE-----RVENVLDIGCSVGMSTLPLHRYLVQKYGDNIKTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K RD++     W     E+T  P  SFD++++ ++ HE P +  R++  
Sbjct  181   PYMLAVA----KVRDKQGEIAEWKQELAENTSFPDNSFDVITLQFLLHELPNKPSRDIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FR+LRPGG  ++ DN+PKS+ +Q LPP LF LMKSTEP+ DEYY  D+E  ++E GF 
Sbjct  237   EAFRILRPGGCLAIVDNNPKSEVIQNLPPALFILMKSTEPWSDEYYTFDVEETLKEVGFD  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                ++ +DPRHRT+ A  P
Sbjct  297   YKITLPSDPRHRTIIALKP  315



>gb|KEI68914.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Planktothrix 
agardhii NIVA-CYA 126/8]
Length=316

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 205/319 (64%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+ V  LI  KPLYSL+K+ AR+V I TAEK  + WR++ +E+  S+  +
Sbjct  7     KPDWAGEDFLSKIVNVLIKTKPLYSLMKLQARKVLIKTAEKNGVQWRKICQELDTSEAKE  66

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++S+ N +++YPDYY  PFHAYD+GNL WLAA EAEPAT AM LR  P  N + + A  
Sbjct  67    LLKSVTNPNIKYPDYYQVPFHAYDKGNLCWLAAYEAEPATKAMGLRVWPKENITWETAEH  126

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRY-PSANLTGLDLS  825
              +R ++ + + ++  +      + ++LDIGCS+G+ST    R L  +Y  +    GLDLS
Sbjct  127   RLRSSFHEILGQYCPE-----RVENVLDIGCSVGMSTLPLHRYLVQKYGDNIRTVGLDLS  181

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K RD +     W     E+T  P  SFD++++ ++ HE P +  R +  
Sbjct  182   PYMLAVA----KVRDTQGEIAEWRQELAENTSFPDNSFDVITLQFLLHELPNKPSREIFQ  237

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FR+LRPGG  ++ DN+PKS+ +Q LPP LF LMKSTEP+ DEYY  D+E+ ++E GF 
Sbjct  238   EAFRILRPGGCLAIVDNNPKSEVIQNLPPALFILMKSTEPWSDEYYTFDVEKTLKEVGFD  297

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                ++ +DPRHRT+ A  P
Sbjct  298   YKITLPSDPRHRTIIALKP  316



>ref|WP_015217053.1| Methyltransferase type 11 [Anabaena cylindrica]
 ref|YP_007159347.1| Methyltransferase type 11 [Anabaena cylindrica PCC 7122]
 gb|AFZ60437.1| Methyltransferase type 11 [Anabaena cylindrica PCC 7122]
Length=317

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 200/316 (63%), Gaps = 15/316 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LS+FV  LI+ KP+YSL+K  ARQV I TAEK  + WR+  +++  S + +
Sbjct  6     KPDWAGQGLLSQFVNLLINTKPIYSLMKQQARQVMIKTAEKNGVAWRKNYEKLEASGIKE  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++  + N ++ YP+YY  PFHAY EGNL W AA EA  AT AM LR  P    +   A+ 
Sbjct  66    KLTEVVNPNVVYPEYYKVPFHAYSEGNLCWKAAFEAPSATYAMGLRVWPKEKITWQTANH  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +R ++ + +  +  Q      ++DILDIGCS+G+ST  +   Y        N  GLDLS
Sbjct  126   RLRSSFHEVLGTYVTQ-----DVQDILDIGCSVGISTLEIHRYYQQKQNHPVNTIGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY L+VA    K  D     ++W+H   E+TGL ++SFDLV++ +V HE P  A + +  
Sbjct  181   PYMLSVA----KQLDVDNEISQWLHTQAENTGLANESFDLVTLQFVTHELPSFASQAIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG F++ DN+PKS  +Q LPPVLFTLMKSTEP+ DEYY+ D+E  ++  GF 
Sbjct  237   EALRLLRPGGCFAIVDNNPKSPVIQNLPPVLFTLMKSTEPWSDEYYMFDIEGTLQTIGFE  296

Query  1186  NVQSVLTDPRHRTVTA  1233
              + +V TDPRHR + A
Sbjct  297   VLTTVSTDPRHRAIVA  312



>ref|WP_015149087.1| methylase [Oscillatoria acuminata]
 ref|YP_007086371.1| methylase [Oscillatoria acuminata PCC 6304]
 gb|AFY82451.1| methylase involved in ubiquinone/menaquinone biosynthesis [Oscillatoria 
acuminata PCC 6304]
Length=316

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 200/320 (63%), Gaps = 16/320 (5%)
 Frame = +1

Query  292   GQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILES  471
             G+L +P W+G   LS+FV  LI  KP+Y L+K  ARQV I TAEK  I WR+   ++ +S
Sbjct  3     GKL-KPDWAGSDLLSQFVNLLIQIKPIYWLMKQQARQVIIKTAEKNGISWRKNYSDLADS  61

Query  472   DVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLD  648
             +    +  + N ++ YPDYYL PFHAY+ GNL W AA EAE AT AM LR  P    S +
Sbjct  62    EAKNLLPKLTNPTITYPDYYLVPFHAYERGNLCWEAAFEAESATYAMALRVWPKEQISWE  121

Query  649   EASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLT-----G  813
              A   +RG++   +E++     G   + DILDIGCSIG+ST  L   Y +   T     G
Sbjct  122   VAQDRLRGSFHQVLEEY-----GPKQVADILDIGCSIGLSTLTLHHYYKNKQDTSPRTIG  176

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             LDLSPY LAVA    K  D     ++W+H   E+  LPS+SFDL+++ +V HE P +A +
Sbjct  177   LDLSPYMLAVA----KTLDINQEISQWLHEKAENINLPSESFDLITLQFVTHELPHQATK  232

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE  1173
              ++ E+FRLLR GG  ++ DN+P+S  +Q LPPVLFTLMKSTEP+ DEYY  +LE  +  
Sbjct  233   AILKEAFRLLRKGGCLALVDNNPQSPVIQNLPPVLFTLMKSTEPWSDEYYTLNLETEIEA  292

Query  1174  AGFVNVQSVLTDPRHRTVTA  1233
              G  +  +V +DPRHRT+ A
Sbjct  293   VGLTHKITVPSDPRHRTIIA  312



>ref|WP_015190107.1| Methyltransferase type 11 [Gloeocapsa sp. PCC 7428]
 ref|YP_007129399.1| Methyltransferase type 11 [Gloeocapsa sp. PCC 7428]
 gb|AFZ32239.1| Methyltransferase type 11 [Gloeocapsa sp. PCC 7428]
Length=306

 Score =   259 bits (663),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 135/302 (45%), Positives = 186/302 (62%), Gaps = 11/302 (4%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SRFV  +++ KPL +L K  ARQ+ I  AEK  +PW +  +E+ + D   ++  ++N  L
Sbjct  13    SRFVNRVLAIKPLANLAKHQARQMMIKRAEKIGVPWTKQVQELKQLDWDTQLAQVENPHL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YPDYY   FHAY++GNLSW   A  E    A  + A   A +  E    +R ++ D ++
Sbjct  73    QYPDYYCCSFHAYEQGNLSW--DAALEVEVAARAVHAGIWAEAGAEGDARLRASYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 Q       RDILDIGCS+G+ST  L   YP A +TGLDLSPYFLAVA ++ + R  
Sbjct  131   NEVAQ------PRDILDIGCSVGMSTFALQEVYPHAAITGLDLSPYFLAVANYRAQQRHA  184

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+HA  E TGLPS SFDLVSI  V HE P+ A + +  E  RLLRPGG  ++ D
Sbjct  185   QIN---WVHAAAESTGLPSASFDLVSIFLVCHELPQSATQQIFQEVRRLLRPGGYLAIMD  241

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+   ++PP + TL+KSTEP+LDEY+  D+E  ++ AGF N+      PRHRT+TA
Sbjct  242   MNPQSEIYGKMPPYILTLLKSTEPYLDEYFTLDIEAALKVAGFQNIAIAPNTPRHRTITA  301

Query  1234  TV  1239
              V
Sbjct  302   QV  303



>ref|WP_036833270.1| methyltransferase type 11 [Planktothrix agardhii]
Length=316

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 203/319 (64%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LS+ V  LI  KPLYSL+K+ AR+V I TAEK  + WR+  +E+  S+  +
Sbjct  7     KPDWAGKDFLSQIVNVLIKTKPLYSLMKLQARKVLIKTAEKNGVQWRKTCQELDTSEAKE  66

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++S+ N +++YPDYY  PFHAYDEGNL WLAA EAEPAT AM LR  P    + + A  
Sbjct  67    LLKSVTNPNIKYPDYYQVPFHAYDEGNLCWLAAYEAEPATKAMGLRVWPKEQITWETAEH  126

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRY-PSANLTGLDLS  825
              +R ++ + + K+  +      + ++LDIGCS+G+ST    R L  +Y  +    GLDLS
Sbjct  127   RLRSSFHEILGKYSPE-----RVENVLDIGCSVGMSTLPLHRYLVQKYGDNIKTVGLDLS  181

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K RD++     W     E+T  P  SFD+V++ ++ HE P +  R++  
Sbjct  182   PYMLAVA----KVRDKQGEIAEWRQELAENTSFPDNSFDVVTLQFLLHELPNKPSRDIFQ  237

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG  ++ DN+PKS+ +Q LPP LF LMKSTEP+ DEYY  D+E  ++E GF 
Sbjct  238   EALRILRPGGCLAIVDNNPKSEVIQNLPPALFILMKSTEPWSDEYYTFDVEETLKEVGFD  297

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                ++ +DPRHRT+ A  P
Sbjct  298   YKITLPSDPRHRTIIALKP  316



>ref|WP_036842508.1| methyltransferase type 11 [Planktothrix agardhii]
Length=316

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 202/316 (64%), Gaps = 15/316 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LS+ V  LI  KPLYSL+K+ AR+V I TAEK  + WR+  +E+  S+  +
Sbjct  7     KPDWAGKDFLSQIVNVLIKTKPLYSLMKLQARKVLIKTAEKNGVQWRKTCQELDTSEAKE  66

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++S+ N +++YPDYY  PFHAYDEGNL WLAA EAEPAT AM LR  P    + + A  
Sbjct  67    LLKSVTNPNIKYPDYYQVPFHAYDEGNLCWLAAYEAEPATKAMGLRVWPKEQITWETAEH  126

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRY-PSANLTGLDLS  825
              +R ++ + + K+  +      + ++LDIGCS+G+ST    R L  +Y  +    GLDLS
Sbjct  127   RLRSSFHEILGKYSPE-----RVENVLDIGCSVGMSTLPLHRYLVQKYGDNIKTVGLDLS  181

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K RD++     W     E+T  P  SFD++++ ++ HE P +  R +  
Sbjct  182   PYMLAVA----KVRDKQGEIAEWRQELAENTSFPDNSFDVITLQFLLHELPNKPSREIFQ  237

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FR+LRPGG  ++ DN+PKS+ +Q LPP LF LMKSTEP+ DEYY  D+E  ++E GF 
Sbjct  238   EAFRILRPGGCLAIVDNNPKSEVIQNLPPALFILMKSTEPWSDEYYTFDVEETLKEVGFD  297

Query  1186  NVQSVLTDPRHRTVTA  1233
                ++ +DPRHRT+ A
Sbjct  298   YKITLPSDPRHRTIIA  313



>ref|WP_026793351.1| MULTISPECIES: methyltransferase type 11 [Planktothrix]
Length=315

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 203/319 (64%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LS+ V  LI  KPLYSL+K+ AR+V I TAEK  + WR+  +E+  S+  +
Sbjct  6     KPDWAGKDFLSQIVNVLIKTKPLYSLMKLQARKVLIKTAEKNGVQWRKTCQELDTSEAKE  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++S+ N +++YPDYY  PFHAYDEGNL WLAA EAEPAT AM LR  P    + + A  
Sbjct  66    LLKSVTNPNIKYPDYYQVPFHAYDEGNLCWLAAYEAEPATKAMGLRVWPKEQITWETAEH  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRY-PSANLTGLDLS  825
              +R ++ + + K+  +      + ++LDIGCS+G+ST    R L  +Y  +    GLDLS
Sbjct  126   RLRSSFHEILGKYSPE-----RVENVLDIGCSVGMSTLPLHRYLVQKYGDNIKTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K RD++     W     E+T  P  SFD+V++ ++ HE P +  R++  
Sbjct  181   PYMLAVA----KVRDKQGEIAEWRQELAENTSFPDNSFDVVTLQFLLHELPNKPSRDIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG  ++ DN+PKS+ +Q LPP LF LMKSTEP+ DEYY  D+E  ++E GF 
Sbjct  237   EALRILRPGGCLAIVDNNPKSEVIQNLPPALFILMKSTEPWSDEYYTFDVEETLKEVGFD  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                ++ +DPRHRT+ A  P
Sbjct  297   YKITLPSDPRHRTIIALKP  315



>ref|WP_027254655.1| methyltransferase type 11 [Planktothrix agardhii]
Length=315

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 202/319 (63%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+ V  LI  KPLYSL+K+ AR+V I TAEK  + WR+  +E+  S   +
Sbjct  6     KPDWAGEDFLSKIVNVLIKTKPLYSLMKLQARKVLIKTAEKNGVQWRKTCQELEASGAKE  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++S  N +++YP+YY  PFHAYDEGNL WLAA EAEPAT AM LR  P    + + A  
Sbjct  66    LLKSFTNPNIKYPNYYQVPFHAYDEGNLCWLAAFEAEPATKAMGLRVWPKEQITWETAEH  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRY-PSANLTGLDLS  825
              +R ++ + + K+  +      + ++LDIGCS+G+ST    R L  +Y  +    GLDLS
Sbjct  126   RLRSSFHEILGKYCPE-----RVENVLDIGCSVGMSTLPLHRYLVQKYGDNIRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K RD++     W     E+T  P  SFD+V++ ++ HE P +  R++  
Sbjct  181   PYMLAVA----KVRDKQGEIAEWRQELAENTSFPDNSFDVVTLQFLLHELPNKPSRDIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FR+LRPGG  ++ DN+PKS+ +Q LPP LF LMKSTEP+ DEYY  D+E  ++E GF 
Sbjct  237   EAFRILRPGGCLAIVDNNPKSEVIQNLPPALFILMKSTEPWSDEYYTFDVEETLKEVGFD  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                ++ +DPRHRT+ A  P
Sbjct  297   YKITLPSDPRHRTIIALKP  315



>ref|WP_026797961.1| methyltransferase type 11 [Planktothrix prolifica]
Length=315

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 203/319 (64%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LS+ V  LI  KPLYSL+K+ AR+V I TAEK  + WR+  +E+  S+  +
Sbjct  6     KPDWAGKDFLSQIVNVLIKTKPLYSLMKLQARKVLIKTAEKNGVQWRKTCQELDTSEAKE  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              ++S+ N +++YPDYY  PFHAYDEGNL WLAA EAEPAT AM LR  P    + + A  
Sbjct  66    LLKSVTNPNIKYPDYYQVPFHAYDEGNLCWLAAYEAEPATKAMGLRVWPKEQITWETAEH  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVST----RCLASRY-PSANLTGLDLS  825
              +R ++ + + ++  +      + ++LDIGCS+G+ST    R L  +Y  +    GLDLS
Sbjct  126   RLRSSFHEILGQYCPE-----RVENVLDIGCSVGMSTLPLHRYLVQKYGDNIRTVGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K RD++     W     E+T  P  SFD++++ ++ HE P +  R +  
Sbjct  181   PYMLAVA----KVRDKQGEIAEWKQELAENTSFPDNSFDVITLQFLLHELPNKPSREIFQ  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+FR+LRPGG  ++ DN+PKS+ +Q LPP LF LMKSTEP+ DEYY  D+E  ++E GF 
Sbjct  237   EAFRILRPGGCLAIVDNNPKSEVIQNLPPALFILMKSTEPWSDEYYTFDVEETLKEVGFD  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                ++ +DPRHRT+ A  P
Sbjct  297   YKITLPSDPRHRTIIALKP  315



>ref|WP_023068497.1| methyltransferase domain protein [Lyngbya aestuarii]
 gb|ERT05233.1| methyltransferase domain protein [Lyngbya aestuarii BL J]
Length=314

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/319 (44%), Positives = 196/319 (61%), Gaps = 16/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G   LS+ V  LI   P+YS++K  ARQV I TAEK  IPWR+  +++  S+V K
Sbjct  6     KPDWAGGDVLSQLVNVLIKTPPIYSVMKHQARQVLIKTAEKNGIPWRKHYQQLEASEVKK  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
                 I ++++ YPDYY  PFHAYD GNL W AA EAE AT +M LR   +   S + A +
Sbjct  66    IFSEINDKNIIYPDYYHKPFHAYDAGNLCWKAAFEAESATYSMGLRVWKNEKISWETAHE  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLA-----SRYPSANLTGLDLS  825
              +R ++   +  +  +     ++  +LDIGCS+GVSTR L      +  P+    GLDLS
Sbjct  126   RLRYSFHQVLNNYLPK-----SVNHVLDIGCSVGVSTRSLHHYLKHNHNPNVQTMGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA+ ++   D       W HAN E T  P   FD+V++ ++ HE P +A RN+  
Sbjct  181   PYMLAVAKHQDTQAD-----ITWKHANAEKTDFPDDFFDVVTLQFLIHELPRQATRNIFQ  235

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG  ++ DN+PKS  +Q LPPVLFTLMKSTEP+ D+YY  ++E  ++E GF 
Sbjct  236   EALRILRPGGCLALVDNNPKSPVIQNLPPVLFTLMKSTEPWSDDYYTFEVEAALKEIGFE  295

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +DPRHRT+    P
Sbjct  296   YKTTVASDPRHRTIIGIKP  314



>ref|WP_023068644.1| ubiE/COQ5 methyltransferase family protein [Lyngbya aestuarii]
 gb|ERT05088.1| ubiE/COQ5 methyltransferase family protein [Lyngbya aestuarii 
BL J]
Length=309

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 189/304 (62%), Gaps = 10/304 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V   ++ KPL+++ K  ARQ+ I  AEK  +PWRE AK +L  +   E   + N  L
Sbjct  13    SRLVNGFLAVKPLFNIAKHQARQMMIDRAEKLGVPWREQAKTLLSRNWDAEFTQVHNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YYL PFHAYDEGNLSW AA E E A  A+  +  P+A +  E   ++R ++ D + 
Sbjct  73    NYPEYYLRPFHAYDEGNLSWQAAVEVEVAAYAVHAKIWPEAGA--EGDHLLRQSYNDVLR  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                   S    ++DI+D GCS+G+ST  L   YP+A +TG+DLSPYFLAVAQ+  +   +
Sbjct  131   A-----SLPTDLQDIVDFGCSVGMSTLALQHLYPTAKMTGVDLSPYFLAVAQYNSQKWQQ  185

Query  874   K--TNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
             +  + PT W+HA  E T LP  SFDLVS+  + HE P+ A + +  E+ R+LRPGG  +V
Sbjct  186   QGFSQPT-WVHAPAEATNLPENSFDLVSLCLICHELPQIATQQIFQEARRILRPGGYIAV  244

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +P S+ +  +PP + TL+KSTEP+LDEY+  +LE+ + EAGF  +      PRHRT 
Sbjct  245   MDMNPHSEVITRMPPFVLTLLKSTEPYLDEYFSLNLEQTLTEAGFQLLTLTCNTPRHRTA  304

Query  1228  TATV  1239
              A V
Sbjct  305   IAKV  308



>ref|WP_016858521.1| methyltransferase type 11 [Fischerella muscicola]
Length=307

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 185/300 (62%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPLY+L K  ARQ+ I  AEK  +PWR+  + +   +   E+  +QN  L
Sbjct  13    SRLVNGVLAIKPLYNLAKHQARQMMIKRAEKIGVPWRKQVQALRSHNWENELAKVQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP+YY++ FHAYD+GNLSW   A  E    A  + A   A +  +    +R ++ D ++
Sbjct  73    KYPEYYVTSFHAYDKGNLSW--DAALEVEVAAYAVHATIWAGAGTKGDSQLRQSYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           +DILD+GCS+G+ST  L   YP A +TG+DLSPYFLAVA ++ + + R
Sbjct  131   QQ-----ILIPPQDILDLGCSVGMSTFALQEMYPQAQITGVDLSPYFLAVANYRSQQQQR  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+HA  E TGLP  SFDLVSI  + HE P+   R +  E+ RLLRPGG  ++ D
Sbjct  186   QIN---WVHAAAESTGLPDASFDLVSIFLMCHELPQSPTRQIFAEARRLLRPGGHLTIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PK++  Q++PP + TL+KSTEP+LDEY+  D+E+ + EAGF         PRHRT+ A
Sbjct  243   MNPKAEAYQKMPPYILTLLKSTEPYLDEYFCLDIEQALVEAGFQTPTITRNSPRHRTIIA  302



>ref|WP_013325384.1| methyltransferase type 11 [Cyanothece sp. PCC 7822]
 ref|YP_003890621.1| type 11 methyltransferase [Cyanothece sp. PCC 7822]
 gb|ADN17346.1| Methyltransferase type 11 [Cyanothece sp. PCC 7822]
Length=309

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 189/304 (62%), Gaps = 9/304 (3%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             +S  +  +++ KPL S+ K  AR++ I  AEK  +PWRE  +++   D  KE+  ++N  
Sbjct  13    ISHLINGVLAIKPLASIAKHQAREMMIKRAEKLGVPWRENVRQLSSHDWGKELIQVENPQ  72

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLD-EASQVVRGNWLDA  687
             L YPDYY+  FHAY++GNLSW AA E E A  A+        + +  +    +R N+   
Sbjct  73    LNYPDYYVCSFHAYEKGNLSWEAALEVESAAYAVHSTIWKKTDGISIKGDAKLRENYHQV  132

Query  688   IEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNR  867
             +++ H       A +DILD+GCSIG+ST  L   YP A +TGLDLSPYFLAVA ++ +  
Sbjct  133   LKEKH-----ALAPQDILDVGCSIGMSTFALQQTYPQARVTGLDLSPYFLAVANYRARKE  187

Query  868   DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
             + K N   W+HA GE +GL  KSFDLVS   ++HE P++A + +  E+ RLLRPGG F++
Sbjct  188   NLKIN---WVHAAGEASGLAEKSFDLVSAFLIYHELPQKAGKGIFREARRLLRPGGYFAM  244

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +P+S   +++PP +FTL+KSTEP+LDEY+  D+E  + EAGF         PRHR +
Sbjct  245   MDMNPQSDDFKQMPPYVFTLLKSTEPYLDEYFSLDVEAALVEAGFAPPTITPISPRHRAI  304

Query  1228  TATV  1239
              A V
Sbjct  305   VAQV  308



>ref|WP_027248784.1| methyltransferase type 11 [Planktothrix agardhii]
Length=308

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/303 (42%), Positives = 192/303 (63%), Gaps = 7/303 (2%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             +SR +  +++ KPL +  K  ARQ+ I  AE   +PWR+  + +L  +   E+  +QN +
Sbjct  12    MSRVINGILAIKPLSNFAKHQARQMMIKRAEAMGVPWRQQTQTLLSRNWDAELTQVQNPN  71

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAI  690
             L+YPDYY++ FHAY++GNLSW AA E E A  ++  +  P+A +  +A   +R ++ D +
Sbjct  72    LQYPDYYVTSFHAYEKGNLSWQAAVEVEVAAYSVHAKIWPEAGAKGDAK--LRQSYHDLL  129

Query  691   EKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRD  870
             +            +DILD+GCS+G+ST  L   YP A +TG+DLSPYFLA+A +  + + 
Sbjct  130   KAQLP-----IPPQDILDLGCSVGMSTFALQEIYPDAKMTGVDLSPYFLAIATYNTQKQS  184

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
                   +W+HA  E TGLPS SFDLVS+  + HE P+ A R ++ E+ RLLRP G  ++ 
Sbjct  185   NLKYTPKWVHATAESTGLPSGSFDLVSLCLICHELPQSATREILQEARRLLRPEGHLAIM  244

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +PKS+  +++PP +FTL+KSTEP+LDEY+  D+E+ + +AGF         PRHRT+ 
Sbjct  245   DMNPKSELFKKMPPYIFTLLKSTEPYLDEYFTLDIEQAIIDAGFQRPTVNFNSPRHRTII  304

Query  1231  ATV  1239
             A+V
Sbjct  305   ASV  307



>gb|KEI66782.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Planktothrix 
agardhii NIVA-CYA 126/8]
Length=331

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 192/303 (63%), Gaps = 7/303 (2%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             +SRF+  +++ KPL +  K  ARQ+ I  AE   +PWR+  + +L  +   E+  +QN +
Sbjct  35    MSRFINGILAIKPLSNFAKHQARQMMIKRAEAMGVPWRQQTQTLLSRNWDAELTQVQNPN  94

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAI  690
             L+YPDYY++ FHAY++GNLSW AA E E A  ++  +  P+A +  +A   +R ++ D +
Sbjct  95    LQYPDYYVTSFHAYEKGNLSWQAAVEVEVAAYSVHAKIWPEAGAKGDAK--LRQSYHDIL  152

Query  691   EKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRD  870
             +            +DILD+GCS+G+ST  L   YP A +TG+DLSPYFLA+A +  + + 
Sbjct  153   KAQLP-----IPPQDILDLGCSVGMSTFALQEIYPDAKMTGVDLSPYFLAIATYNTQKQS  207

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
                   +W+HA  E TGLPS SFDL+S+  + HE P+   R ++ E+ RLLRP G  ++ 
Sbjct  208   NLKYTPKWVHAKAESTGLPSGSFDLISLCLICHELPQSPTREILQEARRLLRPEGHLAIM  267

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +PKS+  +++PP +FTL+KSTEP+LDEY+  D+E+ + +AGF         PRHRT+ 
Sbjct  268   DMNPKSEMFKKMPPYIFTLLKSTEPYLDEYFTLDIEQAIIDAGFQRPTVNFNSPRHRTII  327

Query  1231  ATV  1239
             A+V
Sbjct  328   ASV  330



>ref|WP_009459965.1| MULTISPECIES: methyltransferase type 11 [Fischerella]
 gb|EHC08694.1| Methyltransferase type 11 [Fischerella sp. JSC-11]
Length=306

 Score =   254 bits (650),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 186/302 (62%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             +R V  +++ KP+Y+L K  ARQ+ I  AEK  +PWR+  + +   +   E+  +QN  L
Sbjct  13    TRLVNGVLAIKPVYNLAKHQARQMMIKRAEKIGVPWRKQVQTLRSHNWESELAKVQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YPDYYL+ FHAYD+GNLSW   A  E    A  + A   A +  +    +R ++ D ++
Sbjct  73    KYPDYYLTSFHAYDKGNLSW--DAALEVEVAAYAVHATIWAGAGAKGDAQLRQSYHDLLK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           +DILD+GCS+G+ST  L   YP A +TG+DLSPYFLAVA ++ + + R
Sbjct  131   QQ-----ITTPPQDILDLGCSVGMSTFALQELYPQAQITGVDLSPYFLAVANYRSQQQQR  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   WIHA  E T LP+ SFDLVSI  V HE P+ A R +  E+ RLLRPGG  ++ D
Sbjct  186   HIN---WIHAAAESTNLPNASFDLVSIFLVCHELPQSATRQIFAEARRLLRPGGYLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  +++PP + TL+KSTEP+LDEY+  D+E+ + EAGF         PRHRT+ A
Sbjct  243   MNPQAEAYKKMPPYILTLLKSTEPYLDEYFTLDIEQAIVEAGFQTPTITRNSPRHRTIIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_016868626.1| methyltransferase type 11 [Fischerella muscicola]
Length=307

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 183/300 (61%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPLY+L K  ARQ+ I  AEK  +PWR+  + +   +   E+  IQN  L
Sbjct  13    SRLVNGVLAIKPLYNLAKHQARQMMIKRAEKIGVPWRKQVQALRSHNWENELAKIQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YPDYY + FHAYD+GNLSW   A  E    A  + A   A +  +    +R ++ D ++
Sbjct  73    KYPDYYFTSFHAYDKGNLSW--DAALEVEVAAYAVHATIWAGAGAKGDAKLRQSYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           RDILD+GCS+G+ST  L   YP A +TG+DLSPYFLAVA ++ + + R
Sbjct  131   QQITT-----PPRDILDLGCSVGMSTFALQELYPQAQVTGVDLSPYFLAVANYRSQQQQR  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TGLP  +FDLVSI  V HE P+   R +  E+ RLLRPGG  ++ D
Sbjct  186   HVN---WVHAAAESTGLPDAAFDLVSIFLVCHELPQSPTRQIFAEARRLLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  +++PP + TL+KSTEP+LDEY+  D+E+ + EAGF         PRHRT+ A
Sbjct  243   MNPQAEAYKKMPPYILTLLKSTEPYLDEYFSLDIEQAIVEAGFQTPTITCNSPRHRTIIA  302



>ref|WP_026785596.1| methyltransferase type 11 [Planktothrix rubescens]
Length=308

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 192/303 (63%), Gaps = 7/303 (2%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             +SR +  +++ KPL +  K  ARQ+ I  AE   +PWR+  + +L  +   E+  +QN +
Sbjct  12    MSRVINGILAIKPLSNFAKHQARQMMIKRAEAMGVPWRQQTQTLLSRNWDAELTQVQNPN  71

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAI  690
             L+YPDYY++ FHAY++GNLSW AA E E A  ++  +  P+A +  +A   +R ++ D +
Sbjct  72    LQYPDYYVTSFHAYEKGNLSWQAAVEVEVAAYSVHAKIWPEAGAKGDAK--LRQSYHDLL  129

Query  691   EKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRD  870
             +            +DI+D+GCS+G+ST  L   YP A +TG+DLSPYFLA+A +  + + 
Sbjct  130   KAQLPT-----PPQDIVDLGCSVGMSTFALQEIYPEAKMTGVDLSPYFLAIATYNTQKQS  184

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
                   +W+HA  E TGLPS SFDLVS+  + HE P+ A R ++ E+ RLLRP G  ++ 
Sbjct  185   NLKYTPKWVHATAESTGLPSGSFDLVSLCLICHELPQSATREILQEARRLLRPEGHLAIM  244

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +PKS+  +++PP +FTL+KSTEP+LDEY+  D+E+ + +AGF         PRHRT+ 
Sbjct  245   DMNPKSELFKKMPPYIFTLLKSTEPYLDEYFTLDIEQAIIDAGFQRPTVNFNSPRHRTII  304

Query  1231  ATV  1239
             A+V
Sbjct  305   ASV  307



>ref|WP_006529401.1| methylase involved in ubiquinone/menaquinone biosynthesis [Gloeocapsa 
sp. PCC 73106]
 gb|ELR97726.1| methylase involved in ubiquinone/menaquinone biosynthesis [Gloeocapsa 
sp. PCC 73106]
Length=311

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 188/314 (60%), Gaps = 12/314 (4%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSR V  LIS KPLY+++K  ARQV I TAEK  IPWRE  + +    V  
Sbjct  6     KPDWAGQDWLSRLVNLLISTKPLYAVMKYQARQVIIKTAEKKGIPWRESCQALQAEGVET  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++ S+ N  + YPDYY  PFHAY +GNL W AA EA  AT AM LR   D + + +EA +
Sbjct  66    KLSSLTNPDVVYPDYYQVPFHAYSQGNLCWQAALEAPAATYAMALRVWKDEDLTWEEAQK  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANL--TGLDLSPYF  834
              +R N+   + ++  +      + D+LD+GCS+G+ST  L   Y    +   GLDLSPY 
Sbjct  126   KLRANFYQVLGQYSPE-----VVTDVLDLGCSVGISTLSLHRYYQQQQVRTVGLDLSPYM  180

Query  835   LAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESF  1014
             LAVAQ      D++   ++W H+  E T     SFD++++ +V HE P  A   +  E+ 
Sbjct  181   LAVAQ----TLDKEGQISKWCHSQAEKTDFADNSFDVITLQFVLHELPNTATEAIFREAL  236

Query  1015  RLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQ  1194
             R+L+PGG   + DN+P+S  +Q LPP LF LMKSTEP+ DEYY  D+   + + GF +  
Sbjct  237   RILKPGGCLGIIDNNPRSPVIQNLPPALFLLMKSTEPWSDEYYTFDVVGTLEKVGFKHQS  296

Query  1195  SVLTDPRHRTVTAT  1236
             +   DPRHR + AT
Sbjct  297   TQSVDPRHRAIIAT  310



>ref|WP_015206026.1| methylase involved in ubiquinone/menaquinone biosynthesis [Cylindrospermum 
stagnale]
 ref|YP_007145449.1| methylase involved in ubiquinone/menaquinone biosynthesis [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ22769.1| methylase involved in ubiquinone/menaquinone biosynthesis [Cylindrospermum 
stagnale PCC 7417]
Length=306

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 189/306 (62%), Gaps = 16/306 (5%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             +SR V  +++ KPL SL K  ARQ+ I  AE+  +PW +  +++   D   ++  +QN  
Sbjct  12    VSRLVNGILAIKPLASLAKHQARQMMIKRAERIGVPWIQEVEKLQARDWKPDLAKVQNPQ  71

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAI  690
             + YP+YYL  FHAYD+GNL W AA E E A   +     PDA +  +  + +R ++ D +
Sbjct  72    ITYPEYYLRTFHAYDDGNLGWKAALELEVAACTVHAGIWPDAGA--QGDRQLRQSYHDIL  129

Query  691   EK---HHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEK  861
             ++   H  Q+        ILD+ C +G+ST  L + YP AN+TGLDLSPYFLAVA ++ +
Sbjct  130   KEQIPHQPQH--------ILDLACGVGLSTFALQAVYPDANITGLDLSPYFLAVADYRSQ  181

Query  862   NRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTF  1041
              R  K N   W+HA  E TGLP  SF+LVSI  + HE P+ A R +  E+ RLLRPGG  
Sbjct  182   QRQAKIN---WVHAAAESTGLPDASFNLVSIFLMCHELPQSATRQIFAEARRLLRPGGYL  238

Query  1042  SVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHR  1221
             ++ D +PKS+  +++PP + TL+KSTEP+LDEY+  D+E+V+ EAGF         PRHR
Sbjct  239   AIMDMNPKSEIYKKMPPYILTLLKSTEPYLDEYFTLDIEQVLVEAGFQTPNITRNSPRHR  298

Query  1222  TVTATV  1239
             TV A V
Sbjct  299   TVIAQV  304



>ref|WP_007354559.1| MULTISPECIES: methyltransferase type 11 [Kamptonema]
 emb|CBN55336.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=306

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 190/300 (63%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  ++S KPL +L K  AR++ I  AEK  + WRE A+ +L  +   EM+S+QN +L
Sbjct  13    SRLVNGVLSIKPLANLAKHQAREMMIKRAEKIGVHWREEAQALLARNWDAEMQSVQNPNL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP YYL+ FHAY++GN+SW AA E   A  A+     P+A +  +A   +R ++ D ++
Sbjct  73    SYPKYYLTSFHAYEQGNMSWEAATEVGVAARAVHAGIWPEAGAEGDAK--LRQSYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +            DILD+GCS+G+S+  + + YP A +TG+DLSPYFLAVAQ++ + ++R
Sbjct  131   EQIVSEP-----LDILDLGCSVGMSSFAMQNTYPQAKITGVDLSPYFLAVAQYQSQQQNR  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+HA GE TGLPS SFDLVSI  V HE P+ A   +  E+ RLLRP G  ++ D
Sbjct  186   RIN---WVHAAGESTGLPSASFDLVSIFLVCHELPQAATMQIFREAKRLLRPNGYLAMMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+   ++PP + TL+KSTEP+LD+Y+  D+   + EAGF         PRHRTV A
Sbjct  243   MNPQSEIYAKMPPYILTLLKSTEPYLDQYFSLDISAALVEAGFATPTITCNSPRHRTVIA  302



>ref|WP_013334559.1| methyltransferase type 11 [Cyanothece sp. PCC 7822]
 ref|YP_003899875.1| methyltransferase type 11 [Cyanothece sp. PCC 7822]
 gb|ADN17809.1| Methyltransferase type 11 [Cyanothece sp. PCC 7822]
Length=318

 Score =   252 bits (644),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 191/328 (58%), Gaps = 32/328 (10%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  +SRFV  +I  KP+Y L+K  ARQV I+TA+K  I W+E+ + + +S    
Sbjct  7     KPDWAGEDFISRFVNLMIQTKPVYRLMKHQARQVIINTAKKNGIDWQEICQNLEKSVTKG  66

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQV  663
              +  + N ++ YPDYYL PFHAYDEGNL W              L AIP   SL    +V
Sbjct  67    LLAEMTNPNITYPDYYLVPFHAYDEGNLCW-----------QAALEAIPATQSL--GIRV  113

Query  664   VRG---NWLDA---IEKHHKQYSGCFA---IRDILDIGCSIGVSTRCLASRY-----PSA  801
              +G   +W  A   +     Q  G ++   +RDILD+GCS+G+ST+ L   Y     P  
Sbjct  114   WKGEKLSWEVAQARLRSSFHQVLGRYSSPIVRDILDLGCSVGISTKELHRYYLKRQDPHP  173

Query  802   NLT-GLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECP  978
               T GLDLSPY LAVAQ      D K    +W+H   E T  P  SFD++++ +V HE P
Sbjct  174   LQTRGLDLSPYMLAVAQVT----DEKEEIAQWVHGLAEKTDFPDNSFDVITLQFVLHELP  229

Query  979   ERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLE  1158
               A   +  E  RLLRPGG F + DN+P+SK +Q LPP LF LMKSTEP+ D+YY  ++E
Sbjct  230   RHASLAIFTEVKRLLRPGGVFGMIDNNPRSKVIQNLPPALFMLMKSTEPWSDDYYTFNVE  289

Query  1159  RVMREAGFVNVQSVLTDPRHRTVTATVP  1242
             + + E GF    +V +DPRHRT+ AT P
Sbjct  290   QSLIELGFDYQTTVESDPRHRTIVATKP  317



>ref|WP_015138585.1| methylase [Nostoc sp. PCC 7524]
 ref|YP_007075737.1| methylase [Nostoc sp. PCC 7524]
 gb|AFY48140.1| methylase involved in ubiquinone/menaquinone biosynthesis [Nostoc 
sp. PCC 7524]
Length=306

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/302 (45%), Positives = 186/302 (62%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L K  ARQ+ I  AEK  +PW +  K +   D   ++  IQN  L
Sbjct  13    SRLVNGILAIKPLANLAKHQARQMMIKRAEKIGVPWTQEVKTLQARDWKPDLAQIQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YYL+ FHAY+EGNLSW AA E EPA  A+  +   DA +  +    +R ++ D ++
Sbjct  73    SYPNYYLTSFHAYEEGNLSWQAAFEVEPAAYAVHAKIWQDAEA--QGDPKLRQSYHDIVK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                       A +DILD+GCS+G+ST  L + YP A +TGLDLSPYFLAVA ++ + R  
Sbjct  131   AQIPH-----APQDILDLGCSVGLSTFALQALYPQAKVTGLDLSPYFLAVANYRAQQRQA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   WIHA  E TGLP  S DLVSI  V HE P+ A R +  E  R+LRPGG  ++ D
Sbjct  186   NIN---WIHAAAESTGLPDASVDLVSIFLVCHELPQSATRQIFAEVRRVLRPGGYIAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+  +++PP + TL+KSTEP+LD+Y+  D+++ + EAGF         PRHRTV A
Sbjct  243   MNPQSEAYKKMPPYILTLLKSTEPYLDQYFALDIQQALVEAGFQTPTITPNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_026796279.1| methyltransferase type 11 [Planktothrix prolifica]
Length=308

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/303 (41%), Positives = 191/303 (63%), Gaps = 7/303 (2%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             +SR +  +++ KPL +  K  ARQ+ I  AE   +PWR+  + +L  +   E+  +QN +
Sbjct  12    MSRVINGILAIKPLSNFAKHQARQMMIKRAEAMGVPWRQQTQTLLSRNWDAELTQVQNPN  71

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAI  690
             L+YPDYY++ FHAY++GNLSW AA E E A  ++  +  P+A +  +A   +R ++ D +
Sbjct  72    LQYPDYYVTSFHAYEKGNLSWQAAVEVEVAAYSVHAKIWPEAGAKGDAK--LRQSYHDLL  129

Query  691   EKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRD  870
             +            +DI+D+GCS+G+ST  L   YP A +TG+DLSPYFLA+A +  + + 
Sbjct  130   KAQLPT-----PPQDIVDLGCSVGMSTFALQEIYPEAKMTGVDLSPYFLAIATYNTQKQS  184

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
                   +W+HA  E TGLPS SFDL+S+  + HE P+   R ++ E+ RLLRP G  ++ 
Sbjct  185   NLKYTPKWVHAKAESTGLPSGSFDLISLCLICHELPQSPTREILQEARRLLRPEGHLAIM  244

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +PKS+  +++PP +FTL+KSTEP+LDEY+  D+E+ + +AGF         PRHRT+ 
Sbjct  245   DMNPKSEMFKKMPPYIFTLLKSTEPYLDEYFTLDIEQAIIDAGFQRPTVNFNSPRHRTII  304

Query  1231  ATV  1239
             A+V
Sbjct  305   ASV  307



>ref|WP_026723064.1| methyltransferase type 11 [Fischerella sp. PCC 9431]
Length=307

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 185/300 (62%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KP+Y+L K  ARQ+ I  AEK  +PWR+  + +   +   E+  +QN  L
Sbjct  13    SRLVNEVLAIKPVYNLAKHQARQMMIKRAEKMGVPWRKQVQALRSHNWESELAKVQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP+YY++ FHAYD+GNLSW   A  E    A  + A   A +  +    +R ++ D ++
Sbjct  73    KYPEYYVTSFHAYDKGNLSW--DAALEVEVAAYAVHATIWAGAGVQGDSQLRQSYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           +DILD+GCS+G+ST  L   YP A +TG+DLSPYFLAVA ++ + + R
Sbjct  131   QQ-----ILTPPQDILDLGCSVGMSTFALQDMYPQAQITGVDLSPYFLAVANYRSQQQQR  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+HA  E TGLP  SFDLVSI  + HE P+   R +  E+ RLLRPGG  ++ D
Sbjct  186   QIN---WVHAAAESTGLPDTSFDLVSIFLMCHELPQLPTRQIFAEARRLLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  Q++PP + TL+KSTEP+LDEY+  D+E+ + EAGF         PRHRT+ A
Sbjct  243   MNPQAEAYQKMPPYILTLLKSTEPYLDEYFTLDIEQALVEAGFQTPTITRNSPRHRTIIA  302



>ref|WP_017651933.1| methyltransferase type 11 [Microchaete sp. PCC 7126]
Length=311

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/304 (44%), Positives = 190/304 (63%), Gaps = 9/304 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +  K  ARQ+ I  A+K  + W +  +++   D   ++ +++N  L
Sbjct  13    SRLVNGVLAIKPLANFAKHQARQMMIKRAQKMGVFWTQEVEKLQARDWTTDLATVENPHL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YPDYYL+ FHAY+ GNLSW AA E EPA   +  +  P A    +A   +R ++ D ++
Sbjct  73    KYPDYYLTSFHAYETGNLSWQAAFEVEPAAYTVHAKIWPGAEIQGDAK--LRQSYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
              H  Q       +DILD+GCS+G+ST  L   YP A LTGLDLSPYFLAVAQ++ +    
Sbjct  131   NHILQ-----PPQDILDVGCSVGMSTLALQEIYPQARLTGLDLSPYFLAVAQYRAQLHQA  185

Query  874   KTNPTR--WIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
             + N  +  W+HA  E TGLP+ SFDLVSI  V HE P+ A R +  E+ RLLRPGG  ++
Sbjct  186   QANQGQINWVHAAAESTGLPNASFDLVSIFLVCHELPQSATRQIFAEARRLLRPGGYLAM  245

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +P+S+  Q++PP + TL+KSTEP+LD+Y+  D+E+ M +AGF         PRHRT+
Sbjct  246   MDMNPQSEIYQQMPPYILTLLKSTEPYLDQYFTLDIEQTMVDAGFQTPSITRNSPRHRTI  305

Query  1228  TATV  1239
              A V
Sbjct  306   IAQV  309



>ref|XP_002525119.1| Adaptin ear-binding coat-associated protein, putative [Ricinus 
communis]
 gb|EEF37246.1| Adaptin ear-binding coat-associated protein, putative [Ricinus 
communis]
Length=546

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  529   YLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIEKHHKQ  708
             YL+PFHAYDEGNLSW+AAAEAEPATM+M  RAIP+A+SL+E ++V+RGNWL  IE+HH+Q
Sbjct  77    YLNPFHAYDEGNLSWMAAAEAEPATMSMVRRAIPNASSLEEGNRVLRGNWLKTIEQHHQQ  136

Query  709   YSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDRKTNPT  888
             YSG   I DILD+GCS+GVSTR LA ++P A +TGLDLSP+FL+VAQFKEK    + NP 
Sbjct  137   YSGKSIISDILDVGCSVGVSTRFLADKFPLAKVTGLDLSPHFLSVAQFKEKKGAPRKNPI  196

Query  889   RWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTDNSPKS  1068
              WIHANGEDTGLPSKS+DLV+I++V HECPERAI  ++ E++RLLRPGGT ++TD+SPKS
Sbjct  197   NWIHANGEDTGLPSKSYDLVTIAFVVHECPERAINGLLREAYRLLRPGGTIALTDSSPKS  256

Query  1069  KKLQ  1080
             K LQ
Sbjct  257   KILQ  260



>ref|WP_006198202.1| methyltransferase type 11 [Nodularia spumigena]
 gb|EAW43648.1| hypothetical protein N9414_10723 [Nodularia spumigena CCY9414]
 gb|AHJ27241.1| SAM (and some other nucleotide) binding motif:Generic methyl-transferase 
[Nodularia spumigena CCY9414]
Length=305

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 186/302 (62%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L K  ARQ+ I  AE+  +PW +  K +   D  +E+  +QN  L
Sbjct  12    SRLVNGILAIKPLANLAKHQARQMMIKRAERIGVPWTQEVKTLQARDWTQELAQVQNPQL  71

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL+ FHAY+ GNLSW AA E +PA  A+  +   DA +  +A   +R ++ D + 
Sbjct  72    SYPDYYLNSFHAYETGNLSWQAAFEVKPAAHAVHAKIWQDAEAQGDAK--LRQSYHDILT  129

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                   S     +DILD+GCS+G+ST  L   YP + +TGLDLSPYFLAVA ++ + R  
Sbjct  130   A-----SLPHTPQDILDVGCSVGLSTFALQEIYPQSQITGLDLSPYFLAVAHYRAEQRQG  184

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+HA  E T LP  SFDLVSI  + HE P+ A R +  E  R+LRPGG  ++ D
Sbjct  185   QIN---WLHAAAESTELPDASFDLVSIFLMCHELPQSATRQIFAEMRRVLRPGGHLAIMD  241

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+  Q++PP + TL+KSTEP+LDEY+  D+E+ + EAGF         PRHRT+ A
Sbjct  242   MNPRSEIYQKMPPYILTLLKSTEPYLDEYFALDIEQALVEAGFQAPTITSNSPRHRTIIA  301

Query  1234  TV  1239
              V
Sbjct  302   QV  303



>ref|WP_012164401.1| methyltransferase type 11 [Acaryochloris marina]
 ref|YP_001518368.1| SAM-dependent methyltransferase [Acaryochloris marina MBIC11017]
 gb|ABW29051.1| SAM-dependent methyltransferase, putative [Acaryochloris marina 
MBIC11017]
Length=325

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 191/319 (60%), Gaps = 16/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+ V  LI  KP+Y+++K  ARQV I TAEK  +PWR+  + +  S+   
Sbjct  6     KPDWAGEDWLSKLVNLLIQTKPIYAVMKRQARQVLIKTAEKNGVPWRQNYQTLATSNTQD  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
               +   N +L YPDYY  PFHAY+ GNL W AA EAE AT AM LR  P  + + + A  
Sbjct  66    FFDRTNNPNLVYPDYYQVPFHAYEHGNLCWPAAFEAESATYAMALRVWPQEDLTWEMAQD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +R ++   +  +     G   +  ILD+GCS+G+S+  L   Y S      + TGLDLS
Sbjct  126   RLRASFHQVLADY-----GPAQVTHILDMGCSVGISSFALHRYYQSTQAHPVHTTGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LA+A  ++ N++       W H   E+TGLP  + DLV++ +V HE P    + +  
Sbjct  181   PYMLAIAHKRDVNQE-----ITWHHGKAEETGLPDSALDLVTLQFVIHELPREITQQIFA  235

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG  ++ DN+PKS  +Q LPP LFTLMKSTEP+ D+YY  D+E  +  AGF 
Sbjct  236   EALRILRPGGCIALVDNNPKSPVIQNLPPALFTLMKSTEPWSDDYYTFDVESALTAAGFE  295

Query  1186  NVQSVLTDPRHRTVTATVP  1242
             +  +  +DPRHRT+  T P
Sbjct  296   HTVTTASDPRHRTIIGTKP  314



>ref|WP_035992450.1| methyltransferase type 11 [Leptolyngbya sp. KIOST-1]
Length=319

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 198/318 (62%), Gaps = 17/318 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSR V   I    LY+L+K  ARQV I TAEK  +PWR+   E+    + +
Sbjct  7     KPDWAGDDLLSRLVNRAIQTPLLYALMKRQARQVMIKTAEKNGVPWRQTCAELDTPAMRQ  66

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              +E++ N ++ YPDYY  PFHAY EGNL W AA EA PAT AM LR  P  N S   A +
Sbjct  67    RLEALTNPAVVYPDYYQVPFHAYSEGNLCWQAAFEAAPATYAMALRVWPQDNLSWQAAQE  126

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRY-----PSANL--TGLD  819
              +R ++L  + +H         +RDILD+GCS+G+ST  +   Y     P+  L   GLD
Sbjct  127   RLRQSFLTVLNQHRPP-----QVRDILDLGCSVGLSTLSVHRHYAPKSDPNHPLRTVGLD  181

Query  820   LSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNV  999
             LSPY LAVAQ     +D +   ++W+HA  E TG  + SFD+V++ +V HE P  A + +
Sbjct  182   LSPYMLAVAQ----TQDTQGEISQWVHAAAEATGFAAASFDVVTMQFVAHELPRTATQAI  237

Query  1000  VNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAG  1179
               E+ R+LRPGG  ++ DN+P+S  +Q LPPVLFTLMKSTEP+ D+YY  DLE  +REAG
Sbjct  238   FAEALRVLRPGGVLAIVDNNPQSPVIQSLPPVLFTLMKSTEPWSDDYYTFDLEVALREAG  297

Query  1180  FVNVQSVLTDPRHRTVTA  1233
             F     V +DPRHRT+ A
Sbjct  298   FETPVMVPSDPRHRTLVA  315



>ref|WP_010472917.1| methyltransferase type 11 [Acaryochloris sp. CCMEE 5410]
Length=325

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 191/319 (60%), Gaps = 16/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+GE  LS+ V  LI  KP+Y+++K  ARQV I TAEK  +PWR+  + +  S+   
Sbjct  6     KPDWAGEDWLSKLVNLLIQTKPIYAVMKRQARQVLIKTAEKNGVPWRQNYQTLATSNTQD  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
               +   N +L YPDYY  PFHAY+ GNL W AA EAE AT AM LR  P  + + + A  
Sbjct  66    FFDRTNNPNLVYPDYYQVPFHAYEHGNLCWPAAFEAESATYAMALRVWPQEDLTWEMAQD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +R ++   +  +     G   +  ILD+GCS+G+S+  L   Y S      + TGLDLS
Sbjct  126   RLRASFHQVLADY-----GPAQVTHILDMGCSVGISSFALHRYYQSTQAHPVHTTGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LA+A  ++ N++       W H   E+TGLP  + DLV++ +V HE P    + +  
Sbjct  181   PYMLAIAHKRDVNQE-----ITWHHGKAEETGLPDAALDLVTLQFVIHELPREITQQIFA  235

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG  ++ DN+PKS  +Q LPP LFTLMKSTEP+ D+YY  D+E  +  AGF 
Sbjct  236   EALRILRPGGCIALVDNNPKSPVIQNLPPALFTLMKSTEPWSDDYYTFDVESALTAAGFE  295

Query  1186  NVQSVLTDPRHRTVTATVP  1242
             +  +  +DPRHRT+  T P
Sbjct  296   HTVTTASDPRHRTIIGTKP  314



>ref|WP_015200982.1| type 11 methyltransferase [Calothrix parietina]
 ref|YP_007140346.1| type 11 methyltransferase [Calothrix sp. PCC 6303]
 gb|AFZ04374.1| Methyltransferase type 11 [Calothrix sp. PCC 6303]
Length=312

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/304 (44%), Positives = 188/304 (62%), Gaps = 9/304 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  ++S KPL +  K  ARQ+ I  AEK  +PW +  + +   D   ++  ++N  L
Sbjct  14    SRLVNGVLSIKPLANFAKHQARQMMIKRAEKIGVPWTQTVESLKARDWQGDLTKVKNTQL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP+YYL+ FHAY+ GN+SWLAA E EPA  A+  +    A S  +    +R ++ D ++
Sbjct  74    DYPEYYLTSFHAYESGNMSWLAAFEVEPAAYAVHAKIWQGAGSNGDTQ--LRQSYHDILK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             KH        + + ILD+GCS+G+ST  L   YP A++TGLDLSPYFLAVA ++ + R  
Sbjct  132   KHLPN-----SPQSILDMGCSVGMSTFALQDLYPEASITGLDLSPYFLAVANYRTQQRQA  186

Query  874   KTNPTR--WIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
             K + T+  W+HA  E TGLP  SFDLVSI  V HE P+ A R ++ E+ R+LRPGG  ++
Sbjct  187   KISSTKINWVHAAAESTGLPDASFDLVSIFLVCHELPQSATREILAEARRILRPGGHLAI  246

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +PKS+   +LPP + TL+KSTEP+LDEY+  D+E  +   GF         PRHRT+
Sbjct  247   MDMNPKSQAFTQLPPYVLTLLKSTEPYLDEYFSLDIEEAIIREGFQTPLVQANSPRHRTI  306

Query  1228  TATV  1239
              A V
Sbjct  307   IAQV  310



>ref|WP_008274501.1| methyltransferase type 11 [Cyanothece sp. CCY0110]
 gb|EAZ92289.1| hypothetical protein CY0110_28059 [Cyanothece sp. CCY0110]
Length=316

 Score =   250 bits (638),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 192/320 (60%), Gaps = 15/320 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSRFV  +I  KP+Y L+   ARQV I TAEK  I W    + + +S    
Sbjct  6     KPDWTGDDFLSRFVNVMIQTKPIYRLMTHQARQVIIKTAEKNGISWEGNCQTLEKSPAKS  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              +  I N  + YPDYYL PFHAY+EGNL W AA EA PAT ++ LR   +   +  EA +
Sbjct  66    LLGQITNPDIVYPDYYLVPFHAYEEGNLCWKAAFEAIPATQSLGLRVWKNEELTWQEAQK  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRY-----PSANLTGLDLS  825
              +R ++   +E ++        +++ILDIGCS+G+ST+ L   Y      S N  G+DLS
Sbjct  126   RLRSSFHAVLEPYNPP-----QVKNILDIGCSVGISTKTLHRYYKKRQNASINTIGIDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K  D +   ++WIH   E T     SFD+V+I +V HE P  A   +  
Sbjct  181   PYMLAVA----KVTDEQQEISQWIHGLAEKTNFADNSFDVVTIQFVLHELPRHAAIAIFK  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ R+LRPGG   + DN+P+S+ +Q LPPVLFTLMKSTEP  D+YY  ++E  ++E GF 
Sbjct  237   EALRILRPGGVLGIVDNNPRSEVIQNLPPVLFTLMKSTEPHSDDYYTFNVENALKELGFN  296

Query  1186  NVQSVLTDPRHRTVTATVPY  1245
                +V +D RHRT+ AT P+
Sbjct  297   YQTTVPSDHRHRTIVATKPF  316



>ref|WP_015143974.1| methylase [Pleurocapsa minor]
 ref|YP_007081228.1| methylase [Pleurocapsa sp. PCC 7327]
 gb|AFY77671.1| methylase involved in ubiquinone/menaquinone biosynthesis [Pleurocapsa 
sp. PCC 7327]
Length=306

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 183/311 (59%), Gaps = 32/311 (10%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S  +  ++S KPL +L K  AR + I  AEK  +PWRE  +++   D   E+ ++ N  L
Sbjct  14    SSLIDGILSIKPLANLAKHQARNMMIKRAEKIGVPWRENVQKLRSHDWESELATVDNSQL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVV-----RGNW  678
              YPDYYL  FHAY++GNL+W                    A  L+ A+  V     +G  
Sbjct  74    TYPDYYLCSFHAYEKGNLNW------------------DAALELESAAYAVHATIWQGAG  115

Query  679   LDAIEKHHKQYSGCFAIR------DILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLA  840
             ++   K  + Y      +      DILD+GCS+G+ST  L   YP A +TGLDLSPY+LA
Sbjct  116   INGDPKLRQSYHDVLGAQLSIEPQDILDMGCSVGLSTFALQKVYPQAKITGLDLSPYYLA  175

Query  841   VAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRL  1020
             VAQ++ + R+ + +   WIHA  E TGLP  SFDLVS   +FHE P++A R ++ E+ RL
Sbjct  176   VAQYRARERNARID---WIHAAAESTGLPDASFDLVSAFLMFHELPQQAAREILREARRL  232

Query  1021  LRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSV  1200
             LRPGG F++ D +P S+  +++PP + TL+KSTEPFL +Y+  D+++ + EAGF N   +
Sbjct  233   LRPGGYFTLMDMNPHSEAYKKMPPYVLTLLKSTEPFLGQYFALDIKQALLEAGFKNPTII  292

Query  1201  LTDPRHRTVTA  1233
                PRHRTV A
Sbjct  293   PNSPRHRTVIA  303



>ref|WP_017308856.1| methyltransferase type 11 [Fischerella sp. PCC 9339]
Length=307

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 183/300 (61%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KP+Y+L K  ARQ+ I  AEK  +PWR+  + +   +   E+  +QN  L
Sbjct  13    SRLVNGILAIKPVYNLAKHQARQMMIKRAEKIGVPWRKQVQVLRSHNWESELAKVQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP+YY++ FHAYD+GNLSW   A  E    A  + A   A +  +    +R ++ D ++
Sbjct  73    KYPEYYVTSFHAYDKGNLSW--DAALEVEVAAYAVHATIWAGAGVQGDSQLRQSYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           +DILD+GCS+G+ST  L   YP A +TG+DLSPYFLAVA ++ + + R
Sbjct  131   QQ-----ILTPPQDILDLGCSVGMSTFALQDMYPQAQITGVDLSPYFLAVANYRSQQQQR  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+HA  E TG P   FDL+SI  + HE P+   R +  E+ RLLRPGG  ++ D
Sbjct  186   QIN---WVHAAAESTGFPDSCFDLISIFLMCHELPQSPTRQIFAEARRLLRPGGHLTIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PK++  Q++PP + TL+KSTEP+LDEY+  D+E+ + EAGF         PRHRT+ A
Sbjct  243   MNPKAEAYQKMPPYILTLLKSTEPYLDEYFSLDIEQAIVEAGFQTPTITRNSPRHRTIIA  302



>ref|WP_035157188.1| methyltransferase type 11 [Calothrix sp. 336/3]
 gb|KFB85658.1| methyltransferase type 11 [Calothrix sp. 336/3]
Length=317

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 191/319 (60%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G   LSRFV  LI  KPLY L+   AR+V I TAEK  +PWR+    +  S + +
Sbjct  7     KPDWAGADLLSRFVNLLIQTKPLYKLMSYQARKVIIDTAEKNGVPWRKHYTSLAASGIQE  66

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
             ++    N S  YPDYY  PFHAY +GNL W AA EA  AT AM LR   +   +   A +
Sbjct  67    KINESTNPSTTYPDYYKVPFHAYSQGNLCWQAALEAPSATFAMALRVWKNEKMTWQTAHR  126

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYP-----SANLTGLDLS  825
              +RG +   +  + ++      I+DILDIG  +G+ST  L   Y      S    GLDLS
Sbjct  127   RLRGTFHQVLATYIQE-----PIQDILDIGTGVGISTLALHRFYEKKQGYSPKTVGLDLS  181

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             P+ L+VA    K  DR+   ++W+H   E+TGL S SFDLV++ +V HE P  A  ++  
Sbjct  182   PHMLSVA----KILDRQGAISQWLHLQAENTGLDSHSFDLVTMQFVTHELPGYATTSIFQ  237

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E+ RLLRPGG  ++ DN+PKS  +Q LPP LFTLMKSTEP+ D+YY  D+E  + + GF 
Sbjct  238   EALRLLRPGGYIALVDNNPKSPVIQNLPPALFTLMKSTEPWSDDYYTFDIEATLEKVGFE  297

Query  1186  NVQSVLTDPRHRTVTATVP  1242
             +  +V +DPRHRT+ A  P
Sbjct  298   SPVTVASDPRHRTIIARKP  316



>ref|WP_012597070.1| methyltransferase type 11 [Cyanothece sp. PCC 8801]
 ref|YP_002373969.1| type 11 methyltransferase [Cyanothece sp. PCC 8801]
 gb|ACK67813.1| Methyltransferase type 11 [Cyanothece sp. PCC 8801]
Length=305

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 189/302 (63%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR + ++++ KPL  + K  ARQ+ I+ AEK  +PWRE   ++ + D  KE+  I+N ++
Sbjct  14    SRLINSILAIKPLAKVAKHQARQMIINRAEKIGVPWRENVHQLSQHDWQKELAIIENSNV  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL  FHAY+ GNLSW +A E E A  A+     P      ++   +R N+ + ++
Sbjct  74    IYPDYYLCSFHAYETGNLSWQSALEVESAAYAVHANIWPGTGIKGDSR--LRHNYHEVLK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +         + + ILDIGCS+G+ST  L   YP A +TGLDLSPY LAVA ++ + ++ 
Sbjct  132   QQ-----VVISPQAILDIGCSVGMSTFSLQEIYPQAKVTGLDLSPYHLAVAHYRSQQKNS  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+H   E TGLP  SFDLVS   +FHE P++A +++  E+ RLLRPGG F++ D
Sbjct  187   QIN---WVHGAAESTGLPDASFDLVSAFLLFHELPQKAAQDIFKEARRLLRPGGHFTMMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  Q++PP + TL+KSTEP+LDEY+  D+   +  AGF + +     PRHRT+ A
Sbjct  244   MNPRAEAYQKMPPYVMTLLKSTEPYLDEYFSLDMSTALVNAGFKSPKITPMSPRHRTIVA  303

Query  1234  TV  1239
              V
Sbjct  304   QV  305



>ref|WP_016879044.1| methyltransferase type 11 [Chlorogloeopsis fritschii]
Length=306

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 186/302 (62%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPLYSL K  ARQ+ I  AEK  +PWR+    +   D   E+  +QN  +
Sbjct  13    SRLVNGVLAIKPLYSLAKHQARQMMIKRAEKIGVPWRKNVSRLRSHDWESELAKVQNPQI  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YYL+ FHAY++G+L W AA EAE A  A+      DA +  +    +R ++ + ++
Sbjct  73    NYPEYYLTSFHAYEKGDLCWEAALEAEVAAYAVHSGIWKDAGA--QGDPKLRQSYHEILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +   Q       +DILD+GCS+G+ST  L   YP A +TGLDLSPYFLAVA ++ + R  
Sbjct  131   QQISQQP-----QDILDLGCSVGMSTFALQELYPHAKITGLDLSPYFLAVAHYRSQERQA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TGLP  SFDLVSI  + HE P+ A R +  E+ RLLR GG  ++ D
Sbjct  186   NIN---WVHAAAESTGLPDASFDLVSIFLMCHELPQSATRRIFAEARRLLRSGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  +++PP + TL+KSTEP+LDEY+  D+E+ + +AGF         PRHRTV A
Sbjct  243   MNPKSEVYKKMPPYILTLLKSTEPYLDEYFGLDIEQTLVDAGFQTPTITRNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_026734363.1| methyltransferase type 11 [Fischerella sp. PCC 9605]
Length=306

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 186/302 (62%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR +  +++ KPLY+L +  AR++ I  AEK  +PWR   + +   +   E+  +QN  L
Sbjct  13    SRLINGVLAIKPLYNLAQHQAREMMIKRAEKIGVPWRNQVQALRSHNWESELAKVQNSQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YY++ FHAY++GNLSW AA E E A  A+     P A +  +A   +R ++ D ++
Sbjct  73    NYPEYYVTSFHAYEKGNLSWDAALEVEVAAYAVHANIWPSAGAQGDAK--LRQSYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +   +       ++ILD+GCS+G+ST  L   YP A +TG+DLSPYFLAVAQ++ +    
Sbjct  131   QQISKQP-----QEILDLGCSVGMSTFALQELYPQAKITGVDLSPYFLAVAQYRSQQHHH  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TGLP  SFDLVSI  V HE P+   + +  E+ RLLRPGG  ++ D
Sbjct  186   SIN---WVHAAAEATGLPDASFDLVSIFLVCHELPQSPTQQIFAEARRLLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PK++  +++PP + TL+KSTEP+LDEY+  D+E+ + + GF         PRHRTV A
Sbjct  243   MNPKAEAYKKMPPYVLTLLKSTEPYLDEYFSLDIEQALVKGGFQTPSITSNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_009547805.1| MULTISPECIES: methyltransferase type 11 [Cyanothece]
 ref|YP_001802049.1| hypothetical protein cce_0632 [Cyanothece sp. ATCC 51142]
 gb|ACB49983.1| unknown [Cyanothece sp. ATCC 51142]
Length=316

 Score =   247 bits (630),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 189/319 (59%), Gaps = 15/319 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G+  LSRFV  +I  KP+Y L+   ARQV I TAEK  I W    + + +S    
Sbjct  6     KPDWTGDDFLSRFVNVMIKTKPIYRLMTHQARQVIIKTAEKNGISWEGNCQTLEKSPAKS  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
              +  + N  + YPDYYL PFHAY+EGNL W A+ EA PAT ++ LR   + + +  EA +
Sbjct  66    LLRQMTNPDVVYPDYYLVPFHAYEEGNLCWKASFEAIPATQSLGLRVWKNEDLTWQEAQK  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS-----ANLTGLDLS  825
              +R ++   +E +         ++DILDIGCS+G+ST+ L   Y        N  GLDLS
Sbjct  126   RLRSSFHAVLEPYSPP-----QVKDILDIGCSVGISTKELHRYYSQRQNTPINTIGLDLS  180

Query  826   PYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVN  1005
             PY LAVA    K  D +   ++WIH   E T     SFD+++I +V HE P  A   +  
Sbjct  181   PYMLAVA----KVTDEQQEISQWIHGLAEKTNFADNSFDIITIQFVLHELPRHAAIAIFK  236

Query  1006  ESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFV  1185
             E  RLLRPGG   + DN+P+S+ +Q LPPVLFTLMKSTEP  D+YY  ++E  ++E GF 
Sbjct  237   EVLRLLRPGGVLGIVDNNPRSEVIQNLPPVLFTLMKSTEPHSDDYYTFNVENALKELGFD  296

Query  1186  NVQSVLTDPRHRTVTATVP  1242
                +V +D RHRT+ AT P
Sbjct  297   YQTTVPSDHRHRTIVATKP  315



>ref|WP_006616870.1| methyltransferase type 11 [Arthrospira platensis]
 gb|KDR56918.1| methyltransferase type 11 [Arthrospira platensis str. Paraca]
Length=309

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 178/304 (59%), Gaps = 8/304 (3%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P SR V  ++S +PL    K  ARQ+ I  AEK  +PWR  A  +L+ D   E + +   
Sbjct  12    PASRLVNGILSIQPLAKFAKHQARQMMIDRAEKMGVPWRSHANTLLQRDWSPEFQQVNKS  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YYL  FHAYD GNLSW AA E E A +A+  +  PDA    +    +R ++ D 
Sbjct  72    DLAYPEYYLRSFHAYDNGNLSWQAAVEVEVAALAVHAKIWPDAGVAGDDR--LRQSYHDV  129

Query  688   IEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNR  867
             +++   +       + ILD+GCS+G+ST  +   YP A + G+DLSPYFLA+A +   N+
Sbjct  130   LQQVLPE-----PPKAILDLGCSVGLSTNTMQQIYPDATMVGVDLSPYFLAIAAYN-TNQ  183

Query  868   DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
                 NP  W+HA  E TGLP  SFDLVS+  V HE P+ A RN+  E+ RLLRP G  +V
Sbjct  184   KSSHNPPTWVHAPAEATGLPEHSFDLVSLCLVCHELPQEATRNIFEEARRLLRPNGHLAV  243

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +PKS+   ++PP + TL+KSTEP+LD+Y+  DL    + AGF     V   PRH T 
Sbjct  244   MDMNPKSEVFAKMPPYILTLLKSTEPYLDQYFTLDLVETFKSAGFHTPTIVCNSPRHHTA  303

Query  1228  TATV  1239
              A V
Sbjct  304   IAKV  307



>ref|WP_014277197.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005072294.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI93756.1| hypothetical protein [Arthrospira platensis NIES-39]
Length=309

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 178/304 (59%), Gaps = 8/304 (3%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P SR V  ++S +PL    K  ARQ+ I  AEK  +PWR  A  +L+ D   E + +   
Sbjct  12    PASRLVNGILSIQPLAKFAKHQARQMMIDRAEKMGVPWRSHANTLLQRDWSPEFQQVNKS  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YYL  FHAYD GNLSW AA E E A +A+  +  PDA    +    +R ++ D 
Sbjct  72    DLAYPEYYLRSFHAYDNGNLSWQAAVEVEVAALAVHAKIWPDAGVAGDDR--LRQSYHDV  129

Query  688   IEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNR  867
             +++   +       + ILD+GCS+G+ST  +   YP A + G+DLSPYFLA+A +   N+
Sbjct  130   LQQVLPE-----PPKAILDLGCSVGLSTNTMQQIYPDATMVGVDLSPYFLAIAAYN-TNQ  183

Query  868   DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
                 NP  W+HA  E TGLP  SFDLVS+  V HE P+ A RN+  E+ RLLRP G  +V
Sbjct  184   KSSHNPPTWVHAPAEATGLPDHSFDLVSLCLVCHELPQEATRNIFEEARRLLRPNGHLAV  243

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +PKS+   ++PP + TL+KSTEP+LD+Y+  DL    + AGF     V   PRH T 
Sbjct  244   MDMNPKSEVFAKMPPYILTLLKSTEPYLDQYFTLDLVETFKSAGFHTPTIVCNSPRHHTA  303

Query  1228  TATV  1239
              A V
Sbjct  304   IAKV  307



>ref|WP_015784950.1| methyltransferase type 11 [Cyanothece sp. PCC 8802]
 ref|YP_003139552.1| type 11 methyltransferase [Cyanothece sp. PCC 8802]
 gb|ACV02717.1| Methyltransferase type 11 [Cyanothece sp. PCC 8802]
Length=305

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 188/302 (62%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR + ++++ KPL  + K  ARQ+ I+ AEK  +PWRE   ++ + D  KE+  I+N ++
Sbjct  14    SRLINSILAIKPLAKVAKHQARQMIINRAEKIGVPWRENVHQLSQHDWQKELAIIENPNV  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL  FHAY+ GNLSW +A E E A  A+     P      +    +R N+ + ++
Sbjct  74    IYPDYYLCSFHAYETGNLSWQSALEVESAAYAVHANIWPGTGVKGDPR--LRHNYHEVLK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +         + + ILDIGCS+G+ST  L   YP A +TGLDLSPY LAVA ++ + ++ 
Sbjct  132   QQ-----VVISPQAILDIGCSVGMSTFSLQEIYPQAKVTGLDLSPYHLAVAHYRSQQKNS  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+H   E TGLP  SFDLVS   +FHE P++A +++  E+ RLLRPGG F++ D
Sbjct  187   QIN---WVHGAAESTGLPDASFDLVSAFLLFHELPQKAAQDIFKEARRLLRPGGHFTMMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  Q++PP + TL+KSTEP+LDEY+  D+   +  AGF + +     PRHRT+ A
Sbjct  244   MNPRAEAYQKMPPYVMTLLKSTEPYLDEYFSLDMSTALVNAGFKSPKITPMSPRHRTIVA  303

Query  1234  TV  1239
              V
Sbjct  304   QV  305



>ref|WP_019489134.1| methyltransferase type 11 [Calothrix sp. PCC 7103]
Length=305

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 186/302 (62%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +  K  ARQ+ I  A +  +PW+     +   D   ++  ++N  L
Sbjct  13    SRLVNGVLAIKPLANFAKHQARQMMIKRAHELGVPWKNEVDLLKARDWQSDLAQVKNPDL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YYL+ FHAY+ GN+SWLAA E E A  A+  +   DA +  +    +R N+ + ++
Sbjct  73    SYPEYYLTSFHAYESGNMSWLAAFEVESAAYAVHAKIWQDAGT--QGDTKLRQNYHNILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             KH          + ILD+GCS+G+ST  L + YP+A +TGLDLSPYFLAVA ++ + R  
Sbjct  131   KHIAN-----PPQTILDMGCSVGMSTFALQNLYPNAQVTGLDLSPYFLAVAHYRAQERQA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             K N   W+HA  E TGLP+ SFDLVSI  V HE P+ A + +  E+ RLLRP G  ++ D
Sbjct  186   KIN---WVHAAAESTGLPNASFDLVSIFLVCHELPQTATKQIFAEARRLLRPNGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PK++  + +PP +FTL+KSTEP+LD+Y+  D+E+ + E GFV        PRHRT+ A
Sbjct  243   MNPKAEAFKMMPPYVFTLLKSTEPYLDDYFGLDIEQALIEVGFVAPVIASNSPRHRTIIA  302

Query  1234  TV  1239
              V
Sbjct  303   KV  304



>ref|WP_015129944.1| type 11 methyltransferase [Calothrix sp. PCC 7507]
 ref|YP_007066971.1| type 11 methyltransferase [Calothrix sp. PCC 7507]
 gb|AFY34137.1| Methyltransferase type 11 [Calothrix sp. PCC 7507]
Length=306

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 185/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L K  ARQ+ I  AEK  + W +  +++   D   ++  I+N  L
Sbjct  13    SRLVNGILAIKPLANLAKHQARQMMIKRAEKMGVFWTKEVQKLQARDWTTDLAKIENPHL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL+ FHAY+ GNLSW AA E E A  A+  +   DA    +A   +R ++ D ++
Sbjct  73    SYPDYYLTSFHAYETGNLSWQAAFEVESAAYAVHAKIWQDAPVQGDAK--LRQSYHDIVK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                         +DILD+GCS+G+ST  L   YP A +TGLDLSPYFLAVA+++ + R  
Sbjct  131   SRIPNQP-----QDILDLGCSVGMSTLALQELYPQAKITGLDLSPYFLAVAEYRSQQRQA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+HA  E TGLP  SFD VSI  V HE P+ A R +  E+ RLLRPGG  ++ D
Sbjct  186   QIN---WVHAPAESTGLPDTSFDFVSIFLVCHELPQSATRQIFAEARRLLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + +AGF         PRHRTV A
Sbjct  243   MNPQSEIYKQMPPYILTLLKSTEPYLDQYFALDIEQTLVDAGFQTPTITRNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_019500193.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=309

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/303 (44%), Positives = 189/303 (62%), Gaps = 11/303 (4%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++  PL +  K  ARQ+ I  AE   +PWR++  E    D+  E+  +QN   
Sbjct  12    SRLVNGILAIAPLANFAKHKARQMMIDRAEGMGVPWRKIVAEWRSRDLESELAQVQNPDT  71

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YPDYYL+ FHAY++GN+SW AA E E A  A+  + I + NS  E   ++R ++ D + 
Sbjct  72    QYPDYYLTSFHAYEKGNMSWEAATEVEVAAYAVHSK-IWNNNS-PEGDAMLRRSYHDVMT  129

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                +        +DILDIGCS+G+ST  L + YP ANLTGLDLSPYFLA+A +  + R +
Sbjct  130   NQIQS-----PPQDILDIGCSVGMSTFALQAVYPQANLTGLDLSPYFLAIANYNHRER-Q  183

Query  874   KTNPTR---WIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFS  1044
              T PT+   W+HA  E TGLP+ SFDLVSI  V HE P+ A  +++ E+ RLLR GG  +
Sbjct  184   TTAPTKNIKWVHAAAESTGLPTASFDLVSIFLVCHELPQTATGDILREARRLLRSGGHIA  243

Query  1045  VTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRT  1224
             + D +P+S+   ++PP + TL+KSTEP+LDEY+  D+ + + +AGF         PRHRT
Sbjct  244   IMDMNPQSEIYAKMPPYILTLLKSTEPYLDEYFALDIAQAIADAGFTRPSITSNSPRHRT  303

Query  1225  VTA  1233
             + A
Sbjct  304   IIA  306



>ref|WP_016953434.1| methyltransferase type 11 [Anabaena sp. PCC 7108]
Length=306

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 187/302 (62%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L +  ARQ+ I  AEK  + W +  +++   D   ++  +QN  L
Sbjct  13    SRLVNGILAIKPLANLAQHQARQMMIKRAEKIGVYWTKEVEKLQGRDWANDLAQVQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY++ FHAY+ GNLSW AA E E A  A+  +   D     +A   +R ++ + + 
Sbjct  73    IYPDYYVTSFHAYETGNLSWQAAFEVESAAHAVHAKIWQDTEVQGDAK--LRQSYHNIVA  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 Q     A +DILD+GCS+G+ST  L + YP AN+TGLDLSPYFL+VA ++ K R  
Sbjct  131   SSISQ-----APKDILDLGCSVGMSTFALQAVYPQANITGLDLSPYFLSVANYRAKQRQT  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+HA  E TGLP +SFDLVSI  + HE P+ A + +  E+ R+LRPGG  ++ D
Sbjct  186   QIN---WVHAAAESTGLPDQSFDLVSIFLMCHELPQLATKKIFAEAKRVLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  +++P  + TL+KSTEP+LDEY+  D+E+ + EAGF         PRHRTV A
Sbjct  243   MNPKSEIYKKMPTYILTLLKSTEPYLDEYFSLDIEKALVEAGFQTPNITSNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_039752269.1| methyltransferase type 11 [Hassallia byssoidea]
 gb|KIF28706.1| methyltransferase type 11 [Hassallia byssoidea VB512170]
Length=305

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 182/305 (60%), Gaps = 16/305 (5%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPLY+L K  ARQ+ I  AEK  +PW +  + +   D   ++  +QN  L
Sbjct  12    SRLVNRILAIKPLYNLAKHQARQMMIKRAEKIGVPWNKEVEALKARDWESDLAEVQNPQL  71

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YY  PFHAY+ GNL W  A E E A   +      DA +  +A   +R ++ D ++
Sbjct  72    SYPEYYFRPFHAYEAGNLDWEPALELEVAACTVHAGIWRDAGAQGDAK--LRQSYHDILK  129

Query  694   K---HHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKN  864
                 H  Q        DILD+GCS+G+ST  L   YP A +TGLDLSPYFLAVA ++E+ 
Sbjct  130   AQIPHQPQ--------DILDMGCSVGLSTFALQKIYPQAKITGLDLSPYFLAVAHYREQQ  181

Query  865   RDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFS  1044
              + K N   W+HA  E TGL   SFDLVSI  + HE P+ A + +  E+ RLLRPGG  +
Sbjct  182   HNCKIN---WVHAPAESTGLSDASFDLVSIFLMCHELPQSATKEIFTEARRLLRPGGHLA  238

Query  1045  VTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRT  1224
             + D +PKS+   ++PP + TL+KSTEP+LDEY+  D+E+ + EAGF         PRHRT
Sbjct  239   IMDMNPKSEIYTQMPPYILTLLKSTEPYLDEYFALDIEQTLIEAGFNPPTITRNTPRHRT  298

Query  1225  VTATV  1239
             V A +
Sbjct  299   VIAQM  303



>ref|WP_011319866.1| methyltransferase type 11 [Anabaena variabilis]
 ref|YP_323633.1| hypothetical protein Ava_3130 [Anabaena variabilis ATCC 29413]
 gb|ABA22738.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=305

 Score =   244 bits (623),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 181/312 (58%), Gaps = 31/312 (10%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L K  ARQ+ I  A++  +PW    K +   D  +++  +QN  +
Sbjct  13    SRLVNGILAIKPLANLAKHQARQMMIKRAQRIGVPWINEVKTLQARDWTEDLAQVQNPQI  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVR-GNW----  678
              YPDYYL+ FH YDEG+LSW A                  A  L+ A++ V  G W    
Sbjct  73    TYPDYYLTSFHGYDEGDLSWQA------------------AFELEVAARTVHAGIWQDGK  114

Query  679   LDAIEKHHKQYSGCFAIR-----DILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAV  843
              D   K  + Y     +R     DILD+GCS+G+ST  L   YP A +TGLDLSPYFLAV
Sbjct  115   ADGDAKLRQSYHDILKVRVPQPRDILDLGCSVGLSTFTLQETYPHAQVTGLDLSPYFLAV  174

Query  844   AQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLL  1023
             A+++ +    + N   WIHA  E TGLP ++FDLVS+  + HE P+ A + +  E  R+L
Sbjct  175   AKYRAQQSQAQIN---WIHATAESTGLPDRAFDLVSLFLICHELPQLATQKIFAEVRRIL  231

Query  1024  RPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVL  1203
             RPGG  S+ D +P+++  +++PP + TL+KSTEP++D+Y+  D+E+ + EAGF       
Sbjct  232   RPGGHISIMDMNPQAEAYKKMPPYILTLLKSTEPYMDQYFALDIEQTLVEAGFQTPTITK  291

Query  1204  TDPRHRTVTATV  1239
               PRHRTV A V
Sbjct  292   NSPRHRTVIAQV  303



>ref|WP_006625035.1| MULTISPECIES: methyltransferase type 11 [Arthrospira]
 gb|EDZ91890.1| Methyltransferase type 11 [Arthrospira maxima CS-328]
 emb|CCE14956.1| putative SAM-dependent methyltransferase [Arthrospira sp. PCC 
8005]
 gb|EKD07162.1| methyltransferase type 11 [Arthrospira platensis C1]
 emb|CDM95797.1| putative SAM-dependent methyltransferase [Arthrospira sp. PCC 
8005]
Length=309

 Score =   244 bits (623),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 175/304 (58%), Gaps = 8/304 (3%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P SR V  ++S KPL    K  ARQ+ I  AEK  +PWR  A  +L+ D   E + + + 
Sbjct  12    PASRLVNGILSIKPLAKFAKHQARQMMIDRAEKMGVPWRSHANTLLQRDWSAEFQQVNSS  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
             +L YP+YYL  FHAYD GNLSW AA E E A +A+  +  PDA        V   + L  
Sbjct  72    ALAYPEYYLRSFHAYDNGNLSWQAAVEVEVAALAVHAKIWPDAG-------VAGDDRLRQ  124

Query  688   IEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNR  867
                H  Q       + I+D+GCS+G+ST  +   YP A + G+DLSPYFLA+A +   N+
Sbjct  125   SYHHVLQQVLPEPPKAIVDLGCSVGLSTNTMQQIYPDATMVGVDLSPYFLAIAAYN-TNQ  183

Query  868   DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
                 +P  W+HA  E TGLP  SFDLVS+  V HE P+ A RN+  E+ RLLRP G  +V
Sbjct  184   KSSDHPPTWVHAPAEATGLPDHSFDLVSLCLVCHELPQEATRNIFKEARRLLRPNGHLAV  243

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +P+S+   ++PP + TL+KSTEP+LD+Y+  DL    + AGF     V   PRH T 
Sbjct  244   MDMNPQSEVFAKMPPYILTLLKSTEPYLDQYFTLDLVETFKSAGFQTPTIVCNSPRHHTA  303

Query  1228  TATV  1239
              A V
Sbjct  304   IAKV  307



>ref|WP_017322048.1| methyltransferase type 11 [cyanobacterium PCC 7702]
Length=306

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/310 (42%), Positives = 186/310 (60%), Gaps = 11/310 (4%)
 Frame = +1

Query  313   WSGETPL-SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEM  489
             W+  + L S  +  +++ KPLY+L +  ARQ+ I+ AEK  +PWR+  + +   D   E+
Sbjct  5     WNHTSTLASHLINGILAVKPLYNLARHQARQMMIARAEKIGVPWRKQVQALRSHDWESEL  64

Query  490   ESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVR  669
               +QN  L YPDYYL+ FHAY++GNLSW AA E E A  A+     PDA +  +    +R
Sbjct  65    AKVQNPQLCYPDYYLTSFHAYEKGNLSWDAAFEVEVAAYAVHAGIWPDAGA--QGDLKLR  122

Query  670   GNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
              ++   +++H          +DILD+GCS+G+ST  L   YP A +TG DLSPYFLAVA 
Sbjct  123   QSYHHILKQHVSP-----PPQDILDLGCSVGMSTFALQQVYPHAQITGADLSPYFLAVAS  177

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +   +  N   W+H   E TGLP   FDLVSI  + HE P+ A R +  E  RLLRP
Sbjct  178   YRSQQHHQNIN---WLHTAAEATGLPDACFDLVSIFLMCHELPQSATRQIFAEVRRLLRP  234

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG   + D +PKS+  +++P  + TL+KSTEP+LDEY+  D+E+ +++ GF         
Sbjct  235   GGYLGIMDMNPKSEVYKKMPAYVLTLLKSTEPYLDEYFSLDIEQTLKDTGFQIATIACNS  294

Query  1210  PRHRTVTATV  1239
             PRHRT+ A V
Sbjct  295   PRHRTIVARV  304



>ref|WP_038087080.1| methyltransferase type 11 [Tolypothrix bouteillei]
 gb|KIE08294.1| methyltransferase type 11 [Tolypothrix bouteillei VB521301]
Length=306

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 180/302 (60%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SRF+  +++ KPL +L K  ARQ+ I  AEK  + W +  + +   D  K+   +QN  +
Sbjct  13    SRFINGVLAIKPLANLAKHQARQMMIERAEKIGVNWTQEVRTLQTRDWTKDFAKVQNTQI  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL  FHAYD+G+L W   A  E    A  + A    N+  +   ++R ++ + + 
Sbjct  73    TYPDYYLQSFHAYDKGDLCW--EAALEVEVAAQTVHATLWGNATAKGDALLRQSYHNIVA  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +   +     A + ILDIGCS+G+ST  L   YP A +TGLDLSPYFLAVA ++ + R+ 
Sbjct  131   RQLPK-----APQAILDIGCSVGMSTFALQKNYPHAKITGLDLSPYFLAVAHYRSQQRNA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               +   W+HA  E TGLPS SFD +S+  + HE P+ A R +  E+ RLLRPGG   + D
Sbjct  186   NID---WVHAAAESTGLPSASFDFISMFLICHELPQLATRQIFAEAKRLLRPGGHIGIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  Q++PP + TL+KSTEP +DEY+  ++E+ + +AGF         PRHRTV A
Sbjct  243   MNPKSEVYQKMPPYVMTLLKSTEPLMDEYFSFNIEQALVDAGFETPTITPNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_010996243.1| methyltransferase type 11 [Nostoc sp. PCC 7120]
 ref|NP_486125.1| hypothetical protein all2085 [Nostoc sp. PCC 7120]
 dbj|BAB73784.1| all2085 [Nostoc sp. PCC 7120]
Length=305

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 180/312 (58%), Gaps = 31/312 (10%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L K  ARQ+ I  A++  +PW    K +   +  ++   +QN  +
Sbjct  13    SRLVNGILAIKPLANLAKHQARQMMIKRAQRIGVPWINEVKTLQARNWTEDFAQVQNPQI  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVR-GNW----  678
              YPDYYL+ FH YDEG+LSW A                  A  L+ A++ V  G W    
Sbjct  73    TYPDYYLTSFHGYDEGDLSWQA------------------AFELEVAARTVHAGIWQDGK  114

Query  679   LDAIEKHHKQYSGCFAIR-----DILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAV  843
              D   K  + Y     ++     DILD+GCS+G+ST  L   YP A +TGLDLSPYFLAV
Sbjct  115   ADGDAKLRQSYHDILKVQVPQPQDILDLGCSVGLSTFTLQETYPHAQVTGLDLSPYFLAV  174

Query  844   AQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLL  1023
             A+++ +    + N   WIHA  E TGLP K+FDLVS+  + HE P+ A + +  E  RLL
Sbjct  175   AKYRAQQSQAQIN---WIHATAESTGLPDKAFDLVSLFLICHELPQLATQKIFAEMRRLL  231

Query  1024  RPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVL  1203
             RPGG  S+ D +P+++  +++PP + TL+KSTEP++D+Y+  D+E+ + EAGF       
Sbjct  232   RPGGHISIMDMNPQAEAYKKMPPYILTLLKSTEPYMDQYFALDIEQTLVEAGFQTPTITK  291

Query  1204  TDPRHRTVTATV  1239
               PRHRTV A V
Sbjct  292   NSPRHRTVIAQV  303



>ref|WP_015148229.1| methylase [Oscillatoria acuminata]
 ref|YP_007085505.1| methylase [Oscillatoria acuminata PCC 6304]
 gb|AFY81585.1| methylase involved in ubiquinone/menaquinone biosynthesis [Oscillatoria 
acuminata PCC 6304]
Length=308

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 133/319 (42%), Positives = 182/319 (57%), Gaps = 32/319 (10%)
 Frame = +1

Query  316   SGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMES  495
             +G   LSRF+  L++ KP+ S  K  AR++ I  AE   +PW   A+ +   +  KE + 
Sbjct  7     TGPGFLSRFINGLLAIKPVASFAKSKARKMMIDRAENMGVPWTIEARSLQNRNWDKEFQQ  66

Query  496   IQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGN  675
             +QN +L YPDYYL  FHAYD+GNLSW A                  A+ ++ A++ V  +
Sbjct  67    VQNPTLVYPDYYLRSFHAYDQGNLSWEA------------------ASEVEVAAKAVHAH  108

Query  676   -WLDAI--------EKHHKQYSGCFA--IRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
              W DA         + +H+  S   A   + ILD+GCS+G+ST  L   YP A LTGLDL
Sbjct  109   IWKDAGPDGDCRLRDSYHEVLSAQIADSPQAILDLGCSVGMSTVALQKLYPQATLTGLDL  168

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPYFLAVAQ+K +          W+HA  E TGL   SFDLVS   +FHE P  A R ++
Sbjct  169   SPYFLAVAQYKSEQHYPDIT---WVHAAAESTGLADASFDLVSSCLMFHELPADASRQIL  225

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+ RLLRPGG  ++ D +P+S+   ++PP + TL+KSTEP+LD+Y+  D+E    EAGF
Sbjct  226   QEARRLLRPGGHLAIMDMNPQSEIYAKMPPYILTLLKSTEPYLDQYFSLDIEPAFVEAGF  285

Query  1183  VNVQSVLTDPRHRTVTATV  1239
                      PRHRT+ A V
Sbjct  286   EKPTITRNSPRHRTIIAQV  304



>ref|WP_015121590.1| methylase [Rivularia sp. PCC 7116]
 ref|YP_007058585.1| methylase [Rivularia sp. PCC 7116]
 gb|AFY58038.1| methylase involved in ubiquinone/menaquinone biosynthesis [Rivularia 
sp. PCC 7116]
Length=308

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 184/306 (60%), Gaps = 11/306 (4%)
 Frame = +1

Query  325   TPLS-RFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQ  501
             TP+S R +  L+  KPL++L K  ARQ+ +   E+  +PWRE  +E+   D   +++ ++
Sbjct  9     TPISTRLINGLLGIKPLFNLAKHQARQMMVKRGERVGVPWREQVEEMKTVDWETQIKKVE  68

Query  502   NQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWL  681
             N ++ YP+YYL  FHAY+EGNL W  A E E A + +       A  L   S++ R ++ 
Sbjct  69    NPNVSYPNYYLDSFHAYEEGNLGWKPALELEVAALTVHSTLFNKAGELAGDSKL-RASYH  127

Query  682   DAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEK  861
             D ++    Q       +DILD+ C +G+ST  L   YP A +TGLDLSPYFL+VA ++ +
Sbjct  128   DVLKPQIPQ------PQDILDLACGVGLSTFALQEIYPQAKVTGLDLSPYFLSVANYRSQ  181

Query  862   NRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTF  1041
              R    N   W+HA  E TGLP  SFDLVSI    HE P+ A R +  E+ R+LRP G  
Sbjct  182   QRQTNIN---WVHALAESTGLPENSFDLVSIFLTCHELPQSATRQIFTEARRILRPNGNL  238

Query  1042  SVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHR  1221
             ++ D +P+S+  +++PP +FTL+KSTEP LDEY+  D+++ + +AGF         PRHR
Sbjct  239   AIMDMNPQSEVYKKMPPYVFTLLKSTEPCLDEYFTLDMKQALIDAGFQAPTITPNSPRHR  298

Query  1222  TVTATV  1239
             TV A V
Sbjct  299   TVVAKV  304



>ref|WP_015175324.1| Methyltransferase type 11 [Oscillatoria nigro-viridis]
 ref|YP_007114420.1| Methyltransferase type 11 [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ06004.1| Methyltransferase type 11 [Oscillatoria nigro-viridis PCC 7112]
Length=311

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 192/304 (63%), Gaps = 12/304 (4%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  ++S KPL +L K  AR++ I  AEK  + WR+ A+ +L  +   E+ S+QN  L
Sbjct  13    SRLVNGVLSIKPLANLAKHQAREMMIKRAEKIGVNWRQEAQALLARNWDAELLSVQNPDL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP YYL+ FHAY++GN+SW AA E E A   +     P+A +  +A   +R ++ + I+
Sbjct  73    VYPKYYLTSFHAYEKGNMSWEAATEVEVAARTVHSGICPEAGAEGDAK--LRASYHEVIK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                       + +DI+D+GCS+G+ST  L   YP A +TG++LSPYFLAVA+++ + R+ 
Sbjct  131   SQIAS-----SPQDIVDLGCSVGLSTFALGDVYPEAKMTGVELSPYFLAVAKYRSQQRES  185

Query  874   KT----NPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTF  1041
             ++    +PT W+HA  E TGLP+ +FDLVSI  V HE P++A R +  E+ RLLR GG  
Sbjct  186   ESLNQKSPT-WVHAAAESTGLPAAAFDLVSICLVCHELPQKATREIFREARRLLRVGGHL  244

Query  1042  SVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHR  1221
             ++ D +P+S+   ++PP + TL+KSTEP+LD+Y+  D+E+ + ++GF          RHR
Sbjct  245   TIMDMNPQSEVYAKMPPYILTLLKSTEPYLDQYFGLDIEQALIDSGFAQPTITCNTVRHR  304

Query  1222  TVTA  1233
             T+ A
Sbjct  305   TIVA  308



>ref|WP_027843812.1| methyltransferase type 11 [Mastigocoleus testarum]
Length=304

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 180/302 (60%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  ++S KPL    K  ARQ+ I  AEK  +PW +  +++   +   ++  +QN  +
Sbjct  13    SRLVNGVLSIKPLADFAKHQARQMMIKRAEKIGVPWTKTVEQLQLRNWETDLAKVQNHQI  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL+ FHAY++GN+SWLAA E E A  A+  +     NS  E    +R ++ D ++
Sbjct  73    SYPDYYLTSFHAYEQGNMSWLAAFEVESAAYAVHAKLWGGTNS--EGDAKLRQSYHDVLK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 Q        +ILD+GCS+G+ST  L   YP A +TG+DLSPYFLAVA +  K R  
Sbjct  131   VEISQTP-----ENILDLGCSVGLSTFALQEIYPHAKITGVDLSPYFLAVANYNSKQRQA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TGL    +DLVSI  V HE P+ A R +  E+ RLL PGG F++ D
Sbjct  186   NIN---WVHAAAESTGLKDALYDLVSICLVCHELPQSATRQIFAEAKRLLTPGGYFAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P S+  +++PP + TL+KSTEP+LDEY+  D+++ + +AGF         PRHRTV A
Sbjct  243   MNPCSEAFKKMPPYVLTLLKSTEPYLDEYFSFDIKQALIDAGFQTPSISFNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   RV  304



>ref|WP_015226513.1| type 11 methyltransferase [Halothece sp. PCC 7418]
 ref|YP_007168853.1| type 11 methyltransferase [Halothece sp. PCC 7418]
 gb|AFZ44639.1| Methyltransferase type 11 [Halothece sp. PCC 7418]
Length=307

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/303 (41%), Positives = 188/303 (62%), Gaps = 10/303 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  ++  KP+Y + K  AR + I  AE+  +PWR+   ++ + D   E+ +IQN +L
Sbjct  13    SRLVNGILGIKPIYQMAKSRARNMMIKRAEEIGVPWRDRVAQLKQHDWDSELATIQNPNL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY   FHAY++GNLSW AA E E A  A+  +   D+ +  +  Q +R ++ + ++
Sbjct  73    NYPDYYTCSFHAYEKGNLSWEAALEVEVAAYAVHAKLWDDSGA--DGDQRLRDSYHEVLQ  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +             I+D+GCS+G+S+  L  RYP A +TG+DLSPYFL+VAQ++ + ++ 
Sbjct  131   EQLPT-----TPETIVDLGCSVGMSSFALQERYPEAKITGVDLSPYFLSVAQYQARQKEF  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
                  +W HA  E T LPS S+DLVS   +FHE P++  + +  E+ RL++PGG F + D
Sbjct  186   NI---QWQHAAAEATELPSHSYDLVSAFLMFHELPQQPAKAIFQEAKRLVKPGGYFCLMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S   Q++PP +FTL+KSTEP+LDEY+  DL + + +AGF   + +   PRHRTV A
Sbjct  243   MNPQSPVYQKMPPYVFTLLKSTEPYLDEYFTLDLHQALTDAGFAAPKIIPNSPRHRTVIA  302

Query  1234  TVP  1242
               P
Sbjct  303   YKP  305



>ref|WP_015113628.1| type 11 methyltransferase [Nostoc sp. PCC 7107]
 ref|YP_007050567.1| type 11 methyltransferase [Nostoc sp. PCC 7107]
 gb|AFY43417.1| Methyltransferase type 11 [Nostoc sp. PCC 7107]
Length=306

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/311 (42%), Positives = 186/311 (60%), Gaps = 15/311 (5%)
 Frame = +1

Query  307   PRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKE  486
             P W+        V  +++ KPL  + K  ARQ+ I  AEK  +PW +  +++ E D   +
Sbjct  9     PNWA-----VHLVNGILAIKPLAKIAKHQARQMMIKRAEKIGVPWTKAVEKLQERDWSTD  63

Query  487   MESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVV  666
             +  ++N  L YP+YY + FHAYD GNLSWLAA E EPA  A+  +  P A +  +  + +
Sbjct  64    LAQVENPQLAYPEYYTTSFHAYDNGNLSWLAAFEVEPAAHAVHAKIWPGAEA--QGDRQL  121

Query  667   RGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVA  846
             R ++ + ++    Q       RDILDIGCS+G+ST  L   Y  A +TGLDLSPYFLAVA
Sbjct  122   RQSYHNILKPLLSQEP-----RDILDIGCSVGLSTFALQEVYLQAKVTGLDLSPYFLAVA  176

Query  847   QFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLR  1026
              ++ +      N   W+HA  E TGLP KSFDLVS+  + HE P+   + +  E+ RLLR
Sbjct  177   NYRAQQHQANIN---WVHAAAESTGLPDKSFDLVSLFLICHELPQAPTKQIFAEARRLLR  233

Query  1027  PGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLT  1206
             PGG  ++ D +PKS+  +++P  + TL+KSTEP+LDEY+  D+E+ + +AGF        
Sbjct  234   PGGHLAIMDMNPKSEIYKKMPAYILTLLKSTEPYLDEYFSLDIEQALIDAGFQRPTITSN  293

Query  1207  DPRHRTVTATV  1239
              PRHRTV A V
Sbjct  294   SPRHRTVIAQV  304



>ref|WP_007306809.1| methyltransferase type 11 [Crocosphaera watsonii]
 gb|EAM49468.1| similar to Methylase involved in ubiquinone/menaquinone biosynthesis 
[Crocosphaera watsonii WH 8501]
Length=317

 Score =   239 bits (610),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 183/321 (57%), Gaps = 16/321 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G   LSRFV  +I  KP+Y L+   AR+V I TAEK  I W E  K + +S    
Sbjct  6     KPDWTGNDLLSRFVNLMIETKPIYRLMTHQARKVIIKTAEKNGIAWEENCKNLEKSPAKS  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
                 I N  + YPDYYL PFHAYD+GNL W AA EA PAT ++ LR   + + +  EA  
Sbjct  66    LFSQITNPDIVYPDYYLVPFHAYDQGNLCWKAAFEAVPATQSLGLRVWKNEDLTWQEAQD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS------ANLTGLDL  822
              +R  +   +E +         + +ILDIGCSIGVST+     Y         N  GLDL
Sbjct  126   RLRAAFHAVLEPYSPP-----QVENILDIGCSIGVSTKATHCYYSQRQGNLPINTIGLDL  180

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPY LAVA    K  D +   ++WIH   E T     SFD+++I +V HE P  A   + 
Sbjct  181   SPYMLAVA----KVTDEEQEISQWIHGLAEKTNFDDNSFDVITIQFVLHELPRDAATAIF  236

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FR+L PGG   + DN+P+S+ +Q LPP LF LMKSTEP  D+YY  ++E  +++ GF
Sbjct  237   KEAFRILHPGGVLGIVDNNPRSEVIQNLPPALFMLMKSTEPHSDDYYTFNVEETLQKLGF  296

Query  1183  VNVQSVLTDPRHRTVTATVPY  1245
                 +  +D RHRT+ AT P+
Sbjct  297   DYKTTFPSDHRHRTIVATKPF  317



>ref|WP_021833434.1| hypothetical protein [Crocosphaera watsonii]
 emb|CCQ57231.1| hypothetical protein CWATWH0005_2501 [Crocosphaera watsonii WH 
0005]
 emb|CCQ65119.1| hypothetical protein CWATWH0402_5635 [Crocosphaera watsonii WH 
0402]
Length=317

 Score =   239 bits (610),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 183/321 (57%), Gaps = 16/321 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G   LSRFV  +I  KP+Y L+   AR+V I TAEK  I W E  K + +S    
Sbjct  6     KPDWTGNDLLSRFVNLMIETKPIYRLMTHQARKVIIKTAEKNGIAWEENCKNLEKSPAKS  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
                 I N  + YPDYYL PFHAYD+GNL W AA EA PAT ++ LR   + + +  EA  
Sbjct  66    LFSQITNPDIVYPDYYLVPFHAYDQGNLCWKAAFEAVPATQSLGLRVWKNEDLTWQEAQD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS------ANLTGLDL  822
              +R  +   +E +         + +ILDIGCSIGVST+     Y         N  GLDL
Sbjct  126   RLRAAFHAVLEPYSPP-----QVENILDIGCSIGVSTKATHRYYSQRQGNLPINTIGLDL  180

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPY LAVA    K  D +   ++WIH   E T     SFD+++I +V HE P  A   + 
Sbjct  181   SPYMLAVA----KVTDEEQEISQWIHGLAEKTNFDDNSFDVITIQFVLHELPRDAATAIF  236

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FR+L PGG   + DN+P+S+ +Q LPP LF LMKSTEP  D+YY  ++E  +++ GF
Sbjct  237   KEAFRILHPGGVLGIVDNNPRSEVIQNLPPALFMLMKSTEPHSDDYYTFNVEETLQKLGF  296

Query  1183  VNVQSVLTDPRHRTVTATVPY  1245
                 +  +D RHRT+ AT P+
Sbjct  297   DYKTTFPSDHRHRTIVATKPF  317



>ref|WP_006098440.1| methyltransferase type 11 [Coleofasciculus chthonoplastes]
 gb|EDX78004.1| Methyltransferase domain family [Coleofasciculus chthonoplastes 
PCC 7420]
Length=306

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 179/302 (59%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V   ++ KPL +L K  AR++ I  AEK  +PW +   E+   +    +  +QN  +
Sbjct  13    SRLVNGFLAIKPLANLAKQQARKMIIKRAEKIGVPWTKQVNELRSLNWESYLSQVQNPQV  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL PFHAYD+GNL W AA E E A  A+     P+     +A   +R ++ + ++
Sbjct  73    TYPDYYLRPFHAYDQGNLQWKAAFEQEVAAYAVHANLYPEDKLQGDAK--LRQSYHELVQ  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             K  K        +DI+D+GC +G+ST  L   YP AN+TG+DLSPYFLAVA++K K    
Sbjct  131   KQVKTEP-----QDIVDLGCGVGMSTFALQQIYPQANMTGVDLSPYFLAVAEYKSKQHHT  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W HA  E TGLP  S+DLVS+  VFHE P+   + ++ E+ RLLRPGG  ++ D
Sbjct  186   EIN---WKHAAAEATGLPDASYDLVSVFLVFHELPQTVAKAILREARRLLRPGGYLTLMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+    +P  +FTL KSTEP+ DEY   D+E+ + +AGF     +   PRHRT+  
Sbjct  243   MNPQSQVYATMPAYVFTLFKSTEPYFDEYITLDIEQAIAQAGFQPPMIMPNSPRHRTIIT  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_021831023.1| hypothetical protein [Crocosphaera watsonii]
 emb|CCQ51887.1| FIG00567656: hypothetical protein [Crocosphaera watsonii WH 8502]
Length=317

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 183/321 (57%), Gaps = 16/321 (5%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYK  483
             +P W+G   LSRFV  +I  KP+Y L+   AR+V I TAEK  I W E  K + +S    
Sbjct  6     KPDWTGNDLLSRFVNLMIETKPIYRLMTHQARKVIIKTAEKNGIAWEENCKNLEKSPAKS  65

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQ  660
                 I N  + YPDYYL PFHAYD+GNL W AA EA PAT ++ LR   + + +  EA  
Sbjct  66    LFSQITNPDIVYPDYYLVPFHAYDQGNLCWKAAFEAVPATQSLGLRVWKNEDLTWQEAQD  125

Query  661   VVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS------ANLTGLDL  822
              +R  +   +E +         + +ILDIGCSIGVST+     Y         N  GLDL
Sbjct  126   RLRAAFHAVLEPYSPP-----QVENILDIGCSIGVSTKATHCYYSQRQGNLPINTIGLDL  180

Query  823   SPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVV  1002
             SPY LAVA    K  D +   ++WIH   E T     SFD+++I +V HE P  A   + 
Sbjct  181   SPYMLAVA----KVTDEEQEISQWIHGLAEKTNFDDNSFDVITIQFVLHELPRDAATAIF  236

Query  1003  NESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGF  1182
              E+FR+L PGG   + DN+P+S+ +Q LPP LF LMKSTEP  D+YY  ++E  +++ GF
Sbjct  237   KEAFRILHPGGVLGIIDNNPRSEVIQNLPPALFMLMKSTEPHSDDYYTFNVEETLQKLGF  296

Query  1183  VNVQSVLTDPRHRTVTATVPY  1245
                 +  +D RHRT+ AT P+
Sbjct  297   DYKTTFPSDHRHRTIVATKPF  317



>ref|WP_029638148.1| methyltransferase type 11 [[Scytonema hofmanni] UTEX B 1581]
Length=306

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 186/303 (61%), Gaps = 10/303 (3%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             +SR V  +++ KPLY+L K  ARQ+ I  +EK  + W +  + +   +   ++  +QN  
Sbjct  12    ISRLVNRILAIKPLYNLAKHQARQMMIKRSEKMGVSWLKEVETLKARNWESDLAEVQNPQ  71

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAI  690
             L YP+YYL+ FHAY+ GNLSW AA E E A +A+  +   DA +  +A   +R ++ D +
Sbjct  72    LSYPEYYLTSFHAYEAGNLSWQAAFEVESAAIAVHSKIWQDAEAQGDAK--LRQSYHDIL  129

Query  691   EKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRD  870
                       +  +DILD+GCS+G+ST  L   YP A +TGLDLSPYFLAVA ++E+  +
Sbjct  130   SSQ-----ITYEPQDILDMGCSVGLSTFALQKIYPQAKITGLDLSPYFLAVAHYREQQHN  184

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
              K N   W++A  E TGL   SFDLVSI  + HE P+ A + +  E+ RLLRPGG  ++ 
Sbjct  185   CKIN---WVNAAAESTGLSDASFDLVSIFLMCHELPQSATKEIFTEARRLLRPGGHLAIM  241

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +PKS+   ++PP + TL+KSTEP+LDEY+  D+E+ +  AGF         PRHRTV 
Sbjct  242   DMNPKSEIYTQMPPYILTLLKSTEPYLDEYFALDIEQTLISAGFNAPTITRNTPRHRTVI  301

Query  1231  ATV  1239
             A +
Sbjct  302   AQL  304



>ref|WP_015193439.1| Methyltransferase type 11 [Stanieria cyanosphaera]
 ref|YP_007132737.1| Methyltransferase type 11 [Stanieria cyanosphaera PCC 7437]
 gb|AFZ35771.1| Methyltransferase type 11 [Stanieria cyanosphaera PCC 7437]
Length=307

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 183/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +  K  AR++ I  AE   +PWRE  +++ + +   E+ +I N  L
Sbjct  14    SRLVNGILAIKPLANFAKYRARKMMIDRAEALGVPWRENVRQLSQRNWDAEIAAITNPQL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YPDYYL  FHAY++GNLSW  AA    +        I    S +   Q+ R ++   I+
Sbjct  74    QYPDYYLRSFHAYEQGNLSW-EAAWEVESAAYAVHSTIWSGKSANGDPQL-RQSYHQVIQ  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 Q       +DILDIGCS+G+ST  L   YP A LTG+DLSPYFLAVAQ++ + +  
Sbjct  132   AQSIQ------PQDILDIGCSVGMSTMALQEIYPQAQLTGVDLSPYFLAVAQYRCQKQPN  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             K    +W+HA  E TGL   SFDLVS   +FHE P+ A + ++ E+ RLLRPGG  ++ D
Sbjct  186   KE--IKWLHAAAEATGLTEASFDLVSACLLFHELPQTAAQAIITEARRLLRPGGYLTIMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+  +++PP + TL+KSTEP+LD+Y+  D+ + + + GF   + +   PRHRT+ A
Sbjct  244   MNPQSEVYKKMPPYVLTLLKSTEPYLDQYFSLDISQTLVDQGFNVPKIIPNSPRHRTIVA  303

Query  1234  TV  1239
              V
Sbjct  304   QV  305



>ref|WP_009344078.1| methyltransferase type 11 [Raphidiopsis brookii]
 gb|EFA72003.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=307

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/303 (41%), Positives = 183/303 (60%), Gaps = 9/303 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S FV  ++S KPL+   K  AR++ I  A+K  + W +  +++   D   ++  +QN  L
Sbjct  11    SNFVNKILSIKPLFDFAKHQAREMMIKRAQKIGVNWHQEVEKLQARDWSNDLAQVQNPQL  70

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL+ FHAY+ GN++W AA E E A  A+  +  PD         VV G+      
Sbjct  71    TYPDYYLTSFHAYETGNMNWQAAFEVESAAYAVHAKVWPDL--------VVDGDAKLRQS  122

Query  694   KHHKQYSGCFAI-RDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRD  870
              HH   +      +DILD+GCS+G+ST  L + YP + +TGLDLSPYFLAVA ++ +   
Sbjct  123   YHHILKTFITQTPKDILDLGCSVGMSTFALQAIYPQSQITGLDLSPYFLAVANYRSQQSP  182

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
             +  N   W+HA  E TG+P  S+DLVSI  + HE P+ A + +  E+ R+LRPGG  ++ 
Sbjct  183   QYQNSINWLHAAAESTGMPDNSYDLVSIFLMCHELPQSATQKIFLEARRVLRPGGHLTIM  242

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +P+S+  +++P  +FTL+KSTEP+LD+Y+  D+E+ + +AGF  +      PRHRTV 
Sbjct  243   DMNPQSEIYKKMPTYVFTLLKSTEPYLDDYFTLDMEKSLIDAGFKVISMTSNSPRHRTVI  302

Query  1231  ATV  1239
             A V
Sbjct  303   AQV  305



>ref|WP_012409340.1| methyltransferase type 11 [Nostoc punctiforme]
 ref|YP_001866290.1| methyltransferase type 11 [Nostoc punctiforme PCC 73102]
 gb|ACC81347.1| Methyltransferase type 11 [Nostoc punctiforme PCC 73102]
Length=307

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 182/302 (60%), Gaps = 9/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L K  ARQ+ I  AE+  +PW +  K +   D   ++  I+N  L
Sbjct  13    SRLVNGVLAIKPLANLAKHQARQMMIKRAERIGVPWTKEVKTLQARDWKADLTQIENSQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY++ FHAY+ GNLSW AA E EPA  A+  + +  A    +   ++R ++ + ++
Sbjct  73    SYPDYYVTSFHAYETGNLSWQAAFEVEPAAYAVHSKVVEGAEE-AQGDPMLRQSYHNILK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                         +DILD+GCS+G+ST  L + Y  A + GLDLSPYFLAVA ++ + R  
Sbjct  132   SQIPNEP-----QDILDVGCSVGLSTFALQAVYSQAKIIGLDLSPYFLAVANYRAQQRQA  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             K N   W+HA  E TGLP  SFDLVSI  + HE P+ A R ++ E  R+LRPGG  ++ D
Sbjct  187   KIN---WLHAQAESTGLPDASFDLVSIFLMCHELPQSATRQILAEMRRVLRPGGYLAIMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  Q++P  + TL+KSTEP+LDEY+  D+E+   EAGF          RHRTV A
Sbjct  244   MNPKSEVYQKMPAYILTLLKSTEPYLDEYFALDIEQAFVEAGFQTPTITNNTHRHRTVIA  303

Query  1234  TV  1239
              V
Sbjct  304   QV  305



>ref|WP_010477816.1| methyltransferase type 11 [Acaryochloris sp. CCMEE 5410]
Length=307

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/305 (44%), Positives = 183/305 (60%), Gaps = 14/305 (5%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILES--DVYK-EMESIQN  504
             SR V  L++ KPL +  K  AR++ I  AE   +PWR+ A  +++   +V++ E ++IQ 
Sbjct  13    SRVVNGLLAIKPLANFAKFQARKMMIERAESIGVPWRKRASSLMDRGLEVWEAERQAIQT  72

Query  505   QSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLD  684
               L+YPDYY+  FHAY+ GNLSW AA E E A+ A   R  P++ +  +    +R ++  
Sbjct  73    PDLDYPDYYVVSFHAYESGNLSWEAATEVEVASYAAHARIWPESGA--QGDSRLRQSYHT  130

Query  685   AIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKN  864
              +     Q     A +DILD+GCS+G+ST  L   YP A LTGLDLSPYFLA+A      
Sbjct  131   VM-----QEKISTAPKDILDMGCSVGLSTLALQETYPEARLTGLDLSPYFLAIANHNTPA  185

Query  865   RDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFS  1044
              D      +WIH   E+TGLP  SFDLVSI  V HE P  AIRN+  E+ RLLRP G  +
Sbjct  186   NDS----LQWIHRAAEETGLPDNSFDLVSICLVCHELPRTAIRNIFAEAHRLLRPQGHLA  241

Query  1045  VTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRT  1224
             V D +P S   ++LPP + TL+KSTEP+LD+Y+  D+++   EAGF         PRHRT
Sbjct  242   VMDMNPNSDVHRKLPPYVLTLLKSTEPYLDDYFTFDIQQAFVEAGFRRPSLTCNSPRHRT  301

Query  1225  VTATV  1239
             + A V
Sbjct  302   LIAQV  306



>ref|WP_006632690.1| methyltransferase type 11 [Microcoleus vaginatus]
 gb|EGK88883.1| Methyltransferase type 11 [Microcoleus vaginatus FGP-2]
Length=311

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/304 (41%), Positives = 192/304 (63%), Gaps = 12/304 (4%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  ++S KPL +L K  AR++ I  AE+  + WR+ ++ +L  +   E+ S+QN  L
Sbjct  13    SRLVNGVLSIKPLANLAKHQAREMMIKRAERIGVHWRQESQALLARNWEAELLSVQNPDL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP YYL+ FHAY++GN+SW AA E E A   +     P+A +  +A   +R ++ + I+
Sbjct  73    VYPKYYLTSFHAYEKGNMSWEAATEVEVAARTVHAGIWPEAGAEGDAK--LRASYHEVIK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                       + +DI+D+GCS+G+ST  L   YP A +TG++LSPYFLAVA+++ + R+ 
Sbjct  131   SQIAS-----SPQDIVDLGCSVGMSTFALGDIYPEAKMTGVELSPYFLAVAKYRSQQREA  185

Query  874   KT----NPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTF  1041
             ++    +PT W+HA  E TGLP+ +FDLVSI  V HE P++A R +  E+ RLLR GG  
Sbjct  186   ESLNQKSPT-WVHAAAESTGLPAAAFDLVSICLVCHELPQKATREIFREARRLLRVGGHL  244

Query  1042  SVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHR  1221
             ++ D +P+S+   ++PP + TL+KSTEP+LD+Y+  D+E+ + ++GF          RHR
Sbjct  245   TIMDMNPQSEVYAKMPPYILTLLKSTEPYLDQYFGLDIEQALVDSGFAQPTITCNTVRHR  304

Query  1222  TVTA  1233
             TV A
Sbjct  305   TVVA  308



>ref|WP_026099878.1| methyltransferase type 11 [Prochlorothrix hollandica]
Length=333

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/325 (41%), Positives = 185/325 (57%), Gaps = 28/325 (9%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEI---------LESDVYK  483
             LSR V  L++ KPL  L K  ARQ+ I+ +E   +PWR+  + +          +    +
Sbjct  13    LSRVVSLLLAIKPLAHLAKQKARQMMITRSESIGVPWRDNTQALRSKGSEAVDFDRTWDQ  72

Query  484   EMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQV  663
             ++  + N SL YP YY+  FH YDEGNL WL A E E A+ ++  +  PD  +  +A   
Sbjct  73    DLAHLTNPSLTYPPYYIISFHGYDEGNLGWLPAMEVESASRSVHAKLWPDLGAAGDAH--  130

Query  664   VRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAV  843
             +R  + D++     Q     A R ILD+GC  G+ST  L  RYP A +TGLDLSPYFLAV
Sbjct  131   LRSLYHDSLHAALPQ-----APRRILDLGCGAGLSTFALGDRYPEAAITGLDLSPYFLAV  185

Query  844   AQFKEKNRDRKT------------NPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERA  987
             AQ++ +    +             NP RW+H   E TGLP +SFDLVSI  V HE P+ A
Sbjct  186   AQYRSQQALSQQLRSPEPPAHPAPNPIRWLHGAAETTGLPDQSFDLVSIFLVVHELPQSA  245

Query  988   IRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVM  1167
                ++ E+ RLL PGG F++ D +P  + +Q+LPP + TL+KSTEP+LD+Y+  DL   +
Sbjct  246   TLALLGEAHRLLAPGGHFALMDMNPSCEFVQKLPPYVLTLLKSTEPYLDDYFSLDLAEAV  305

Query  1168  REAGFVNVQSVLTDPRHRTVTATVP  1242
             + AGF       T PRHRT+ A  P
Sbjct  306   QGAGFEPATIAATGPRHRTLIAAKP  330



>ref|WP_013192336.1| methyltransferase type 11 [Trichormus azollae]
 ref|YP_003722446.1| type 11 methyltransferase ['Nostoc azollae' 0708]
 gb|ADI65323.1| Methyltransferase type 11 ['Nostoc azollae' 0708]
Length=306

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 183/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S+ V  +++ KPL +L K  ARQ+ I  AEK  + W + A+++   D   ++  +QN  L
Sbjct  13    SQMVNGILAIKPLANLAKHQARQMMIKRAEKIGVFWTKEAEKLQARDWTNDLAQVQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY+  FHAY+ GNLSW AA E E A  A+  +   DA    +A   +R ++ + + 
Sbjct  73    TYPDYYVISFHAYETGNLSWQAAFEVESAAHAVHAKIWQDAEVQGDAK--LRQSYHNILT  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                   S     +DILD+GCS+G+ST  L   YP AN+TGLDLSPYFLAVA ++ +    
Sbjct  131   S-----SISEPPKDILDLGCSVGMSTFALQEIYPDANITGLDLSPYFLAVANYRCQQHQA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             K N   W+HA  E TG+P  SFDLVSI  + HE P+ A R +  E+ R+LRPGG  ++ D
Sbjct  186   KIN---WVHAAAESTGMPDASFDLVSIFLMCHELPQLATRKIFAEARRVLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  +++P  +FTL+KSTEP+LDEY+  D+E+ +  AGF         PRHRT+  
Sbjct  243   MNPKSEVYKKMPKYIFTLLKSTEPYLDEYFTLDIEQTLVGAGFQTPTITSNSPRHRTIIT  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_015166468.1| type 11 methyltransferase [Pseudanabaena sp. PCC 7367]
 ref|YP_007103942.1| type 11 methyltransferase [Pseudanabaena sp. PCC 7367]
 gb|AFY71514.1| Methyltransferase type 11 [Pseudanabaena sp. PCC 7367]
Length=318

 Score =   237 bits (604),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 184/305 (60%), Gaps = 13/305 (4%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S+ V ++++  PL SL K  AR++ I  AE   +PWR++  E+   D+  E+  +QN +L
Sbjct  17    SKLVNSILAIGPLASLAKHQARKMMIERAEGMGVPWRKIVAELQAEDLDTELVQVQNSNL  76

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP YYL+ FHAY+ GNLSW AA E E A  A+  R    AN+  +A  ++R ++ D + 
Sbjct  77    KYPKYYLTSFHAYESGNLSWEAATEVEVAAYAVHSRIWKGANAQGDA--MLRQSYHDVLN  134

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKN---  864
             +          I +ILD+GCS+G+ST  LA  YP A +TGLDLSPYFLA+A ++ ++   
Sbjct  135   QQIAIQPD--QIHNILDVGCSVGMSTFALAQAYPEAKITGLDLSPYFLAIANYQTRHKHP  192

Query  865   --RDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGT  1038
               RDR T    W HA  E TGL   SFDL SI  V+HE P+ A R ++ E  R++RPGG 
Sbjct  193   EWRDRFT----WQHAAAEATGLADNSFDLASIFLVYHELPKTAAREILKEMHRVVRPGGY  248

Query  1039  FSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRH  1218
              ++ D +P S+   ++PP + TL+KSTEP+LD+Y+  D+      AGF         PRH
Sbjct  249   LTIMDMNPNSEIYAKMPPYILTLLKSTEPYLDQYFSLDMAHEFEAAGFERPTITCNSPRH  308

Query  1219  RTVTA  1233
             RT+ A
Sbjct  309   RTIVA  313



>ref|WP_012626190.1| methyltransferase type 11 [Cyanothece sp. PCC 7425]
 ref|YP_002481453.1| type 11 methyltransferase [Cyanothece sp. PCC 7425]
 gb|ACL43092.1| Methyltransferase type 11 [Cyanothece sp. PCC 7425]
Length=300

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 175/300 (58%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  L++ KPL ++ K  AR++ I  AE   +PW E    +   D   E+  +QN  L
Sbjct  9     SRLVSGLLAIKPLATVAKHQARKMIIQRAEAIGVPWTEQVAALQTHDWESELAQVQNPEL  68

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP YYL+ FHAY+ GNL W AA E E A  A+  R  P+        Q +R ++ D  +
Sbjct  69    VYPSYYLNSFHAYERGNLCWQAALEVEVAAQAVHARLWPEPTI--NGDQRLRQSYHDQFQ  126

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +  +          +LD+GC +G+ST  L + YP A +TG+DLSPYFLAVA ++ + R  
Sbjct  127   QFIQTTP-----HQVLDLGCGVGMSTFALHALYPQAEITGVDLSPYFLAVAHYQSRERQL  181

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
                P RW+HA  E TGLP  SFDLVS+  V HE P++A   ++ E+ RLLRP G  ++ D
Sbjct  182   ---PIRWVHAAAEATGLPESSFDLVSLCLVCHELPQQATWEILQEAHRLLRPEGYLTIMD  238

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S    ++P  + TL KSTEPFLDEY+  DLE  +++AGF ++      PRHR + A
Sbjct  239   MNPRSPIYAQMPTYVLTLQKSTEPFLDEYFTFDLEAAIQQAGFQSINVASNSPRHRALVA  298



>ref|WP_035150741.1| methyltransferase type 11 [Calothrix sp. 336/3]
 gb|KFB82446.1| methyltransferase type 11 [Calothrix sp. 336/3]
Length=306

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 185/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S+ V  +++ KP+  + K  ARQ+ I  AEK  + WR+  + + + +   E+  ++N  L
Sbjct  13    SQLVNGILAIKPIADIAKHQARQMMIKRAEKIGVAWRQEVETLKQHNWEGELAEVENPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL+ FHAY++GN+SW AA E E A  A+  +    A +  +A   +R ++   ++
Sbjct  73    NYPDYYLTSFHAYEKGNMSWDAAWEVEVAARAVHAKIWQGAGAKGDAK--LRYSYHHILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +  K        +DILD+GCS+G+ST  L + YP A LTG+DLSPYFLAVA ++ + R+ 
Sbjct  131   EQLKT-----PPQDILDLGCSVGMSTFALQALYPEAKLTGVDLSPYFLAVAHYQAQKREA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TGL S SFDLVSI  V HE P+   + +  E+ RLLRPGG  ++ D
Sbjct  186   NIN---WVHAAAETTGLQSSSFDLVSIFLVCHELPQIPTKQIFAEARRLLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PK++   ++PP + TL+KSTEP+LDEY+  D+++ + E GF         PRHRTV A
Sbjct  243   MNPKAEAFLKMPPYILTLLKSTEPYLDEYFSLDIQQALVEVGFHTPTITPNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_017317911.1| methyltransferase type 11 [Mastigocladopsis repens]
Length=306

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 182/302 (60%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SRFV  +++ KPL ++ K  ARQ+ I  AEK  + W +  + +   D   ++  +QN  L
Sbjct  13    SRFVNRVLAIKPLANIAKHQARQMMIKRAEKIGVNWLQEVQTLQARDWQSDLAKVQNPKL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YYL  FH Y++G+L W AA EAE A   +      +A +  +A   +R ++ D ++
Sbjct  73    SYPEYYLRSFHGYEKGDLCWEAALEAEVAAYTVHASIWSNAGAQGDAK--LRQSYHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             K           +DILD+GCS+G+S+  L   YP A +TGLDLSPYFLAVA ++ + R  
Sbjct  131   KQIPTEP-----QDILDLGCSVGMSSFALQKVYPHAKITGLDLSPYFLAVAHYRSQQRHA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   WIHA  E TGLP+ SFDL+SI  + HE P+ A   +  E+ RLLRPGG  ++ D
Sbjct  186   NIN---WIHATAESTGLPNASFDLISIFLMCHELPQSATWRIFAEARRLLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  +++PP + TL+KSTEP+LDEY+  D+E+ +  AGF         PRHRTV A
Sbjct  243   MNPKSEMYKKMPPYILTLLKSTEPYLDEYFALDIEQALLGAGFNTPTITPNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   YV  304



>ref|WP_007307752.1| methyltransferase type 11 [Crocosphaera watsonii]
 gb|EAM48473.1| similar to Methylase involved in ubiquinone/menaquinone biosynthesis 
[Crocosphaera watsonii WH 8501]
Length=306

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 184/300 (61%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR +  ++S KPL  L K  AR + I+ AEK  +PWR+  +++ + +  +E+ +++N +L
Sbjct  14    SRVINGILSVKPLAKLAKHQARNMIINRAEKIGVPWRDNVRQLSQHNWQEELANVENSNL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY+  FH YD GNLSW +A E E A  A+     PDA    +    +R N+   ++
Sbjct  74    VYPDYYVCSFHGYDSGNLSWESALEVESAAYAVHASIWPDAGV--KGDPRLRDNYHSILK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           + ILDIGCS+G+ST  L   YP+A LTGLDLS Y LAVA+++ + R+ 
Sbjct  132   QQL-----SLNPQTILDIGCSVGMSTFPLQEMYPNAKLTGLDLSAYHLAVARYRSQQRNL  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               +   W+HA  E+T LPS SFDLVS   ++HE P+ A   +  E+ RLL+PGG F++ D
Sbjct  187   DID---WVHAAAEETSLPSASFDLVSSFLLYHELPKTAAIAIFKEARRLLKPGGYFTMMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  Q++PP + TL+KSTEP+LD+Y+  D+E  + EAGF         PRHR + A
Sbjct  244   MNPRAEAFQKMPPYVLTLLKSTEPYLDQYFALDVETALTEAGFETPTITPVSPRHRAIVA  303



>ref|WP_007312806.1| methyltransferase type 11 [Crocosphaera watsonii]
 gb|EHJ10231.1| hypothetical protein CWATWH0003_5015 [Crocosphaera watsonii WH 
0003]
 emb|CCQ61977.1| hypothetical protein CWATWH0401_1495 [Crocosphaera watsonii WH 
0401]
 emb|CCQ69753.1| hypothetical protein CWATWH0402_609 [Crocosphaera watsonii WH 
0402]
Length=306

 Score =   234 bits (596),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 184/300 (61%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR +  ++S KPL  L K  AR + I+ AEK  +PWR+  +++ + +  +E+ +++N +L
Sbjct  14    SRVINGILSVKPLAKLAKHQARNMIINRAEKIGVPWRDNVRQLSQHNWQEELANVENSNL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY+  FH YD GNLSW +A E E A  A+     PDA    +    +R N+   ++
Sbjct  74    VYPDYYVCSFHGYDSGNLSWESALEVESAAYAVHASIWPDAGV--KGDPRLRDNYHSILK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           + ILDIGCS+G+ST  L   YP+A LTGLDLS Y LAVA+++ + R+ 
Sbjct  132   QQL-----SLNPQTILDIGCSVGMSTFPLQEMYPNAKLTGLDLSAYHLAVARYRSQQRNL  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               +   W+HA  E+T LPS SFDLVS   ++HE P+ A   +  E+ RLL+PGG F++ D
Sbjct  187   DID---WVHAAAEETNLPSASFDLVSSFLLYHELPKTAAIAIFKEARRLLKPGGYFTMMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  Q++PP + TL+KSTEP+LD+Y+  D+E  + EAGF         PRHR + A
Sbjct  244   MNPRAEAFQKMPPYVLTLLKSTEPYLDQYFALDVETALTEAGFETPTITPVSPRHRAIVA  303



>ref|WP_021830996.1| hypothetical protein [Crocosphaera watsonii]
 emb|CCQ51841.1| FIG00570720: hypothetical protein [Crocosphaera watsonii WH 8502]
Length=306

 Score =   234 bits (596),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 184/300 (61%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR +  ++S KPL  L K  AR + I+ AEK  +PWR+  +++ + +  +E+ +++N +L
Sbjct  14    SRVINGILSVKPLAKLAKHQARNMIINRAEKIGVPWRDNVRQLSQHNWQEELANVENSNL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY+  FH YD GNLSW +A E E A  A+     PDA    +    +R N+   ++
Sbjct  74    VYPDYYVCSFHGYDSGNLSWESALEVESAAYAVHASIWPDAGV--KGDPRLRDNYHSILK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           + ILDIGCS+G+ST  L   YP+A LTGLDLS Y LAVA+++ + R+ 
Sbjct  132   QQLSSNP-----QTILDIGCSVGMSTFPLQEMYPNAKLTGLDLSAYHLAVARYRSQQRNL  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               +   W+HA  E+T LPS SFDLVS   ++HE P+ A   +  E+ RLL+PGG F++ D
Sbjct  187   DID---WVHAAAEETNLPSASFDLVSSFLLYHELPKTAAIAIFKEARRLLKPGGYFTMMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  Q++PP + TL+KSTEP+LD+Y+  D+E  + EAGF         PRHR + A
Sbjct  244   MNPRAEAFQKMPPYVLTLLKSTEPYLDQYFALDVETALTEAGFETPTITPVSPRHRAIVA  303



>ref|WP_019507106.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=306

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 180/300 (60%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL S  K  AR + I  AE   +PWRE  + + + +   E+ +++N+ L
Sbjct  14    SRLVNGVLAIKPLASFAKNRARNMMIKRAEAIGVPWRENVQRLSDRNWDAELTAVENREL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YPDYY + FHAY+EGNLSW AA E E A  A+  +     +       ++R ++   +E
Sbjct  74    KYPDYYTTSFHAYEEGNLSWKAAWEVESAAYAVHAKIWSTGDP--SGDPMLRQSYHQVME  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +             ILD+GC +G+ST  L   YP A +TGLDLSPYFLAVAQ++ +   +
Sbjct  132   QKLD-----ITPATILDLGCGVGMSTFALQEIYPQAQVTGLDLSPYFLAVAQYRGQQNQK  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TGL   SFDLVS   +FHE P  A ++++ E+ RLLRPGG  ++ D
Sbjct  187   NIN---WVHAAAESTGLADASFDLVSACLMFHELPATAAQDIITEARRLLRPGGYLAIMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+   ++PP + TL+KSTEP+LD+Y+  D+++V  +AG       +  PRHRT+ A
Sbjct  244   MNPQSEIFLKMPPYILTLLKSTEPYLDQYFALDMKQVFSQAGLTIPSITVNSPRHRTIIA  303



>ref|WP_015215491.1| Methyltransferase type 11 [Anabaena cylindrica]
 ref|YP_007157778.1| Methyltransferase type 11 [Anabaena cylindrica PCC 7122]
 gb|AFZ58868.1| Methyltransferase type 11 [Anabaena cylindrica PCC 7122]
Length=306

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 183/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  ++S +PL +L K  ARQ+ I  AE+  + W +  +++   D   ++  +QN  L
Sbjct  13    SRLVNGILSIQPLANLAKHQARQMMIKRAERIGVFWTQEVEKLRSRDWSTDLAQVQNSQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY++ FHAY+ GNLSW AA E EPA  A+  +   D  +  +A   +R ++   +E
Sbjct  73    TYPDYYVTSFHAYETGNLSWQAAFEVEPAAHAVHAKIWQDTEAQGDAK--LRQSYHKILE  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 Q       +DILD+GCS+G+ST  L + YP A +TGLDLSPYFLAVA ++ +    
Sbjct  131   SSISQ-----PPQDILDLGCSVGMSTFALQAAYPQAKITGLDLSPYFLAVANYRSQQHQA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TGL   S+DLVSI  + HE P+ A + +  E+ R+LRPGG  ++ D
Sbjct  186   TIN---WVHAQAETTGLADASYDLVSIFLMCHELPQSATQKIFAEARRVLRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  +++P  + TL+KSTEP+LDEY+  D+E+ + +AGF         PRHRTV A
Sbjct  243   MNPKSEIYKKMPTYILTLLKSTEPYLDEYFSLDIEQALVKAGFQTPTITSNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_017744239.1| methyltransferase type 11 [Scytonema hofmanni]
Length=306

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 177/302 (59%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SRF+  +++ KPL +L K  ARQ+ I  AEK  + W +  + +   D  ++   +QN  +
Sbjct  13    SRFINGVLAIKPLANLAKHQARQMMIKRAEKIGVNWTQEVRTLQARDWTQDFAKVQNPQV  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL  FHAYD+G+L W   A  E    A  + A    N+  +    +R ++ + + 
Sbjct  73    TYPDYYLQSFHAYDQGDLCW--EAALEVEVAAQTVHATLWGNATVQGDAQLRQSYHNILA  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             K   +       + ILDIGCS+G+ST  L   YP A +TGLDLSPYFLAVA+++ + R  
Sbjct  131   KQLPKQP-----QAILDIGCSVGMSTFALQEIYPHAKITGLDLSPYFLAVAEYRSQQRSV  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               +   W+HA+ E T LPS SFD +S+  + HE P+ A R +  E+ RLLRPGG   + D
Sbjct  186   NID---WVHASAESTRLPSASFDFISMFLICHELPQVATRKIFAEAKRLLRPGGCIGIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  Q++P  + TL+KSTEP +DEY+  D+E+ + +AGF         PRHRTV A
Sbjct  243   MNPKSEVYQKMPTYIMTLLKSTEPLMDEYFSFDIEQALVDAGFNTPTITPNSPRHRTVIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>dbj|BAJ88688.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=267

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 148/174 (85%), Gaps = 3/174 (2%)
 Frame = +1

Query  286  EEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEIL  465
            +EG LERP WSGETP+SR V ALI+ KPLYSL+K+ +R+V I TAEK+NIPWREM K++L
Sbjct  44   QEGSLERPAWSGETPVSRLVAALIAIKPLYSLMKLASREVIIRTAEKSNIPWREMTKKVL  103

Query  466  ESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSL  645
            ESDVY+  E I++ ++ YPDYYLSPFHAYDEGNLSWLAAAEAE AT+++  RAIP+A ++
Sbjct  104  ESDVYEVFERIRDPNIVYPDYYLSPFHAYDEGNLSWLAAAEAEAATLSIAKRAIPEATTI  163

Query  646  DEASQVVRGNWLDAIEKHHKQYSG--CFAIRDILDIGCSIGVSTRCLASRYPSA  801
            +EA+++VRGNW++AIE+HH +YSG  C  I DILDIGCS+GVSTR LA ++PSA
Sbjct  164  EEANRIVRGNWMNAIEEHHLKYSGGNC-QINDILDIGCSVGVSTRYLAEKFPSA  216



>ref|WP_008276030.1| methyltransferase type 11 [Cyanothece sp. CCY0110]
 gb|EAZ90871.1| hypothetical protein CY0110_25611 [Cyanothece sp. CCY0110]
Length=307

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/302 (40%), Positives = 185/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR +  ++S KPL  L K  AR++ I+ AEK  +PWR+  +++   +  +E+E +QNQ+L
Sbjct  14    SRLINGILSIKPLAKLAKYQARKMIINRAEKIGVPWRDNVRQLQAHNWEEELEKVQNQNL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY+  FH Y+ GNLSW +A E E A  A+     P A    +    +R N+ + ++
Sbjct  74    IYPDYYVCSFHGYETGNLSWESALEVESAAYAVHASIWPSAGV--KGDPRLRHNYHEILK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           + ILDIGCS+G+ST  L   YP+A +TGLDLS Y LAVAQ++ + R+ 
Sbjct  132   QQL-----SLTPQTILDIGCSVGMSTFPLQELYPNAKVTGLDLSAYHLAVAQYRSQQRNL  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               +   W+H   E T LP+ SFDLVS   ++HE P+ A   +  E+ RLL+PGG F++ D
Sbjct  187   AID---WVHGAAERTNLPATSFDLVSAFLLYHELPQTAAIAIFKEARRLLKPGGYFTMMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  +++PP + TL+KSTEP+LD+Y+  D+E  + +AGF   +     PRHR + A
Sbjct  244   MNPRAEAYEKMPPYILTLLKSTEPYLDQYFALDVETALEKAGFDTPKITPISPRHRAIVA  303

Query  1234  TV  1239
              +
Sbjct  304   RI  305



>ref|WP_012161686.1| methyltransferase type 11 [Acaryochloris marina]
 ref|YP_001515446.1| methyltransferase [Acaryochloris marina MBIC11017]
 gb|ABW26132.1| methyltransferase, putative [Acaryochloris marina MBIC11017]
Length=307

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 182/305 (60%), Gaps = 14/305 (5%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILES--DVYK-EMESIQN  504
             SR V  L++ KPL +  K  AR++ I  AE   +PWR+ A  +++   DV++ E ++IQ 
Sbjct  13    SRVVNGLLAIKPLANFAKFQARKMMIERAESIGVPWRKRASSLMDRGLDVWEAERQAIQT  72

Query  505   QSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLD  684
               L+YP+YY+  FHAY+ GNLSW AA E E A+ A   R  P+A +  ++   +R ++  
Sbjct  73    PDLDYPNYYVVSFHAYESGNLSWEAATEVEVASYAAHARIWPEAGAKGDSR--LRQSYHA  130

Query  685   AIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKN  864
              +     Q     A +DILD+GCS+G+ST  L   YP A LTGLDLSPYFLA+A      
Sbjct  131   VM-----QEKIATAPKDILDMGCSVGLSTLALQETYPEARLTGLDLSPYFLAIANHNTPA  185

Query  865   RDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFS  1044
              D      +WIH   E+T LP  SFDLVSI  V HE P  AI N+  E+ RLLRP G  +
Sbjct  186   NDS----LQWIHRAAEETSLPDNSFDLVSICLVCHELPRTAICNIFAEAHRLLRPQGHLA  241

Query  1045  VTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRT  1224
             + D +P S   ++LPP + TL+KSTEP+LD+Y+  D+++   EAGF         PRHRT
Sbjct  242   IMDMNPNSDIHRKLPPYVLTLLKSTEPYLDDYFTFDIQQAFVEAGFQQPSLTCNSPRHRT  301

Query  1225  VTATV  1239
             + A V
Sbjct  302   LIAQV  306



>ref|WP_006276903.1| methyltransferase type 11 [Cylindrospermopsis raciborskii]
 gb|EFA70112.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=307

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/302 (40%), Positives = 181/302 (60%), Gaps = 7/302 (2%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S  V  ++S KPL+   K  AR + I  A+K  + W +  +++   D   ++  +QN  L
Sbjct  11    SNLVNRVLSIKPLFDFAKHQARDMMIKRAQKIGVNWHQEVEKLQARDWTNDLAQVQNPQL  70

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL+ FHAY+ GN+SW AA E E A  A+  +  PD   L +    +R ++   ++
Sbjct  71    TYPDYYLTSFHAYETGNMSWQAAFEVESAAYAVHAKVWPDL--LADGDAKLRQSYHHILK  128

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 Q       +DILD+GCS+G+ST  L + YP + +TGLDLSPYFLAVA ++ +   +
Sbjct  129   TFITQ-----TPKDILDLGCSVGMSTFALQAIYPQSQITGLDLSPYFLAVANYRSQQSPQ  183

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TG+P  S+DLVSI  + HE P+ A + +  E+ R+LRPGG  ++ D
Sbjct  184   YQNSINWLHAAAESTGMPDNSYDLVSIFLMCHELPQSAAQKIFVEARRVLRPGGHLTIMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S+  +++P  +FTL+KSTEP+LD+Y+  D+E+ + +AGF         PRHRTV  
Sbjct  244   MNPQSEIYKKMPTYVFTLLKSTEPYLDDYFTLDMEKSLIDAGFKTPTMTSNSPRHRTVIT  303

Query  1234  TV  1239
              V
Sbjct  304   QV  305



>ref|WP_036008702.1| methyltransferase type 11 [Leptolyngbya sp. JSC-1]
Length=313

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/310 (41%), Positives = 185/310 (60%), Gaps = 18/310 (6%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVY--------KEM  489
             S+ +  +++ KPL  + K  AR + I  AE   + WR+  + +   +           E+
Sbjct  13    SQLINGILAVKPLAQMAKHQARTMMIKRAESIGVYWRQEVQALRSRNGQCEFSPAWEAEL  72

Query  490   ESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVR  669
             + I+   L YPDYYL+ FHAYD+GNLSW AA E E A  A+  R  P+A +  +A  ++R
Sbjct  73    KQIEAVDLVYPDYYLTSFHAYDQGNLSWDAALEVEVAAHAVHARIWPEAGTQGDA--LLR  130

Query  670   GNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
              ++   +++           RDI+D+GCS+G+ST  L + YP A +TG+DLSPYFL VAQ
Sbjct  131   QSFHQVLQQQIANPP-----RDIVDLGCSVGMSTFALQAVYPQARITGVDLSPYFLTVAQ  185

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ K   ++  P  W+HA  E TGLP+ SFDLVS   VFHE P+ A   ++NE+ RLLRP
Sbjct  186   YRSK---QQAIPVTWVHAAAEATGLPNASFDLVSAHLVFHELPQTAAIAILNEARRLLRP  242

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P S    ++ P + TL+KSTEP+LD+Y+  +LE+ +  AGF     V   
Sbjct  243   GGYLAIMDMNPNSDVFVKMRPYVLTLLKSTEPYLDQYFALELEQAIYAAGFTKPTVVCNS  302

Query  1210  PRHRTVTATV  1239
             PRHRT+ A V
Sbjct  303   PRHRTLVAQV  312



>ref|WP_009556100.1| methylase involved in ubiquinone/menaquinone biosynthesis [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ69188.1| methylase involved in ubiquinone/menaquinone biosynthesis [Oscillatoriales 
cyanobacterium JSC-12]
Length=319

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 181/315 (57%), Gaps = 22/315 (7%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL  L K  ARQ+ I  A+   +PW      +      +++ +++N +L
Sbjct  12    SRVVNGILAIKPLAKLAKNRARQMMIKRADSIGVPWLAEVAALKTRSWSEDLAAVENPNL  71

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL+ FHAY+EGNL W  A E E A  A+  R   DA +  +         L   +
Sbjct  72    TYPDYYLTSFHAYEEGNLGWEPALEVEVAAHAVHARIWQDAGANGD---------LQLRQ  122

Query  694   KHHKQYSGCFAI--RDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNR  867
              +H        I   DI+D+GCS+G+ST  L + +P+ANLTG+DLSPYFLAVA+++   R
Sbjct  123   SYHACLKPQLVIEPHDIVDLGCSVGMSTFALQATFPNANLTGVDLSPYFLAVAKYRTDMR  182

Query  868   -----------DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESF  1014
                        D   +   W+HA  E TGLP+ S+DLVS   +FHE P+ A   V  E+ 
Sbjct  183   ATGNGTRLQGTDATASTPSWVHAAAEATGLPNASYDLVSACLLFHELPQAAAIAVFQEAR  242

Query  1015  RLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQ  1194
             RLLRPGG F+  D +P+S+   ++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF    
Sbjct  243   RLLRPGGYFAFMDMNPQSEVYAKMPPYILTLLKSTEPYLDQYFALDVEQALMEAGFERPT  302

Query  1195  SVLTDPRHRTVTATV  1239
                  PRHRTV A +
Sbjct  303   ITPNSPRHRTVVARI  317



>ref|WP_039713026.1| methyltransferase type 11 [Scytonema millei]
 gb|KIF20666.1| methyltransferase type 11 [Scytonema millei VB511283]
Length=307

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/304 (40%), Positives = 182/304 (60%), Gaps = 9/304 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L K  ARQ+ +  AEK  +PW ++ +E+   +     + I N  L
Sbjct  13    SRLVNTVLAIKPLANLAKHQARQMMVKRAEKIGVPWTKIVRELRSQEWESHWQQIYNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP+YY   FHAY++GNLSW AA E E A  A+      DA +  +A   +R ++ + ++
Sbjct  73    QYPEYYCCSFHAYEQGNLSWDAAFEVEVAARAVHAGIWSDAGAAGDAK--LRQSYHEIVK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 +     + + ILD+GCS+G+ST  L + YP A +TGLDLSPYFLAVA   ++++ +
Sbjct  131   SQLPK-----SPQAILDVGCSVGMSTFALKALYPQAKITGLDLSPYFLAVAH--QRSQQQ  183

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
                   W+HA  E TGLP  ++DLVSI  V HE P+ A R ++ E  RLLRPGG  ++ D
Sbjct  184   NLTEIEWVHAAAEATGLPEANYDLVSIFLVCHELPQSATRQILQEMQRLLRPGGYLAIMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S    ++PP + TL+KSTEP+LDEY+  D+ + +   GF         PRHRT+ A
Sbjct  244   MNPQSAIYAQMPPYILTLLKSTEPYLDEYFTLDIAQAIVAVGFHPPTITCNSPRHRTIVA  303

Query  1234  TVPY  1245
              V +
Sbjct  304   QVKH  307



>ref|WP_017299303.1| hypothetical protein [Nodosilinea nodulosa]
Length=337

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 127/325 (39%), Positives = 188/325 (58%), Gaps = 34/325 (10%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAK----------EILESDVY  480
             LS  V  +++ KPL++  K  AR + ++ AE   +PWRE  +          +I +S   
Sbjct  10    LSSVVNQVLAIKPLWTFAKGRARAMMVTRAETIGVPWRERVQALRSRRTATGQIAQSPST  69

Query  481   KE-----------MESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAI  627
             +E           ++++QN +L YPDYY + FHAYDEGNL W  A E E A+ A+  +  
Sbjct  70    EEAGALSPLWQADLDAVQNPNLIYPDYYTTSFHAYDEGNLGWKPAMEVEVASQAVHAKIW  129

Query  628   PDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANL  807
             P+A +  +  + +R ++ D +  H  Q        DI+DIGC +G+ST    + +P A L
Sbjct  130   PEAGAAGD--ERLRQSYHDVLTAHLPQPPA-----DIVDIGCGVGLSTEAFQTTFPQARL  182

Query  808   TGLDLSPYFLAVAQFKEKNRDRK------TNPTRWIHANGEDTGLPSKSFDLVSISYVFH  969
             TG+DLSPYFLAVA+++++ R         T P  W HA GE TGLP+ S+DLVS   V H
Sbjct  183   TGVDLSPYFLAVARYRQQERRENGEMASPTLPIAWHHAAGEATGLPAASYDLVSACLVLH  242

Query  970   ECPERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLT  1149
             E P+   + ++ E+ RLLRPGG  ++ D +P+S  +++LPP + TL+KSTEP+LD+Y+  
Sbjct  243   ELPQSVSQAILREARRLLRPGGHLAIMDMNPRSPAIEKLPPFVLTLLKSTEPYLDDYFTL  302

Query  1150  DLERVMREAGFVNVQSVLTDPRHRT  1224
             DLE     AGF   +     PRHRT
Sbjct  303   DLEAAFVAAGFERPRVAFNSPRHRT  327



>ref|WP_015954613.1| methyltransferase type 11 [Cyanothece sp. PCC 7424]
 ref|YP_002377878.1| type 11 methyltransferase [Cyanothece sp. PCC 7424]
 gb|ACK71010.1| Methyltransferase type 11 [Cyanothece sp. PCC 7424]
Length=311

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 182/305 (60%), Gaps = 15/305 (5%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             +S  +  +++ KPL +L K  AR++ I  AEK  +PWRE  +++   D  KE  +I+N  
Sbjct  13    ISSLINGILAIKPLANLAKHQAREMMIKRAEKLGVPWRENVQKLRSHDWEKERLAIENPQ  72

Query  511   LEYPDYYLSPFHAYDEGNLSW--LaaaeaepatmameLRAIPDANSLDEASQVVRGNWLD  684
             + YPDYY+  FH Y+ G+L W      E+   T+   +    D  S+   S++ R N+  
Sbjct  73    VTYPDYYVRSFHGYEMGDLCWEAALEFESAAYTVHSTIWQKTDGISIKGDSRL-RQNY--  129

Query  685   AIEKHHKQYSGCFAI--RDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKE  858
                  H+      +I  +DILD+GCSIG+ST  +A  YP A +TG+DLSPYFLAVA ++ 
Sbjct  130   -----HQVLLEQLSIQPKDILDVGCSIGMSTFAIAQAYPQAQITGIDLSPYFLAVANYRS  184

Query  859   KNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGT  1038
             + ++    P  W+H   E TGLP  SFDLVS   +FHE P++A + +  E+ RLLR GG 
Sbjct  185   QTQNI---PINWVHTAAEATGLPDNSFDLVSAFLIFHELPQKAAKEIFREARRLLRKGGY  241

Query  1039  FSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRH  1218
             F++ D +P S+  + +PP +FTL+KSTEP LDEY+  D++  + EAGF +       PRH
Sbjct  242   FAMMDMNPDSQAYKTMPPYVFTLLKSTEPHLDEYFTLDVQTALIEAGFHSPTITPISPRH  301

Query  1219  RTVTA  1233
             RT+ A
Sbjct  302   RTIIA  306



>ref|WP_011612473.1| methyltransferase type 11 [Trichodesmium erythraeum]
 ref|YP_722590.1| type 11 methyltransferase [Trichodesmium erythraeum IMS101]
 gb|ABG52117.1| Methyltransferase type 11 [Trichodesmium erythraeum IMS101]
Length=304

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 188/302 (62%), Gaps = 11/302 (4%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             ++ V  ++S KPL +  K  AR++ I  AEK  IPWR+  KE+ + +  +E + + N +L
Sbjct  13    TKLVNGILSIKPLANFAKTQARKMIIKRAEKIGIPWRQQVKELSKHNWDREWKVVNNPNL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP YYL+ FHAY++GN+SW AA E E A++A+     P+     +A   +R ++LD ++
Sbjct  73    GYPKYYLTSFHAYEKGNMSWQAATEVEVASLAVHAGIWPEEGIGGDAR--LRQSFLDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                   +     +D+LD+GCS+G++T  L   +P A  TG+DLSPYFLAVA ++ + ++ 
Sbjct  131   ------AEISTPKDVLDLGCSVGLNTFPLQKLFPEAQFTGVDLSPYFLAVALYRSQQQNL  184

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+HA  E TGLP  SFDL+SI  V HE P+ A R +  E+ RLLR  GT ++ D
Sbjct  185   DIN---WVHAAAEATGLPDDSFDLISIFLVCHELPQFATRKIFREARRLLRSNGTIAIMD  241

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+    + P +FTL+KSTEP+LDEY+  D+ER + +AGF   + +    RHRT+ A
Sbjct  242   MNPKSEVYTTMDPHIFTLLKSTEPYLDEYFTLDIERELVDAGFEPPKIICNTHRHRTIIA  301

Query  1234  TV  1239
              V
Sbjct  302   IV  303



>ref|WP_015202475.1| type 11 methyltransferase [Crinalium epipsammum]
 ref|YP_007141863.1| type 11 methyltransferase [Crinalium epipsammum PCC 9333]
 gb|AFZ12353.1| Methyltransferase type 11 [Crinalium epipsammum PCC 9333]
Length=305

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 176/302 (58%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S+ V  L+S KPL +L K  AR + I  AEK  + WR+  +++ + D  K +  ++N  L
Sbjct  13    SKLVNGLLSVKPLANLAKQQARTMMIKRAEKIGVYWRQEVEDLQKLDWDKYLAEVKNPDL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YYL  FHAYDEGNL W  A E   A  A+       A +  E    +R ++ + ++
Sbjct  73    TYPEYYLRTFHAYDEGNLGWHPALEVSVAARAVHAGIWQGAGA--EGDAKLRESYHEVLK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 Q  G     DILD+GCS+G+ST  L   YP AN+TGLDLSPYFLAVA +  +    
Sbjct  131   SSLAQAPG-----DILDVGCSVGMSTFALQELYPQANITGLDLSPYFLAVANYNSQQCHA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W++A  E+T LP  SFDLVS   V HE P+ A + +  E  RLLRP G  S+ D
Sbjct  186   NIN---WVNAAAENTNLPEASFDLVSTFLVHHELPQFASKEIFCEMRRLLRPNGYISIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+   ++PP + TL+KSTEP+LDEY+  D+E+ + +AGF         PRHRT+ A
Sbjct  243   MNPKSEIYSKMPPYILTLLKSTEPYLDEYFSLDIEQALIDAGFNKPIITCNSPRHRTIIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_028089869.1| methyltransferase type 11 [Dolichospermum circinale]
Length=308

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 181/315 (57%), Gaps = 34/315 (11%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SRF+  +++ KPL +L K  ARQ+ I  AEK  +PW +  +++ + D  K++  ++N  +
Sbjct  13    SRFINGILAIKPLANLAKHQARQMMIKRAEKIGVPWTQEVEKLQQRDWVKDLSKVENPQI  72

Query  514   E--YPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGN-WLD  684
             +  YP+YYL  FHAY++GNL W                  P A  L+ A++ V  + W +
Sbjct  73    QINYPEYYLRTFHAYEQGNLGW------------------PAAFELEVAARTVHASIWTE  114

Query  685   AIE----KHHKQYSGCFAIR------DILDIGCSIGVSTRCLASRYPSANLTGLDLSPYF  834
             A      K  + Y      +      +ILD+GC++G+ST  L + YP A +TGLDLSPYF
Sbjct  115   AGSQGDTKLRQSYHNILKEKIDSQPQNILDLGCAVGLSTFALQAAYPQAKITGLDLSPYF  174

Query  835   LAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESF  1014
             LAVA ++ +    + N   W+HA  E TG    +FDLVSI  + HE P+ A   +  E+ 
Sbjct  175   LAVANYRSQEHQTQIN---WVHAQAESTGFTDATFDLVSIFLMCHELPQSATHIIFTEAR  231

Query  1015  RLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQ  1194
             R+L PGG  ++ D +PK++  +++PP + TL+KSTEP+LDEY+  D+E+ + +AGF    
Sbjct  232   RILSPGGHLAIMDMNPKAENYKKMPPYILTLLKSTEPYLDEYFSLDIEQALIKAGFNAPT  291

Query  1195  SVLTDPRHRTVTATV  1239
                  PRHRTV A V
Sbjct  292   ITSNSPRHRTVIAQV  306



>ref|WP_015166964.1| methylase [Synechococcus sp. PCC 7502]
 ref|YP_007104440.1| methylase [Synechococcus sp. PCC 7502]
 gb|AFY72305.1| methylase involved in ubiquinone/menaquinone biosynthesis [Synechococcus 
sp. PCC 7502]
Length=302

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 180/301 (60%), Gaps = 9/301 (3%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             ++  V  L+S KPL S  K  ARQ+ I  A      W++M   +   D+  +   ++N  
Sbjct  8     MTGLVNGLLSIKPLASFAKQKARQMMIDRAALIGFSWQDMVNNLRSQDLEAKRTKLENPR  67

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAI  690
             LEYPDYY+ PFHAY +GNL W AA+E E A  A+  R     N   +A  ++R ++ D +
Sbjct  68    LEYPDYYIRPFHAYSDGNLGWDAASEVEVAAYAVHSRVWGATNPKGDA--LLRQSYHDLV  125

Query  691   EKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRD  870
             ++  +      A +DILD+GCS+G+ST  LA+ YP A +TGLDLSPYFLA+A     + +
Sbjct  126   KERVQ------APKDILDLGCSVGMSTLALAAIYPDAKITGLDLSPYFLAIADHNISHSN  179

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
             +  N    +HA  E TGL   SFDL+SI  V HE P+ A  N++ E+ RLLRP G  ++ 
Sbjct  180   KSEN-INLVHAAAESTGLADHSFDLISIFLVCHELPQGATLNILKEAKRLLRPQGHLAIM  238

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +P+S+   ++PP + TL+KSTEP+LD+Y+  DLE  +   GF ++      PRHRTV 
Sbjct  239   DMNPQSEIYAKMPPYILTLLKSTEPYLDQYFSLDLESAIASCGFKHITITANSPRHRTVM  298

Query  1231  A  1233
             A
Sbjct  299   A  299



>ref|WP_017715750.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=305

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 179/302 (59%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S+ V  ++S KPL  L K  AR + I  AE+  + WR+ A+ + E D+  ++  + N  L
Sbjct  13    SQVVNRILSIKPLAKLAKSQARNMMIERAERIGVHWRQEAQALRERDLEAQLAKVLNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YY+  FHAY++GNLSW AA E E A  A+     P+A +  +A  ++R ++ D + 
Sbjct  73    IYPEYYVCSFHAYEKGNLSWEAATEVEVAAHAVHATIWPNAGAQGDA--MLRKSYHDILN  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                   S   A RDI D+GCS+G+ST  L   YP A LTG+DLSPYFLA+A  + + R+ 
Sbjct  131   A-----SLPVAPRDIADLGCSVGMSTFALQEVYPDAKLTGVDLSPYFLAIANLRSQERNA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
                   W HA  E TGLP+ SFDLVSI  + HE P+ A R +  E+ RLLRP G  ++ D
Sbjct  186   DIT---WRHAPAESTGLPAASFDLVSIFLMCHELPQAATREIFREARRLLRPNGHIAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PK+    ++PP + TL+KSTEP++DEY+  D+E  +  AGF          RHRT+ A
Sbjct  243   MNPKADAYMKMPPYILTLLKSTEPYIDEYFTLDMEEALVGAGFEKPVITPNSRRHRTIIA  302

Query  1234  TV  1239
              V
Sbjct  303   KV  304



>ref|XP_005846678.1| hypothetical protein CHLNCDRAFT_35970 [Chlorella variabilis]
 gb|EFN54576.1| hypothetical protein CHLNCDRAFT_35970 [Chlorella variabilis]
Length=362

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 187/317 (59%), Gaps = 11/317 (3%)
 Frame = +1

Query  304   RPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESD---  474
             +P W+G+  +SR V  +I   PL+ +LK GAR     TAE+  +PW++   E+  S    
Sbjct  44    KPSWAGDDLVSRLVNVVID-SPLFGVLKEGARNRIKQTAERRGVPWQQRVYELEHSQPHV  102

Query  475   -VYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLR--AIPDANSL  645
              V+   E I+++ L+YP YY   FH YDEGNLSWLAA EAEPAT  M L   A  +A   
Sbjct  103   QVFAIKEEIEDKELQYPAYYTRAFHGYDEGNLSWLAALEAEPATDVMALLPWAKAEAQLT  162

Query  646   DEASQV-VRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDL  822
               A+Q  +R   L  I K+     G    RDILD GCS+G+ TR LA  YPSA++TGLDL
Sbjct  163   GPAAQARLRSTTLTTIRKYAAD-RGLKEPRDILDAGCSVGICTRWLAGEYPSASVTGLDL  221

Query  823   SPYFLAVAQFKEKNRDRKTNPTR--WIHANGEDTGLPSKSFDLVSISYVFHECPERAIRN  996
             SPY LA A          +   R  + H+  E +GLPS+S DLV++ +V HECP   I  
Sbjct  222   SPYMLAAAAVGADAVPGASRRRRIAYRHSRLEASGLPSRSQDLVAVQFVIHECPADIISQ  281

Query  997   VVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREA  1176
             ++ ES RLLRPGG  +  D +P S   + +PP + TLMK+TEP+ DEYY   LE  M +A
Sbjct  282   MIQESKRLLRPGGVLAFVDINPNSATGRRMPPAVATLMKATEPWTDEYYFYPLEESMGKA  341

Query  1177  GFVNVQSVLTDPRHRTV  1227
             GF +V+    DPRHR +
Sbjct  342   GFKHVECSELDPRHRII  358



>ref|WP_009628996.1| Methyltransferase type 11 [Pseudanabaena biceps]
 gb|ELS30939.1| Methyltransferase type 11 [Pseudanabaena biceps PCC 7429]
Length=315

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 184/305 (60%), Gaps = 9/305 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++  PL++L K  AR++ I  AE   + WR++  ++ + D+  E+  +QN +L
Sbjct  16    SRIVNGILAIAPLFNLAKQRARKMMIERAESMGVNWRQIVADLQKQDLEAELVKVQNPNL  75

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP+YYL  FHAY+EGNL WL A E E A  A+  R   D     +    +R ++LD ++
Sbjct  76    KYPEYYLKHFHAYEEGNLGWLPATEVEVAAYAVHSRIWNDDKPPVQGDARLRQSYLDIVK  135

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +         A ++ILDIGCS+G+ST  L   YP A +TGLDLSP+FLA+A +    +  
Sbjct  136   EKMP------APQNILDIGCSVGMSTFSLHENYPLAKITGLDLSPHFLAIANYNTNLKYP  189

Query  874   K---TNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFS  1044
             +       +WIH+  E+  LP  SFD VS   +FHE P+ A R ++ E  R+L+P G F+
Sbjct  190   QLIEKGQIQWIHSTAENISLPDASFDFVSCFLLFHELPQDATRQILREIRRVLQPNGYFA  249

Query  1045  VTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRT  1224
             + D +P+S   Q++PP + TL+KSTEP+LD+Y+  +L + +  AGF +   +   PRHRT
Sbjct  250   MMDMNPQSDIYQKMPPYILTLLKSTEPYLDQYFSFNLAQELVTAGFASPTIIANSPRHRT  309

Query  1225  VTATV  1239
             V A V
Sbjct  310   VIARV  314



>ref|WP_028954313.1| methyltransferase type 11 [Synechocystis sp. PCC 7509]
Length=305

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 176/300 (59%), Gaps = 10/300 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +L K  ARQ+ I  AEK  +PW +  +E+   D   ++  +QN  +
Sbjct  13    SRLVNRVLAIKPLANLAKHQARQMMIKRAEKIGVPWTKRVQELKTRDWETDLAQVQNPQI  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYYL  FHAY++GNL+W   A  E    A  + A     S  +  +++R ++ + I 
Sbjct  73    AYPDYYLKSFHAYEQGNLNW--EAALEVEVAAHAVHAGIWKESGAKGDRLLRSSYHEIIT  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +           + ILD+GCS+G+ST  L   YP A +TGLDLSPYFLAVA++    RD 
Sbjct  131   REIPTTP-----QTILDLGCSVGMSTFALQEVYPHAAITGLDLSPYFLAVAKYSALERDT  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               N   W+H+  E T L + SFDLV+   +FHE P+ A   +  E+ RLL+PGG  ++ D
Sbjct  186   NIN---WVHSTAEATPLAANSFDLVTSFLMFHELPQSATGQIFQEAQRLLKPGGYLTIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+   ++PP + TL+KSTEP+LD+Y+  D+E  +  AGF     V   PRHRT+ A
Sbjct  243   MNPKSEIYAKMPPYILTLLKSTEPYLDDYFSLDIESALAAAGFATPTIVSNTPRHRTIIA  302



>ref|WP_027403064.1| methyltransferase type 11 [Aphanizomenon flos-aquae]
Length=306

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 183/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SRFV ++++ KP+ +L K  ARQ+ I  AEK  + W +  +++   D   ++  +QN  L
Sbjct  13    SRFVNSILAIKPVANLAKHRARQMMIKRAEKIGVFWTKEVEKLQTRDWGSDLAQVQNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY++ FHAY+ GNLSW AA E E A  A+  R      +  +A   +R ++ D ++
Sbjct  73    NYPDYYVTSFHAYETGNLSWQAAFEVESAAHAVHSRIWQKPENQGDAK--LRQSFHDILK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                   S     +D++D+GCS+G+ST  L + YP A +TGLDLSPYFLAVA ++ + R  
Sbjct  131   N-----SISEQPQDVIDLGCSVGISTFALQAVYPHAKITGLDLSPYFLAVANYRSQERQT  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             + N   W+H+  E TG+   SFDL SI  + HE P+ A   +  E+ R+LRPGG  ++ D
Sbjct  186   QIN---WVHSQAESTGIADASFDLASIFLMCHELPQSATHQIFAEARRILRPGGHLAIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +PKS+  +++P  + TL+KSTEP+LDEY+  D+E+ +  AGF         PRHRT+ A
Sbjct  243   MNPKSEIYKKMPTYILTLLKSTEPYLDEYFSLDIEQALIGAGFQAPSITSNSPRHRTIIA  302

Query  1234  TV  1239
              V
Sbjct  303   QV  304



>ref|WP_015157482.1| type 11 methyltransferase [Chroococcidiopsis thermalis]
 ref|YP_007094814.1| type 11 methyltransferase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY90945.1| Methyltransferase type 11 [Chroococcidiopsis thermalis PCC 7203]
Length=307

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 183/305 (60%), Gaps = 15/305 (5%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ +PL +L K  ARQ+ +  AEK  +PW +  +E+   +     + + N  L
Sbjct  13    SRLVNTVLAIQPLANLAKHQARQMMVKRAEKIGVPWTKTVRELRSQEWESHWQQVYNPQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP+YY   FHAY++GNLSW AA E E A  A+      +A +  +A   +R ++ + ++
Sbjct  73    QYPEYYCCSFHAYEQGNLSWDAAFEVEVAARAVHAGIWSNAGAAGDAQ--LRQSYHEIVK  130

Query  694   K---HHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKN  864
                 H+ Q         ILD+GCS+G+ST  L + YP A +TGLDLSPYFLAVA   +++
Sbjct  131   SQLPHNPQ--------AILDVGCSVGMSTFALKALYPQAKITGLDLSPYFLAVAH--QRS  180

Query  865   RDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFS  1044
             + +  +   W+HA  E TGLP  ++DLVSI  V HE P+ A R ++ E  RLLRPGG  +
Sbjct  181   QQQNQSEIEWVHAAAEATGLPEANYDLVSIFLVCHELPQSATRQILQEMQRLLRPGGYLA  240

Query  1045  VTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRT  1224
             + D +P+S+   ++PP + TL+KSTEP+LDEY+  D+ + +  AGF         PRHRT
Sbjct  241   IMDMNPQSEIYAQMPPYILTLLKSTEPYLDEYFTLDIAQAIVAAGFHPPTITCNSPRHRT  300

Query  1225  VTATV  1239
             + + V
Sbjct  301   IVSQV  305



>ref|WP_028083080.1| methyltransferase type 11 [Dolichospermum circinale]
Length=308

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 181/315 (57%), Gaps = 34/315 (11%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR +  +++ KPL +L K  ARQ+ I  AEK  +PW +  +++ + D  K++  ++N  +
Sbjct  13    SRCINGILAIKPLANLAKHQARQMMIKRAEKIGVPWTQEVEKLQQRDWVKDLSKVENPQI  72

Query  514   E--YPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGN-WLD  684
             +  YP+YYL  FHAY++GNL W                  P A  L+ A++ V  + W +
Sbjct  73    QINYPEYYLRTFHAYEQGNLGW------------------PAAFELEVAARTVHASIWTE  114

Query  685   AIE----KHHKQYSGCFAIR------DILDIGCSIGVSTRCLASRYPSANLTGLDLSPYF  834
             A      K  + Y      +      +ILD+GC++G+ST  L + YP A +TGLDLSPYF
Sbjct  115   AGSEGDTKLRQSYHNILKEKIDSQPQNILDLGCAVGLSTFALQAAYPQAKITGLDLSPYF  174

Query  835   LAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESF  1014
             LAVA ++ +    + N   W+HA  E TG    +FDLVSI  + HE P+ A   +  E+ 
Sbjct  175   LAVANYRSQEHQTQIN---WVHAQAESTGFTDATFDLVSIFLMCHELPQSATYRIFTEAR  231

Query  1015  RLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQ  1194
             R+LRPGG  ++ D +PK++  +++PP + TL+KSTEP+LDEY+  D+E+ + +AGF    
Sbjct  232   RILRPGGHLAIMDINPKAENYKKMPPYILTLLKSTEPYLDEYFSLDIEQALIKAGFNAPT  291

Query  1195  SVLTDPRHRTVTATV  1239
                  PRHRTV A V
Sbjct  292   ITSNSPRHRTVIAQV  306



>dbj|GAL92902.1| hypothetical protein N44_01589 [Microcystis aeruginosa NIES-44]
Length=308

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 185/310 (60%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  +++ KPL+ + +  AR + I  AEK  +PWRE  K+  + D  +E+++++N 
Sbjct  12    PVSGLVNRILAIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSRELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGMDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+ER + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIERALVEAGFQTPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_024750299.1| methyltransferase type 11 [Cyanothece sp. ATCC 51472]
Length=307

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 183/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR +  ++S KPL  L K  AR + I+ AEK  +PWR+  +++   +  +E+E +QN +L
Sbjct  14    SRVINGILSVKPLAKLAKYQARNMIINRAEKIGVPWRDNVRQLSNHNWEEELEKVQNPNL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY+  FH Y+ GNLSW +A E E A  A+     P A         +R N+ + ++
Sbjct  74    VYPDYYVCSFHGYETGNLSWESALEVESAAYAVHASIWPGAGV--NGDPRLRHNYHEILK  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +   Q S     + ILD+GCS+G+ST  L + YP A +TGLDLS Y LAVA ++ + R+ 
Sbjct  132   Q---QLSST--PQRILDMGCSVGMSTFPLQAMYPDAKVTGLDLSAYHLAVAHYRSQERNL  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               +   W+H   E T LP  SFDLVS   ++HE P+ A   +  E+ RLL+PGG F++ D
Sbjct  187   AID---WVHGAAEATNLPETSFDLVSAFLLYHELPQTAAIAIFKEARRLLKPGGYFTMMD  243

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  Q++PP + TL+KSTEP+LD+Y+  D+E  ++EAGF   +     PRHR + A
Sbjct  244   MNPRAEAYQKMPPYILTLLKSTEPYLDQYFALDIETALQEAGFNPPKITPISPRHRAIVA  303

Query  1234  TV  1239
              V
Sbjct  304   RV  305



>gb|AFW68876.1| hypothetical protein ZEAMMB73_796332 [Zea mays]
Length=172

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 132/173 (76%), Gaps = 7/173 (4%)
 Frame = +1

Query  619   RAIPDANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPS  798
             RAIP+A S++EA+Q+VRGNWL+ IE+HH +YSG   + DILDIGCS+GVSTR LA ++PS
Sbjct  6     RAIPEATSIEEANQIVRGNWLNVIEEHHLKYSGNCQVNDILDIGCSVGVSTRYLAEKFPS  65

Query  799   ANLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECP  978
             A   GLDLSPYFLAVA  KE+   R   P RW+HANGE TGL S SFDLVS++YV HECP
Sbjct  66    AQAVGLDLSPYFLAVAAQKEEKLSRP-KPIRWVHANGEATGLSSDSFDLVSLAYVCHECP  124

Query  979   ERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDE  1137
              RAI  +V E+FR+LRPGGT ++TDNSPKSK LQ        L +S+ P+LD+
Sbjct  125   ARAITGLVKEAFRVLRPGGTIALTDNSPKSKVLQ------VKLQQSSAPYLDD  171



>ref|WP_037224344.1| methyltransferase type 11 [Richelia intracellularis]
Length=306

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 181/302 (60%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S+ V  +++ KPL +  K  ARQ+ I  AE   + W +  +++       +   +QN  +
Sbjct  13    SQLVNGILAIKPLANFAKHQARQMIIKRAENIGVHWTQEVEKLKARSWNSDFAQVQNPQV  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP+YYL PFHAY++ NLSW AA E E A  A+  +   +A    +A   +R ++ D ++
Sbjct  73    SYPEYYLKPFHAYEKSNLSWEAALEVEVAAKAVHAKIWQEAGINGDAQ--LRQSYHDVVK  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                       + +DI+D+GCS+G+ST  L + YP A +TG+DLSPYFLAVA ++ + R  
Sbjct  131   AQIPD-----SPKDIIDLGCSVGMSTFALQAVYPQAQITGVDLSPYFLAVAHYRTQQRQA  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
             K N   W+HA  E TG+   SFDL S+  + HE P+ A R +  E  RLLRPGG  ++ D
Sbjct  186   KIN---WVHAAAESTGIADNSFDLGSMCLICHELPQSATRQIFTEVRRLLRPGGHLTIMD  242

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  +++PP +FTL+KSTEP+LD+Y+  D+ + + EAGF +       PRHRT+ A
Sbjct  243   MNPQAEAYKKMPPYVFTLLKSTEPYLDDYFTLDIAQTLVEAGFNSPTITPNSPRHRTIIA  302

Query  1234  TV  1239
              V
Sbjct  303   RV  304



>ref|WP_008315062.1| methylase involved in ubiquinone/menaquinone biosynthesis [Leptolyngbya 
sp. PCC 6406]
Length=351

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 186/332 (56%), Gaps = 35/332 (11%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEME------  492
             ++  V  +++ KPL  L K  AR + +  AE   + WR+  K++       E +      
Sbjct  15    MNGLVNGVLAIKPLADLAKSRARTMMMDRAESIGVYWRDEVKQLRSRQTDAEFDPAWADT  74

Query  493   --SIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVV  666
               ++QN  L YP+YY++ FHAY EGNL WL A E E A  A+  R  P+A +  ++   +
Sbjct  75    LAAVQNPELAYPNYYVTSFHAYPEGNLGWLPALEVEVAAKAVHARIWPEAGAAGDSR--L  132

Query  667   RGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVA  846
             R ++ D ++ H +       +R I D+GC +G+ST  L + +P+A+LTG+DLSPYFLAVA
Sbjct  133   RQSYHDVLQTHLRDAPQ--PVRAIADLGCGVGMSTETLQATFPAAHLTGIDLSPYFLAVA  190

Query  847   QFKEKNRDRK-----------------------TNPTRWIHANGEDTGLPSKSFDLVSIS  957
             Q++ + + +                        ++P  W HA  E TGLP+ SFDLVS  
Sbjct  191   QYRAQEQAQNHAQNHVSNPLEFNPPTAKLAPLDSSPITWHHAAAEATGLPAGSFDLVSAC  250

Query  958   YVFHECPERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDE  1137
              +FHE P+ A  +++ E+ RLLRPGG F++ D  P+S    ++PP + TL+KSTEP+LDE
Sbjct  251   LMFHELPKTAAISIIREARRLLRPGGHFAIMDMDPQSDTFAKMPPFVLTLLKSTEPYLDE  310

Query  1138  YYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
             Y+  D    +  AGF   Q +   PRHRT+ A
Sbjct  311   YFSVDFAAALVAAGFSTPQVIRNSPRHRTILA  342



>ref|WP_009546876.1| methyltransferase type 11 [Cyanothece sp. ATCC 51142]
 ref|YP_001803539.1| hypothetical protein cce_2123 [Cyanothece sp. ATCC 51142]
 gb|ACB51473.1| hypothetical protein cce_2123 [Cyanothece sp. ATCC 51142]
Length=321

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 183/302 (61%), Gaps = 10/302 (3%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR +  ++S KPL  L K  AR + I+ AEK  +PWR+  +++   +  +E+E +QN +L
Sbjct  28    SRVINGILSVKPLAKLAKYQARNMIINRAEKIGVPWRDNVRQLSNHNWEEELEKVQNPNL  87

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YPDYY+  FH Y+ GNLSW +A E E A  A+     P A         +R N+ + ++
Sbjct  88    VYPDYYVCSFHGYETGNLSWESALEVESAAYAVHASIWPGAGV--NGDPRLRHNYHEILK  145

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +   Q S     + ILD+GCS+G+ST  L + YP A +TGLDLS Y LAVA ++ + R+ 
Sbjct  146   Q---QLSST--PQRILDMGCSVGMSTFPLQAMYPDAKVTGLDLSAYHLAVAHYRSQERNL  200

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
               +   W+H   E T LP  SFDLVS   ++HE P+ A   +  E+ RLL+PGG F++ D
Sbjct  201   AID---WVHGAAEATNLPETSFDLVSAFLLYHELPQTAAIAIFKEARRLLKPGGYFTMMD  257

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+++  Q++PP + TL+KSTEP+LD+Y+  D+E  ++EAGF   +     PRHR + A
Sbjct  258   MNPRAEAYQKMPPYILTLLKSTEPYLDQYFALDIETALQEAGFNPPKITPISPRHRAIVA  317

Query  1234  TV  1239
              V
Sbjct  318   RV  319



>ref|WP_024544740.1| methyltransferase type 11 [Synechococcus sp. NKBG15041c]
Length=307

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/304 (40%), Positives = 184/304 (61%), Gaps = 14/304 (5%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S+ V  +++ +P+ +  K  AR + I  AEK  +PWR+  + +   D   E+ +++N +L
Sbjct  14    SKLVNGILAIRPIATFAKNRARAMMIQRAEKLGVPWRQNVETLQRRDWRGELAAVENPAL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
              YP YYL+ FHAYDEGNL W  A E E A  ++      + N   E   ++R       E
Sbjct  74    SYPSYYLTSFHAYDEGNLGWEPALEVESAAYSVHSTLFGEPNI--EGDALLR-------E  124

Query  694   KHHK--QYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNR  867
              +H+  +++   + + ILDIGCS+G+ST  L   +P A LTG+DLSPYFLAVA+++   +
Sbjct  125   SYHQILKFNIDLSPQKILDIGCSVGMSTEALKKTFPEAELTGVDLSPYFLAVAKYRTAAQ  184

Query  868   DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
                     W HA GEDT LP++SFDLVS S +FHE P+ A   +  E+ RLL+PGG F++
Sbjct  185   GENFT---WCHAPGEDTQLPAQSFDLVSCSLIFHELPQTAAIALFQEAKRLLKPGGYFAM  241

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +P+++  +++PP + TL+KSTEP+LD+Y+  D+   ++ AGF         PRHRTV
Sbjct  242   MDMNPQAEVYKKMPPYILTLLKSTEPYLDQYFSLDVATELQWAGFEAPFIQENTPRHRTV  301

Query  1228  TATV  1239
              A V
Sbjct  302   IAKV  305



>ref|WP_018396185.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=304

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 175/302 (58%), Gaps = 14/302 (5%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             S+ V  L+S KPL +  K  AR + I  AE+  +PWR+  +E  + D    + ++QN  L
Sbjct  13    SQIVNGLLSIKPLANFAKSRARSMMIERAERLGVPWRKRFQEYQQIDWAPYLSTVQNLQL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEAS--QVVRGNWLDA  687
              YPDYYL  FHAY+ GNLSW AA E E A  ++      DAN   +A   Q      LD 
Sbjct  73    PYPDYYLRAFHAYENGNLSWDAAWEVESAAYSVHSGIWKDANPQGDAKLRQSYHAVMLDK  132

Query  688   IEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNR  867
             +    ++         ILD+GCS+G+S+  L   YP A +TG+DLSPYFLAVAQ+  + R
Sbjct  133   MATPPQR---------ILDLGCSVGMSSFALQDTYPHAEITGVDLSPYFLAVAQYNSQQR  183

Query  868   DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
              +      W HA  E TGL S SFDLVS   +FHE P      +  E+ RLL PGG F++
Sbjct  184   PKAI---AWKHAPAEATGLESASFDLVSACLMFHELPATIACQIFTEAQRLLSPGGYFTL  240

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+  ++ E GF N+      PRHRT+
Sbjct  241   MDMNPQSEIYEKMPPYILTLLKSTEPYLDQYFSLDIAAILSELGFRNITITPNSPRHRTI  300

Query  1228  TA  1233
              A
Sbjct  301   VA  302



>emb|CDN16863.1| SAM (and some other nucleotide) binding motif:Generic methyl-transferase 
[Richelia intracellularis]
Length=340

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 189/322 (59%), Gaps = 10/322 (3%)
 Frame = +1

Query  274   VEVYEEGQLERPRWSGETPLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMA  453
             + V++E  +     +  +  S+ V  +++ KPL +  K  ARQ+ I  AE   + W +  
Sbjct  27    ISVHKETPMTAAVKTSPSIASQLVNGILAIKPLANFAKHQARQMIIKRAENIGVHWTQEV  86

Query  454   KEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPD  633
             +++       +   +QN  + YP+YYL PFHAY++ NLSW AA E E A  A+  +   +
Sbjct  87    EKLKARSWNSDFAQVQNPQVSYPEYYLKPFHAYEKSNLSWEAALEVEVAAKAVHAKIWQE  146

Query  634   ANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTG  813
             A    +A   +R ++ D ++          + +DI+D+GCS+G+ST  L + YP A +TG
Sbjct  147   AGINGDAQ--LRQSYHDVVKAQIPD-----SPKDIIDLGCSVGMSTFALQAVYPQAQITG  199

Query  814   LDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIR  993
             +DLSPYFLAVA ++ + R  K N   W+HA  E TG+   SFDL S+  + HE P+ A R
Sbjct  200   VDLSPYFLAVAHYRTQQRQAKIN---WVHAAAESTGIADNSFDLGSMCLICHELPQSATR  256

Query  994   NVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMRE  1173
              +  E  RLLRPGG  ++ D +P+++  +++PP +FTL+KSTEP+LD+Y+  D+ + + E
Sbjct  257   QIFTEVRRLLRPGGHLTIMDMNPQAEAYKKMPPYVFTLLKSTEPYLDDYFTLDIAQTLVE  316

Query  1174  AGFVNVQSVLTDPRHRTVTATV  1239
             AGF +       PRHRT+ A V
Sbjct  317   AGFNSPTITPNSPRHRTIIARV  338



>ref|WP_011143466.1| methyltransferase type 11 [Gloeobacter violaceus]
 ref|NP_926423.1| hypothetical protein gll3477 [Gloeobacter violaceus PCC 7421]
 dbj|BAC91418.1| gll3477 [Gloeobacter violaceus PCC 7421]
Length=306

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 177/301 (59%), Gaps = 10/301 (3%)
 Frame = +1

Query  331   LSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQS  510
             + R V  +++  PL+ L +  AR++ I  AE   + W +    + E D   ++E+++N++
Sbjct  12    VDRLVSGMLAIGPLFHLARHQARRMMIRRAESVGVAWHDRVAALRERDWQADLEAVENRT  71

Query  511   LEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAI  690
             L YP+YY  PFHAY++GNL W AA E E A  A   R  P+A +  +  + +R  +LD +
Sbjct  72    LLYPEYYRRPFHAYEQGNLCWEAALEVEVAAYAAHARVWPEAGA--DGDRRLRQGFLDIL  129

Query  691   EKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRD  870
               H  +         ILDIGCS+G+ST  L + YP A +TGLDLSP+FLAVA+ +   RD
Sbjct  130   SAHLPEPP-----HTILDIGCSVGMSTFALQTAYPEAQVTGLDLSPHFLAVARHR-AGRD  183

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
              +T    W HA  E TGLP+ S DLV    +FHE P +A   V+ E+ RLLRPGGT +V 
Sbjct  184   GRT--LIWRHAAAEQTGLPNHSVDLVCAFLLFHELPAQATHQVLGEAHRLLRPGGTLAVM  241

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             D +P+S     +P  + TL+KSTEP+L EY+  DLE  +  AGF         PRHRT+ 
Sbjct  242   DMNPRSTIYARMPLYVLTLLKSTEPYLGEYFDLDLEAALTGAGFEPPTLTCNTPRHRTLI  301

Query  1231  A  1233
             A
Sbjct  302   A  302



>ref|WP_002744668.1| methyltransferase domain protein [Microcystis aeruginosa]
 emb|CAO87058.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS47423.1| methyltransferase domain protein [Microcystis aeruginosa DIANCHI905]
Length=308

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 185/310 (60%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D  +E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSQELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGMDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF     + T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIEQALVEAGFQAPIIIPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_002736498.1| methyltransferase type 11 [Microcystis aeruginosa]
 emb|CCH91791.1| Genome sequencing data, contig C301 [Microcystis aeruginosa PCC 
9432]
 emb|CCI06450.1| Genome sequencing data, contig C301 [Microcystis aeruginosa PCC 
7941]
 emb|CCI22290.1| Genome sequencing data, contig C301 [Microcystis aeruginosa PCC 
9808]
 gb|ELP54055.1| methyltransferase domain protein [Microcystis aeruginosa TAIHU98]
Length=308

 Score =   226 bits (575),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 184/310 (59%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D  +E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSQELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGMDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAKINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIEQALVEAGFQAPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_002767286.1| methyltransferase type 11 [Microcystis aeruginosa]
 emb|CCI01830.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9443]
Length=308

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 184/310 (59%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D  +E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSRELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGMDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIEQALVEAGFQAPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_017290444.1| hypothetical protein [Leptolyngbya boryana]
Length=304

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 178/300 (59%), Gaps = 11/300 (4%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  ++S KP++ L +  AR + I  AE   +PW ++  ++   D   E   + N  L
Sbjct  13    SRLVNGILSIKPVFDLARYRARTMMIKRAESIGVPWTKIVADLQARDWSTEFNQVNNPDL  72

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YP+YY+  FHAY+EGNL W  A E E A  A+  R   D+    +    +R ++ + ++
Sbjct  73    KYPEYYVRSFHAYEEGNLGWEPATEVEVAAYAVHARIWSDSGK--DGDPRLRQSYHNVLQ  130

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
                 +     + + I+D+GCS+G+ST  L   +P A LTG+DLSPYFLAVA+ +   R+ 
Sbjct  131   AEISE-----SPKAIVDLGCSVGMSTVALQDAFPGATLTGVDLSPYFLAVAKHRVGEREN  185

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
                   W+HA+   TGLPS S+DLVS   +FHE P+ A  +++ E+ RLLRPGG  ++ D
Sbjct  186   ----INWVHADAAATGLPSGSYDLVSACLLFHELPKSAAIDILKEARRLLRPGGHLAIMD  241

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P S+   ++PP + TL+KSTEP+LD+Y+  DLE+ + EAGF         PRHRT+ A
Sbjct  242   MNPNSEIYAKMPPYILTLLKSTEPYLDQYFGLDLEKEIVEAGFSKPTLTCNTPRHRTLVA  301



>ref|WP_002803544.1| methyltransferase type 11 [Microcystis aeruginosa]
 emb|CCI37894.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=308

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 183/310 (59%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D   E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSWELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGIDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+ER + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIERALVEAGFQTPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_008203012.1| methyltransferase type 11 [Microcystis sp. T1-4]
 emb|CCI33013.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=308

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 185/310 (60%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  +++ KPL+ + +  AR + I  AEK  +PWRE  K+  + D  +E+++++N 
Sbjct  12    PVSGLVNRILAIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSRELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              + YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DIVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGIDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIEQALVEAGFQAPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_002783982.1| Genome sequencing data, contig C301 [Microcystis aeruginosa]
 emb|CCI13703.1| Genome sequencing data, contig C301 [Microcystis aeruginosa PCC 
9806]
Length=308

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 184/310 (59%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D  +E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSQELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGIDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQITAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIEQALVEAGFQAPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_036480685.1| methyltransferase type 11 [Myxosarcina sp. GI1]
Length=295

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 179/302 (59%), Gaps = 14/302 (5%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL +  K  AR + I  AE   +PWR+  +++   +   + +++ N  L
Sbjct  3     SRLVNGILAIKPLANFAKNRARNMMIERAETIGVPWRDNVRQLSNRNWDADFKAVANPQL  62

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             +YPDYY + FHAY+ GNL+W AA E E A +A+  +   + +        VRG+ L   +
Sbjct  63    DYPDYYTTSFHAYERGNLNWEAAWEVESAALAVHAKIWSEGD--------VRGD-LMLRQ  113

Query  694   KHHKQYSGCFAI--RDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNR  867
              +H        I  + ILD GCS+G+S+  L   +P A +TG+DLSPYFLAVA+++ +  
Sbjct  114   SYHDLVRQQLEIEPKAILDFGCSVGLSSFALQEVFPQAKVTGVDLSPYFLAVAKYRSQQT  173

Query  868   DRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSV  1047
              +  +   W+HA  E TGLP  SFDLVS   +FHE P+ A + +++E+ RLLR GG  ++
Sbjct  174   GQNIS---WLHAAAESTGLPDASFDLVSACLMFHELPQSAAKAIISEARRLLRSGGYLTI  230

Query  1048  TDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTV  1227
              D +P S   Q +PP + TL+KSTEP+LD+Y+  DLER + E  F  +      PRHRT+
Sbjct  231   MDMNPSSPIYQAMPPYILTLLKSTEPYLDQYFALDLERAIAEESFTTLTITTNSPRHRTI  290

Query  1228  TA  1233
              A
Sbjct  291   VA  292



>ref|WP_022603788.1| methylase involved in ubiquinone/menaquinone biosynthesis [Rubidibacter 
lacunae]
 gb|ERN43220.1| methylase involved in ubiquinone/menaquinone biosynthesis [Rubidibacter 
lacunae KORDI 51-2]
Length=308

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/297 (41%), Positives = 180/297 (61%), Gaps = 10/297 (3%)
 Frame = +1

Query  343   VGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSLEYP  522
             +  L++ KPL ++ K  ARQ  +  AE   IPWRE  +++ + ++  + ++I N +LEYP
Sbjct  19    INGLLAVKPLAAVAKRQARQKIVKRAEANGIPWRENVRQLQQQNLQADYDAIANPNLEYP  78

Query  523   DYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIEKHH  702
             +YY  PFHAY EGNL+W   A  E  + AM + AI    + D     +R  +  A     
Sbjct  79    EYYCRPFHAYAEGNLNW--QAAWEAESAAMAVHAILCEETGDRGDFKLRRGYTKAFRDRV  136

Query  703   KQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDRKTN  882
             +      A + I+D+GCS+G+ST  L   YP A +TG+DLSPYFL+VA    + ++R+++
Sbjct  137   E-----IAPQRIVDLGCSVGLSTFELEEIYPEAEITGVDLSPYFLSVAH--RRGQERRSS  189

Query  883   PTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTDNSP  1062
               +W H+  E TGLP+  +DLVSI  VFHE P++A   V+ E+ RLL+PGG  +  D +P
Sbjct  190   -IQWRHSAAETTGLPAGKWDLVSICLVFHELPQQAALAVLKEARRLLKPGGYLTFMDMNP  248

Query  1063  KSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
             +S+  + +PP + TL+KSTEP+LDEY+  DLE  +  AGF         PRHRT+ A
Sbjct  249   QSEAYKTMPPYVLTLLKSTEPYLDEYFSLDLEGAIASAGFTPPTVRFNSPRHRTLIA  305



>ref|WP_002757824.1| methyltransferase type 11 [Microcystis aeruginosa]
 emb|CCH95840.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=308

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 183/310 (59%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D  +E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSRELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGIDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LP +S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPGQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIEQALVEAGFQAPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_002795667.1| methyltransferase type 11 [Microcystis aeruginosa]
 emb|CCI30207.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
Length=308

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 183/310 (59%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D   E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSWELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGMDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFALDIEQALVEAGFQAPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_012265085.1| methyltransferase type 11 [Microcystis aeruginosa]
 ref|YP_001656780.1| hypothetical protein MAE_17660 [Microcystis aeruginosa NIES-843]
 dbj|BAG01588.1| hypothetical protein MAE_17660 [Microcystis aeruginosa NIES-843]
Length=308

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 183/310 (59%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D   E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSWELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+  FHAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSFHAYEKGNLDWLPAFEV-------------ESAAYAVHSTIWPGAGMDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIEQALVEAGFQAPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>ref|WP_002789851.1| methyltransferase type 11 [Microcystis aeruginosa]
 emb|CCI19797.1| Genome sequencing data, contig C301 [Microcystis aeruginosa PCC 
9807]
Length=308

 Score =   223 bits (569),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 183/310 (59%), Gaps = 22/310 (7%)
 Frame = +1

Query  328   PLSRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQ  507
             P+S  V  ++  KPL+ + +  AR + I  AEK  +PWRE  K+  + D  +E+++++N 
Sbjct  12    PVSGLVNRILGIKPLFDIARYQARNMMIKRAEKLGVPWRETVKQWQQRDWSQELQAVENP  71

Query  508   SLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDA  687
              L YP+YY+   HAY++GNL WL A E              ++ +    S +  G  +D 
Sbjct  72    DLVYPEYYVCSLHAYEKGNLDWLPAFEV-------------ESATYAVHSTIWPGAGMDG  118

Query  688   IEKHHKQYSGCFA------IRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
               +  ++Y           I DI+D+GCS+G+S+  L   YP A +TGLDLSPY+LAVAQ
Sbjct  119   DPRLRREYHRILKEQIKAEINDIVDLGCSVGMSSFALQDTYPQARVTGLDLSPYYLAVAQ  178

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +    K    +W HA  E T LPS+S+DLVS   +FHE P++A R +  E+ RLLR 
Sbjct  179   YQAQQ---KQKTIQWQHAAAEKTQLPSQSYDLVSSFLMFHELPQQATREIFAEARRLLRS  235

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S+  +++PP + TL+KSTEP+LD+Y+  D+E+ + EAGF       T 
Sbjct  236   GGYLTLMDMNPRSEIYRKMPPYVLTLLKSTEPYLDQYFTLDIEQALVEAGFQAPIITPTS  295

Query  1210  PRHRTVTATV  1239
             PRHR + A V
Sbjct  296   PRHRAIVARV  305



>gb|EDX86634.1| Methyltransferase domain family [Synechococcus sp. PCC 7335]
Length=326

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 187/321 (58%), Gaps = 25/321 (8%)
 Frame = +1

Query  340   FVGALISFKPLYSLLKIGARQVFISTAEKTNIPWR-----------------------EM  450
              V  L+S KPL    +  AR++ +  AE   + WR                       ++
Sbjct  5     LVNGLLSVKPLAKFARQRARKMMMDRAETIGVYWRDEVKELERRSDESAQSSSPLPAGQL  64

Query  451   AKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIP  630
             A+E +     +E+ +I + +++YP YY + FHAYDEGNL WL A E + A  A+  +   
Sbjct  65    AREKINPIWEEELRAIADPTIDYPPYYTTKFHAYDEGNLGWLPAMEVDAAARAVHAQIWT  124

Query  631   DANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLT  810
             D  S     + +R ++   ++++  + S     +DI+D+GC IG+S+  +   +P+A +T
Sbjct  125   DERSGINGDKSLRASYHQILKEYFDEIS-AETPKDIVDLGCGIGMSSVAIGEAFPNARVT  183

Query  811   GLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAI  990
             G++LSPYFLAV Q++ K  + KT    W HA  E+TGL + S DLVS   VFHE P  A 
Sbjct  184   GIELSPYFLAVGQYRLKQLE-KTGSVHWKHAAAENTGLDASSADLVSAFLVFHELPSSAA  242

Query  991   RNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMR  1170
             ++++ E+ RL+RPGG F++ D +P SK  +ELPP +FTL+KSTEP+LD+Y+  D+ +V +
Sbjct  243   KDIIAEANRLVRPGGHFAIMDMNPASKIYRELPPYVFTLLKSTEPYLDQYFSLDMNQVFQ  302

Query  1171  EAGFVNVQSVLTDPRHRTVTA  1233
             +AGF   + V   PRHRT+ A
Sbjct  303   DAGFSAPRIVANSPRHRTIIA  323



>ref|WP_038016107.1| methyltransferase type 11 [Synechococcus sp. PCC 7335]
Length=337

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 187/321 (58%), Gaps = 25/321 (8%)
 Frame = +1

Query  340   FVGALISFKPLYSLLKIGARQVFISTAEKTNIPWR-----------------------EM  450
              V  L+S KPL    +  AR++ +  AE   + WR                       ++
Sbjct  16    LVNGLLSVKPLAKFARQRARKMMMDRAETIGVYWRDEVKELERRSDESAQSSSPLPAGQL  75

Query  451   AKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIP  630
             A+E +     +E+ +I + +++YP YY + FHAYDEGNL WL A E + A  A+  +   
Sbjct  76    AREKINPIWEEELRAIADPTIDYPPYYTTKFHAYDEGNLGWLPAMEVDAAARAVHAQIWT  135

Query  631   DANSLDEASQVVRGNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLT  810
             D  S     + +R ++   ++++  + S     +DI+D+GC IG+S+  +   +P+A +T
Sbjct  136   DERSGINGDKSLRASYHQILKEYFDEIS-AETPKDIVDLGCGIGMSSVAIGEAFPNARVT  194

Query  811   GLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAI  990
             G++LSPYFLAV Q++ K  + KT    W HA  E+TGL + S DLVS   VFHE P  A 
Sbjct  195   GIELSPYFLAVGQYRLKQLE-KTGSVHWKHAAAENTGLDASSADLVSAFLVFHELPSSAA  253

Query  991   RNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMR  1170
             ++++ E+ RL+RPGG F++ D +P SK  +ELPP +FTL+KSTEP+LD+Y+  D+ +V +
Sbjct  254   KDIIAEANRLVRPGGHFAIMDMNPASKIYRELPPYVFTLLKSTEPYLDQYFSLDMNQVFQ  313

Query  1171  EAGFVNVQSVLTDPRHRTVTA  1233
             +AGF   + V   PRHRT+ A
Sbjct  314   DAGFSAPRIVANSPRHRTIIA  334



>ref|WP_021835782.1| hypothetical protein [Crocosphaera watsonii]
 emb|CCQ62220.1| hypothetical protein CWATWH0401_3048 [Crocosphaera watsonii WH 
0401]
Length=296

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 173/305 (57%), Gaps = 16/305 (5%)
 Frame = +1

Query  352   LISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSLEYPDYY  531
             +I  KP+Y L+   AR+V I TAEK  I W E  K + +S        I N  + YPDYY
Sbjct  1     MIETKPIYRLMTHQARKVIIKTAEKNGIAWEENCKNLEKSPAKSLFSQITNPDIVYPDYY  60

Query  532   LSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQVVRGNWLDAIEKHHKQ  708
             L PFHAYD+GNL W AA EA PAT ++ LR   + + +  EA   +R  +   +E +   
Sbjct  61    LVPFHAYDQGNLCWKAAFEAVPATQSLGLRVWKNEDLTWQEAQDRLRAAFHAVLEPYSPP  120

Query  709   YSGCFAIRDILDIGCSIGVSTRCLASRYPS------ANLTGLDLSPYFLAVAQFKEKNRD  870
                   + +ILDIGCSIGVST+     Y         N  GLDLSPY LAVA    K  D
Sbjct  121   -----QVENILDIGCSIGVSTKATHCYYSQRQGNLPINTIGLDLSPYMLAVA----KVTD  171

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
              +   ++WIH   E T     SFD+++I +V HE P  A   +  E+FR+L PGG   + 
Sbjct  172   EEQEISQWIHGLAEKTNFDDNSFDVITIQFVLHELPRDAATAIFKEAFRILHPGGVLGIV  231

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             DN+P+S+ +Q LPP LF LMKSTEP  D+YY  ++E  +++ GF    +  +D RHRT+ 
Sbjct  232   DNNPRSEVIQNLPPALFMLMKSTEPHSDDYYTFNVEETLQKLGFDYKTTFPSDHRHRTIV  291

Query  1231  ATVPY  1245
             AT P+
Sbjct  292   ATKPF  296



>gb|EHJ11327.1| hypothetical protein CWATWH0003_3931 [Crocosphaera watsonii WH 
0003]
Length=296

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 173/305 (57%), Gaps = 16/305 (5%)
 Frame = +1

Query  352   LISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSLEYPDYY  531
             +I  KP+Y L+   AR+V I TAEK  I W E  K + +S        I N  + YPDYY
Sbjct  1     MIETKPIYRLMTHQARKVIIKTAEKNGIAWEENCKNLEKSPAKSLFSQITNPDIVYPDYY  60

Query  532   LSPFHAYDEGNLSWLaaaeaepatmameLRAIPDAN-SLDEASQVVRGNWLDAIEKHHKQ  708
             L PFHAYD+GNL W AA EA PAT ++ LR   + + +  EA   +R  +   +E +   
Sbjct  61    LVPFHAYDQGNLCWKAAFEAVPATQSLGLRVWKNEDLTWQEAQDRLRAAFHAVLEPYSPP  120

Query  709   YSGCFAIRDILDIGCSIGVSTRCLASRYPS------ANLTGLDLSPYFLAVAQFKEKNRD  870
                   + +ILDIGCSIGVST+     Y         N  GLDLSPY LAVA    K  D
Sbjct  121   -----QVENILDIGCSIGVSTKATHRYYSQRQGNLPINTIGLDLSPYMLAVA----KVTD  171

Query  871   RKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVT  1050
              +   ++WIH   E T     SFD+++I +V HE P  A   +  E+FR+L PGG   + 
Sbjct  172   EEQEISQWIHGLAEKTNFDDNSFDVITIQFVLHELPRDAATAIFKEAFRILHPGGVLGIV  231

Query  1051  DNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVT  1230
             DN+P+S+ +Q LPP LF LMKSTEP  D+YY  ++E  +++ GF    +  +D RHRT+ 
Sbjct  232   DNNPRSEVIQNLPPALFMLMKSTEPHSDDYYTFNVEETLQKLGFDYKTTFPSDHRHRTIV  291

Query  1231  ATVPY  1245
             AT P+
Sbjct  292   ATKPF  296



>ref|WP_015171516.1| type 11 methyltransferase [Geitlerinema sp. PCC 7407]
 ref|YP_007109001.1| type 11 methyltransferase [Geitlerinema sp. PCC 7407]
 gb|AFY65949.1| Methyltransferase type 11 [Geitlerinema sp. PCC 7407]
Length=314

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/307 (38%), Positives = 177/307 (58%), Gaps = 18/307 (6%)
 Frame = +1

Query  337   RFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILES--------DVYKEME  492
             R +  ++  +PL++L++  AR + +  AE   I W +  + +L          +  +E+ 
Sbjct  15    RLINGVLGIQPLFNLMRQRARTMMMRRAESMGIHWEQEVQTLLSRGGSAAIAPEWEQELA  74

Query  493   SIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRG  672
             ++ N ++ YPDYYL  FHAYDEGNL WL AAE E A  A+  R  PDA    E    +R 
Sbjct  75    AVTNPAVRYPDYYLKNFHAYDEGNLGWLPAAEEEVAAYAVHSRLWPDAGV--EGDARMRR  132

Query  673   NWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQF  852
             ++ + ++    +       R ILD+GC +G++   L   YP A +TGLDLSPYFLA+A++
Sbjct  133   SYHEVLQAQIAEPP-----RRILDLGCGVGMNAFALQQVYPEAEMTGLDLSPYFLAIARY  187

Query  853   KEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPG  1032
             + + R +      W+HA  E TGLP +SFDLVS   +FHE P+     +  E+ RLLRPG
Sbjct  188   QAQRRQQSVT---WVHAPAEATGLPDQSFDLVSTCLMFHELPQEVSIAIFKEARRLLRPG  244

Query  1033  GTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDP  1212
             G  ++ D +P+S+   ++PP + TL+KSTEP+LD Y+  D+E+ +  AGF         P
Sbjct  245   GHLAIMDMNPQSEVYAKMPPFILTLLKSTEPYLDSYFALDMEQAIEAAGFTRPTRTFNTP  304

Query  1213  RHRTVTA  1233
             RH T+ A
Sbjct  305   RHVTLVA  311



>ref|WP_011378292.1| methyltransferase type 11 [Synechococcus elongatus]
 ref|YP_401071.1| hypothetical protein Synpcc7942_2054 [Synechococcus elongatus 
PCC 7942]
 gb|ABB58084.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD57439.1| methyltransferase type 11 [Synechococcus sp. UTEX 2973]
Length=313

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 183/308 (59%), Gaps = 18/308 (6%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPW--------REMAKEILESDVYKEM  489
             SR V  ++  +PL+++ +  AR + +  A +  + W        +  +++    D  +++
Sbjct  13    SRLVSGILQIQPLFNIARKRARSMMVQRASQIGVDWPARTAALRQRQSEQSFSPDWEQDL  72

Query  490   ESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVR  669
             +++ N  L+YP YY++PFHAY EGNL W  A E E A +++  R  P+A +  +A   +R
Sbjct  73    QALTNPDLQYPSYYVAPFHAYPEGNLGWEPAMEVEVAALSVHARIWPEAGAQGDAQ--LR  130

Query  670   GNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
              ++   +++H        A + ILDIGCS+G+ST  L   +P A + GLDLSPYFLAVA+
Sbjct  131   ASYHQVLKEHLPT-----APQRILDIGCSVGMSTFTLQDTFPQAAIAGLDLSPYFLAVAK  185

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +   R     +W HA  E TGLP +SFDL+S   VFHE P +A ++++ E+ RLL  
Sbjct  186   YQAEQAGRSI---QWHHAAAEATGLPDQSFDLISACLVFHELPAQAAQDILKEARRLLPV  242

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S    ++PP + TL+KSTEP++DEY+  DL+ V + AGF     +   
Sbjct  243   GGHIALMDMNPQSDVFAKMPPYILTLLKSTEPYIDEYFSLDLDAVFQAAGFTTPTRICNS  302

Query  1210  PRHRTVTA  1233
             PRH T+ A
Sbjct  303   PRHHTLIA  310



>ref|WP_011244349.1| methyltransferase type 11 [Synechococcus elongatus]
 ref|YP_172749.1| hypothetical protein syc2039_d [Synechococcus elongatus PCC 6301]
 dbj|BAD80229.1| hypothetical protein [Synechococcus elongatus PCC 6301]
Length=305

 Score =   221 bits (562),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 183/308 (59%), Gaps = 18/308 (6%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPW--------REMAKEILESDVYKEM  489
             SR V  ++  +PL+++ +  AR + +  A +  + W        +  +++    D  +++
Sbjct  5     SRLVSGILQIQPLFNIARKRARSMMVQRASQIGVDWPARTAALRQRQSEQSFSPDWEQDL  64

Query  490   ESIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVR  669
             +++ N  L+YP YY++PFHAY EGNL W  A E E A +++  R  P+A +  +A   +R
Sbjct  65    QALTNPDLQYPSYYVAPFHAYPEGNLGWEPAMEVEVAALSVHARIWPEAGAQGDAQ--LR  122

Query  670   GNWLDAIEKHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQ  849
              ++   +++H        A + ILDIGCS+G+ST  L   +P A + GLDLSPYFLAVA+
Sbjct  123   ASYHQVLKEHLPT-----APQRILDIGCSVGMSTFTLQDTFPQAAIAGLDLSPYFLAVAK  177

Query  850   FKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRP  1029
             ++ +   R     +W HA  E TGLP +SFDL+S   VFHE P +A ++++ E+ RLL  
Sbjct  178   YQAEQAGRSI---QWHHAAAEATGLPDQSFDLISACLVFHELPAQAAQDILKEARRLLPV  234

Query  1030  GGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTD  1209
             GG  ++ D +P+S    ++PP + TL+KSTEP++DEY+  DL+ V + AGF     +   
Sbjct  235   GGHIALMDMNPQSDVFAKMPPYILTLLKSTEPYIDEYFSLDLDAVFQAAGFTTPTRICNS  294

Query  1210  PRHRTVTA  1233
             PRH T+ A
Sbjct  295   PRHHTLIA  302



>ref|WP_006509897.1| methylase involved in ubiquinone/menaquinone biosynthesis [Xenococcus 
sp. PCC 7305]
 gb|ELS03001.1| methylase involved in ubiquinone/menaquinone biosynthesis [Xenococcus 
sp. PCC 7305]
Length=311

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 180/304 (59%), Gaps = 7/304 (2%)
 Frame = +1

Query  334   SRFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSL  513
             SR V  +++ KPL    K  AR++ I  AE   +PWR+   E+ + D   E  ++ N  L
Sbjct  14    SRLVNGILAIKPLADFAKTRARKMMIDRAEVLGVPWRKNVDELSKRDWDLEWNTVVNPQL  73

Query  514   EYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRGNWLDAIE  693
             + PDYYL+ FHAY EGNLSW AA E E A  A+  +  P+A +  +A+  +R ++   ++
Sbjct  74    QPPDYYLTSFHAYPEGNLSWKAAWEVESAAYAVHAKIWPEAGAKGDAA--LRQSYHQVLQ  131

Query  694   KHHKQYSGCFAIRDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVAQFKEKNRDR  873
             +   Q S     + I+D+GC +G+ST  L + YP A+LTG+DLS YFLAVA ++      
Sbjct  132   E---QLSS--PPQTIVDLGCGVGMSTLALQNIYPQAHLTGVDLSAYFLAVASYRASQVQN  186

Query  874   KTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTD  1053
              +    W++   EDTGLP+ S DLVS   VFHE P  A + ++ E+ R+LRPGG  ++ D
Sbjct  187   SSLNIDWLNVAAEDTGLPANSCDLVSACLVFHELPAIAAKKIITEARRILRPGGHLAIMD  246

Query  1054  NSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTA  1233
              +P+S    ++PP + TL+KSTEP+LD+Y+  DL     ++GF         PRHRT+ A
Sbjct  247   MNPRSAIFAKMPPYILTLLKSTEPYLDQYFDLDLAETFVQSGFTRPLITNNSPRHRTIIA  306

Query  1234  TVPY  1245
              + +
Sbjct  307   RLAH  310



>ref|WP_015220798.1| type 11 methyltransferase [Cyanobacterium aponinum]
 ref|YP_007163123.1| type 11 methyltransferase [Cyanobacterium aponinum PCC 10605]
 gb|AFZ55079.1| Methyltransferase type 11 [Cyanobacterium aponinum PCC 10605]
Length=307

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/309 (38%), Positives = 180/309 (58%), Gaps = 14/309 (5%)
 Frame = +1

Query  316   SGETPLS-RFVGALISFKPLYSLLKIGARQVFISTAEKTNIPWREMAKEILESDVYKEME  492
             S ET LS + +  L++ KPL    K  AR + I  A    + W+E    +   D  +E+ 
Sbjct  7     SPETTLSTKIINGLLAIKPLAEFAKNRARNMIIKRAYSIGVNWQENINSLQNHDWEQEIN  66

Query  493   SIQNQSLEYPDYYLSPFHAYDEGNLSWLaaaeaepatmameLRAIPDANSLDEASQVVRG  672
             S+ N ++ YP+YYL+ FHAY++GNL W  AA    +        I       E  + +R 
Sbjct  67    SLTNANISYPEYYLNSFHAYEKGNLQW-EAAWELESAAYSVHSTIYSKTPQKEGDRTLRN  125

Query  673   NWLDAIEKHHKQYSGCFAI--RDILDIGCSIGVSTRCLASRYPSANLTGLDLSPYFLAVA  846
             N+       H+      AI  ++ILDIGC +G+ST  L  +YP + ++GLDLSPYFLAVA
Sbjct  126   NY-------HQVLKEKLAITPQNILDIGCGVGLSTFALKEQYPESKISGLDLSPYFLAVA  178

Query  847   QFKEKNRDRKTNPTRWIHANGEDTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLR  1026
              ++ + +++     +W+H+  E T LPS S DLVS   +FHE P+ A +N++ E+ R+L+
Sbjct  179   NYQSRQKNQNI---QWLHSQAEKTNLPSNSHDLVSAFLIFHELPQLAAKNIIQEAHRVLK  235

Query  1027  PGGTFSVTDNSPKSKKLQELPPVLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLT  1206
              GG FS+ D +P+S+  +++P  +FTL+KSTEP+LDEY+  ++E V  +AGF     +  
Sbjct  236   TGGYFSMMDMNPQSEVYKKMPRYVFTLLKSTEPYLDEYFSLNMESVFLDAGFEKPSIIPI  295

Query  1207  DPRHRTVTA  1233
               RHRT+ A
Sbjct  296   SIRHRTIIA  304



>ref|XP_002958397.1| hypothetical protein VOLCADRAFT_84448 [Volvox carteri f. nagariensis]
 gb|EFJ40547.1| hypothetical protein VOLCADRAFT_84448 [Volvox carteri f. nagariensis]
Length=281

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 178/290 (61%), Gaps = 12/290 (4%)
 Frame = +1

Query  382   LKIGARQVFISTAEKTNIPWREMAKEILESDVYKEMESIQNQSLEYPDYYLSPFHAYDEG  561
             +K+ A+QV  ++AE   + W      +   +  KE+E   + ++ YPDYYL PFHAY+ G
Sbjct  1     MKVLAKQVRHNSAESRGVRWDGHVDNMRRQNE-KELE---DPAMSYPDYYLKPFHAYETG  56

Query  562   NLSWLaaaeaepatmameLRAIPDAN--SLDEASQVVRGNWLDAIEKHHKQYSGCFAIRD  735
             NL WLAA E +PAT AM +R   D    S D+    +R    DAI+ +H ++      R 
Sbjct  57    NLEWLAAYEVQPATYAMGIRTFKDKQHWSGDQCFVELRSRITDAIKSYHTRHGLPLPSR-  115

Query  736   ILDIGCSIGVSTRCLASRYP-SANLTGLDLSPYFLAVAQFKEKNRDRKTNPTRWIHANGE  912
             I D+GCS G+ST+ LA ++P +A +TGLDLSPYFLAVA+     R  ++ P  ++H   E
Sbjct  116   IADMGCSTGMSTQWLAEQFPQAAAITGLDLSPYFLAVAE----ERWVRSAPITYVHGLAE  171

Query  913   DTGLPSKSFDLVSISYVFHECPERAIRNVVNESFRLLRPGGTFSVTDNSPKSKKLQELPP  1092
              +     S D+V+ ++V HECP+ AI + + ES R+LRPGG  +  DN+P+S  +Q LPP
Sbjct  172   QSPFSDSSLDMVNFNFVIHECPQAAIESFIRESSRILRPGGVLAFVDNNPRSATIQNLPP  231

Query  1093  VLFTLMKSTEPFLDEYYLTDLERVMREAGFVNVQSVLTDPRHRTVTATVP  1242
              +FTLMKSTEP+ DEYY  DLE  MR AGF  V ++ TD RHR V    P
Sbjct  232   AIFTLMKSTEPWSDEYYSFDLEAAMRAAGFKEVVTLETDHRHRCVMGIRP  281



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3947080548888