BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14084_g1_i1 len=453 path=[1:0-452]

Length=453
                                                                      Score     E

ref|XP_004236389.1|  PREDICTED: uncharacterized protein LOC101255578  48.9    2e-04   



>ref|XP_004236389.1| PREDICTED: uncharacterized protein LOC101255578 [Solanum lycopersicum]
Length=220

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +2

Query  50   SITKTEHFWAPCRRLNPDEKIPRGFVSGMLSGMGIPADGQPFLVQKISECADEIANAAHN  229
            SI KT  F   C RL P   +    V+ ML  M +P D QP ++ +I   AD IAN  +N
Sbjct  59   SIIKTGIFQERCDRL-PHNNLSWHNVTRMLHIMEVPVDRQPMILHQICNFADRIANEPYN  117

Query  230  EKEKILGMIVSASVLVDSLEDHQQQTNA  313
              +KIL + V  S+ V+   +  + ++ 
Sbjct  118  RNKKILPIKVYISLPVNYFIEENESSDV  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507136922424