BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c14083_g1_i2 len=853 path=[3035:0-41 2205:42-852]

Length=853
                                                                      Score     E

emb|CDP01035.1|  unnamed protein product                                340   5e-112   
ref|XP_004237894.1|  PREDICTED: probable trehalose-phosphate phos...    322   6e-105   
ref|XP_011099372.1|  PREDICTED: probable trehalose-phosphate phos...    321   1e-104   
ref|XP_006353999.1|  PREDICTED: probable trehalose-phosphate phos...    320   2e-104   
ref|XP_011074162.1|  PREDICTED: probable trehalose-phosphate phos...    318   2e-103   
gb|EYU36516.1|  hypothetical protein MIMGU_mgv1a008595mg                313   2e-101   
ref|XP_002301043.2|  hypothetical protein POPTR_0002s09510g             312   6e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009587491.1|  PREDICTED: probable trehalose-phosphate phos...    310   1e-100   
ref|XP_011016259.1|  PREDICTED: probable trehalose-phosphate phos...    308   3e-100   
ref|XP_009779130.1|  PREDICTED: probable trehalose-phosphate phos...    310   3e-100   
ref|XP_011016253.1|  PREDICTED: probable trehalose-phosphate phos...    309   6e-100   
ref|XP_011043568.1|  PREDICTED: probable trehalose-phosphate phos...    303   2e-97    
ref|XP_011097592.1|  PREDICTED: probable trehalose-phosphate phos...    302   6e-97    
ref|XP_002263078.1|  PREDICTED: probable trehalose-phosphate phos...    301   7e-97    Vitis vinifera
ref|XP_011090521.1|  PREDICTED: probable trehalose-phosphate phos...    300   5e-96    
ref|XP_009595324.1|  PREDICTED: probable trehalose-phosphate phos...    299   1e-95    
ref|XP_006472627.1|  PREDICTED: probable trehalose-phosphate phos...    298   1e-95    
ref|XP_002284201.1|  PREDICTED: probable trehalose-phosphate phos...    298   1e-95    Vitis vinifera
ref|XP_008234617.1|  PREDICTED: probable trehalose-phosphate phos...    297   2e-95    
ref|XP_006434015.1|  hypothetical protein CICLE_v10001513mg             298   2e-95    
ref|XP_006434014.1|  hypothetical protein CICLE_v10001513mg             298   2e-95    
ref|XP_002307096.1|  trehalose-6-phosphate phosphatase family pro...    297   4e-95    Populus trichocarpa [western balsam poplar]
ref|XP_002533145.1|  trehalose-6-phosphate synthase, putative           296   7e-95    Ricinus communis
ref|XP_007205367.1|  hypothetical protein PRUPE_ppa007221mg             296   8e-95    
ref|XP_002310573.1|  trehalose-6-phosphate phosphatase family pro...    296   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_004237406.1|  PREDICTED: probable trehalose-phosphate phos...    296   2e-94    
ref|XP_009373162.1|  PREDICTED: probable trehalose-phosphate phos...    295   2e-94    
ref|XP_002513897.1|  trehalose-6-phosphate synthase, putative           295   3e-94    Ricinus communis
gb|KHN31363.1|  Trehalose-phosphate phosphatase                         291   7e-94    
ref|XP_011022770.1|  PREDICTED: probable trehalose-phosphate phos...    293   9e-94    
ref|XP_004288217.1|  PREDICTED: probable trehalose-phosphate phos...    293   9e-94    
ref|XP_004502437.1|  PREDICTED: probable trehalose-phosphate phos...    293   1e-93    
ref|XP_004502438.1|  PREDICTED: probable trehalose-phosphate phos...    293   1e-93    
ref|XP_006601938.1|  PREDICTED: probable trehalose-phosphate phos...    292   2e-93    
ref|XP_009775195.1|  PREDICTED: probable trehalose-phosphate phos...    293   2e-93    
ref|XP_011022771.1|  PREDICTED: probable trehalose-phosphate phos...    292   3e-93    
gb|EYU24005.1|  hypothetical protein MIMGU_mgv1a007720mg                293   4e-93    
ref|XP_009369663.1|  PREDICTED: probable trehalose-phosphate phos...    291   6e-93    
ref|XP_011030992.1|  PREDICTED: probable trehalose-phosphate phos...    291   6e-93    
gb|KDP41360.1|  hypothetical protein JCGZ_15767                         290   2e-92    
ref|XP_008391072.1|  PREDICTED: LOW QUALITY PROTEIN: probable tre...    288   9e-92    
ref|XP_006591511.1|  PREDICTED: probable trehalose-phosphate phos...    288   1e-91    
ref|XP_008375355.1|  PREDICTED: probable trehalose-phosphate phos...    288   2e-91    
ref|XP_007163639.1|  hypothetical protein PHAVU_001G251300g             286   6e-91    
ref|XP_007224341.1|  hypothetical protein PRUPE_ppa020645mg             286   8e-91    
ref|XP_002307388.2|  hypothetical protein POPTR_0005s16910g             285   9e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010519807.1|  PREDICTED: probable trehalose-phosphate phos...    286   1e-90    
emb|CDP01436.1|  unnamed protein product                                286   1e-90    
ref|XP_006355362.1|  PREDICTED: probable trehalose-phosphate phos...    286   1e-90    
ref|XP_008219665.1|  PREDICTED: probable trehalose-phosphate phos...    285   2e-90    
ref|XP_008375418.1|  PREDICTED: probable trehalose-phosphate phos...    285   3e-90    
ref|XP_010519815.1|  PREDICTED: probable trehalose-phosphate phos...    284   3e-90    
ref|XP_004299611.1|  PREDICTED: probable trehalose-phosphate phos...    284   4e-90    
ref|XP_010546407.1|  PREDICTED: probable trehalose-phosphate phos...    284   4e-90    
ref|XP_008345555.1|  PREDICTED: probable trehalose-phosphate phos...    284   4e-90    
gb|KDP46861.1|  hypothetical protein JCGZ_24070                         284   5e-90    
ref|XP_010261265.1|  PREDICTED: probable trehalose-phosphate phos...    284   5e-90    
ref|XP_003527912.1|  PREDICTED: probable trehalose-phosphate phos...    283   1e-89    
ref|XP_006581545.1|  PREDICTED: probable trehalose-phosphate phos...    283   1e-89    
ref|XP_004143475.1|  PREDICTED: probable trehalose-phosphate phos...    283   2e-89    
gb|EYU23217.1|  hypothetical protein MIMGU_mgv1a023678mg                281   3e-89    
ref|XP_003523824.2|  PREDICTED: probable trehalose-phosphate phos...    281   6e-89    
gb|KHN19743.1|  Trehalose-phosphate phosphatase                         281   1e-88    
ref|XP_010547623.1|  PREDICTED: probable trehalose-phosphate phos...    279   3e-88    
ref|XP_007018813.1|  Haloacid dehalogenase-like hydrolase superfa...    275   8e-88    
ref|XP_008440611.1|  PREDICTED: probable trehalose-phosphate phos...    278   1e-87    
ref|XP_010547624.1|  PREDICTED: probable trehalose-phosphate phos...    277   2e-87    
gb|EYU31023.1|  hypothetical protein MIMGU_mgv1a008338mg                277   2e-87    
ref|XP_009613560.1|  PREDICTED: probable trehalose-phosphate phos...    277   3e-87    
ref|XP_007018814.1|  Haloacid dehalogenase-like hydrolase superfa...    273   4e-87    
ref|XP_008453786.1|  PREDICTED: probable trehalose-phosphate phos...    276   4e-87    
ref|XP_009797815.1|  PREDICTED: probable trehalose-phosphate phos...    276   4e-87    
ref|XP_010105898.1|  Trehalose-phosphate phosphatase                    275   8e-87    
ref|XP_010544184.1|  PREDICTED: probable trehalose-phosphate phos...    275   1e-86    
ref|XP_009797816.1|  PREDICTED: probable trehalose-phosphate phos...    275   2e-86    
ref|XP_010269219.1|  PREDICTED: probable trehalose-phosphate phos...    275   2e-86    
ref|XP_007018811.1|  Haloacid dehalogenase-like hydrolase superfa...    274   2e-86    
ref|XP_007018810.1|  Haloacid dehalogenase-like hydrolase superfa...    274   2e-86    
ref|XP_004146870.1|  PREDICTED: probable trehalose-phosphate phos...    273   6e-86    
ref|XP_008453785.1|  PREDICTED: probable trehalose-phosphate phos...    272   3e-85    
ref|XP_007136236.1|  hypothetical protein PHAVU_009G0298000g            267   1e-84    
ref|XP_007159639.1|  hypothetical protein PHAVU_002G254600g             268   3e-84    
ref|XP_010676890.1|  PREDICTED: probable trehalose-phosphate phos...    268   4e-84    
ref|XP_003543766.1|  PREDICTED: probable trehalose-phosphate phos...    267   1e-83    
gb|KHF97975.1|  Trehalose-phosphate phosphatase                         265   8e-83    
ref|XP_010059987.1|  PREDICTED: probable trehalose-phosphate phos...    265   1e-82    
ref|XP_010428924.1|  PREDICTED: trehalose-phosphate phosphatase B       264   3e-82    
ref|XP_010937497.1|  PREDICTED: probable trehalose-phosphate phos...    264   3e-82    
gb|KEH20857.1|  trehalose-phosphate phosphatase                         262   3e-82    
gb|KHN44334.1|  Trehalose-phosphate phosphatase                         263   3e-82    
ref|XP_003544198.1|  PREDICTED: probable trehalose-phosphate phos...    263   4e-82    
ref|XP_010444490.1|  PREDICTED: probable trehalose-phosphate phos...    263   4e-82    
gb|KHN09128.1|  Trehalose-phosphate phosphatase                         263   4e-82    
gb|KHG13010.1|  Trehalose-phosphate phosphatase                         263   5e-82    
ref|NP_001119501.1|  probable trehalose-phosphate phosphatase J         262   5e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484318.1|  PREDICTED: probable trehalose-phosphate phos...    263   5e-82    
ref|XP_006390024.1|  hypothetical protein EUTSA_v10018720mg             263   7e-82    
ref|XP_006394074.1|  hypothetical protein EUTSA_v10004405mg             263   7e-82    
ref|XP_006826948.1|  hypothetical protein AMTR_s00010p00186780          263   1e-81    
gb|KEH20856.1|  trehalose-phosphate phosphatase                         262   1e-81    
ref|XP_010534065.1|  PREDICTED: trehalose-phosphate phosphatase B...    263   1e-81    
ref|XP_002866651.1|  hypothetical protein ARALYDRAFT_919840             262   1e-81    
gb|KCW54475.1|  hypothetical protein EUGRSUZ_I00423                     262   1e-81    
ref|XP_010462232.1|  PREDICTED: probable trehalose-phosphate phos...    262   1e-81    
ref|XP_007047993.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    262   1e-81    
ref|XP_010321465.1|  PREDICTED: probable trehalose-phosphate phos...    261   2e-81    
emb|CDY08815.1|  BnaA06g24090D                                          261   2e-81    
ref|XP_010027843.1|  PREDICTED: probable trehalose-phosphate phos...    262   2e-81    
ref|XP_010027842.1|  PREDICTED: probable trehalose-phosphate phos...    262   2e-81    
ref|XP_009130492.1|  PREDICTED: probable trehalose-phosphate phos...    261   2e-81    
ref|XP_010534066.1|  PREDICTED: trehalose-phosphate phosphatase B...    261   2e-81    
ref|XP_006366536.1|  PREDICTED: probable trehalose-phosphate phos...    261   2e-81    
emb|CDY31283.1|  BnaA02g34580D                                          261   3e-81    
ref|XP_010555351.1|  PREDICTED: probable trehalose-phosphate phos...    260   4e-81    
ref|NP_201319.2|  probable trehalose-phosphate phosphatase J            261   4e-81    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11650.1|  trehalose-6-phosphate phosphatase                      261   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280660.1|  hypothetical protein CARUB_v10026620mg             261   5e-81    
gb|KFK28197.1|  hypothetical protein AALP_AA8G485000                    259   6e-81    
ref|XP_004504061.1|  PREDICTED: probable trehalose-phosphate phos...    260   7e-81    
ref|NP_177932.1|  trehalose-6-phosphate phosphatase                     260   9e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939628.1|  PREDICTED: probable trehalose-phosphate phos...    260   1e-80    
ref|XP_009150597.1|  PREDICTED: probable trehalose-phosphate phos...    259   1e-80    
ref|XP_006302406.1|  hypothetical protein CARUB_v10020479mg             259   1e-80    
ref|XP_007141163.1|  hypothetical protein PHAVU_008G172400g             259   1e-80    
ref|XP_006294548.1|  hypothetical protein CARUB_v10023582mg             258   1e-80    
dbj|BAJ99358.1|  predicted protein                                      259   2e-80    
ref|XP_010416778.1|  PREDICTED: trehalose-phosphate phosphatase B       259   2e-80    
gb|EMT12736.1|  hypothetical protein F775_52288                         259   2e-80    
dbj|BAJ33676.1|  unnamed protein product                                254   2e-80    
ref|XP_002454258.1|  hypothetical protein SORBIDRAFT_04g027650          258   2e-80    Sorghum bicolor [broomcorn]
ref|XP_004504060.1|  PREDICTED: probable trehalose-phosphate phos...    258   3e-80    
emb|CDY14544.1|  BnaC03g49150D                                          261   4e-80    
ref|XP_010463168.1|  PREDICTED: probable trehalose-phosphate phos...    256   6e-80    
ref|XP_010496062.1|  PREDICTED: probable trehalose-phosphate phos...    258   6e-80    
ref|XP_008808174.1|  PREDICTED: probable trehalose-phosphate phos...    258   6e-80    
ref|XP_006305131.1|  hypothetical protein CARUB_v10009500mg             257   8e-80    
ref|XP_002887719.1|  trehalose-6-phosphate phosphatase                  258   9e-80    
ref|XP_010472010.1|  PREDICTED: trehalose-phosphate phosphatase B...    258   1e-79    
tpg|DAA49101.1|  TPA: hypothetical protein ZEAMMB73_457766              257   1e-79    
gb|KFK42193.1|  hypothetical protein AALP_AA2G223500                    257   1e-79    
ref|XP_010472213.1|  PREDICTED: probable trehalose-phosphate phos...    256   2e-79    
ref|XP_010461341.1|  PREDICTED: probable trehalose-phosphate phos...    256   2e-79    
ref|XP_010416975.1|  PREDICTED: probable trehalose-phosphate phos...    255   3e-79    
ref|XP_010064765.1|  PREDICTED: probable trehalose-phosphate phos...    255   4e-79    
ref|XP_009127222.1|  PREDICTED: probable trehalose-phosphate phos...    254   5e-79    
emb|CDX72676.1|  BnaC07g46980D                                          256   5e-79    
gb|EMT32785.1|  Trehalose-phosphate phosphatase                         254   5e-79    
ref|XP_009128274.1|  PREDICTED: trehalose-phosphate phosphatase B...    256   5e-79    
ref|XP_003524269.1|  PREDICTED: probable trehalose-phosphate phos...    255   7e-79    
gb|AAC39370.1|  trehalose-6-phosphate phosphatase                       255   7e-79    Arabidopsis thaliana [mouse-ear cress]
gb|ACK44515.1|  AT5G10100-like protein                                  255   7e-79    Arabidopsis arenosa
ref|XP_006647910.1|  PREDICTED: LOW QUALITY PROTEIN: probable tre...    254   8e-79    
ref|XP_002880434.1|  trehalose-phosphatase                              254   8e-79    
ref|XP_004953949.1|  PREDICTED: probable trehalose-phosphate phos...    254   8e-79    
ref|XP_002871404.1|  hypothetical protein ARALYDRAFT_350217             255   8e-79    
ref|NP_179809.2|  probable trehalose-phosphate phosphatase E            254   9e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001167890.1|  hypothetical protein                               254   1e-78    Zea mays [maize]
ref|XP_008790818.1|  PREDICTED: probable trehalose-phosphate phos...    254   1e-78    
gb|KHG18855.1|  Trehalose-phosphate phosphatase                         253   2e-78    
ref|XP_004500616.1|  PREDICTED: probable trehalose-phosphate phos...    253   2e-78    
emb|CDX88416.1|  BnaC06g38600D                                          254   2e-78    
ref|XP_003573088.1|  PREDICTED: probable trehalose-phosphate phos...    253   3e-78    
emb|CDY26848.1|  BnaA02g18730D                                          254   3e-78    
gb|EMS59182.1|  Trehalose-phosphate phosphatase                         254   3e-78    
ref|XP_010531388.1|  PREDICTED: probable trehalose-phosphate phos...    252   3e-78    
ref|XP_010500057.1|  PREDICTED: probable trehalose-phosphate phos...    253   3e-78    
ref|XP_006411773.1|  hypothetical protein EUTSA_v10025622mg             253   3e-78    
ref|NP_001142999.1|  uncharacterized protein LOC100275460               253   3e-78    Zea mays [maize]
ref|XP_010680570.1|  PREDICTED: probable trehalose-phosphate phos...    253   3e-78    
emb|CDY14635.1|  BnaC02g24780D                                          253   6e-78    
gb|KDO56609.1|  hypothetical protein CISIN_1g020273mg                   251   8e-78    
sp|Q6ZAL2.1|TPP6_ORYSJ  RecName: Full=Probable trehalose-phosphat...    252   9e-78    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ06967.1|  hypothetical protein OsI_29208                          252   1e-77    Oryza sativa Indica Group [Indian rice]
ref|NP_001190271.1|  probable trehalose-phosphate phosphatase I         251   1e-77    
gb|EEC71779.1|  hypothetical protein OsI_04393                          252   1e-77    Oryza sativa Indica Group [Indian rice]
ref|NP_001048143.1|  Os02g0753000                                       252   1e-77    Oryza sativa Japonica Group [Japonica rice]
emb|CAB92051.1|  trehalose-6-phosphate phosphatase-like protein         252   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196572.2|  probable trehalose-phosphate phosphatase I            251   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KHG28413.1|  Trehalose-phosphate phosphatase                         251   2e-77    
ref|XP_006287992.1|  hypothetical protein CARUB_v10001225mg             251   2e-77    
ref|XP_010926273.1|  PREDICTED: probable trehalose-phosphate phos...    251   2e-77    
ref|XP_003574465.1|  PREDICTED: probable trehalose-phosphate phos...    251   3e-77    
ref|XP_006399500.1|  hypothetical protein EUTSA_v10013874mg             251   3e-77    
ref|XP_006464217.1|  PREDICTED: probable trehalose-phosphate phos...    251   3e-77    
gb|AAM63513.1|  trehalose-phosphatase, putative                         251   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429136.1|  PREDICTED: probable trehalose-phosphate phos...    250   4e-77    
ref|XP_009398164.1|  PREDICTED: probable trehalose-phosphate phos...    251   4e-77    
ref|XP_006428166.1|  hypothetical protein CICLE_v10025685mg             251   4e-77    
gb|KEH34903.1|  trehalose-6-phosphate phosphatase                       251   4e-77    
ref|NP_564464.1|  probable trehalose-phosphate phosphatase D            251   4e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513754.1|  PREDICTED: probable trehalose-phosphate phos...    251   4e-77    
ref|XP_009106458.1|  PREDICTED: trehalose-phosphate phosphatase B...    250   8e-77    
ref|XP_004973406.1|  PREDICTED: probable trehalose-phosphate phos...    250   9e-77    
ref|XP_010422894.1|  PREDICTED: probable trehalose-phosphate phos...    248   9e-77    
ref|XP_006428167.1|  hypothetical protein CICLE_v10025685mg             251   1e-76    
dbj|BAJ88024.1|  predicted protein                                      249   1e-76    
dbj|BAJ96268.1|  predicted protein                                      249   1e-76    
ref|XP_009380195.1|  PREDICTED: probable trehalose-phosphate phos...    249   2e-76    
ref|XP_009101851.1|  PREDICTED: probable trehalose-phosphate phos...    248   2e-76    
gb|KHN29076.1|  Trehalose-phosphate phosphatase                         248   2e-76    
ref|XP_010491664.1|  PREDICTED: probable trehalose-phosphate phos...    247   3e-76    
gb|AAZ66928.1|  117M18_9                                                248   3e-76    Brassica rapa
ref|XP_002893908.1|  hypothetical protein ARALYDRAFT_891246             248   3e-76    
ref|NP_195687.2|  probable trehalose-phosphate phosphatase H            248   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419974.1|  PREDICTED: probable trehalose-phosphate phos...    248   3e-76    
ref|XP_003532832.1|  PREDICTED: probable trehalose-phosphate phos...    248   3e-76    
ref|XP_009109445.1|  PREDICTED: probable trehalose-phosphate phos...    247   3e-76    
ref|XP_010446535.1|  PREDICTED: probable trehalose-phosphate phos...    247   4e-76    
ref|XP_010431963.1|  PREDICTED: probable trehalose-phosphate phos...    247   4e-76    
ref|XP_009109444.1|  PREDICTED: probable trehalose-phosphate phos...    247   4e-76    
ref|XP_010437099.1|  PREDICTED: probable trehalose-phosphate phos...    247   4e-76    
emb|CDX87477.1|  BnaA07g33960D                                          248   4e-76    
ref|XP_003615055.1|  Trehalose-6-phosphate phosphatase                  248   4e-76    
gb|AFK47239.1|  unknown                                                 248   4e-76    
emb|CDX90361.1|  BnaA08g16230D                                          247   5e-76    
emb|CDY22393.1|  BnaA06g37150D                                          248   5e-76    
ref|XP_009122089.1|  PREDICTED: probable trehalose-phosphate phos...    247   5e-76    
ref|XP_010102586.1|  putative glycosyl hydrolase                        250   8e-76    
ref|XP_009380850.1|  PREDICTED: probable trehalose-phosphate phos...    247   8e-76    
ref|XP_010422893.1|  PREDICTED: probable trehalose-phosphate phos...    247   9e-76    
ref|XP_008646283.1|  PREDICTED: probable trehalose-phosphate phos...    246   9e-76    
ref|XP_003576467.1|  PREDICTED: probable trehalose-phosphate phos...    248   9e-76    
ref|XP_009101850.1|  PREDICTED: probable trehalose-phosphate phos...    246   1e-75    
gb|EMT31501.1|  Trehalose-phosphate phosphatase                         244   1e-75    
ref|XP_002444320.1|  hypothetical protein SORBIDRAFT_07g020100          247   1e-75    Sorghum bicolor [broomcorn]
ref|XP_009387126.1|  PREDICTED: probable trehalose-phosphate phos...    246   1e-75    
gb|EAZ42700.1|  hypothetical protein OsJ_27268                          244   1e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002868927.1|  predicted protein                                  246   1e-75    
ref|XP_009131141.1|  PREDICTED: probable trehalose-phosphate phos...    246   2e-75    
ref|XP_010491663.1|  PREDICTED: probable trehalose-phosphate phos...    246   2e-75    
ref|XP_008782128.1|  PREDICTED: probable trehalose-phosphate phos...    246   3e-75    
ref|XP_009122088.1|  PREDICTED: probable trehalose-phosphate phos...    245   3e-75    
ref|XP_010453031.1|  PREDICTED: probable trehalose-phosphate phos...    246   3e-75    
gb|AAZ67593.1|  80A08_8                                                 245   4e-75    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_008445345.1|  PREDICTED: probable trehalose-phosphate phos...    245   5e-75    
gb|KFK44322.1|  hypothetical protein AALP_AA1G243200                    243   6e-75    
gb|EMT08049.1|  Trehalose-phosphate phosphatase                         244   7e-75    
gb|KFK23771.1|  hypothetical protein AALP_AAs53909U000100               244   1e-74    
ref|XP_010916894.1|  PREDICTED: probable trehalose-phosphate phos...    244   1e-74    
ref|XP_004956679.1|  PREDICTED: probable trehalose-phosphate phos...    244   2e-74    
ref|XP_006404674.1|  hypothetical protein EUTSA_v10000217mg             243   2e-74    
ref|XP_004150660.1|  PREDICTED: probable trehalose-phosphate phos...    243   3e-74    
gb|EPS68990.1|  hypothetical protein M569_05778                         240   3e-74    
emb|CDY39454.1|  BnaC03g60640D                                          239   4e-74    
gb|EMT24321.1|  Trehalose-phosphate phosphatase                         241   5e-74    
gb|KHN06593.1|  Trehalose-phosphate phosphatase                         239   9e-74    
dbj|BAJ98055.1|  predicted protein                                      241   1e-73    
ref|XP_006286088.1|  hypothetical protein CARUB_v10007631mg             241   1e-73    
gb|KFK30542.1|  hypothetical protein AALP_AA7G275800                    241   1e-73    
gb|KCW68839.1|  hypothetical protein EUGRSUZ_F02439                     241   1e-73    
gb|AAG51089.1|AC027032_9  trehalose-phosphatase, putative               240   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002460140.1|  hypothetical protein SORBIDRAFT_02g023260          241   4e-73    Sorghum bicolor [broomcorn]
ref|XP_004958375.1|  PREDICTED: probable trehalose-phosphate phos...    239   5e-73    
ref|XP_004958374.1|  PREDICTED: probable trehalose-phosphate phos...    239   7e-73    
ref|NP_001105814.1|  LOC677667                                          239   7e-73    Zea mays [maize]
emb|CDY15842.1|  BnaA04g12690D                                          238   7e-73    
gb|ACF82891.1|  unknown                                                 239   8e-73    Zea mays [maize]
gb|ACF87631.1|  unknown                                                 239   8e-73    Zea mays [maize]
ref|XP_004298659.1|  PREDICTED: probable trehalose-phosphate phos...    239   9e-73    
tpg|DAA63683.1|  TPA: hypothetical protein ZEAMMB73_677696              239   9e-73    
ref|XP_009140332.1|  PREDICTED: probable trehalose-phosphate phos...    239   1e-72    
gb|ADK11431.1|  trehalose-6-phosphate phosphatase                       239   1e-72    
sp|Q6H5L4.2|TPP7_ORYSJ  RecName: Full=Probable trehalose-phosphat...    239   2e-72    Oryza sativa Japonica Group [Japonica rice]
gb|EEE69579.1|  hypothetical protein OsJ_29113                          238   2e-72    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08844.1|  hypothetical protein OsI_31105                          238   2e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_009390913.1|  PREDICTED: probable trehalose-phosphate phos...    239   3e-72    
ref|XP_009409163.1|  PREDICTED: probable trehalose-phosphate phos...    238   4e-72    
ref|XP_010453030.1|  PREDICTED: probable trehalose-phosphate phos...    236   4e-72    
ref|XP_010235584.1|  PREDICTED: probable trehalose-phosphate phos...    237   4e-72    
ref|XP_009390912.1|  PREDICTED: probable trehalose-phosphate phos...    239   5e-72    
ref|XP_006660576.1|  PREDICTED: probable trehalose-phosphate phos...    235   5e-72    
ref|XP_006660121.1|  PREDICTED: probable trehalose-phosphate phos...    235   7e-72    
gb|AAU03490.1|  trehalose-phosphate phosphatase                         237   9e-72    Nicotiana tabacum [American tobacco]
gb|EMS54383.1|  Trehalose-phosphate phosphatase                         234   9e-72    
emb|CDY63411.1|  BnaCnng42030D                                          236   1e-71    
ref|XP_007210565.1|  hypothetical protein PRUPE_ppa014788mg             237   1e-71    
ref|XP_003561584.1|  PREDICTED: probable trehalose-phosphate phos...    236   1e-71    
ref|XP_002461047.1|  hypothetical protein SORBIDRAFT_02g039790          236   1e-71    Sorghum bicolor [broomcorn]
ref|XP_009388774.1|  PREDICTED: probable trehalose-phosphate phos...    236   1e-71    
ref|XP_009609253.1|  PREDICTED: trehalose-phosphate phosphatase A...    236   2e-71    
ref|XP_002461048.1|  hypothetical protein SORBIDRAFT_02g039810          235   2e-71    
ref|XP_008795570.1|  PREDICTED: probable trehalose-phosphate phos...    236   3e-71    
ref|XP_009794086.1|  PREDICTED: trehalose-phosphate phosphatase A       236   3e-71    
ref|XP_009609216.1|  PREDICTED: trehalose-phosphate phosphatase A...    236   4e-71    
ref|XP_006366166.1|  PREDICTED: trehalose-phosphate phosphatase A...    235   4e-71    
ref|XP_010317997.1|  PREDICTED: trehalose-phosphate phosphatase A       234   9e-71    
ref|NP_001141014.1|  uncharacterized protein LOC100273093               234   1e-70    
tpg|DAA39973.1|  TPA: hypothetical protein ZEAMMB73_891232              234   1e-70    
ref|XP_008670591.1|  PREDICTED: probable trehalose-phosphate phos...    231   1e-70    
ref|XP_004964980.1|  PREDICTED: probable trehalose-phosphate phos...    234   2e-70    
gb|ABD92781.1|  sister of ramosa 3                                      229   2e-70    
tpg|DAA41515.1|  TPA: hypothetical protein ZEAMMB73_277907              232   2e-70    
ref|XP_008670589.1|  PREDICTED: probable trehalose-phosphate phos...    231   3e-70    
gb|ABD92784.1|  ramosa 3                                                232   3e-70    
ref|XP_002463212.1|  hypothetical protein SORBIDRAFT_02g039820          232   5e-70    
ref|XP_010477481.1|  PREDICTED: probable trehalose-phosphate phos...    231   6e-70    
gb|KDO56611.1|  hypothetical protein CISIN_1g020273mg                   228   1e-69    
gb|EEE65353.1|  hypothetical protein OsJ_20634                          229   1e-69    
ref|XP_004958373.1|  PREDICTED: probable trehalose-phosphate phos...    231   1e-69    
ref|NP_001140586.1|  uncharacterized protein LOC100272656               231   1e-69    
ref|XP_002467773.1|  hypothetical protein SORBIDRAFT_01g033800          231   1e-69    
ref|XP_003528191.1|  PREDICTED: probable trehalose-phosphate phos...    226   2e-69    
ref|XP_006304608.1|  hypothetical protein CARUB_v10011681mg             229   2e-69    
ref|XP_008670590.1|  PREDICTED: probable trehalose-phosphate phos...    228   3e-69    
ref|XP_006658837.1|  PREDICTED: probable trehalose-phosphate phos...    230   3e-69    
ref|XP_008670588.1|  PREDICTED: probable trehalose-phosphate phos...    229   4e-69    
gb|AEI55390.1|  trehalose-6-phosphate phosphatase                       229   5e-69    
ref|XP_009406609.1|  PREDICTED: probable trehalose-phosphate phos...    229   5e-69    
gb|AAD23621.1|  putative trehalose-6-phosphate phosphatase              226   5e-69    
ref|XP_009390290.1|  PREDICTED: probable trehalose-phosphate phos...    228   6e-69    
ref|XP_010259016.1|  PREDICTED: probable trehalose-phosphate phos...    229   7e-69    
dbj|BAD37685.1|  putative trehalose-phosphatase                         233   8e-69    
ref|XP_011076342.1|  PREDICTED: trehalose-phosphate phosphatase A...    229   9e-69    
ref|NP_001159304.1|  uncharacterized protein LOC100304396               228   9e-69    
ref|XP_010321466.1|  PREDICTED: probable trehalose-phosphate phos...    228   1e-68    
ref|XP_006651451.1|  PREDICTED: probable trehalose-phosphate phos...    226   1e-68    
ref|XP_008651884.1|  PREDICTED: ramosa3 isoform X2                      227   2e-68    
ref|NP_001105864.1|  ramosa3                                            227   3e-68    
ref|XP_011076338.1|  PREDICTED: trehalose-phosphate phosphatase A...    227   9e-68    
ref|XP_011070095.1|  PREDICTED: probable trehalose-phosphate phos...    227   1e-67    
ref|XP_011076341.1|  PREDICTED: trehalose-phosphate phosphatase A...    226   1e-67    
sp|Q10KF5.1|TPP9_ORYSJ  RecName: Full=Probable trehalose-phosphat...    226   1e-67    
dbj|BAD25928.1|  putative trehalose-phosphatase B                       227   1e-67    
ref|XP_011018261.1|  PREDICTED: probable trehalose-phosphate phos...    226   2e-67    
ref|XP_008651883.1|  PREDICTED: ramosa3 isoform X1                      226   2e-67    
gb|ACF22728.1|  trehalose-phosphatase family protein                    225   2e-67    
ref|XP_002532578.1|  trehalose-6-phosphate synthase, putative           226   2e-67    
ref|XP_010498684.1|  PREDICTED: probable trehalose-phosphate phos...    224   2e-67    
gb|EMT18034.1|  Trehalose-phosphate phosphatase                         224   2e-67    
ref|XP_010693684.1|  PREDICTED: trehalose-phosphate phosphatase A...    226   2e-67    
ref|NP_173640.1|  probable trehalose-phosphate phosphatase C            223   3e-67    
ref|NP_001057178.2|  Os06g0222100                                       228   3e-67    
sp|Q0DDI1.3|TPP8_ORYSJ  RecName: Full=Probable trehalose-phosphat...    229   3e-67    
ref|XP_006368175.1|  trehalose-6-phosphate phosphatase family pro...    224   3e-67    
ref|XP_009417373.1|  PREDICTED: probable trehalose-phosphate phos...    222   3e-67    
tpg|DAA61203.1|  TPA: hypothetical protein ZEAMMB73_657005              224   4e-67    
ref|NP_001050255.1|  Os03g0386500                                       223   6e-67    
ref|XP_009128275.1|  PREDICTED: trehalose-phosphate phosphatase B...    224   6e-67    
gb|EYU24964.1|  hypothetical protein MIMGU_mgv1a0091051mg               224   6e-67    
ref|XP_008652634.1|  PREDICTED: probable trehalose-phosphate phos...    225   6e-67    
ref|XP_008234398.1|  PREDICTED: trehalose-phosphate phosphatase A       224   7e-67    
gb|EAZ04762.1|  hypothetical protein OsI_26925                          224   8e-67    
ref|XP_002890499.1|  hypothetical protein ARALYDRAFT_313108             223   8e-67    
ref|XP_006366751.1|  PREDICTED: probable trehalose-phosphate phos...    223   8e-67    
ref|XP_007039915.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    224   8e-67    
gb|EEC75381.1|  hypothetical protein OsI_11847                          222   9e-67    
ref|XP_010446536.1|  PREDICTED: probable trehalose-phosphate phos...    220   1e-66    
ref|NP_001060326.1|  Os07g0624600                                       223   1e-66    
ref|XP_009400695.1|  PREDICTED: probable trehalose-phosphate phos...    223   2e-66    
gb|EMS48520.1|  Trehalose-phosphate phosphatase                         224   2e-66    
ref|XP_010264217.1|  PREDICTED: probable trehalose-phosphate phos...    223   3e-66    
emb|CBI25779.3|  unnamed protein product                                223   3e-66    
ref|XP_004242008.1|  PREDICTED: probable trehalose-phosphate phos...    221   3e-66    
gb|KDP25632.1|  hypothetical protein JCGZ_20788                         223   3e-66    
ref|XP_007018812.1|  Haloacid dehalogenase-like hydrolase superfa...    221   3e-66    
gb|KHG07067.1|  otsB                                                    223   4e-66    
ref|XP_006477242.1|  PREDICTED: probable trehalose-phosphate phos...    223   4e-66    
ref|XP_004516353.1|  PREDICTED: trehalose-phosphate phosphatase A...    222   5e-66    
ref|XP_006440369.1|  hypothetical protein CICLE_v10020410mg             223   6e-66    
ref|XP_002303518.2|  trehalose-6-phosphate phosphatase family pro...    222   6e-66    
ref|XP_007218121.1|  hypothetical protein PRUPE_ppa007023mg             222   7e-66    
gb|KDO48367.1|  hypothetical protein CISIN_1g015439mg                   222   8e-66    
ref|XP_002318886.1|  hypothetical protein POPTR_0012s14700g             222   8e-66    
ref|XP_009394963.1|  PREDICTED: probable trehalose-phosphate phos...    221   1e-65    
ref|XP_009626608.1|  PREDICTED: probable trehalose-phosphate phos...    221   1e-65    
gb|KHG07066.1|  otsB                                                    222   1e-65    
ref|XP_006377097.1|  hypothetical protein POPTR_0012s14700g             221   1e-65    
ref|XP_002264471.2|  PREDICTED: probable trehalose-phosphate phos...    221   1e-65    
gb|EMS61117.1|  Trehalose-phosphate phosphatase                         219   1e-65    
gb|EEC80247.1|  hypothetical protein OsI_22201                          221   1e-65    
ref|XP_010933707.1|  PREDICTED: probable trehalose-phosphate phos...    221   2e-65    
ref|XP_010933704.1|  PREDICTED: probable trehalose-phosphate phos...    221   2e-65    
gb|KHG07065.1|  otsB                                                    222   2e-65    
gb|KDP22419.1|  hypothetical protein JCGZ_26250                         220   2e-65    
ref|XP_006837441.1|  hypothetical protein AMTR_s00107p00077150          219   3e-65    
gb|ABD92782.1|  ramosa 3                                                216   3e-65    
ref|XP_003608755.1|  Trehalose-phosphate phosphatase                    220   3e-65    
ref|XP_010662410.1|  PREDICTED: trehalose-phosphate phosphatase A       220   3e-65    
gb|ABD92785.1|  sister of ramosa 3                                      216   3e-65    
ref|XP_002510945.1|  trehalose-6-phosphate synthase, putative           220   3e-65    
ref|XP_003598212.1|  Trehalose-phosphate phosphatase                    220   5e-65    
ref|XP_011029944.1|  PREDICTED: trehalose-phosphate phosphatase A       219   6e-65    
ref|XP_009788659.1|  PREDICTED: probable trehalose-phosphate phos...    219   6e-65    
ref|XP_008376127.1|  PREDICTED: trehalose-phosphate phosphatase A...    219   7e-65    
ref|XP_010053437.1|  PREDICTED: probable trehalose-phosphate phos...    219   8e-65    
ref|XP_008343697.1|  PREDICTED: trehalose-phosphate phosphatase A...    219   8e-65    
ref|XP_002321830.1|  trehalose-6-phosphate phosphatase family pro...    219   9e-65    
emb|CBI31887.3|  unnamed protein product                                219   1e-64    
ref|XP_011000146.1|  PREDICTED: trehalose-phosphate phosphatase A...    219   1e-64    
ref|XP_001782534.1|  predicted protein                                  217   1e-64    
ref|XP_008343698.1|  PREDICTED: trehalose-phosphate phosphatase A...    218   1e-64    
gb|EAZ40714.1|  hypothetical protein OsJ_25183                          217   2e-64    
gb|KHG09887.1|  Trehalose-phosphate phosphatase                         218   2e-64    
ref|XP_010093689.1|  Trehalose-phosphate phosphatase                    218   2e-64    
ref|XP_003631447.1|  PREDICTED: probable trehalose-phosphate phos...    218   2e-64    
ref|XP_010442651.1|  PREDICTED: trehalose-phosphate phosphatase A...    218   2e-64    
ref|XP_006656791.1|  PREDICTED: probable trehalose-phosphate phos...    214   3e-64    
ref|XP_006355487.1|  PREDICTED: probable trehalose-phosphate phos...    218   3e-64    
ref|XP_006280627.1|  hypothetical protein CARUB_v10026589mg             218   3e-64    
ref|XP_010443302.1|  PREDICTED: trehalose-phosphate phosphatase A...    218   3e-64    
ref|XP_009625712.1|  PREDICTED: probable trehalose-phosphate phos...    218   3e-64    
ref|XP_008652632.1|  PREDICTED: probable trehalose-phosphate phos...    218   4e-64    
ref|XP_010536537.1|  PREDICTED: trehalose-phosphate phosphatase A       217   4e-64    
ref|XP_004245739.1|  PREDICTED: probable trehalose-phosphate phos...    217   4e-64    
ref|XP_007038401.1|  Haloacid dehalogenase-like hydrolase superfa...    217   4e-64    
ref|XP_007155632.1|  hypothetical protein PHAVU_003G218200g             217   5e-64    
ref|XP_010676172.1|  PREDICTED: probable trehalose-phosphate phos...    217   7e-64    
gb|EYU24748.1|  hypothetical protein MIMGU_mgv1a025269mg                216   7e-64    
ref|XP_010053438.1|  PREDICTED: probable trehalose-phosphate phos...    215   8e-64    
ref|XP_003598213.1|  Trehalose-phosphate phosphatase                    214   1e-63    
ref|XP_009374486.1|  PREDICTED: trehalose-phosphate phosphatase A...    216   2e-63    
ref|XP_008376434.1|  PREDICTED: trehalose-phosphate phosphatase A...    216   2e-63    
ref|XP_002438079.1|  hypothetical protein SORBIDRAFT_10g007770          218   2e-63    
ref|XP_009374488.1|  PREDICTED: trehalose-phosphate phosphatase A...    215   2e-63    
ref|XP_008376435.1|  PREDICTED: trehalose-phosphate phosphatase A...    215   2e-63    
ref|XP_009625717.1|  PREDICTED: probable trehalose-phosphate phos...    214   2e-63    
emb|CDP05325.1|  unnamed protein product                                215   3e-63    
ref|XP_004984186.1|  PREDICTED: probable trehalose-phosphate phos...    214   3e-63    
ref|NP_199959.2|  trehalose-phosphate phosphatase A                     215   3e-63    
ref|XP_010482481.1|  PREDICTED: trehalose-phosphate phosphatase A       215   4e-63    
emb|CAA18763.1|  puative protein                                        211   5e-63    
ref|XP_003541164.1|  PREDICTED: trehalose-phosphate phosphatase A...    214   5e-63    
gb|KHN32439.1|  Trehalose-phosphate phosphatase                         214   5e-63    
ref|XP_007038404.1|  Haloacid dehalogenase-like hydrolase superfa...    212   5e-63    
ref|XP_008376433.1|  PREDICTED: trehalose-phosphate phosphatase A...    215   5e-63    
gb|EPS67838.1|  trehalose 6-phosphate phosphatase                       214   5e-63    
ref|XP_011033929.1|  PREDICTED: probable trehalose-phosphate phos...    214   5e-63    
ref|XP_006401974.1|  hypothetical protein EUTSA_v10013801mg             214   6e-63    
ref|XP_007038400.1|  Haloacid dehalogenase-like hydrolase superfa...    216   6e-63    
gb|KDO65466.1|  hypothetical protein CISIN_1g016635mg                   214   7e-63    
gb|ABD92783.1|  sister of ramosa 3                                      210   8e-63    
ref|XP_010261542.1|  PREDICTED: probable trehalose-phosphate phos...    212   9e-63    
ref|NP_001047645.1|  Os02g0661100                                       213   1e-62    
ref|XP_006856571.1|  hypothetical protein AMTR_s00046p00190820          214   1e-62    
emb|CDY00477.1|  BnaA10g07960D                                          213   1e-62    
ref|XP_003534412.1|  PREDICTED: trehalose-phosphate phosphatase A...    213   1e-62    
ref|XP_006421675.1|  hypothetical protein CICLE_v10005151mg             213   1e-62    
ref|XP_004514523.1|  PREDICTED: trehalose-phosphate phosphatase A...    213   1e-62    
ref|XP_006840955.1|  hypothetical protein AMTR_s00085p00016590          214   1e-62    
ref|XP_010442648.1|  PREDICTED: trehalose-phosphate phosphatase A...    213   2e-62    
gb|AFK33570.1|  unknown                                                 211   2e-62    
ref|XP_010443279.1|  PREDICTED: trehalose-phosphate phosphatase A...    213   2e-62    
ref|XP_006280628.1|  hypothetical protein CARUB_v10026589mg             213   2e-62    
gb|KHN11663.1|  Trehalose-phosphate phosphatase                         213   2e-62    
ref|XP_007131344.1|  hypothetical protein PHAVU_011G006000g             213   2e-62    
ref|XP_009372886.1|  PREDICTED: trehalose-phosphate phosphatase A...    213   2e-62    
ref|XP_009370472.1|  PREDICTED: trehalose-phosphate phosphatase A...    213   2e-62    
ref|XP_006600830.1|  PREDICTED: probable trehalose-phosphate phos...    211   2e-62    
ref|XP_004516846.1|  PREDICTED: probable trehalose-phosphate phos...    213   4e-62    
gb|ABD92789.1|  ramosa 3-like protein                                   208   4e-62    
ref|XP_010538762.1|  PREDICTED: probable trehalose-phosphate phos...    212   4e-62    
ref|XP_010919491.1|  PREDICTED: probable trehalose-phosphate phos...    212   5e-62    
ref|XP_009137266.1|  PREDICTED: probable trehalose-phosphate phos...    211   5e-62    
ref|XP_006490109.1|  PREDICTED: trehalose-phosphate phosphatase A...    212   5e-62    
ref|XP_008796838.1|  PREDICTED: probable trehalose-phosphate phos...    211   6e-62    
ref|XP_009402281.1|  PREDICTED: probable trehalose-phosphate phos...    212   7e-62    
ref|XP_010261540.1|  PREDICTED: probable trehalose-phosphate phos...    211   8e-62    
ref|XP_001758437.1|  predicted protein                                  212   9e-62    
gb|EPS71945.1|  hypothetical protein M569_02812                         208   1e-61    
emb|CDY56658.1|  BnaA02g11230D                                          211   1e-61    
ref|NP_001063014.1|  Os09g0369400                                       213   1e-61    
ref|XP_010529491.1|  PREDICTED: probable trehalose-phosphate phos...    211   1e-61    
ref|XP_004307816.1|  PREDICTED: trehalose-phosphate phosphatase A...    211   1e-61    
emb|CDX94103.1|  BnaC07g37370D                                          209   2e-61    
emb|CDX98760.1|  BnaA03g45450D                                          209   2e-61    
ref|XP_006647637.1|  PREDICTED: probable trehalose-phosphate phos...    210   2e-61    
ref|XP_008448886.1|  PREDICTED: probable trehalose-phosphate phos...    211   2e-61    
ref|NP_851171.1|  trehalose-phosphate phosphatase A                     210   2e-61    
ref|XP_010662574.1|  PREDICTED: trehalose-phosphate phosphatase B...    209   3e-61    
ref|XP_010227842.1|  PREDICTED: probable trehalose-phosphate phos...    208   3e-61    
gb|ABD92788.1|  sister of ramosa 3                                      206   3e-61    
ref|XP_008787005.1|  PREDICTED: probable trehalose-phosphate phos...    210   4e-61    
emb|CDX99919.1|  BnaC09g27860D                                          209   4e-61    
ref|XP_002864113.1|  hypothetical protein ARALYDRAFT_495218             209   4e-61    
ref|XP_010321467.1|  PREDICTED: probable trehalose-phosphate phos...    207   4e-61    
ref|XP_010106223.1|  hypothetical protein L484_003381                   210   5e-61    
emb|CBI22538.3|  unnamed protein product                                208   5e-61    
emb|CAN79955.1|  hypothetical protein VITISV_027427                     209   5e-61    
ref|XP_010538763.1|  PREDICTED: probable trehalose-phosphate phos...    207   6e-61    
emb|CDY66417.1|  BnaAnng22210D                                          209   6e-61    
ref|NP_001065336.1|  Os10g0553300                                       209   6e-61    
ref|XP_004953370.1|  PREDICTED: probable trehalose-phosphate phos...    208   7e-61    
ref|XP_004953368.1|  PREDICTED: probable trehalose-phosphate phos...    208   9e-61    
ref|XP_008439088.1|  PREDICTED: trehalose-phosphate phosphatase A       208   1e-60    
gb|EAY79464.1|  hypothetical protein OsI_34594                          209   1e-60    
gb|EYU30313.1|  hypothetical protein MIMGU_mgv1a007850mg                208   2e-60    
ref|XP_009136013.1|  PREDICTED: probable trehalose-phosphate phos...    207   2e-60    
gb|ABD92786.1|  sister of ramosa 3                                      203   2e-60    
ref|XP_004148142.1|  PREDICTED: trehalose-phosphate phosphatase A...    207   3e-60    
ref|XP_006662038.1|  PREDICTED: probable trehalose-phosphate phos...    207   3e-60    
emb|CDX82953.1|  BnaC01g14030D                                          207   3e-60    
gb|KEH29388.1|  trehalose-phosphate phosphatase                         207   3e-60    
ref|XP_003560203.1|  PREDICTED: probable trehalose-phosphate phos...    206   3e-60    
ref|XP_004150651.1|  PREDICTED: probable trehalose-phosphate phos...    207   3e-60    
ref|XP_004167227.1|  PREDICTED: probable trehalose-phosphate phos...    207   3e-60    
ref|XP_009127308.1|  PREDICTED: trehalose-phosphate phosphatase A...    207   3e-60    
ref|XP_008681270.1|  PREDICTED: uncharacterized protein LOC100216...    207   3e-60    
gb|ABD92787.1|  ramosa 3-like protein                                   203   3e-60    
ref|XP_009400886.1|  PREDICTED: probable trehalose-phosphate phos...    207   4e-60    
gb|AFW72664.1|  hypothetical protein ZEAMMB73_205068                    207   4e-60    



>emb|CDP01035.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   340 bits (872),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 180/247 (73%), Positives = 206/247 (83%), Gaps = 15/247 (6%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPA-GAGSFISIPRP---------  592
            MTNQNVV+SD KSG ++ I V++ EP LF  AV KPL A G G+ I   +P         
Sbjct  1    MTNQNVVISDTKSGFSMEIVVSMREPVLFAQAVPKPLAAPGGGTPIIWTKPSLKVLETAG  60

Query  591  --GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
              GRINA  +SMR SSP RRS ESE+VNKSWML+HPSA+SMF++I+  SKGK+IVMFLDY
Sbjct  61   GGGRINAWVDSMRSSSPPRRSSESEEVNKSWMLHHPSALSMFEEIIEVSKGKQIVMFLDY  120

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIVEDPD+AF++ EMRDAVR++A HFPTAIV+GRCRAKVYNFVKLS+LYYAGSHG
Sbjct  121  DGTLSPIVEDPDRAFISNEMRDAVRDIAHHFPTAIVTGRCRAKVYNFVKLSELYYAGSHG  180

Query  237  MDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            MDIKGPT+G+   KGNQ VLCQPAREFLPMI+EVYK LLEKTKS+PGAKVENNKFCLSVH
Sbjct  181  MDIKGPTQGHRYRKGNQTVLCQPAREFLPMIDEVYKTLLEKTKSIPGAKVENNKFCLSVH  240

Query  63   YRCVEEK  43
            YRCVEEK
Sbjct  241  YRCVEEK  247



>ref|XP_004237894.1| PREDICTED: probable trehalose-phosphate phosphatase J [Solanum 
lycopersicum]
Length=365

 Score =   322 bits (824),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 195/246 (79%), Gaps = 22/246 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIP-----------RP  592
            MTNQNV++SDP+SG     +++S       AV  PLP   G FI++P             
Sbjct  1    MTNQNVIISDPRSGFDSSLLSLSP------AVPGPLPQ-PGRFIAVPAKRSFKNIDSTDA  53

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
             RI AL +SMR SSPTRRS E+E++N SW+++HPSA++MFD+I+N SKGK+IV+FLDYDG
Sbjct  54   ARITALLDSMRASSPTRRSSETENLN-SWIVHHPSALNMFDEIINSSKGKQIVVFLDYDG  112

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPDKAFMT EMR+AVRN +K+FPTAIVSGRCRAKV+NFVKLS+LYYAGSHGMD
Sbjct  113  TLSPIVDDPDKAFMTCEMREAVRNTSKYFPTAIVSGRCRAKVFNFVKLSELYYAGSHGMD  172

Query  231  IKGPTKGN--LKG-NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            IK P KG    KG NQ VLCQPAREFLPMI EVYK L+EKTKS+PGAKVENNKFCLSVH+
Sbjct  173  IKAPVKGRNYRKGNNQTVLCQPAREFLPMISEVYKSLVEKTKSIPGAKVENNKFCLSVHF  232

Query  60   RCVEEK  43
            R VEEK
Sbjct  233  RRVEEK  238



>ref|XP_011099372.1| PREDICTED: probable trehalose-phosphate phosphatase D [Sesamum 
indicum]
Length=364

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 192/242 (79%), Gaps = 11/242 (5%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP-------GRI  583
            MTNQN+V+SD KSG+A+ I VA+ E   F  A+    P G  S   + +         R+
Sbjct  1    MTNQNMVISDAKSGLAMAIAVALKESGHFSPAMPVVSPNGYFSRKKLHKKLEANGNGARM  60

Query  582  NALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
            NAL +SMR SSPTRR  ++ED + SW+L+HPSA+SMF++IM  S+GK+IV+FLDYDGTLS
Sbjct  61   NALLDSMRASSPTRRPTDTED-HTSWILHHPSALSMFEEIMRASQGKQIVVFLDYDGTLS  119

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIV+DPD+AF+TTEMR+AVR VA  FPTAIVSGRCRAKVYNFV+LS+LYYAGSHGMDIKG
Sbjct  120  PIVQDPDRAFITTEMREAVRAVANLFPTAIVSGRCRAKVYNFVRLSELYYAGSHGMDIKG  179

Query  222  PTKGNLK--GNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVE  49
            P KG+    GNQ VLCQPAREFLPMI EVY+ L+EK K +PGAKVENNKFCLSVHYRCVE
Sbjct  180  PAKGHTHRTGNQTVLCQPAREFLPMINEVYRALMEKIKHIPGAKVENNKFCLSVHYRCVE  239

Query  48   EK  43
            EK
Sbjct  240  EK  241



>ref|XP_006353999.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Solanum 
tuberosum]
Length=365

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 193/246 (78%), Gaps = 22/246 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIP-----------RP  592
            MTNQNV++SDP+SG        S    F  AV  PLP   G FI++P             
Sbjct  1    MTNQNVIISDPRSGFD------SSLLSFSPAVPGPLPQ-PGRFIAVPAKKSFKNIDSTDA  53

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
             RI AL +SMR SSPTRRS E+E++ KSW+ +HPSA++MFD+I+N SKGK+IV+FLDYDG
Sbjct  54   TRITALLDSMRASSPTRRSSETENL-KSWIDHHPSALNMFDEIINSSKGKQIVVFLDYDG  112

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPDKAFMT+EMR+AV+N +K+FPTAIVSGRCRAKV+NFVKLSQLYYAGSHGMD
Sbjct  113  TLSPIVDDPDKAFMTSEMREAVKNTSKYFPTAIVSGRCRAKVFNFVKLSQLYYAGSHGMD  172

Query  231  IKGPTKGN--LKG-NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            IK P KG    KG NQ VLCQPAREFLPMI EVYK L+EKTKS+PGAKVENNKFCLSVH+
Sbjct  173  IKAPVKGRNYRKGNNQTVLCQPAREFLPMISEVYKSLVEKTKSIPGAKVENNKFCLSVHF  232

Query  60   RCVEEK  43
            R VEEK
Sbjct  233  RRVEEK  238



>ref|XP_011074162.1| PREDICTED: probable trehalose-phosphate phosphatase H [Sesamum 
indicum]
Length=364

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/236 (68%), Positives = 190/236 (81%), Gaps = 6/236 (3%)
 Frame = -2

Query  738  MTNQ-NVVVSDPKSGVA-LIRVAVSEPALFPHAVAKPLPAGA--GSFISIPRPGRINALF  571
            MTNQ N+V+SD KSG+   I VA+SE +  P  V++            S      INA  
Sbjct  1    MTNQANMVISDAKSGLTRAIAVALSE-SFSPQLVSQYFTRKKLLKKLESYGNDAGINAFL  59

Query  570  ESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVE  391
            +SMR SSPTRRS ++E  + SW L HPSA+SMF++IM+ SKGK+IV+FLDYDGTLSPIV+
Sbjct  60   DSMRASSPTRRSSDAEHQD-SWTLRHPSALSMFEEIMDASKGKQIVVFLDYDGTLSPIVD  118

Query  390  DPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKG  211
            DPD+AFMT+EMR+AVR+VAK FPTAIVSGRCRAKVYNFVKLS+LYYAGSHGMDIKGP KG
Sbjct  119  DPDRAFMTSEMREAVRDVAKLFPTAIVSGRCRAKVYNFVKLSELYYAGSHGMDIKGPAKG  178

Query  210  NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            + KGNQ VLCQPAR+FLPMI+EVYK L+EK + +PGAKVENNKFCLSVHYRCVEEK
Sbjct  179  HRKGNQTVLCQPARKFLPMIDEVYKCLIEKIEHIPGAKVENNKFCLSVHYRCVEEK  234



>gb|EYU36516.1| hypothetical protein MIMGU_mgv1a008595mg [Erythranthe guttata]
Length=368

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/241 (66%), Positives = 188/241 (78%), Gaps = 11/241 (5%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVS--EPALFPHAVAKPLPAGAGSFI------SIPRPGRI  583
            MTNQ++VVSD K+G+ +    V+  +PALF  + AKPL +  G F        +   G  
Sbjct  1    MTNQSMVVSDAKTGLTMGISTVTRPDPALF--SSAKPLVSPNGYFSRKKLVKKLESCGNG  58

Query  582  NALFESMRDSSPTRRSFESEDVN-KSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
              L +SMR SSPTR      D +  SW  +HPSA+SMF++IM  SKGK+IV+FLDYDGTL
Sbjct  59   ARLLDSMRASSPTRTRLNDTDPDPNSWTAHHPSALSMFEEIMGESKGKEIVVFLDYDGTL  118

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIVEDPD+AFMTTEMR+AVR+VAK FPTAIVSGRCRAKVYNFV+LS+LYYAGSHGMDIK
Sbjct  119  SPIVEDPDRAFMTTEMREAVRDVAKFFPTAIVSGRCRAKVYNFVRLSELYYAGSHGMDIK  178

Query  225  GPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEE  46
            GP KG  KGN+ VLCQPAREFLPMI+EV+K L+EK K +PGAKVENNKFCLSVHYRCVEE
Sbjct  179  GPAKGPRKGNKTVLCQPAREFLPMIDEVFKSLIEKMKHIPGAKVENNKFCLSVHYRCVEE  238

Query  45   K  43
            K
Sbjct  239  K  239



>ref|XP_002301043.2| hypothetical protein POPTR_0002s09510g [Populus trichocarpa]
 gb|EEE80316.2| hypothetical protein POPTR_0002s09510g [Populus trichocarpa]
Length=371

 Score =   312 bits (799),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 188/247 (76%), Gaps = 14/247 (6%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP---------GR  586
            MTNQNVVV D K G+ +    V   +LF   V KPLPA  G + +I R          G+
Sbjct  1    MTNQNVVVPDAKQGIDITIAMVLPKSLFSPVVPKPLPAAPGGYFTITRKRFSKKTETGGK  60

Query  585  INALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
            I++  +SMRDSSPTR     S    +   SW++NHPSA++MF+ I+  SKGK+IVMFLDY
Sbjct  61   ISSWVDSMRDSSPTRVKSTTSLSETEEKNSWIVNHPSALNMFEQIVKGSKGKQIVMFLDY  120

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIVEDPD+AFMT EMR+AVR+VA++FPTAIV+GRCR KVY+FV+L+ LYYAGSHG
Sbjct  121  DGTLSPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRKKVYSFVRLAGLYYAGSHG  180

Query  237  MDIKGPTKGNLKGNQ-AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            MDIKGP+K N K  +  VL QPA EFLPMI+EVY VLLE+TKS+PGAKVENNKFC+SVH+
Sbjct  181  MDIKGPSKNNCKYEKGGVLFQPASEFLPMIDEVYNVLLERTKSIPGAKVENNKFCVSVHF  240

Query  60   RCVEEKV  40
            RCVEEK+
Sbjct  241  RCVEEKM  247



>ref|XP_009587491.1| PREDICTED: probable trehalose-phosphate phosphatase H [Nicotiana 
tomentosiformis]
Length=365

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/247 (64%), Positives = 187/247 (76%), Gaps = 23/247 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG----------  589
            MTNQNV+VSDP+SG+    ++ S                 G FI++P             
Sbjct  1    MTNQNVIVSDPRSGLESSFLSFS-------PAVPGPLPPPGRFIAVPAKKTFKNIESAAG  53

Query  588  --RINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
              RI AL +SMR SSP RRS E+E++ KSW+++HPSA+ MF++I+N SKGK+I+MFLDYD
Sbjct  54   DHRITALLDSMRASSPPRRSSETENL-KSWIVHHPSALDMFEEIINASKGKQIIMFLDYD  112

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPDKAFMT EMR+AVR+ AK+FPTAIVSGRCRAKV+NFVKLS+LYYAGSHGM
Sbjct  113  GTLSPIVDDPDKAFMTAEMREAVRDTAKYFPTAIVSGRCRAKVFNFVKLSELYYAGSHGM  172

Query  234  DIKGPTKGNL---KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            DIK P KG       NQ VLCQPAREFLPMI+EVYK L+EKTKS+PGAKVENNKFCLSVH
Sbjct  173  DIKAPAKGRKYRNGNNQTVLCQPAREFLPMIDEVYKSLVEKTKSIPGAKVENNKFCLSVH  232

Query  63   YRCVEEK  43
            +R VEEK
Sbjct  233  FRRVEEK  239



>ref|XP_011016259.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Populus euphratica]
Length=314

 Score =   308 bits (789),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 192/248 (77%), Gaps = 16/248 (6%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEP-ALFPHAVAKPLPAGAGSFISIPR---------PG  589
            MTNQNVVV D K G+  I +A++ P +LF   V KPLPA  G + +I R          G
Sbjct  1    MTNQNVVVPDAKQGID-ITIAMALPQSLFSPVVPKPLPAAPGGYFTITRNRFSKKTEAGG  59

Query  588  RINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            +I++  +SMRDSSPTR     S    +   SW++NHPSA++MF+ I+  SKGK+IVMFLD
Sbjct  60   KISSWVDSMRDSSPTRVKSTTSLSETEEKNSWIVNHPSALNMFEQIVKGSKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIVEDPD+AFMT EMR+AVR+VA++FPTAIV+GRCR KVY+FV+L+ LYYAGSH
Sbjct  120  YDGTLSPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRNKVYSFVRLAGLYYAGSH  179

Query  240  GMDIKGPTKGNLKGNQ-AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            GMDIKGP+K N K  +  VL QPA EFLPMI+EVY VLLE+TKS+PGA+VENNKFC+SVH
Sbjct  180  GMDIKGPSKNNCKYQKGGVLFQPASEFLPMIDEVYNVLLERTKSIPGAQVENNKFCVSVH  239

Query  63   YRCVEEKV  40
            +RCVEEK+
Sbjct  240  FRCVEEKM  247



>ref|XP_009779130.1| PREDICTED: probable trehalose-phosphate phosphatase H [Nicotiana 
sylvestris]
Length=368

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 187/250 (75%), Gaps = 26/250 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTNQNV+VSDP+SG+    ++ S                 G FI++P             
Sbjct  1    MTNQNVIVSDPRSGLESSFLSFS-------PAVPGPLPPPGRFIAVPAKKSFKNIESAAG  53

Query  594  ---PGRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
                 RI AL +SMR SSP RRS E+E++ KSW+++HPSA+ MF++I+N SKGK+I+MFL
Sbjct  54   DHGANRITALLDSMRASSPPRRSSETENL-KSWIVHHPSALDMFEEIINASKGKQIIMFL  112

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFMT EMR+AVR+ AK+FPTAIVSGRCRAKV+NFVKLS+LYYAGS
Sbjct  113  DYDGTLSPIVDDPDKAFMTAEMREAVRDTAKYFPTAIVSGRCRAKVFNFVKLSELYYAGS  172

Query  243  HGMDIKGPTKGNL---KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIK P KG       NQ VLCQPAREFLPMI+EVYK L+EKTKS+PGAKVENNKFCL
Sbjct  173  HGMDIKAPAKGRKYRNGNNQTVLCQPAREFLPMIDEVYKSLVEKTKSIPGAKVENNKFCL  232

Query  72   SVHYRCVEEK  43
            SVH+R VEEK
Sbjct  233  SVHFRRVEEK  242



>ref|XP_011016253.1| PREDICTED: probable trehalose-phosphate phosphatase C isoform 
X1 [Populus euphratica]
Length=367

 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 192/248 (77%), Gaps = 16/248 (6%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEP-ALFPHAVAKPLPAGAGSFISIPR---------PG  589
            MTNQNVVV D K G+  I +A++ P +LF   V KPLPA  G + +I R          G
Sbjct  1    MTNQNVVVPDAKQGID-ITIAMALPQSLFSPVVPKPLPAAPGGYFTITRNRFSKKTEAGG  59

Query  588  RINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            +I++  +SMRDSSPTR     S    +   SW++NHPSA++MF+ I+  SKGK+IVMFLD
Sbjct  60   KISSWVDSMRDSSPTRVKSTTSLSETEEKNSWIVNHPSALNMFEQIVKGSKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIVEDPD+AFMT EMR+AVR+VA++FPTAIV+GRCR KVY+FV+L+ LYYAGSH
Sbjct  120  YDGTLSPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRNKVYSFVRLAGLYYAGSH  179

Query  240  GMDIKGPTKGNLKGNQ-AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            GMDIKGP+K N K  +  VL QPA EFLPMI+EVY VLLE+TKS+PGA+VENNKFC+SVH
Sbjct  180  GMDIKGPSKNNCKYQKGGVLFQPASEFLPMIDEVYNVLLERTKSIPGAQVENNKFCVSVH  239

Query  63   YRCVEEKV  40
            +RCVEEK+
Sbjct  240  FRCVEEKM  247



>ref|XP_011043568.1| PREDICTED: probable trehalose-phosphate phosphatase C [Populus 
euphratica]
Length=374

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 187/250 (75%), Gaps = 18/250 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP---------GR  586
            MTNQNVVV + + GV +        +LF   V KPLPA  G + +I R          G+
Sbjct  1    MTNQNVVVPNARKGVDITIAMALSKSLFSPVVPKPLPAAPGGYFTISRKMFAKKTETGGK  60

Query  585  INALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
             N   +SMRDSSPTR      S E E+ N +W++NHPSA++MF+ I+N SKGK+IVMFLD
Sbjct  61   TNFWADSMRDSSPTRVKSTTSSSEIEEKN-NWIVNHPSALNMFEQIVNVSKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIVEDPD+AFMT EMR+AVR+VA++FPTAIV+GRCR KVY+FV+L+ LYYAGSH
Sbjct  120  YDGTLSPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRDKVYSFVRLAGLYYAGSH  179

Query  240  GMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            GMDIKGP+K    N K  Q VL QPA EFLPMI+EVY VLLE+ K +PGA+VE+NKFCLS
Sbjct  180  GMDIKGPSKNGCRNKKDYQGVLFQPASEFLPMIDEVYNVLLERIKYIPGARVEDNKFCLS  239

Query  69   VHYRCVEEKV  40
            VH+RCVEEK+
Sbjct  240  VHFRCVEEKM  249



>ref|XP_011097592.1| PREDICTED: probable trehalose-phosphate phosphatase J [Sesamum 
indicum]
Length=386

 Score =   302 bits (773),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 187/250 (75%), Gaps = 19/250 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP----------  592
            MTNQNVVV D KSG+ + I VAVS  +LF  A  KP PA  G++I+I +           
Sbjct  1    MTNQNVVVPDAKSGINMAITVAVSGSSLFSSAAQKP-PAVPGTYITISKKKLLQNLDINT  59

Query  591  -GRINALFESMRDSSPTRRSFES----EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMF  427
              RINA  +SMR SSPT     S    +D + SW ++HPSA+ MF+ I N SKGK+IVMF
Sbjct  60   GARINAWVDSMRASSPTHIKSSSPHLSDDHHNSWTMHHPSALDMFEQITNASKGKQIVMF  119

Query  426  LDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAG  247
            LDYDGTLSPIV+DPD+AFM+  MR  VR VA++FPTAIVSGRCR KVY+FV+L++LYYAG
Sbjct  120  LDYDGTLSPIVDDPDRAFMSDSMRATVRKVARYFPTAIVSGRCRDKVYSFVRLAELYYAG  179

Query  246  SHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            SHGMDIKGP+KG+   KG +AVL QPA E+LPMI+EVYK LLE TK  PGAKVENNKFCL
Sbjct  180  SHGMDIKGPSKGSKYKKGAEAVLFQPASEYLPMIDEVYKALLEVTKDTPGAKVENNKFCL  239

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  240  SVHFRCVDEK  249



>ref|XP_002263078.1| PREDICTED: probable trehalose-phosphate phosphatase J [Vitis 
vinifera]
 emb|CBI40999.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 184/241 (76%), Gaps = 10/241 (4%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIP-----RPGRINA  577
            MT QNVVV+D KSG+ + I + VS  +LF  AV K      G  I+IP        RINA
Sbjct  1    MTRQNVVVADSKSGINVAITMTVSNSSLFTKAVQKTRETQGGC-INIPPKKVGGGARINA  59

Query  576  LFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSP  400
              +SMR SSPTR +S  S     SWML HPSA++MF+ I+  SKGK+IVMFLDYDGTLSP
Sbjct  60   WVDSMRASSPTRVKSAASLSDQNSWMLRHPSALNMFEQIIEASKGKQIVMFLDYDGTLSP  119

Query  399  IVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGP  220
            IV+DPD+AFM+  MR AVR +A++FPTAIVSGRCR KVYNFV+L++LYYAGSHGMDIKGP
Sbjct  120  IVDDPDRAFMSDAMRAAVRQLARYFPTAIVSGRCRDKVYNFVRLAELYYAGSHGMDIKGP  179

Query  219  TKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEE  46
             KG+   K  +AVL QPA EFLPMI+EVYK LLEKTKS+PGA VE+NKFCLSVHYRCV+E
Sbjct  180  AKGSKYKKETKAVLFQPASEFLPMIDEVYKALLEKTKSIPGASVEHNKFCLSVHYRCVDE  239

Query  45   K  43
            K
Sbjct  240  K  240



>ref|XP_011090521.1| PREDICTED: probable trehalose-phosphate phosphatase J [Sesamum 
indicum]
Length=379

 Score =   300 bits (767),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 187/239 (78%), Gaps = 8/239 (3%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGA-GSFISIPR---PGRINAL  574
            MT QN+VV+D K+G+ + I +AVS  +LF  A  +P PA   G +I+I R     RINA 
Sbjct  1    MTKQNMVVADAKTGINVAISMAVSGSSLFTTAAQRPPPAAVPGPYITISRINNGARINAW  60

Query  573  FESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPI  397
             +SMR SSPTR ++    D   SW+L+HPSA+ MF+ I + SKGK+IVMFLDYDGTLSPI
Sbjct  61   VDSMRASSPTRIKASSLSDDQDSWILHHPSALDMFEQITSASKGKQIVMFLDYDGTLSPI  120

Query  396  VEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPT  217
            V+DPD+AFM+  MR  VR +A++FPTAIVSGRCR KVY+FV+L++LYYAGSHGMDIKGP+
Sbjct  121  VDDPDRAFMSEAMRATVRKLARYFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMDIKGPS  180

Query  216  KGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEE  46
            KG+   KG QAVL QPA EFLPMI+EVYK LLE TKS PGA+VENNKFC+SVH+RCV+E
Sbjct  181  KGSKYKKGAQAVLFQPASEFLPMIDEVYKALLEVTKSTPGARVENNKFCVSVHFRCVDE  239



>ref|XP_009595324.1| PREDICTED: probable trehalose-phosphate phosphatase J [Nicotiana 
tomentosiformis]
Length=390

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/253 (62%), Positives = 186/253 (74%), Gaps = 23/253 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-----IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP------  592
            MT QNVVVSDPKSG+ L     ++V  + PALF  AV KP PA  GS I+I R       
Sbjct  1    MTQQNVVVSDPKSGINLAISVKLQVPSNSPALFTTAVQKPPPA-PGSCITISRKTLVEIN  59

Query  591  -----GRINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKI  436
                  RIN+  +SMR SSPT        S+D+N SW + HPSA+ MF+ I+  SKGK+I
Sbjct  60   GNNNGARINSWVDSMRASSPTHHKSTPPLSDDIN-SWTVQHPSALDMFEQIITASKGKQI  118

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMFLDYDGTLSPIVEDPD+AFM+  MR  VR +A++FPTAIVSGRCR KVYNFV+L++LY
Sbjct  119  VMFLDYDGTLSPIVEDPDQAFMSEAMRATVRKLARYFPTAIVSGRCRDKVYNFVRLAELY  178

Query  255  YAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            YAGSHGMDIKGP+KG+   KG +AVLCQPA EFLPMI+EVYK L++ TKS  G  VENNK
Sbjct  179  YAGSHGMDIKGPSKGSKYKKGAEAVLCQPASEFLPMIDEVYKALIDATKSTEGVIVENNK  238

Query  81   FCLSVHYRCVEEK  43
            FC SVH+RCV+EK
Sbjct  239  FCASVHFRCVDEK  251



>ref|XP_006472627.1| PREDICTED: probable trehalose-phosphate phosphatase D-like [Citrus 
sinensis]
 gb|KDO80922.1| hypothetical protein CISIN_1g017025mg [Citrus sinensis]
Length=379

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 189/256 (74%), Gaps = 26/256 (10%)
 Frame = -2

Query  738  MTNQNVVV-SDPKSG-VAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG-------  589
            MTNQNVVV SD KS  + L I V ++   LF  A +K LPA  G FI+I R         
Sbjct  1    MTNQNVVVASDRKSSNIGLKITVTLTNSTLFSGADSKALPAPGGGFITISRKNILRKPTD  60

Query  588  -------RINALFESMRDSSPTRR------SFESEDVNKSWMLNHPSAISMFDDIMNFSK  448
                   +INA   S+R SSPTR       S ++E+   SW+  HPSA+S F++I+N SK
Sbjct  61   TTDQGGNKINAWVNSLRASSPTRLKSSIAFSPQTEE-QTSWIARHPSALSKFEEIVNASK  119

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GKKIVMFLDYDGTL+PIVEDPD+AFMT EMR+AVR+VA++FPTAIV+GRCR KV++FVKL
Sbjct  120  GKKIVMFLDYDGTLAPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRDKVFSFVKL  179

Query  267  SQLYYAGSHGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKV  94
            + LYYAGSHGMDI+GP+K     KGN  VLCQPA EFLPMI EVY+ LLEKTKS+PGAKV
Sbjct  180  AGLYYAGSHGMDIEGPSKKRRYKKGNHGVLCQPASEFLPMINEVYQTLLEKTKSIPGAKV  239

Query  93   ENNKFCLSVHYRCVEE  46
            ENNKFCLSVH+RCV+E
Sbjct  240  ENNKFCLSVHFRCVDE  255



>ref|XP_002284201.1| PREDICTED: probable trehalose-phosphate phosphatase J [Vitis 
vinifera]
 emb|CBI19142.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 184/248 (74%), Gaps = 17/248 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIP----------RP  592
            MTNQNV VSDPKS + + I V VS  + F  AV KP P   G +I+I             
Sbjct  1    MTNQNVAVSDPKSAIGMAIDVIVSNSSFFSPAVRKP-PTVPGGYITISLKKLETGGAGGA  59

Query  591  GRINALFESMRDSSPTR---RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            GR+ A  +SMR SSPT          +   SWML+HPSA+  F+ I N S+GK+IVMFLD
Sbjct  60   GRVGAWVDSMRASSPTHIKSTPLSDSEALSSWMLHHPSALRTFEQITNASEGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIVEDPD+AFM+ EMR AV++VA++FPTAIVSGRCR KVY FVKLS+LYYAGSH
Sbjct  120  YDGTLSPIVEDPDQAFMSKEMRAAVKDVARYFPTAIVSGRCRDKVYRFVKLSELYYAGSH  179

Query  240  GMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGP KG    KG+Q++LCQPA EFLPMI+EVYK LLEKTKS PGAKVENNKFCLSV
Sbjct  180  GMDIKGPAKGRKYKKGDQSLLCQPASEFLPMIDEVYKALLEKTKSTPGAKVENNKFCLSV  239

Query  66   HYRCVEEK  43
            H+RCV+E+
Sbjct  240  HFRCVDEQ  247



>ref|XP_008234617.1| PREDICTED: probable trehalose-phosphate phosphatase J [Prunus 
mume]
Length=344

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 185/253 (73%), Gaps = 23/253 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVA--LIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MT QNVVVSD ++ +    I VAVS  ++F     KP P G   +ISI R          
Sbjct  1    MTKQNVVVSDAEAEIMNMAISVAVSNSSIFTAVAEKP-PVGPPGYISISRKRFLNLKNLD  59

Query  594  ----PGRINALFESMRDSSPTR---RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKI  436
                  RIN+  +SMR SSPT     SF  ED   SW+L HPSA+ MF+ I++ SKGK+I
Sbjct  60   SINGAERINSWVDSMRASSPTHLKSSSFLKED-QSSWILQHPSALDMFEQIIDASKGKQI  118

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMF+DYDGTLSPIVEDPD+AFM+  MR+ V+ VA+ FPTAIVSGRCR KVY FV+L++LY
Sbjct  119  VMFMDYDGTLSPIVEDPDQAFMSDAMRETVKKVARCFPTAIVSGRCRDKVYKFVRLAELY  178

Query  255  YAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            YAGSHGMDIKGP KG+   KG+Q VLCQPA EFLPMI+EVYK+L+EKTKS PGAKVENNK
Sbjct  179  YAGSHGMDIKGPAKGSKYKKGSQGVLCQPASEFLPMIDEVYKLLVEKTKSTPGAKVENNK  238

Query  81   FCLSVHYRCVEEK  43
            FCLSVH+RCV+EK
Sbjct  239  FCLSVHFRCVDEK  251



>ref|XP_006434015.1| hypothetical protein CICLE_v10001513mg [Citrus clementina]
 gb|ESR47255.1| hypothetical protein CICLE_v10001513mg [Citrus clementina]
Length=379

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 189/256 (74%), Gaps = 26/256 (10%)
 Frame = -2

Query  738  MTNQNVVV-SDPK-SGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG-------  589
            MTNQNVVV SD K S + L I V ++   LF  A +K LPA  G FI+I R         
Sbjct  1    MTNQNVVVASDRKFSNIGLKITVTLTNSTLFSGADSKALPAPGGGFITISRKNILRKPTD  60

Query  588  -------RINALFESMRDSSPTRR------SFESEDVNKSWMLNHPSAISMFDDIMNFSK  448
                   +INA   S+R SSPTR       S ++E+   SW+  HPSA+S F++I+N SK
Sbjct  61   TSDQGGNKINAWVNSLRASSPTRLKSSVAFSPQTEE-QTSWIARHPSALSKFEEIVNASK  119

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GKKIVMFLDYDGTL+PIVEDPD+AFMT EMR+AVR+VA++FPTAIV+GRCR KV++FVKL
Sbjct  120  GKKIVMFLDYDGTLAPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRDKVFSFVKL  179

Query  267  SQLYYAGSHGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKV  94
            + LYYAGSHGMDI+GP+K     KGN  VLCQPA EFLPMI EVY+ LLEKTKS+PGAKV
Sbjct  180  AGLYYAGSHGMDIEGPSKKRRYKKGNHGVLCQPASEFLPMINEVYQTLLEKTKSIPGAKV  239

Query  93   ENNKFCLSVHYRCVEE  46
            ENNKFCLSVH+RCV+E
Sbjct  240  ENNKFCLSVHFRCVDE  255



>ref|XP_006434014.1| hypothetical protein CICLE_v10001513mg [Citrus clementina]
 gb|ESR47254.1| hypothetical protein CICLE_v10001513mg [Citrus clementina]
Length=373

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 189/256 (74%), Gaps = 26/256 (10%)
 Frame = -2

Query  738  MTNQNVVV-SDPK-SGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG-------  589
            MTNQNVVV SD K S + L I V ++   LF  A +K LPA  G FI+I R         
Sbjct  1    MTNQNVVVASDRKFSNIGLKITVTLTNSTLFSGADSKALPAPGGGFITISRKNILRKPTD  60

Query  588  -------RINALFESMRDSSPTRR------SFESEDVNKSWMLNHPSAISMFDDIMNFSK  448
                   +INA   S+R SSPTR       S ++E+   SW+  HPSA+S F++I+N SK
Sbjct  61   TSDQGGNKINAWVNSLRASSPTRLKSSVAFSPQTEE-QTSWIARHPSALSKFEEIVNASK  119

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GKKIVMFLDYDGTL+PIVEDPD+AFMT EMR+AVR+VA++FPTAIV+GRCR KV++FVKL
Sbjct  120  GKKIVMFLDYDGTLAPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRDKVFSFVKL  179

Query  267  SQLYYAGSHGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKV  94
            + LYYAGSHGMDI+GP+K     KGN  VLCQPA EFLPMI EVY+ LLEKTKS+PGAKV
Sbjct  180  AGLYYAGSHGMDIEGPSKKRRYKKGNHGVLCQPASEFLPMINEVYQTLLEKTKSIPGAKV  239

Query  93   ENNKFCLSVHYRCVEE  46
            ENNKFCLSVH+RCV+E
Sbjct  240  ENNKFCLSVHFRCVDE  255



>ref|XP_002307096.1| trehalose-6-phosphate phosphatase family protein [Populus trichocarpa]
 gb|ABK94249.1| unknown [Populus trichocarpa]
 gb|EEE94092.1| trehalose-6-phosphate phosphatase family protein [Populus trichocarpa]
Length=373

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 184/248 (74%), Gaps = 17/248 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP----------  592
            MTNQNVVV+D  SG+ L I V V+  ++F  A  KP PA  G +ISI R           
Sbjct  1    MTNQNVVVADTNSGINLAITVHVTNSSIFTTAAQKP-PAAPGGYISISRKKLLKNLEISG  59

Query  591  -GRINALFESMRDSSPT--RRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
              R NA   SMR SSPT  + +  + D   SW+L+HPSA+ MF+ I++ SKGK+IVMFLD
Sbjct  60   GARFNAWVNSMRTSSPTHVKSTPSANDDQSSWILHHPSALEMFEQIIDASKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPD+AFM+ +MR  VR +A+ FPTAIVSGRCR KVYNFV+L++LYYAGSH
Sbjct  120  YDGTLSPIVDDPDRAFMSKKMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSH  179

Query  240  GMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGP KG+   KG++ V+ Q   EFLPMI+EVYK L+EKTK+ PGAKVENNKFCLSV
Sbjct  180  GMDIKGPAKGSKYKKGSEGVVFQAGSEFLPMIDEVYKELVEKTKTTPGAKVENNKFCLSV  239

Query  66   HYRCVEEK  43
            HYRCV+EK
Sbjct  240  HYRCVDEK  247



>ref|XP_002533145.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF29241.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=373

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 186/249 (75%), Gaps = 19/249 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP----------  592
            MTNQNVVV+D KS + L   V VS  ++F  AV KP PA  G +ISI R           
Sbjct  1    MTNQNVVVADAKSTINLATTVHVSNSSIFTTAVQKP-PAAPGGYISISRKKLLKNLEING  59

Query  591  -GRINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
              RINA  +SMR SSPT        +ED   SW L+HPSA+ MF+ I++ SKGK+IVMFL
Sbjct  60   GARINAWVDSMRASSPTHLKSTPSLTED-QGSWTLHHPSALDMFEQIIDASKGKQIVMFL  118

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPD+AFM+ +MR  VR +AK FPTAIVSGRCR KVYNFV+L++LYYAGS
Sbjct  119  DYDGTLSPIVDDPDRAFMSKKMRATVRKLAKCFPTAIVSGRCRDKVYNFVRLAELYYAGS  178

Query  243  HGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            HGMDIKGP KG+   KG++A++ QPA EFLPMI+EVYK L+EKTKS PGA VENNKFC+S
Sbjct  179  HGMDIKGPAKGSKYKKGSEALIFQPASEFLPMIDEVYKELVEKTKSTPGAFVENNKFCVS  238

Query  69   VHYRCVEEK  43
            VHYRCV+EK
Sbjct  239  VHYRCVDEK  247



>ref|XP_007205367.1| hypothetical protein PRUPE_ppa007221mg [Prunus persica]
 gb|EMJ06566.1| hypothetical protein PRUPE_ppa007221mg [Prunus persica]
Length=377

 Score =   296 bits (758),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 183/253 (72%), Gaps = 23/253 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVA--LIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MT QNVVVSD ++ +    I VAVS  ++F     KP P G   +ISI R          
Sbjct  1    MTKQNVVVSDAEAEIMNMAISVAVSNSSIFTAVAEKP-PVGPPGYISISRKRFLNLKNLD  59

Query  594  ----PGRINALFESMRDSSPTR---RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKI  436
                  RIN+  +SMR SSPT     SF  ED   SW+L HPSA+ MF+ I++ SKGK+I
Sbjct  60   SINGAERINSWVDSMRASSPTHLKSSSFLKED-QSSWILQHPSALDMFEQIIDASKGKQI  118

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMF+DYDGTLSPIVEDPD+AFM+  MR  V+ VA+ FPTAIVSGRCR KVY FVKL++LY
Sbjct  119  VMFMDYDGTLSPIVEDPDRAFMSDAMRKTVKKVARCFPTAIVSGRCRDKVYKFVKLAELY  178

Query  255  YAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            YAGSHGMDIKGP KG+    G+Q VLCQPA EFLPMI+EVYK+L+EKTKS PGAKVENNK
Sbjct  179  YAGSHGMDIKGPAKGSKYKTGSQGVLCQPASEFLPMIDEVYKLLVEKTKSTPGAKVENNK  238

Query  81   FCLSVHYRCVEEK  43
            FCLSVH+RCV+EK
Sbjct  239  FCLSVHFRCVDEK  251



>ref|XP_002310573.1| trehalose-6-phosphate phosphatase family protein [Populus trichocarpa]
 gb|EEE91023.1| trehalose-6-phosphate phosphatase family protein [Populus trichocarpa]
Length=374

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 187/248 (75%), Gaps = 17/248 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP----------  592
            MTNQNVVV+D  SG+ L I V V+  ++F  A  KP PA  G +ISI R           
Sbjct  1    MTNQNVVVADTNSGLNLAITVHVTNSSIFTTAAQKP-PAAPGGYISISRKKLLKNLEING  59

Query  591  -GRINALFESMRDSSPTR-RSFESEDVNKS-WMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
              RINA  +SMR SSPT  +S  S + ++S W+L+HPSA+ MF+ I++ SKGK+IVMFLD
Sbjct  60   GARINAWVDSMRASSPTHIKSTPSVNEDQSSWILHHPSALEMFEQIIDASKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPDKAFM+ +MR  VR +A+ FPTAIVSGRCR KVYNFV+L++LYYAGSH
Sbjct  120  YDGTLSPIVDDPDKAFMSKQMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSH  179

Query  240  GMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGP KG+   KG   V+ Q A EFLPMI+EVY+ L+EKTK+ PGAKVENNKFCLSV
Sbjct  180  GMDIKGPAKGSKYKKGGDGVVFQAASEFLPMIDEVYEELVEKTKTTPGAKVENNKFCLSV  239

Query  66   HYRCVEEK  43
            HYRCV+EK
Sbjct  240  HYRCVDEK  247



>ref|XP_004237406.1| PREDICTED: probable trehalose-phosphate phosphatase J [Solanum 
lycopersicum]
Length=388

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 187/251 (75%), Gaps = 21/251 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL---IRVAVS-EPALFPHAVAKPLPAGAGSFISIPR--------  595
            MT QNVVVSDPKSG+ L   ++V VS   ALF  A  KP P G GS I+I R        
Sbjct  1    MTQQNVVVSDPKSGINLTIPVKVPVSNSSALFTTAAQKP-PPGPGSCITISRKTLLEING  59

Query  594  --PGRINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
                RIN+  ESMR SSPT        S+D+N SWM+ HPSA+ MF+ I++ SKGK+IVM
Sbjct  60   NNSARINSWVESMRASSPTHHKSSPALSDDLN-SWMVQHPSALDMFEQIISASKGKQIVM  118

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIVEDPD+AFM+  MR  VR +A++FPTAIVSGRCR KVY+FV+L++LYYA
Sbjct  119  FLDYDGTLSPIVEDPDQAFMSDSMRATVRKLARYFPTAIVSGRCRDKVYSFVRLAELYYA  178

Query  249  GSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            GSHGMDIKGP+KG+   KG QAVL QPA EFLPMI+EVYK L++ TKS  G +VENNKFC
Sbjct  179  GSHGMDIKGPSKGSKYKKGAQAVLFQPASEFLPMIDEVYKELVDITKSTEGVRVENNKFC  238

Query  75   LSVHYRCVEEK  43
             SVH+RCV+EK
Sbjct  239  ASVHFRCVDEK  249



>ref|XP_009373162.1| PREDICTED: probable trehalose-phosphate phosphatase D [Pyrus 
x bretschneideri]
Length=375

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 190/254 (75%), Gaps = 25/254 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLP-AGAGSFISIPR-----------  595
            MTNQNV+VS+ K GVA I+V V++ A+F  +V KP+   G G   +IP            
Sbjct  1    MTNQNVLVSEAK-GVA-IKVTVAKKAMFSQSVPKPMTEGGGGGCFTIPMNIKVLKVDTEG  58

Query  594  -PGRINALFESMRDSSPTR------RSF-ESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
               R+NA  +S+R SSPTR      +S  E+ D N SW ++HPSA+SMF+ I N SKGK+
Sbjct  59   GAARVNAWVDSLRASSPTRVKSATPQSLSETVDYN-SWTIHHPSAMSMFEQITNASKGKQ  117

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPD+AFM+ EMR AVR  A++FPTAIVSGRCR KVY+FVKL +L
Sbjct  118  IVMFLDYDGTLSPIVEDPDRAFMSNEMRKAVRATARYFPTAIVSGRCRDKVYSFVKLGEL  177

Query  258  YYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDI+GP+K +     NQAVL QPA EF+PMI+EVYK LLEKT+S+ GA+VENN
Sbjct  178  YYAGSHGMDIRGPSKSSKYKNDNQAVLFQPASEFVPMIDEVYKTLLEKTRSISGARVENN  237

Query  84   KFCLSVHYRCVEEK  43
            KFCLSVH+RCV+EK
Sbjct  238  KFCLSVHFRCVDEK  251



>ref|XP_002513897.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF48480.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=369

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 186/244 (76%), Gaps = 11/244 (5%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPL----PAGAGSFISIPRPGRINAL  574
            MTNQNVV ++ K  + + IRV + +    P  V KPL    P  A    +     R +  
Sbjct  1    MTNQNVVSTEAKLRIDIRIRVLLPKSLFSPAVVPKPLLLPAPKLANKMETRVTGVRTSTW  60

Query  573  FESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
             +SMRDSSPTR     S    +   SW++NHPSA+S+F+ I+N SKGK+IVMFLDYDGTL
Sbjct  61   VDSMRDSSPTRVKSTASLSEIEEKSSWIVNHPSALSVFEQIVNASKGKQIVMFLDYDGTL  120

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIVEDPD+AFMT EMRDAVR+VA++FPTAIV+GRCR KVY+FVKL+ LYYAGSHGMDIK
Sbjct  121  SPIVEDPDRAFMTNEMRDAVRDVARYFPTAIVTGRCRDKVYSFVKLAGLYYAGSHGMDIK  180

Query  225  GPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCV  52
            GP+K +   K +Q+VL QPA +FLPMI+EVYKVL+EKTKS+PGAKVENNKFCLSVH+RCV
Sbjct  181  GPSKSHKYRKDHQSVLFQPASKFLPMIDEVYKVLMEKTKSIPGAKVENNKFCLSVHFRCV  240

Query  51   EEKV  40
            EE++
Sbjct  241  EEQM  244



>gb|KHN31363.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=306

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 184/249 (74%), Gaps = 25/249 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------P  592
            MT QNVVVSD KSGV+L         +FP    KP PA  G +ISIPR            
Sbjct  1    MTQQNVVVSDTKSGVSL--------TVFPTTTQKP-PAAPGGYISIPRRRVLKNLEINGG  51

Query  591  GRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
             RINA  ESMR SSPT  +S      + SW+L+HPSA+ MFD I++ SKGK+IVMFLDYD
Sbjct  52   QRINAWVESMRASSPTHHKSTPLSQEHNSWILHHPSALDMFDQIIDASKGKQIVMFLDYD  111

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPD+AFM+  MR  VR +A+ FPTAIV+GRC+ KVYNFV+L++LYYAGSHGM
Sbjct  112  GTLSPIVDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGM  171

Query  234  DIKGPTKGNL--KGNQA--VLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            DIKGPT+ +   K ++A  +LCQPA +FLP+I+EVY+ L+EKTKS PGA VENNKFCLSV
Sbjct  172  DIKGPTRSSKYNKDSKAEPILCQPASDFLPLIDEVYQQLVEKTKSTPGALVENNKFCLSV  231

Query  66   HYRCVEEKV  40
            H+RCV+EKV
Sbjct  232  HFRCVDEKV  240



>ref|XP_011022770.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Populus euphratica]
Length=376

 Score =   293 bits (751),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 187/249 (75%), Gaps = 17/249 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP----------  592
            MTNQNVVV+D  SG+ L I V V+  ++F  A  KP PA  G +ISI R           
Sbjct  1    MTNQNVVVADSNSGLNLAITVHVTNSSIFTTAAQKP-PAAPGGYISISRKKLLKNLEING  59

Query  591  -GRINALFESMRDSSPTR-RSFESEDVNKS-WMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
              RINA  +SMR SSPT  +S  S + ++S W+++HPSA+ MF+ I++ SKGK+IVMFLD
Sbjct  60   GARINAWVDSMRASSPTHIKSTPSVNEDQSSWIVHHPSALEMFEQIIDASKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPDKAFM+ +MR  VR +A+ FPTAIVSGRCR KVYNFV+L++LYYAGSH
Sbjct  120  YDGTLSPIVDDPDKAFMSKQMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSH  179

Query  240  GMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGP KG+   KG   V+ Q A EFLPMI+EVY+ L+EKTK+ PGAK ENNKFCLSV
Sbjct  180  GMDIKGPAKGSKYKKGGDGVVFQAASEFLPMIDEVYEELVEKTKTTPGAKEENNKFCLSV  239

Query  66   HYRCVEEKV  40
            HYRCV+EKV
Sbjct  240  HYRCVDEKV  248



>ref|XP_004288217.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Fragaria 
vesca subsp. vesca]
Length=377

 Score =   293 bits (751),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 180/252 (71%), Gaps = 21/252 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVA--LIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG--------  589
            MT QNVVVSD  S +    + VAVS  ++FP A  KP P   G +ISI R          
Sbjct  1    MTKQNVVVSDADSQIMNMAVSVAVSNASVFPAAAEKP-PMAPGGYISISRKKLMNLKNLD  59

Query  588  ------RINALFESMRDSSPT--RRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
                  RI +  +SM+ SSPT  + S        SWML HPSA+ MF+ I+  S+GK+IV
Sbjct  60   IINGGERITSWVDSMKASSPTHIQSSTCLMKDQSSWMLQHPSALDMFEQIIEASQGKQIV  119

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIVEDPD+AFM+  MR  V+ +A+ FPTAIVSGRCR KVY FV+L++LYY
Sbjct  120  MFLDYDGTLSPIVEDPDRAFMSDSMRKTVKRLARCFPTAIVSGRCRDKVYKFVRLAELYY  179

Query  252  AGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            AGSHGMDIKGP KG+   KG Q VLCQPA EFLPMI+EVYK+L+EKTKS PGAKVENNKF
Sbjct  180  AGSHGMDIKGPAKGSKYKKGGQGVLCQPASEFLPMIDEVYKLLIEKTKSTPGAKVENNKF  239

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  240  CLSVHFRCVDEK  251



>ref|XP_004502437.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X1 [Cicer arietinum]
Length=366

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/251 (61%), Positives = 181/251 (72%), Gaps = 31/251 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG----------  589
            MT QNV+VSD KSGV +          FP    KP PA  G +ISI R            
Sbjct  1    MTQQNVLVSDTKSGVTV----------FPTTSQKPPPAPGGGYISIQRRWVLKDLEINGG  50

Query  588  -RINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RINA  ESMR SSPT      SF  E    SW+L+HPSA+ MFD I+  SKGK+IVMFL
Sbjct  51   QRINAWLESMRASSPTHLKSTPSFAEEQT--SWILHHPSALDMFDQIIEASKGKQIVMFL  108

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIVEDPD+AFM+  MR  VR +A++FPTAIV+GRC+ KVYNFV+L++LYYAGS
Sbjct  109  DYDGTLSPIVEDPDRAFMSDSMRKTVRKLARYFPTAIVTGRCKDKVYNFVRLAELYYAGS  168

Query  243  HGMDIKGPTKGNL--KGN--QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            HGMDIKGPT+ +   KG+  QAVL QPA EFLPMI+EVYK L++KTKS PGAKVENNKFC
Sbjct  169  HGMDIKGPTRSSKYNKGSKAQAVLYQPASEFLPMIDEVYKQLVDKTKSTPGAKVENNKFC  228

Query  75   LSVHYRCVEEK  43
            +SVH+RCV+EK
Sbjct  229  VSVHFRCVDEK  239



>ref|XP_004502438.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X2 [Cicer arietinum]
Length=365

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/251 (61%), Positives = 181/251 (72%), Gaps = 31/251 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG----------  589
            MT QNV+VSD KSGV +          FP    KP PA  G +ISI R            
Sbjct  1    MTQQNVLVSDTKSGVTV----------FPTTSQKPPPAPGGGYISIQRRWVLKDLEINGG  50

Query  588  -RINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RINA  ESMR SSPT      SF  E    SW+L+HPSA+ MFD I+  SKGK+IVMFL
Sbjct  51   QRINAWLESMRASSPTHLKSTPSFAEEQT--SWILHHPSALDMFDQIIEASKGKQIVMFL  108

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIVEDPD+AFM+  MR  VR +A++FPTAIV+GRC+ KVYNFV+L++LYYAGS
Sbjct  109  DYDGTLSPIVEDPDRAFMSDSMRKTVRKLARYFPTAIVTGRCKDKVYNFVRLAELYYAGS  168

Query  243  HGMDIKGPTKGNL--KGN--QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            HGMDIKGPT+ +   KG+  QAVL QPA EFLPMI+EVYK L++KTKS PGAKVENNKFC
Sbjct  169  HGMDIKGPTRSSKYNKGSKAQAVLYQPASEFLPMIDEVYKQLVDKTKSTPGAKVENNKFC  228

Query  75   LSVHYRCVEEK  43
            +SVH+RCV+EK
Sbjct  229  VSVHFRCVDEK  239



>ref|XP_006601938.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Glycine 
max]
Length=365

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 181/248 (73%), Gaps = 25/248 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------P  592
            MT QNVVVSD KSGV+L         +FP    KP PA  G +ISIPR            
Sbjct  1    MTQQNVVVSDTKSGVSL--------TVFPTTTQKP-PAAPGGYISIPRRRVLKNLEINGG  51

Query  591  GRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
             RINA  ESMR SSPT  +S      + SW+L+HPSA+ MFD I++ SKGK+IVMFLDYD
Sbjct  52   QRINAWVESMRASSPTHHKSTPLSQEHNSWILHHPSALDMFDQIIDASKGKQIVMFLDYD  111

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPD+AFM+  MR  VR +A+ FPTAIV+GRC+ KVYNFV+L++LYYAGSHGM
Sbjct  112  GTLSPIVDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGM  171

Query  234  DIKGPTKGNLKGN----QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            DIKGPT+ +        +A+LCQPA +FLP+I+EVY+ L+EKTKS PGA VENNKFCLSV
Sbjct  172  DIKGPTRSSKYNKDSKAEAILCQPASDFLPLIDEVYQQLVEKTKSTPGALVENNKFCLSV  231

Query  66   HYRCVEEK  43
            H+RCV+EK
Sbjct  232  HFRCVDEK  239



>ref|XP_009775195.1| PREDICTED: probable trehalose-phosphate phosphatase H [Nicotiana 
sylvestris]
Length=380

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 187/247 (76%), Gaps = 21/247 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVS-EPALFPHAVAKPLPAGAGSFISIPRPG--------  589
            MT QNVVVSDPKSG+ L I V VS  PALF     KP PA  GS I+I R          
Sbjct  1    MTQQNVVVSDPKSGINLTIPVKVSNSPALF----TKPPPA-PGSCITISRKTLVEINSGP  55

Query  588  RINALFESMRDSSPTRR---SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
            RIN+  +SMR SSPTR    S  S+D+N SWM+ HPSA+ MF+ I++ SKGK+IVMFLDY
Sbjct  56   RINSWVDSMRASSPTRHKSTSPLSDDIN-SWMVQHPSALDMFEQIISASKGKQIVMFLDY  114

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIVEDPD+AFM+  MR  VR +A++FPTAIVSGRCR KVYNFV+L++LYYAGSHG
Sbjct  115  DGTLSPIVEDPDQAFMSDAMRATVRKLARYFPTAIVSGRCRDKVYNFVRLAELYYAGSHG  174

Query  237  MDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            MDIKGP+KG+   KG +AVLCQPA EFLPMI+EVYK L++ TKS  G  VENNKFC SVH
Sbjct  175  MDIKGPSKGSKYKKGAEAVLCQPASEFLPMIDEVYKALIDATKSTEGVTVENNKFCASVH  234

Query  63   YRCVEEK  43
            +R V+EK
Sbjct  235  FRRVDEK  241



>ref|XP_011022771.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Populus euphratica]
Length=374

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/248 (61%), Positives = 186/248 (75%), Gaps = 17/248 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP----------  592
            MTNQNVVV+D  SG+ L I V V+  ++F  A  KP PA  G +ISI R           
Sbjct  1    MTNQNVVVADSNSGLNLAITVHVTNSSIFTTAAQKP-PAAPGGYISISRKKLLKNLEING  59

Query  591  -GRINALFESMRDSSPTR-RSFESEDVNKS-WMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
              RINA  +SMR SSPT  +S  S + ++S W+++HPSA+ MF+ I++ SKGK+IVMFLD
Sbjct  60   GARINAWVDSMRASSPTHIKSTPSVNEDQSSWIVHHPSALEMFEQIIDASKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPDKAFM+ +MR  VR +A+ FPTAIVSGRCR KVYNFV+L++LYYAGSH
Sbjct  120  YDGTLSPIVDDPDKAFMSKQMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSH  179

Query  240  GMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGP KG+   KG   V+ Q A EFLPMI+EVY+ L+EKTK+ PGAK ENNKFCLSV
Sbjct  180  GMDIKGPAKGSKYKKGGDGVVFQAASEFLPMIDEVYEELVEKTKTTPGAKEENNKFCLSV  239

Query  66   HYRCVEEK  43
            HYRCV+EK
Sbjct  240  HYRCVDEK  247



>gb|EYU24005.1| hypothetical protein MIMGU_mgv1a007720mg [Erythranthe guttata]
Length=397

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 183/258 (71%), Gaps = 26/258 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGV--ALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP---------  592
            MTNQNVVVSD KSG+  A+   AVS  +LF  A  KP      S+I+I +          
Sbjct  1    MTNQNVVVSDGKSGINMAITAAAVSGSSLFTTAAQKPPAVPGTSYITISKKKLLQNLDIN  60

Query  591  ----------GRINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFS  451
                       RINA  +SMR SSPT        S D   SW + HPSA+ MF+ I N S
Sbjct  61   AAAAACGGGGARINAWVDSMRASSPTHMKSPPPLSGDHQTSWTMQHPSALDMFEQITNAS  120

Query  450  KGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVK  271
            KGK+IVMFLDYDGTLSPIV+DPD+AFM+  MR  VR +A++FPTAIVSGRCR KVY+FV+
Sbjct  121  KGKQIVMFLDYDGTLSPIVDDPDRAFMSESMRATVRKLARYFPTAIVSGRCRDKVYSFVR  180

Query  270  LSQLYYAGSHGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAK  97
            L++LYYAGSHGMDIKGP+KG++  KG +AVL QPA E++PMI+EVYK LLE TK+ PGAK
Sbjct  181  LAELYYAGSHGMDIKGPSKGSIHKKGAEAVLFQPASEYIPMIDEVYKALLEVTKATPGAK  240

Query  96   VENNKFCLSVHYRCVEEK  43
            VENNKFCLSVH+RCV+EK
Sbjct  241  VENNKFCLSVHFRCVDEK  258



>ref|XP_009369663.1| PREDICTED: probable trehalose-phosphate phosphatase D [Pyrus 
x bretschneideri]
Length=376

 Score =   291 bits (746),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 185/255 (73%), Gaps = 24/255 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPA---GAGSF--------ISIPRP  592
            MTNQNVVVSD K GVA+     ++  +F  +V KP+     G G F        +++ + 
Sbjct  1    MTNQNVVVSDAK-GVAITVTVAAKQNMFSQSVPKPMTEAGRGGGCFTIPMNIKVLNVDKE  59

Query  591  G---RINALFESMRDSSPTR-------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGK  442
            G   R+NA  +S+R SSP R       +S      N SW   HPSA+SMF+ I N SKGK
Sbjct  60   GGAARVNAWVDSLRASSPPRVKSAATPQSLSETVDNNSWSSRHPSAMSMFEQITNASKGK  119

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            +IV+FLDYDGTLSPIVEDPD+AFM+ EMR AV+  A++FPTAIVSGRCR KVY+FVKL +
Sbjct  120  QIVLFLDYDGTLSPIVEDPDRAFMSNEMRKAVKAAARYFPTAIVSGRCRDKVYSFVKLGE  179

Query  261  LYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            LYYAGSHGMDIKGP+K +    GNQAVL QPA EF+PMI+EVYK+LLEKT+S+ GA+VEN
Sbjct  180  LYYAGSHGMDIKGPSKSSKYKNGNQAVLFQPASEFVPMIDEVYKILLEKTRSISGARVEN  239

Query  87   NKFCLSVHYRCVEEK  43
            NKFCLSVH+RCV+EK
Sbjct  240  NKFCLSVHFRCVDEK  254



>ref|XP_011030992.1| PREDICTED: probable trehalose-phosphate phosphatase J [Populus 
euphratica]
Length=373

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 181/248 (73%), Gaps = 17/248 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------  595
            MTNQNVVV+D  SG+ L I V V+  ++F  A  KP PA  G +I+I R           
Sbjct  1    MTNQNVVVADTSSGINLAITVHVTNSSIFTTAKQKP-PAAPGGYITISRNKLLKNLEISG  59

Query  594  PGRINALFESMRDSSPTR--RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
              R NA   SMR SSPT    +    D   SW+L+HPSA+ MF  I++ SKGK+IVMFLD
Sbjct  60   GARFNAWVNSMRTSSPTHVNSTPSVNDDQSSWILHHPSALEMFGQIIDASKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPD+AFM+ +MR  VR +A+ FPTAIVSGRCR KVYNFV+L++LYYAGSH
Sbjct  120  YDGTLSPIVDDPDRAFMSKQMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSH  179

Query  240  GMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGP KG+   KG++ V+ Q   EFLPMI+EVYK L+E+TK+ PGAKVENNKFCLSV
Sbjct  180  GMDIKGPAKGSKYKKGSEGVVFQAGSEFLPMIDEVYKELVERTKTTPGAKVENNKFCLSV  239

Query  66   HYRCVEEK  43
            HYRCV+EK
Sbjct  240  HYRCVDEK  247



>gb|KDP41360.1| hypothetical protein JCGZ_15767 [Jatropha curcas]
Length=375

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 186/255 (73%), Gaps = 27/255 (11%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGV----------ALIRVAVSEPALF--PHAVAKPLPAGAGSFISIPR  595
            MTNQNV+ SD K  +          +L    VSEP L   P  V K   AG  +      
Sbjct  1    MTNQNVIASDAKPSIDIRIRVLFPKSLFSTVVSEPVLTASPRLVKKMETAGGEAVTKTN-  59

Query  594  PGRINALF-ESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
                NA + +SMRDSSPTR      S    +  KSWM+NHPSA+SMF+ I+N SKGK+IV
Sbjct  60   ----NAYWVDSMRDSSPTRVKSTASSLSETEERKSWMINHPSALSMFEQILNASKGKQIV  115

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIVEDPD+AFMT+EMR+AVR+VA++FPTAIV+GRCR KVY+FVKL+ LYY
Sbjct  116  MFLDYDGTLSPIVEDPDRAFMTSEMREAVRDVARYFPTAIVTGRCRDKVYSFVKLAGLYY  175

Query  252  AGSHGMDIKGP----TKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            AGSHGMDIKGP     K   K ++A+L QPA +FLPMI+EVY+VL+EKTK++PGAKVENN
Sbjct  176  AGSHGMDIKGPSSKSRKYKKKDHEALLFQPASKFLPMIDEVYEVLIEKTKTIPGAKVENN  235

Query  84   KFCLSVHYRCVEEKV  40
            KFCLSVH+RCV+EK+
Sbjct  236  KFCLSVHFRCVDEKM  250



>ref|XP_008391072.1| PREDICTED: LOW QUALITY PROTEIN: probable trehalose-phosphate 
phosphatase D [Malus domestica]
Length=376

 Score =   288 bits (738),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 186/254 (73%), Gaps = 24/254 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLP-AGAGSFISIPR-----------  595
            MTNQNV+VSD K G+A+     ++ A+F  +V KP+   G G   +IP            
Sbjct  1    MTNQNVLVSDAK-GMAITVTVAAKKAMFSQSVPKPMTEGGGGGCFTIPMNIKVLKVDTEG  59

Query  594  -PGRINALFESMRDSSPTR------RSF-ESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
               R+NA  +S+R SSPTR      +S  E+ D N SW ++HPSA+SMF+ I N SKGK+
Sbjct  60   GAARVNAWVDSLRASSPTRVKSATPQSLSETVDYN-SWTIHHPSAMSMFEQITNASKGKQ  118

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPD AFM+ EMR AVR+ A++FPTAIVSGRCR KVY+FV+L +L
Sbjct  119  IVMFLDYDGTLSPIVEDPDSAFMSNEMRKAVRDAARYFPTAIVSGRCRDKVYSFVQLGEL  178

Query  258  YYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDI+GP+K +     NQAVL QPA EF+PMI+EVYK LLEKT+S+ G++VENN
Sbjct  179  YYAGSHGMDIRGPSKSSKYKNDNQAVLFQPASEFVPMIDEVYKTLLEKTRSISGSRVENN  238

Query  84   KFCLSVHYRCVEEK  43
            KF LSVH+RCV+EK
Sbjct  239  KFSLSVHFRCVDEK  252



>ref|XP_006591511.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Glycine 
max]
Length=363

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 181/251 (72%), Gaps = 31/251 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------P  592
            MT QNVVVSD KSGV+L   + ++         KP PA  G +ISIPR            
Sbjct  1    MTQQNVVVSDTKSGVSLTVFSTTQ---------KP-PAAPGGYISIPRRRVLKNLEINGG  50

Query  591  GRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RINA  ESMR SSPT      S   E  + SW+L+HPSA+ MFD I++ SKGK+IVMFL
Sbjct  51   QRINAWVESMRASSPTHHKSTPSLSQE--HNSWILHHPSALDMFDQIIDASKGKQIVMFL  108

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPD+AFM+  MR  VR +A+ FPTAIV+GRC+ KVYNFV+L++LYYAGS
Sbjct  109  DYDGTLSPIVDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGS  168

Query  243  HGMDIKGPTKGNLKGN----QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            HGMDIKGPT+ +        +A+LCQPA +FLPMI+EVY+ L+EKTKS PGA VENNKFC
Sbjct  169  HGMDIKGPTRSSKYNKDSKAEAILCQPASDFLPMIDEVYQQLVEKTKSTPGALVENNKFC  228

Query  75   LSVHYRCVEEK  43
            LSVH+RCV+EK
Sbjct  229  LSVHFRCVDEK  239



>ref|XP_008375355.1| PREDICTED: probable trehalose-phosphate phosphatase C isoform 
X1 [Malus domestica]
Length=395

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 183/258 (71%), Gaps = 26/258 (10%)
 Frame = -2

Query  744  RKMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPA---GAGSFISIPR-------  595
            RKMTNQNVVVSD K GVA+     ++  +F  +V KP+     G G F +IP        
Sbjct  17   RKMTNQNVVVSDAK-GVAITVTVAAKQNMFSQSVPKPITEAGRGGGCF-TIPMNIKVLNV  74

Query  594  -----PGRINALFESMRDSSPTR-------RSFESEDVNKSWMLNHPSAISMFDDIMNFS  451
                   R+NA  +S+R SSP R       +S      N SW   HPSA+SMF+ I N S
Sbjct  75   DTEGGAARVNAWVDSLRASSPPRVKSAATPQSLSETVDNNSWSSRHPSAMSMFEQITNAS  134

Query  450  KGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVK  271
            KGK+IVMFLDYDGTLSPIVEDPD+AFM+ EMR AV+  A +FPTAIVSGRCR KVY+FVK
Sbjct  135  KGKQIVMFLDYDGTLSPIVEDPDRAFMSNEMRRAVKAAAGYFPTAIVSGRCRDKVYSFVK  194

Query  270  LSQLYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAK  97
            L +L YAGSHGMDIKGP+K +    GNQAVL QPA EF+PMI+EVYK+LLEKT+S+ GA+
Sbjct  195  LGELXYAGSHGMDIKGPSKSSKYKNGNQAVLFQPASEFVPMIDEVYKILLEKTRSISGAR  254

Query  96   VENNKFCLSVHYRCVEEK  43
            VE+NKFCLSVH+RCV+EK
Sbjct  255  VEDNKFCLSVHFRCVDEK  272



>ref|XP_007163639.1| hypothetical protein PHAVU_001G251300g [Phaseolus vulgaris]
 gb|ESW35633.1| hypothetical protein PHAVU_001G251300g [Phaseolus vulgaris]
Length=367

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 177/251 (71%), Gaps = 29/251 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------P  592
            MT QNVVVSD KSGV L         +FP    K  PA  G +ISI R            
Sbjct  1    MTQQNVVVSDTKSGVPL--------TVFPTPAQKKPPAAPGGYISISRRRVLKNLEINGD  52

Query  591  GRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RINA  ESMR SSPT      SF  E    SW+L+HPSA+ MFD I++ SKGK+IVMFL
Sbjct  53   QRINAWVESMRASSPTHLKSTPSFSQE--QNSWILHHPSALDMFDQIIDASKGKQIVMFL  110

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIVEDPD+AFM+  MR  VR +A+ FPTAIV+GRC+ KVYNFV+L++LYYAGS
Sbjct  111  DYDGTLSPIVEDPDRAFMSHSMRKTVRKLARCFPTAIVTGRCKDKVYNFVQLAELYYAGS  170

Query  243  HGMDIKGPTKGNLKGN----QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            HGMDIKGPT+ +        +A+L QPA +FLPMI+EVY+ L+EKTKS PGA VENNKFC
Sbjct  171  HGMDIKGPTRSSKYNKDAKAEAILFQPASDFLPMIDEVYQQLVEKTKSTPGAMVENNKFC  230

Query  75   LSVHYRCVEEK  43
            LSVH+RCV+EK
Sbjct  231  LSVHFRCVDEK  241



>ref|XP_007224341.1| hypothetical protein PRUPE_ppa020645mg [Prunus persica]
 gb|EMJ25540.1| hypothetical protein PRUPE_ppa020645mg [Prunus persica]
Length=376

 Score =   286 bits (732),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 187/252 (74%), Gaps = 20/252 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVS--EPALFPHAVAKPLPA---GAGSFISIPR-------  595
            MTNQNVVVSD K     + V V+    ++F  +V KP  A   G G   +IPR       
Sbjct  1    MTNQNVVVSDAKGVAVTVAVTVTVANQSMFSSSVPKPRTAEAGGGGGCFTIPRNIKLLKV  60

Query  594  -----PGRINALFESMRDSSPTRRSFESEDVN-KSWMLNHPSAISMFDDIMNFSKGKKIV  433
                   R+NA  +S+R SSP R    +E V+  SW L+HPSA+SMF++I N+SKGK+IV
Sbjct  61   ETEGGAARVNAWVDSLRASSPPRVKSATETVDYSSWNLHHPSAMSMFEEITNYSKGKQIV  120

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            +FLDYDGTLSPIVEDPD+AFM+ EMR+AV+  A++FPTAIVSGRCR KV++FVKL +LYY
Sbjct  121  LFLDYDGTLSPIVEDPDRAFMSREMRNAVKAAARYFPTAIVSGRCRDKVHSFVKLGELYY  180

Query  252  AGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            AGSHGMDIKGP+K +    GNQAVL QPA EF+PMI+EV K+L+EKT+S+ GA+VENNKF
Sbjct  181  AGSHGMDIKGPSKSSKYKNGNQAVLFQPASEFVPMIDEVCKILVEKTRSISGARVENNKF  240

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  241  CLSVHFRCVDEK  252



>ref|XP_002307388.2| hypothetical protein POPTR_0005s16910g [Populus trichocarpa]
 gb|EEE94384.2| hypothetical protein POPTR_0005s16910g [Populus trichocarpa]
Length=347

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 172/224 (77%), Gaps = 16/224 (7%)
 Frame = -2

Query  663  ALFPHAVAKPLPAGAGSFISIPRP---------GRINALFESMRDSSPTR----RSFESE  523
            +LF   V KPLPA  G + +I R          G+ N+  +SMRDSSPTR     S    
Sbjct  6    SLFSPVVPKPLPAAPGGYFTISRKMFAKKTETGGKTNSWADSMRDSSPTRVKSTTSLSEI  65

Query  522  DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVR  343
            +   +W++NHPSA++MF+ I+N SKGK+IVMFLDYDGTLSPIVEDPD+AFMT EMR+AVR
Sbjct  66   EEKNTWIVNHPSALNMFEQIVNGSKGKQIVMFLDYDGTLSPIVEDPDRAFMTNEMREAVR  125

Query  342  NVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKG---NLKGNQAVLCQPA  172
            +VA++FPTAIV+GRCR KVY+FV+L+ LYYAGSHGMDIKGP+K    N K  Q VL QPA
Sbjct  126  DVARYFPTAIVTGRCRDKVYSFVRLAGLYYAGSHGMDIKGPSKNCCINKKDYQGVLFQPA  185

Query  171  REFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEKV  40
             +FLPMI+EVY  LLE+TK +PGA+VE+NKFC+SVH+RCVEEK+
Sbjct  186  SDFLPMIDEVYNALLERTKYIPGARVEDNKFCISVHFRCVEEKM  229



>ref|XP_010519807.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Tarenaya hassleriana]
Length=377

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 185/253 (73%), Gaps = 21/253 (8%)
 Frame = -2

Query  750  KTRKMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG------  589
            + ++M  QNVVVS+ KSG+  I +AVS  A+F  +  KP P   G +ISI R        
Sbjct  7    ENQRMATQNVVVSESKSGI--IAMAVSNSAVFTPSAQKP-PTAPG-YISISRKKLLKNLD  62

Query  588  -----RINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
                 RINA  +SMR SSPT        S D   SW++ HPSA+ MF+ I+  S+GK+IV
Sbjct  63   INGGHRINAWVDSMRASSPTHLKSVPSLSADERNSWIMQHPSALDMFEQIIEASRGKQIV  122

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIVEDPD+AFM+++MR  VR VAK FPTAIVSGRCR KVY+FVKL++LYY
Sbjct  123  MFLDYDGTLSPIVEDPDRAFMSSKMRRTVRKVAKCFPTAIVSGRCRDKVYSFVKLAELYY  182

Query  252  AGSHGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            AGSHGMDIKGPTKG     K  Q+VL QPA EFLP+I+EVYK L+E TKSVPGAKVENN+
Sbjct  183  AGSHGMDIKGPTKGFSKYKKDKQSVLFQPASEFLPLIDEVYKQLVENTKSVPGAKVENNR  242

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+E+
Sbjct  243  FCVSVHFRCVDEQ  255



>emb|CDP01436.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/251 (62%), Positives = 183/251 (73%), Gaps = 20/251 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP----------  592
            MT QNVVVS  KSG+++ I VAV+  ALF  A  KP PA  G++ SI +           
Sbjct  1    MTKQNVVVSGTKSGISMAIAVAVTNSALFTTASQKP-PAVPGTYFSISKKKLLQNLEINT  59

Query  591  -GRINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
              +IN+  +SMR SSPT        S D   S  L+HPSA+ MF+ I N SKGK+IVMFL
Sbjct  60   GAKINSWVDSMRASSPTHLKSTPPLSSDDQSSSTLHHPSALDMFEQITNASKGKQIVMFL  119

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIVEDPD+AFM+  MR AVR +A  FPTAIVSGRCR KVY+FV+L++LYYAGS
Sbjct  120  DYDGTLSPIVEDPDRAFMSDAMRAAVRKLAGCFPTAIVSGRCRDKVYSFVRLAELYYAGS  179

Query  243  HGMDIKGPTKG--NLKGNQAVLCQP--AREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            HGMDIKGP+KG  + KG QAVL QP  A EFLPMI+EVY+ LLEKTKS  GAKVENNKFC
Sbjct  180  HGMDIKGPSKGSKHKKGAQAVLFQPDTANEFLPMIDEVYEALLEKTKSTEGAKVENNKFC  239

Query  75   LSVHYRCVEEK  43
            +SVH+RCV+EK
Sbjct  240  VSVHFRCVDEK  250



>ref|XP_006355362.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Solanum 
tuberosum]
Length=386

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/248 (61%), Positives = 181/248 (73%), Gaps = 17/248 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAG-SFISIPR----------P  592
            MT QNVVVSDPKSG+ L     +  ALF  A  KP P     S I+I R           
Sbjct  1    MTQQNVVVSDPKSGINLTIPVSNSSALFTTAAQKPPPGPGPGSCITISRKTLVEINGNNS  60

Query  591  GRINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
             RIN+  ESMR SSPT        S+D+N SWM+ HPSA+ MF+ I++ SKGK+IVMFLD
Sbjct  61   ARINSWVESMRASSPTHHKSSPALSDDLN-SWMVQHPSALDMFEQIISASKGKQIVMFLD  119

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIVEDPD+AFM+  MR  VR +A++FPTAIVSGRCR KVY+FV+L++LYYAGSH
Sbjct  120  YDGTLSPIVEDPDQAFMSDAMRATVRKLARYFPTAIVSGRCRDKVYSFVRLAELYYAGSH  179

Query  240  GMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGP+KG+   KG QAVL QPA EFLPMI+EVYK L++ TKS  G +VENNKFC SV
Sbjct  180  GMDIKGPSKGSKYKKGAQAVLFQPASEFLPMIDEVYKKLVDITKSTEGVRVENNKFCASV  239

Query  66   HYRCVEEK  43
            H+RCV+EK
Sbjct  240  HFRCVDEK  247



>ref|XP_008219665.1| PREDICTED: probable trehalose-phosphate phosphatase D [Prunus 
mume]
Length=376

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 189/253 (75%), Gaps = 22/253 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEP--ALFPHAVAKPLPA----GAGSFISIPR------  595
            MTNQNVVVSD K     + V V+    ++F  +V KP  A    GAG F +IPR      
Sbjct  1    MTNQNVVVSDAKGVAVTVAVTVTVANRSMFSSSVPKPRTAEAGGGAGCF-TIPRNIKLLK  59

Query  594  ------PGRINALFESMRDSSPTRRSFESEDVN-KSWMLNHPSAISMFDDIMNFSKGKKI  436
                    R+NA  +S+R SSP R    +E V+  SW L+HPSA+SMF++I N+SKGK+I
Sbjct  60   VETEGGAARVNAWVDSLRASSPPRVKSATETVDYSSWNLHHPSAMSMFEEITNYSKGKQI  119

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            V+FLDYDGTLSPIVEDPD+AFM+ EMR+AV+  A++FPTAIVSGRCR KV++FVKL +LY
Sbjct  120  VLFLDYDGTLSPIVEDPDRAFMSREMRNAVKAAARYFPTAIVSGRCRDKVHSFVKLGELY  179

Query  255  YAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            YAGSHGMDIKGP+K +    GNQAVL QPA EF+PMI+EV K+L+EKT+S+ GA+VENNK
Sbjct  180  YAGSHGMDIKGPSKSSKYKNGNQAVLFQPASEFVPMIDEVCKILVEKTRSISGARVENNK  239

Query  81   FCLSVHYRCVEEK  43
            FCLSVH+RCV+EK
Sbjct  240  FCLSVHFRCVDEK  252



>ref|XP_008375418.1| PREDICTED: probable trehalose-phosphate phosphatase C isoform 
X2 [Malus domestica]
Length=377

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 181/256 (71%), Gaps = 26/256 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPA---GAGSFISIPR---------  595
            MTNQNVVVSD K GVA+     ++  +F  +V KP+     G G F +IP          
Sbjct  1    MTNQNVVVSDAK-GVAITVTVAAKQNMFSQSVPKPITEAGRGGGCF-TIPMNIKVLNVDT  58

Query  594  ---PGRINALFESMRDSSPTR-------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKG  445
                 R+NA  +S+R SSP R       +S      N SW   HPSA+SMF+ I N SKG
Sbjct  59   EGGAARVNAWVDSLRASSPPRVKSAATPQSLSETVDNNSWSSRHPSAMSMFEQITNASKG  118

Query  444  KKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLS  265
            K+IVMFLDYDGTLSPIVEDPD+AFM+ EMR AV+  A +FPTAIVSGRCR KVY+FVKL 
Sbjct  119  KQIVMFLDYDGTLSPIVEDPDRAFMSNEMRRAVKAAAGYFPTAIVSGRCRDKVYSFVKLG  178

Query  264  QLYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVE  91
            +L YAGSHGMDIKGP+K +    GNQAVL QPA EF+PMI+EVYK+LLEKT+S+ GA+VE
Sbjct  179  ELXYAGSHGMDIKGPSKSSKYKNGNQAVLFQPASEFVPMIDEVYKILLEKTRSISGARVE  238

Query  90   NNKFCLSVHYRCVEEK  43
            +NKFCLSVH+RCV+EK
Sbjct  239  DNKFCLSVHFRCVDEK  254



>ref|XP_010519815.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Tarenaya hassleriana]
Length=367

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 182/249 (73%), Gaps = 21/249 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG----------  589
            M  QNVVVS+ KSG+  I +AVS  A+F  +  KP P   G +ISI R            
Sbjct  1    MATQNVVVSESKSGI--IAMAVSNSAVFTPSAQKP-PTAPG-YISISRKKLLKNLDINGG  56

Query  588  -RINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
             RINA  +SMR SSPT        S D   SW++ HPSA+ MF+ I+  S+GK+IVMFLD
Sbjct  57   HRINAWVDSMRASSPTHLKSVPSLSADERNSWIMQHPSALDMFEQIIEASRGKQIVMFLD  116

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIVEDPD+AFM+++MR  VR VAK FPTAIVSGRCR KVY+FVKL++LYYAGSH
Sbjct  117  YDGTLSPIVEDPDRAFMSSKMRRTVRKVAKCFPTAIVSGRCRDKVYSFVKLAELYYAGSH  176

Query  240  GMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            GMDIKGPTKG     K  Q+VL QPA EFLP+I+EVYK L+E TKSVPGAKVENN+FC+S
Sbjct  177  GMDIKGPTKGFSKYKKDKQSVLFQPASEFLPLIDEVYKQLVENTKSVPGAKVENNRFCVS  236

Query  69   VHYRCVEEK  43
            VH+RCV+E+
Sbjct  237  VHFRCVDEQ  245



>ref|XP_004299611.1| PREDICTED: probable trehalose-phosphate phosphatase D-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 186/262 (71%), Gaps = 31/262 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAV-SEPALFPHAVAKPLPAG--AGSFISIPR---------  595
            MTNQNV+VSD K GVA+   A+ ++        +  + +G  AG   +IPR         
Sbjct  1    MTNQNVLVSDVK-GVAMAVAAMKNQSMFSSSVASSMIESGGVAGCIFTIPRSIKLLKVET  59

Query  594  ------PGRINALFESMRDSSPTR---------RSFESEDVNKSWMLNHPSAISMFDDIM  460
                    R+NA  +S+R SSP R            ++ D   SW L HPSAI+MF++I 
Sbjct  60   AEVGGGAARVNAWVDSLRASSPPRVKSTTTSPSTLSQTGDEENSWNLRHPSAINMFEEIT  119

Query  459  NFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYN  280
            N SKGK+IVMFLDYDGTLSPIV+DPD+AFM+ EMR AVR VA++FPTAIVSGRCR KVY+
Sbjct  120  NASKGKQIVMFLDYDGTLSPIVQDPDRAFMSNEMRKAVRAVARYFPTAIVSGRCRDKVYS  179

Query  279  FVKLSQLYYAGSHGMDIKGPTKGNLKGN---QAVLCQPAREFLPMIEEVYKVLLEKTKSV  109
            FVKL++LYYAGSHGMDIKGP+K N   N   QAVLCQPA EF+PMI+EV+K+L+EKTKS+
Sbjct  180  FVKLAELYYAGSHGMDIKGPSKSNKYKNANQQAVLCQPASEFVPMIDEVFKILVEKTKSI  239

Query  108  PGAKVENNKFCLSVHYRCVEEK  43
             GA+VENNKFCLSVH+RCVEEK
Sbjct  240  SGARVENNKFCLSVHFRCVEEK  261



>ref|XP_010546407.1| PREDICTED: probable trehalose-phosphate phosphatase J [Tarenaya 
hassleriana]
Length=378

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/257 (59%), Positives = 188/257 (73%), Gaps = 24/257 (9%)
 Frame = -2

Query  756  LPKTRKMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP-----  592
            + + ++M  QNVVVSD KSG+  I V+V+ P++FP +  KP P   G +ISI R      
Sbjct  5    IEEKQRMATQNVVVSDAKSGI--IAVSVANPSVFPPSAQKP-PTALG-YISISRKKLLKN  60

Query  591  ------GRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGK  442
                   RINA  +SMR SSPT      S  +E+ N SW++ HPSA+ MF+ I+  S+GK
Sbjct  61   LEINGGQRINAWVDSMRASSPTHLKSVPSLSAEERN-SWIMQHPSALDMFEQIIEASRGK  119

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            +IVMFLDYDGTLSPIV+DPD+AFM+++MR  VR +AK FPTAIVSGRC  KVY FVKL++
Sbjct  120  RIVMFLDYDGTLSPIVDDPDRAFMSSKMRRTVRKLAKCFPTAIVSGRCGDKVYEFVKLAE  179

Query  261  LYYAGSHGMDIKGPTKGNLKGNQ----AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKV  94
            LYYAG HGMDIKGPTKG  K N+    +VL QPA +FLPMI+ VYK L+EKTKS PGAKV
Sbjct  180  LYYAGRHGMDIKGPTKGLSKYNKDKQPSVLFQPASDFLPMIDGVYKQLMEKTKSTPGAKV  239

Query  93   ENNKFCLSVHYRCVEEK  43
            ENNKFC+SVH+RCV+EK
Sbjct  240  ENNKFCVSVHFRCVDEK  256



>ref|XP_008345555.1| PREDICTED: probable trehalose-phosphate phosphatase J [Malus 
domestica]
Length=374

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 181/250 (72%), Gaps = 20/250 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVA--LIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MT QNVVVS+  + +    I VAV+  +LF     KP P G   +I I R          
Sbjct  1    MTKQNVVVSEADAEIMNMAISVAVANSSLFTAVAEKP-PVGPPGYIXISRKRFMNLKNLD  59

Query  594  ----PGRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMF  427
                  R+N+  +SMR SSPT     S  + ++W+L HPSA+ MF+ I++ SKGK+IVMF
Sbjct  60   SFNGAERMNSWVDSMRASSPTHIK-SSSFLKENWILQHPSALDMFEQIIDASKGKQIVMF  118

Query  426  LDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAG  247
            LDYDGTLSPIVEDPD+AFM+  MR  V+ VA+ FPTAIVSGRCR KVY FV+L++LYYAG
Sbjct  119  LDYDGTLSPIVEDPDRAFMSDAMRKTVKKVARCFPTAIVSGRCRDKVYKFVRLAELYYAG  178

Query  246  SHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            SHGMDIKGP KG+  +K +Q VLCQPA EFLPMI+EVY++L++KTKS PGAKVENNKFCL
Sbjct  179  SHGMDIKGPAKGSKYMKVSQGVLCQPASEFLPMIDEVYRLLVDKTKSTPGAKVENNKFCL  238

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  239  SVHFRCVDEK  248



>gb|KDP46861.1| hypothetical protein JCGZ_24070 [Jatropha curcas]
Length=374

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 184/249 (74%), Gaps = 18/249 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG---------  589
            MTNQNVVVSD KS + L I V VS   +F  A  KP  A AG +ISI R           
Sbjct  1    MTNQNVVVSDTKSTINLAITVHVSNSNIFTTAAQKPPAAPAG-YISISRKKLLKNLEING  59

Query  588  --RINALFESMRDSSPTRRSFES---EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
              RINA  ESMR SSPT          D  +SW+L+HPSA+ MF+ I++ SKGK+IVMFL
Sbjct  60   GPRINAWVESMRASSPTHLKSTPPSLTDDQRSWILHHPSALDMFEQIIDASKGKQIVMFL  119

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPD+AFM+ +MR  VR +A+ FPTAIVSGRCR KVYNFV+L++LYYAGS
Sbjct  120  DYDGTLSPIVDDPDRAFMSKKMRATVRRLARCFPTAIVSGRCRDKVYNFVRLAELYYAGS  179

Query  243  HGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            HGMDIKGP KG+   KGN+ ++ QPA EFLPMI+EVYK L+EKTKS  GAKVENNKFC+S
Sbjct  180  HGMDIKGPAKGSKYKKGNEGLIFQPASEFLPMIDEVYKELVEKTKSTAGAKVENNKFCVS  239

Query  69   VHYRCVEEK  43
            VH+RCV+EK
Sbjct  240  VHFRCVDEK  248



>ref|XP_010261265.1| PREDICTED: probable trehalose-phosphate phosphatase J [Nelumbo 
nucifera]
Length=382

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 182/253 (72%), Gaps = 25/253 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------P  592
            MT QNVVVSD K G+  +   V + +LFP    KP P     ++SI R            
Sbjct  1    MTKQNVVVSDVKCGINDMISVVPKGSLFPSTGQKP-PKAPDGYVSISRNKFLKKLETGGG  59

Query  591  GRINALFESMRDSSPTR--------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKI  436
             RIN   ESMR SSPT          +   ED   SW+L+HPSA++MF+ IM+ SKGK+I
Sbjct  60   ARINPWVESMRASSPTHIKSNPSLSSTVHQED---SWILDHPSALNMFEQIMSASKGKQI  116

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMFLDYDGTLSPIV+DPD+AFM+  MR AV+ VA++FPTAIVSGRCR KVY+FV+L++LY
Sbjct  117  VMFLDYDGTLSPIVDDPDRAFMSRAMRAAVKAVARYFPTAIVSGRCRDKVYSFVRLAELY  176

Query  255  YAGSHGMDIKGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            YAGSHGMDIKGP KG    KGN+ VL QPA EFLPMI+EVYK L+EK KS+PGAKVE+N+
Sbjct  177  YAGSHGMDIKGPAKGPRYSKGNEPVLFQPASEFLPMIDEVYKALVEKIKSIPGAKVEHNR  236

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+EK
Sbjct  237  FCVSVHFRCVDEK  249



>ref|XP_003527912.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X1 [Glycine max]
Length=370

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 179/244 (73%), Gaps = 13/244 (5%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIP---------RPGR  586
            MTNQNVV  +  + +  +  ++S   + P A      A  G F  +P            +
Sbjct  2    MTNQNVVTHEVINTLIAMAASISNSTVLPSATVPESMAVLGGFWGLPHNKNLVKRLEGAK  61

Query  585  INALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
            ++A  +SMR SSPTR   ES++  +SW+L HPSA++ F+ I+  +KGK+IV+FLDYDGTL
Sbjct  62   VSAWIDSMRASSPTRAKSESQE-KRSWILYHPSALNTFEQIVYSAKGKQIVVFLDYDGTL  120

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIV DP+KAFMT +MR  ++ +A+HFPTAIV+GRCR KVYNFVKL++LYYAGSHGMDI 
Sbjct  121  SPIVADPNKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAELYYAGSHGMDIT  180

Query  225  GPTKGNLKG---NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            GPTK   +G   N+AVL QPA +FLPMI+EVYK+LLEKTK+VPGAKVENNKFCLSVH+RC
Sbjct  181  GPTKSPKQGNNNNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGAKVENNKFCLSVHFRC  240

Query  54   VEEK  43
            V+EK
Sbjct  241  VDEK  244



>ref|XP_006581545.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X2 [Glycine max]
Length=380

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 179/244 (73%), Gaps = 13/244 (5%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIP---------RPGR  586
            MTNQNVV  +  + +  +  ++S   + P A      A  G F  +P            +
Sbjct  2    MTNQNVVTHEVINTLIAMAASISNSTVLPSATVPESMAVLGGFWGLPHNKNLVKRLEGAK  61

Query  585  INALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
            ++A  +SMR SSPTR   ES++  +SW+L HPSA++ F+ I+  +KGK+IV+FLDYDGTL
Sbjct  62   VSAWIDSMRASSPTRAKSESQE-KRSWILYHPSALNTFEQIVYSAKGKQIVVFLDYDGTL  120

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIV DP+KAFMT +MR  ++ +A+HFPTAIV+GRCR KVYNFVKL++LYYAGSHGMDI 
Sbjct  121  SPIVADPNKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAELYYAGSHGMDIT  180

Query  225  GPTKGNLKG---NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            GPTK   +G   N+AVL QPA +FLPMI+EVYK+LLEKTK+VPGAKVENNKFCLSVH+RC
Sbjct  181  GPTKSPKQGNNNNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGAKVENNKFCLSVHFRC  240

Query  54   VEEK  43
            V+EK
Sbjct  241  VDEK  244



>ref|XP_004143475.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 ref|XP_004160134.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 gb|KGN48762.1| hypothetical protein Csa_6G500540 [Cucumis sativus]
Length=385

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 180/257 (70%), Gaps = 26/257 (10%)
 Frame = -2

Query  738  MTNQ-NVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAG-----AGSFISIPRP----  592
            MTN  NVV+S+ KS + + I V VS  ++F     KP PAG      G +ISI R     
Sbjct  1    MTNNPNVVISESKSSINMAITVTVSNSSIFQATAQKP-PAGPSSTTGGGYISISRSTKLV  59

Query  591  ------GRINALFESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDIMNFSK  448
                   RI    +SMR SSP+R       S    D N SWML+HPSA+ MFD I++ SK
Sbjct  60   QQPDGRARIKTWVDSMRASSPSRIKPTPSLSDHDHDNNSSWMLHHPSALDMFDQIIDASK  119

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GK+IVMFLDYDGTLSPIV+DPD+AFM+  MR  V+ VA+ FPTAIVSGR R KVY FV+L
Sbjct  120  GKQIVMFLDYDGTLSPIVDDPDRAFMSDAMRKTVKTVARSFPTAIVSGRRRDKVYGFVRL  179

Query  267  SQLYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKV  94
             +LYYAGSHGMDIKGPTK +   K  Q+VL QPA EFLPMI++VYK L+EKTKS PGAKV
Sbjct  180  GELYYAGSHGMDIKGPTKDSNYKKCTQSVLFQPASEFLPMIDQVYKELVEKTKSTPGAKV  239

Query  93   ENNKFCLSVHYRCVEEK  43
            ENNKFCLSVHYRCVEEK
Sbjct  240  ENNKFCLSVHYRCVEEK  256



>gb|EYU23217.1| hypothetical protein MIMGU_mgv1a023678mg [Erythranthe guttata]
Length=340

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 171/213 (80%), Gaps = 14/213 (7%)
 Frame = -2

Query  642  AKPLPAGAGSFIS----------IPRPGRINALFESMRDSSPTRRS-FESEDVNKSWMLN  496
            AKP    AG +++          I     INAL +SMR SSPTR   ++++D N SW++ 
Sbjct  6    AKPAIPVAGGYLTRKKLLKNLETIGNGAMINALLDSMRASSPTRGGPYDAQDHN-SWIVR  64

Query  495  HPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTA  316
            HPSA++ F++I + SKGK+IV+FLDYDGTLSPIV DPD+AF+T EMR+AV+NVA++FPTA
Sbjct  65   HPSALTEFEEITSASKGKQIVVFLDYDGTLSPIVNDPDRAFITNEMREAVKNVAENFPTA  124

Query  315  IVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEV  142
            IVSGRCR KVYNFV+LS+LYYAGSHGMDIKGP+KG+   KGNQ V+CQPAREFLPMI+EV
Sbjct  125  IVSGRCRTKVYNFVRLSELYYAGSHGMDIKGPSKGHRQTKGNQTVMCQPAREFLPMIDEV  184

Query  141  YKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            YK L+EK + +PG+ VE+NKFCLSVHYRCVEEK
Sbjct  185  YKSLVEKVRYIPGSNVEHNKFCLSVHYRCVEEK  217



>ref|XP_003523824.2| PREDICTED: probable trehalose-phosphate phosphatase J-like [Glycine 
max]
Length=371

 Score =   281 bits (718),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 178/247 (72%), Gaps = 18/247 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIP---------RPGR  586
            MTNQNVV  +  + +  +  ++S     P A      A  G F  +P            +
Sbjct  2    MTNQNVVTHEVINTLIAVAASISNSTALPSATVPESMAVLGGFWGLPHNKNLVKRLEGAK  61

Query  585  INALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
            ++A  +SMR SSPTR   ES++  +SW+L HPSA++ F+ I+  +KGK++V+FLDYDGTL
Sbjct  62   VSAWIDSMRASSPTRAKSESQE-KRSWILYHPSALNTFEQIVCSAKGKQVVVFLDYDGTL  120

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIV DPDKAFMT +MR  ++ +A+HFPTAIV+GRCR KVYNFVKL++LYYAGSHGMDIK
Sbjct  121  SPIVADPDKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAELYYAGSHGMDIK  180

Query  225  GPTK------GNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            GPTK      GN   N+AVL QPA +FLPMI+EVYK+LLEKTK+VPGA VENNKFCLSVH
Sbjct  181  GPTKSQSPKQGN--NNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGANVENNKFCLSVH  238

Query  63   YRCVEEK  43
            +RCV+EK
Sbjct  239  FRCVDEK  245



>gb|KHN19743.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=381

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 178/247 (72%), Gaps = 18/247 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR---------PGR  586
            MTNQNVV  +  + +  +  ++S     P A      A  G F  +P            +
Sbjct  2    MTNQNVVTHEVINTLIAVAASISNSTALPSATVPESMAVLGGFWGLPHNKNLVKRLEGAK  61

Query  585  INALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
            ++A  +SMR SSPTR   ES++  +SW+L HPSA++ F+ I+  +KGK++V+FLDYDGTL
Sbjct  62   VSAWIDSMRASSPTRAKSESQE-KRSWILYHPSALNTFEQIVCSAKGKQVVVFLDYDGTL  120

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIV DPDKAFMT +MR  ++ +A+HFPTAIV+GRCR KVYNFVKL++LYYAGSHGMDIK
Sbjct  121  SPIVADPDKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAELYYAGSHGMDIK  180

Query  225  GPTK------GNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            GPTK      GN   N+AVL QPA +FLPMI+EVYK+LLEKTK+VPGA VENNKFCLSVH
Sbjct  181  GPTKSQSPKQGN--NNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGANVENNKFCLSVH  238

Query  63   YRCVEEK  43
            +RCV+EK
Sbjct  239  FRCVDEK  245



>ref|XP_010547623.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Tarenaya hassleriana]
Length=374

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/254 (58%), Positives = 184/254 (72%), Gaps = 26/254 (10%)
 Frame = -2

Query  750  KTRKMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG------  589
            K  +M +QNVV S+ KSG+  + VAV+ P+      A+  P   G +ISI R        
Sbjct  7    KRERMASQNVVASEAKSGIITVTVAVANPS------AQKPPTAPG-YISISRKKLLHNLE  59

Query  588  -----RINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKI  436
                 RINA  +SMR SSPT      S   E+ N SW++ HPSA+ MF+ I+  S+GK+I
Sbjct  60   INGGHRINAWVDSMRASSPTHLKSVPSLSPEERN-SWIIQHPSALDMFEQIIEASRGKQI  118

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMFLDYDGTLSPIV+DP++AFM+++MR  VR +AK FPTAIVSGRCR KVYNFVKL++LY
Sbjct  119  VMFLDYDGTLSPIVDDPERAFMSSKMRRTVRKLAKCFPTAIVSGRCRDKVYNFVKLAELY  178

Query  255  YAGSHGMDIKGPTKGN---LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YAGSHGMDIKGPTKG+    K N +V+ QPA EFLP+I+EVYK L++KTKS PGA VENN
Sbjct  179  YAGSHGMDIKGPTKGSSKYQKDNPSVVFQPASEFLPIIDEVYKELVDKTKSTPGAMVENN  238

Query  84   KFCLSVHYRCVEEK  43
            KFCLSVH+RCV+EK
Sbjct  239  KFCLSVHFRCVDEK  252



>ref|XP_007018813.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
4, partial [Theobroma cacao]
 gb|EOY16038.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
4, partial [Theobroma cacao]
Length=272

 Score =   275 bits (702),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 183/248 (74%), Gaps = 21/248 (8%)
 Frame = -2

Query  738  MTNQ-NVVVSDPK-SGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------PGRI  583
            MTNQ NVVV D K  GV      V  P+  P  VAKPL       + + R        +I
Sbjct  1    MTNQQNVVVFDLKPRGVR----HVLPPSSLP--VAKPLSRQDIKMLLMKRFETEKAGAKI  54

Query  582  NALFESMRDSSPTR-RSFES----EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
            NA  +SMR SSPTR +S  S     D   SW+++HPSA+SMF+ I+  SKGK+IVMFLDY
Sbjct  55   NAWVDSMRASSPTRIKSTASLPPETDEKSSWIVHHPSALSMFEQIVAASKGKQIVMFLDY  114

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIVEDPD+AFM  EMR A+R+VA++FPTAIV+GRCR KVY+FVKL+ LYYAGSHG
Sbjct  115  DGTLSPIVEDPDQAFMPREMRAALRDVARYFPTAIVTGRCRDKVYSFVKLAGLYYAGSHG  174

Query  237  MDIKGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            MDIKGP+K     KGNQ VL QPA EFLPMI++VYK L+EKTKS+PGAKVENNKFC+SVH
Sbjct  175  MDIKGPSKSCKYKKGNQGVLFQPASEFLPMIDKVYKALVEKTKSIPGAKVENNKFCVSVH  234

Query  63   YRCVEEKV  40
            +RCV+EKV
Sbjct  235  FRCVDEKV  242



>ref|XP_008440611.1| PREDICTED: probable trehalose-phosphate phosphatase J [Cucumis 
melo]
Length=387

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 179/259 (69%), Gaps = 28/259 (11%)
 Frame = -2

Query  738  MTNQ-NVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAG-----AGSFISIPRP----  592
            MTN  NVV+S+ KS + + I V VS  ++F     KP PAG      G +ISI R     
Sbjct  1    MTNNPNVVISESKSSINMAITVTVSNSSIFQATAQKP-PAGPSSTTGGGYISISRSTKLV  59

Query  591  ------GRINALFESMRDSSPTR--------RSFESEDVNKSWMLNHPSAISMFDDIMNF  454
                   RI    +SMR SSP+R              D N SWML+HPSA+ MFD I++ 
Sbjct  60   QQPDGRARIKTWVDSMRASSPSRIKPTPSLSDHDHDHDHNSSWMLHHPSALDMFDQIIDA  119

Query  453  SKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFV  274
            SKGK+IVMFLDYDGTLSPIV+DPD+AFM+  MR  V+ VA+ FPTAIVSGR R KVY FV
Sbjct  120  SKGKQIVMFLDYDGTLSPIVDDPDRAFMSDAMRKTVKMVARSFPTAIVSGRRRDKVYGFV  179

Query  273  KLSQLYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGA  100
            +L +LYYAGSHGMDIKGPTK +   K  Q+VL QPA EFLPMI++VYK L+EKTKS PGA
Sbjct  180  RLGELYYAGSHGMDIKGPTKDSNYKKCTQSVLFQPASEFLPMIDQVYKQLVEKTKSTPGA  239

Query  99   KVENNKFCLSVHYRCVEEK  43
            KVENNKFCLSVHYRCVEEK
Sbjct  240  KVENNKFCLSVHYRCVEEK  258



>ref|XP_010547624.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Tarenaya hassleriana]
Length=364

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 182/250 (73%), Gaps = 26/250 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG----------  589
            M +QNVV S+ KSG+  + VAV+ P+      A+  P   G +ISI R            
Sbjct  1    MASQNVVASEAKSGIITVTVAVANPS------AQKPPTAPG-YISISRKKLLHNLEINGG  53

Query  588  -RINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RINA  +SMR SSPT      S   E+ N SW++ HPSA+ MF+ I+  S+GK+IVMFL
Sbjct  54   HRINAWVDSMRASSPTHLKSVPSLSPEERN-SWIIQHPSALDMFEQIIEASRGKQIVMFL  112

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DP++AFM+++MR  VR +AK FPTAIVSGRCR KVYNFVKL++LYYAGS
Sbjct  113  DYDGTLSPIVDDPERAFMSSKMRRTVRKLAKCFPTAIVSGRCRDKVYNFVKLAELYYAGS  172

Query  243  HGMDIKGPTKGN---LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGPTKG+    K N +V+ QPA EFLP+I+EVYK L++KTKS PGA VENNKFCL
Sbjct  173  HGMDIKGPTKGSSKYQKDNPSVVFQPASEFLPIIDEVYKELVDKTKSTPGAMVENNKFCL  232

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  233  SVHFRCVDEK  242



>gb|EYU31023.1| hypothetical protein MIMGU_mgv1a008338mg [Erythranthe guttata]
Length=377

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 181/245 (74%), Gaps = 26/245 (11%)
 Frame = -2

Query  723  VVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP--------------G  589
            V ++D KSG+ + I +A+S    F  A A P     G++ISIP+                
Sbjct  2    VNIADSKSGINMEITMAISG---FSPAAAPP-----GTYISIPKKKLLQNNNLDISSSNS  53

Query  588  RINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            R N   +SMR SSPTR +S    D   SWM+ HPSA+++FD+I + SKGK+IVMFLDYDG
Sbjct  54   RTNTWVDSMRASSPTRIKSSPFSDDQNSWMVQHPSALNVFDEITSASKGKQIVMFLDYDG  113

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+  MR  VR +A++FPTAIVSGRCR KVY+FV+L++LYYAGSHGMD
Sbjct  114  TLSPIVDDPDRAFMSDAMRATVRKLARYFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMD  173

Query  231  IKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP+KG+   KG+QAVL QPA EFLPMI+EVYK LLE TKS PG++VENNKFC+SVH+R
Sbjct  174  IKGPSKGSKYTKGSQAVLFQPASEFLPMIDEVYKALLEVTKSTPGSRVENNKFCVSVHFR  233

Query  57   CVEEK  43
            CV+EK
Sbjct  234  CVDEK  238



>ref|XP_009613560.1| PREDICTED: probable trehalose-phosphate phosphatase J [Nicotiana 
tomentosiformis]
Length=374

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 178/244 (73%), Gaps = 21/244 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG--------RI  583
            MT QNVVVSDP SG+       +       AV KP PA  GS I+I R          RI
Sbjct  1    MTKQNVVVSDPNSGI-------NNATFTAAAVQKPPPA-PGSCINISRKTLVEINSGPRI  52

Query  582  NALFESMRDSSPTRRSFES--EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
            N+  +SMR SSPT     S  ED N SWM++HPSA+ MF+ I++ SKGKK+VMFLDYDGT
Sbjct  53   NSWVDSMRASSPTHHKCTSLSED-NTSWMVHHPSALDMFEQIISASKGKKMVMFLDYDGT  111

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV+DPD+AFM+  MR  VR +A++FPTAIVSGRCR KVY+FV+L++LYYAGSHGMDI
Sbjct  112  LSPIVDDPDQAFMSDAMRGTVRKLARYFPTAIVSGRCRDKVYSFVQLAELYYAGSHGMDI  171

Query  228  KGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            +GP+K +   KG QA L QPA EFLPMI EVYK LL+KT S+ G +VENNKFC+SVH+RC
Sbjct  172  EGPSKDSKYKKGAQAALFQPASEFLPMIVEVYKELLDKTNSINGVRVENNKFCVSVHFRC  231

Query  54   VEEK  43
            V+EK
Sbjct  232  VDEK  235



>ref|XP_007018814.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
5 [Theobroma cacao]
 gb|EOY16039.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
5 [Theobroma cacao]
Length=284

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 182/247 (74%), Gaps = 21/247 (9%)
 Frame = -2

Query  738  MTNQ-NVVVSDPK-SGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------PGRI  583
            MTNQ NVVV D K  GV      V  P+  P  VAKPL       + + R        +I
Sbjct  1    MTNQQNVVVFDLKPRGVR----HVLPPSSLP--VAKPLSRQDIKMLLMKRFETEKAGAKI  54

Query  582  NALFESMRDSSPTR-RSFES----EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
            NA  +SMR SSPTR +S  S     D   SW+++HPSA+SMF+ I+  SKGK+IVMFLDY
Sbjct  55   NAWVDSMRASSPTRIKSTASLPPETDEKSSWIVHHPSALSMFEQIVAASKGKQIVMFLDY  114

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIVEDPD+AFM  EMR A+R+VA++FPTAIV+GRCR KVY+FVKL+ LYYAGSHG
Sbjct  115  DGTLSPIVEDPDQAFMPREMRAALRDVARYFPTAIVTGRCRDKVYSFVKLAGLYYAGSHG  174

Query  237  MDIKGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            MDIKGP+K     KGNQ VL QPA EFLPMI++VYK L+EKTKS+PGAKVENNKFC+SVH
Sbjct  175  MDIKGPSKSCKYKKGNQGVLFQPASEFLPMIDKVYKALVEKTKSIPGAKVENNKFCVSVH  234

Query  63   YRCVEEK  43
            +RCV+EK
Sbjct  235  FRCVDEK  241



>ref|XP_008453786.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Cucumis melo]
Length=381

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 178/253 (70%), Gaps = 21/253 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGS-----FISIPRPGRINA  577
            MTNQNVVVSD KSG+ + I VAVS  ++F     KP PA  G      +ISI R   +  
Sbjct  1    MTNQNVVVSDTKSGINMSITVAVSNSSIFATTAQKPPPAPGGGGGGGGYISISRKKILKD  60

Query  576  L------FESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
            L       ESMR SSPT        S   +    SWML+HPSA+ MFD I+  SKGK+IV
Sbjct  61   LDVNGGWIESMRASSPTHVKSLPSLSASDDHHQNSWMLHHPSALDMFDQIIEASKGKQIV  120

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIVEDPDKAFM+  MR  V+ +A  FPTAIVSGRCR KVY F++L++LYY
Sbjct  121  MFLDYDGTLSPIVEDPDKAFMSEAMRKTVKKLASCFPTAIVSGRCRDKVYGFIRLAELYY  180

Query  252  AGSHGMDIKGPTKGN---LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            AGSHGMDIKGPTK +      NQ +L QPA EFLPMI+EVY+ L+EK KS PGAKVENNK
Sbjct  181  AGSHGMDIKGPTKSSKFKKAVNQGLLFQPASEFLPMIDEVYQQLVEKMKSTPGAKVENNK  240

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+EK
Sbjct  241  FCISVHFRCVDEK  253



>ref|XP_009797815.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Nicotiana sylvestris]
Length=379

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 180/246 (73%), Gaps = 23/246 (9%)
 Frame = -2

Query  741  KMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR---------PG  589
            KMT QNVV SD K+GV          A F  AV KP PA  GS I+I R         P 
Sbjct  5    KMTKQNVVDSDAKAGV--------NTATFTAAVQKPPPA-PGSCINISRKTLVEINSGPR  55

Query  588  RINALFESMRDSSPTRRSFES--EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
              N   +SMR SSPT   + S  ED N SWM++HPSA++MF+ I+  SKGKK+VMFLDYD
Sbjct  56   INNNWVDSMRASSPTHHKYTSLSED-NTSWMVHHPSALNMFEQIIGASKGKKMVMFLDYD  114

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPD+AFM+  MR  VR +A++FPTAIVSGRCR KVY+FV+L++LYYAGSHGM
Sbjct  115  GTLSPIVDDPDQAFMSDAMRGTVRKLARYFPTAIVSGRCRDKVYSFVQLAELYYAGSHGM  174

Query  234  DIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            DI+GP+KG+   K  QAVL QPA +FLPMI+EVYK LL+KTK + G +VENNKFC+SVH+
Sbjct  175  DIEGPSKGSKYKKEAQAVLFQPASDFLPMIDEVYKELLDKTKCIEGVRVENNKFCVSVHF  234

Query  60   RCVEEK  43
            RCV+EK
Sbjct  235  RCVDEK  240



>ref|XP_010105898.1| Trehalose-phosphate phosphatase [Morus notabilis]
 gb|EXC06717.1| Trehalose-phosphate phosphatase [Morus notabilis]
Length=358

 Score =   275 bits (703),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 183/247 (74%), Gaps = 16/247 (6%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG---RINALFE  568
            MTNQNVVVSD K G+A I VAV+  +LF  A    +         +   G   RI+A  +
Sbjct  1    MTNQNVVVSDAK-GLA-IAVAVANQSLFSSAPGGCITISRNKLQRLETGGGGARISAWVD  58

Query  567  SMRDSSPTRRS-------FESEDVNKS-WMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            SMR SSP R +         S+D  KS W L HPSA+SMF+ I N SKGK+IVMFLDYDG
Sbjct  59   SMRASSPPRTTKSITSSNLISQDEEKSSWTLRHPSALSMFEQITNASKGKQIVMFLDYDG  118

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIVEDPD+A+M+ EMR AVR VA++FPTAIVSGRCR KVY+FV+L++LYYAGSHGMD
Sbjct  119  TLSPIVEDPDRAYMSNEMRKAVRAVARYFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMD  178

Query  231  IKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP+K +    GN++VLCQPA EFLPM++EVYK+LLEKTKS+PG++VE+NKFC+S  + 
Sbjct  179  IKGPSKCSKYKNGNESVLCQPATEFLPMVDEVYKILLEKTKSIPGSRVEHNKFCIS-SWA  237

Query  57   CVEEKVQ  37
             + E+V+
Sbjct  238  ALAEQVR  244



>ref|XP_010544184.1| PREDICTED: probable trehalose-phosphate phosphatase D [Tarenaya 
hassleriana]
Length=367

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 185/254 (73%), Gaps = 34/254 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP----------  592
            MTN+NVV+SD KSG+   ++V V+ P+           +    +ISIPR           
Sbjct  1    MTNRNVVMSDAKSGIGFAVKVPVTNPS-----------SSLCGYISIPRKKLLKKLEADP  49

Query  591  --GRINALFESMRDSSPTRR-----SF---ESEDVNKSWMLNHPSAISMFDDIMNFSKGK  442
               RIN+  ESMR SSPTR      +F   ESE    SW+ +HPSA++MFDDI + SKGK
Sbjct  50   TRTRINSWVESMRASSPTRSRPGSGNFTIPESEVEEDSWVAHHPSALNMFDDIAHASKGK  109

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            K+VMFLDYDGTLSPIVEDPD+AFMT EMRDAV++VA++FPTAIV+GRC+ KV +FVKL+ 
Sbjct  110  KVVMFLDYDGTLSPIVEDPDRAFMTNEMRDAVKDVARYFPTAIVTGRCQDKVRSFVKLAG  169

Query  261  LYYAGSHGMDIKGP--TKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            LYYAGSHGMDIKGP   K + K NQ VL QPA EFLPMI+EV+K L+EK K++PGAKVEN
Sbjct  170  LYYAGSHGMDIKGPSKKKKHNKSNQGVLFQPASEFLPMIDEVFKSLVEKMKTIPGAKVEN  229

Query  87   NKFCLSVHYRCVEE  46
            NKFC+SVH+RCV++
Sbjct  230  NKFCVSVHFRCVDQ  243



>ref|XP_009797816.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009797817.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009797818.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Nicotiana sylvestris]
Length=374

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 179/245 (73%), Gaps = 23/245 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR---------PGR  586
            MT QNVV SD K+GV          A F  AV KP PA  GS I+I R         P  
Sbjct  1    MTKQNVVDSDAKAGV--------NTATFTAAVQKPPPA-PGSCINISRKTLVEINSGPRI  51

Query  585  INALFESMRDSSPTRRSFES--EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
             N   +SMR SSPT   + S  ED N SWM++HPSA++MF+ I+  SKGKK+VMFLDYDG
Sbjct  52   NNNWVDSMRASSPTHHKYTSLSED-NTSWMVHHPSALNMFEQIIGASKGKKMVMFLDYDG  110

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+  MR  VR +A++FPTAIVSGRCR KVY+FV+L++LYYAGSHGMD
Sbjct  111  TLSPIVDDPDQAFMSDAMRGTVRKLARYFPTAIVSGRCRDKVYSFVQLAELYYAGSHGMD  170

Query  231  IKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            I+GP+KG+   K  QAVL QPA +FLPMI+EVYK LL+KTK + G +VENNKFC+SVH+R
Sbjct  171  IEGPSKGSKYKKEAQAVLFQPASDFLPMIDEVYKELLDKTKCIEGVRVENNKFCVSVHFR  230

Query  57   CVEEK  43
            CV+EK
Sbjct  231  CVDEK  235



>ref|XP_010269219.1| PREDICTED: probable trehalose-phosphate phosphatase J [Nelumbo 
nucifera]
Length=374

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 181/250 (72%), Gaps = 19/250 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP-----------  592
            MT QNVVV D KSG+  +   V   +LFP A  KP PA  G +I I R            
Sbjct  1    MTKQNVVVPDVKSGINDMITVVPNASLFPSAGQKP-PAAPGGYIGISRKKFLKKLETGGG  59

Query  591  GRINALFESMRDSSPTR-RSFESEDVN----KSWMLNHPSAISMFDDIMNFSKGKKIVMF  427
             ++N   +SM+ SSPT  +S  S   N    +SW+L+HPSA++MF+ IM  SKGK+IVMF
Sbjct  60   AKVNPWVDSMKVSSPTHAKSTPSLSPNVDQIESWILSHPSALNMFEQIMAASKGKQIVMF  119

Query  426  LDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAG  247
            LDYDGTLSPIV++PD+AFM+  MR AV+ VA+ FPTAIVSGRCR KVY+FV+L++LYYAG
Sbjct  120  LDYDGTLSPIVDNPDEAFMSESMRRAVKAVARCFPTAIVSGRCRDKVYSFVRLAELYYAG  179

Query  246  SHGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            SHGMDIKGP +G +  K NQ VL QPA EFLPMI+EVYK L+EKT+ + GA VE+NKFC+
Sbjct  180  SHGMDIKGPAEGVICSKVNQPVLFQPASEFLPMIDEVYKALVEKTRCIRGANVEHNKFCV  239

Query  72   SVHYRCVEEK  43
            SVH+RCVEEK
Sbjct  240  SVHFRCVEEK  249



>ref|XP_007018811.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY16036.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
2 [Theobroma cacao]
Length=351

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 182/247 (74%), Gaps = 21/247 (9%)
 Frame = -2

Query  738  MTNQ-NVVVSDPK-SGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------PGRI  583
            MTNQ NVVV D K  GV      V  P+  P  VAKPL       + + R        +I
Sbjct  1    MTNQQNVVVFDLKPRGVR----HVLPPSSLP--VAKPLSRQDIKMLLMKRFETEKAGAKI  54

Query  582  NALFESMRDSSPTR-RSFES----EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
            NA  +SMR SSPTR +S  S     D   SW+++HPSA+SMF+ I+  SKGK+IVMFLDY
Sbjct  55   NAWVDSMRASSPTRIKSTASLPPETDEKSSWIVHHPSALSMFEQIVAASKGKQIVMFLDY  114

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIVEDPD+AFM  EMR A+R+VA++FPTAIV+GRCR KVY+FVKL+ LYYAGSHG
Sbjct  115  DGTLSPIVEDPDQAFMPREMRAALRDVARYFPTAIVTGRCRDKVYSFVKLAGLYYAGSHG  174

Query  237  MDIKGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            MDIKGP+K     KGNQ VL QPA EFLPMI++VYK L+EKTKS+PGAKVENNKFC+SVH
Sbjct  175  MDIKGPSKSCKYKKGNQGVLFQPASEFLPMIDKVYKALVEKTKSIPGAKVENNKFCVSVH  234

Query  63   YRCVEEK  43
            +RCV+EK
Sbjct  235  FRCVDEK  241



>ref|XP_007018810.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY16035.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
1 [Theobroma cacao]
Length=364

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 182/247 (74%), Gaps = 21/247 (9%)
 Frame = -2

Query  738  MTNQ-NVVVSDPK-SGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------PGRI  583
            MTNQ NVVV D K  GV      V  P+  P  VAKPL       + + R        +I
Sbjct  1    MTNQQNVVVFDLKPRGVR----HVLPPSSLP--VAKPLSRQDIKMLLMKRFETEKAGAKI  54

Query  582  NALFESMRDSSPTR-RSFES----EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
            NA  +SMR SSPTR +S  S     D   SW+++HPSA+SMF+ I+  SKGK+IVMFLDY
Sbjct  55   NAWVDSMRASSPTRIKSTASLPPETDEKSSWIVHHPSALSMFEQIVAASKGKQIVMFLDY  114

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIVEDPD+AFM  EMR A+R+VA++FPTAIV+GRCR KVY+FVKL+ LYYAGSHG
Sbjct  115  DGTLSPIVEDPDQAFMPREMRAALRDVARYFPTAIVTGRCRDKVYSFVKLAGLYYAGSHG  174

Query  237  MDIKGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            MDIKGP+K     KGNQ VL QPA EFLPMI++VYK L+EKTKS+PGAKVENNKFC+SVH
Sbjct  175  MDIKGPSKSCKYKKGNQGVLFQPASEFLPMIDKVYKALVEKTKSIPGAKVENNKFCVSVH  234

Query  63   YRCVEEK  43
            +RCV+EK
Sbjct  235  FRCVDEK  241



>ref|XP_004146870.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 ref|XP_004167555.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 gb|KGN53223.1| hypothetical protein Csa_4G028470 [Cucumis sativus]
Length=381

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 153/253 (60%), Positives = 182/253 (72%), Gaps = 21/253 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGS-----FISIPRPGRINA  577
            MTNQNVVVSD KSG+ + I VAVS  ++F     KP PA AG+     +ISI R   +  
Sbjct  1    MTNQNVVVSDTKSGINMSITVAVSNSSIFATTAQKPPPAPAGAAGGGGYISISRKKILKD  60

Query  576  L------FESMRDSSPTRR----SFESEDVNK--SWMLNHPSAISMFDDIMNFSKGKKIV  433
            L       ESMR SSPT      SF + D ++  SWM  HPSA+ MFD I+  SKGK+IV
Sbjct  61   LDVNGGWIESMRASSPTHVKSLPSFSASDDHRQNSWMHLHPSALDMFDQIIEASKGKQIV  120

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIVEDPDKAFM+  MR  V+ +A  FPTAIVSGRCR KVY F++L++LYY
Sbjct  121  MFLDYDGTLSPIVEDPDKAFMSEAMRKTVKKLATCFPTAIVSGRCRDKVYGFIRLAELYY  180

Query  252  AGSHGMDIKGPTKGN---LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            AGSHGMDIKGPTK +      NQ +L QPA EFLPMI+EVY+ L++K KS PGAKVENNK
Sbjct  181  AGSHGMDIKGPTKSSKFKKAVNQGLLFQPASEFLPMIDEVYQQLVQKMKSTPGAKVENNK  240

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+EK
Sbjct  241  FCISVHFRCVDEK  253



>ref|XP_008453785.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Cucumis melo]
Length=382

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/254 (60%), Positives = 178/254 (70%), Gaps = 22/254 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGS-----FISIPRPGRINA  577
            MTNQNVVVSD KSG+ + I VAVS  ++F     KP PA  G      +ISI R   +  
Sbjct  1    MTNQNVVVSDTKSGINMSITVAVSNSSIFATTAQKPPPAPGGGGGGGGYISISRKKILKD  60

Query  576  L------FESMRDSSPTR------RSFESEDVNKSWM-LNHPSAISMFDDIMNFSKGKKI  436
            L       ESMR SSPT        S   +    SWM L+HPSA+ MFD I+  SKGK+I
Sbjct  61   LDVNGGWIESMRASSPTHVKSLPSLSASDDHHQNSWMQLHHPSALDMFDQIIEASKGKQI  120

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMFLDYDGTLSPIVEDPDKAFM+  MR  V+ +A  FPTAIVSGRCR KVY F++L++LY
Sbjct  121  VMFLDYDGTLSPIVEDPDKAFMSEAMRKTVKKLASCFPTAIVSGRCRDKVYGFIRLAELY  180

Query  255  YAGSHGMDIKGPTKGN---LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YAGSHGMDIKGPTK +      NQ +L QPA EFLPMI+EVY+ L+EK KS PGAKVENN
Sbjct  181  YAGSHGMDIKGPTKSSKFKKAVNQGLLFQPASEFLPMIDEVYQQLVEKMKSTPGAKVENN  240

Query  84   KFCLSVHYRCVEEK  43
            KFC+SVH+RCV+EK
Sbjct  241  KFCISVHFRCVDEK  254



>ref|XP_007136236.1| hypothetical protein PHAVU_009G0298000g, partial [Phaseolus vulgaris]
 gb|ESW08230.1| hypothetical protein PHAVU_009G0298000g, partial [Phaseolus vulgaris]
Length=291

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 153/185 (83%), Gaps = 4/185 (2%)
 Frame = -2

Query  588  RINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
            ++ A  +SMR SSPTR   ES++  +SW+L HPSA++ F+ I   SKGK+IV+FLDYDGT
Sbjct  23   KVGAWIDSMRASSPTRGKSESQE-KRSWILYHPSALNTFEQITYNSKGKQIVVFLDYDGT  81

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV DPDKAFM+ +MR  ++ +A+HFPTAIV+GRCR KVYNFVKL +LYYAGSHGMDI
Sbjct  82   LSPIVTDPDKAFMSRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLGELYYAGSHGMDI  141

Query  228  KGPTK---GNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            KGPTK   G    N+ VL QPA +FLPMI+EVYK+LLE+TKSVPGAKVENNKFCLSVH+R
Sbjct  142  KGPTKSRSGKQGNNKGVLFQPASQFLPMIDEVYKILLERTKSVPGAKVENNKFCLSVHFR  201

Query  57   CVEEK  43
            CV+EK
Sbjct  202  CVDEK  206



>ref|XP_007159639.1| hypothetical protein PHAVU_002G254600g [Phaseolus vulgaris]
 gb|ESW31633.1| hypothetical protein PHAVU_002G254600g [Phaseolus vulgaris]
Length=366

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 172/251 (69%), Gaps = 32/251 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------P  592
            MT QNVV+S  KSG+        +P           PA  G +I IPR            
Sbjct  1    MTQQNVVLSKTKSGINRDLTVAQKP-----------PAAPGGYIPIPRRRVLKNLEINGG  49

Query  591  GRINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RINA  +SMR SSPT+     SF  E  + SW+L HPSA+ MF+ IM+ S+GK+IVMFL
Sbjct  50   QRINAWVDSMRASSPTQAKSTSSFAEE--HSSWILRHPSALDMFEQIMDASRGKQIVMFL  107

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPD+AFM+  MR  VR +A+ FPTAIV+GRC+ KVYNFV+L++LYYAGS
Sbjct  108  DYDGTLSPIVDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGS  167

Query  243  HGMDIKGPTK----GNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            HGMDI+GPT+     N    + +L QPA EFLPMI+EVY  L+EK KS+PGA+VENNKFC
Sbjct  168  HGMDIQGPTRDSKYSNKDKGEPLLFQPASEFLPMIDEVYNQLVEKMKSIPGARVENNKFC  227

Query  75   LSVHYRCVEEK  43
             SVH+RCV+EK
Sbjct  228  ASVHFRCVDEK  238



>ref|XP_010676890.1| PREDICTED: probable trehalose-phosphate phosphatase D [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 179/242 (74%), Gaps = 13/242 (5%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFI---------SIPRPG  589
            MTNQNVVVSD K  + + + +A+S  +LF  AV KP  + AG FI         +   P 
Sbjct  1    MTNQNVVVSDGKQSLKVAVAMAMSNSSLFSPAVPKPPTSTAGRFIRRKVVKKLETQGAPQ  60

Query  588  RINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
            +IN   +SMR SSP +    S + + +WM+ HPSA+ MFD I+  SKGKKIVMFLDYDGT
Sbjct  61   KINVWVDSMRASSPAKSPPSSPE-HDTWMVTHPSALGMFDQIIRASKGKKIVMFLDYDGT  119

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV+DPD+AFM+ EMR AV+ VA++FPTAIVSGR + KVY+FVKL +LYYAGSHGMDI
Sbjct  120  LSPIVQDPDRAFMSDEMRAAVKTVARYFPTAIVSGRGKDKVYDFVKLKELYYAGSHGMDI  179

Query  228  KGPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVE  49
            +GP  G+   +++V+CQPA EFLP+I  VY  L+EKTK + GAKVE+NKFCLSVH+RCV+
Sbjct  180  EGPVNGS--NDKSVVCQPASEFLPIINHVYNKLVEKTKFIEGAKVESNKFCLSVHFRCVD  237

Query  48   EK  43
            EK
Sbjct  238  EK  239



>ref|XP_003543766.1| PREDICTED: probable trehalose-phosphate phosphatase I [Glycine 
max]
 gb|KHN19585.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=372

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 174/252 (69%), Gaps = 25/252 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGR---------  586
            MTN+NV      + +  + +++S  +  P A    + A  G  + +P+            
Sbjct  1    MTNRNV-----NNTLVELAMSISNTSALPRATVPGIMALLGGVLGLPQKKLLMKTLEDGS  55

Query  585  --------INALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
                    IN   +SMR SSPTR +S +++D    W L HPSA+SMFD I+  SKGK+IV
Sbjct  56   VNKGGTKVINTWIDSMRASSPTRVKSTQNQDPTSPWTLYHPSALSMFDQIVCESKGKQIV  115

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
             FLDYDGTLSPIV DPDKA+M+ +MR  ++++A+HFPTAIVSGRC  KVYNFV+L++LYY
Sbjct  116  TFLDYDGTLSPIVADPDKAYMSKKMRTTLKDLARHFPTAIVSGRCLDKVYNFVRLAELYY  175

Query  252  AGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            AGSHGMDIKGPT  +   K N+ VL QPA EFLPMI EVY +L+EKTKSVPGAKVENNKF
Sbjct  176  AGSHGMDIKGPTNKRSTKKENEQVLFQPASEFLPMINEVYNILVEKTKSVPGAKVENNKF  235

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  236  CLSVHFRCVDEK  247



>gb|KHF97975.1| Trehalose-phosphate phosphatase [Gossypium arboreum]
Length=368

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 176/244 (72%), Gaps = 14/244 (6%)
 Frame = -2

Query  738  MTNQ-NVVVSDPKS-GVA--LIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGRINALF  571
            MTNQ NVVV D  S GV+  L R ++  P  F     K L      F +     +I+A  
Sbjct  1    MTNQQNVVVLDVISRGVSNVLPRSSLPVPKSFSPQDLKMLLMK--RFEAENGGAKISAWV  58

Query  570  ESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
            +SMR SSPTR       S    D   SW+++HPSA+SMF+ I+  SKGK+IVMFLDYDGT
Sbjct  59   DSMRASSPTRIKSSTTASLPETDDTSSWIVHHPSALSMFEQIVAGSKGKQIVMFLDYDGT  118

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIVEDPD+AFM  EMR  VR+VA++FPTAIV+GRCR KVY+FVKL+ LYYAGSHGMDI
Sbjct  119  LSPIVEDPDQAFMPKEMRATVRDVARYFPTAIVTGRCRDKVYSFVKLAGLYYAGSHGMDI  178

Query  228  KGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            KGP+K     KGNQ VL Q A EFLPMI+EVYK L+EKTKS+PG KVENNKFC+SVH+RC
Sbjct  179  KGPSKSCKYKKGNQGVLFQAASEFLPMIDEVYKDLVEKTKSIPGTKVENNKFCVSVHFRC  238

Query  54   VEEK  43
            V+EK
Sbjct  239  VDEK  242



>ref|XP_010059987.1| PREDICTED: probable trehalose-phosphate phosphatase C [Eucalyptus 
grandis]
 gb|KCW66492.1| hypothetical protein EUGRSUZ_F00298 [Eucalyptus grandis]
Length=384

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 176/256 (69%), Gaps = 23/256 (9%)
 Frame = -2

Query  753  PKTRKMTNQNVVVSDPKSGVALIRVAVSEPALFPHAV-----AKPLPAGAGSFISIPRPG  589
            PKT KM  Q+V VS+P      + + V +P L P  +      K    G G  +   R  
Sbjct  8    PKTGKMMKQSVRVSNPTLNFINVPI-VRDPKLIPRGLPRNKHLKIESNGGGHLV---REA  63

Query  588  RINALFESMRDSSPTRRSFES--------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
            R++ L +SMR SSP R    S        +D  KSW+  HPSA+SMF+ I   S GKKIV
Sbjct  64   RVSTLLDSMRASSPARARPASAATRAASLDDEQKSWIQRHPSALSMFEQITRASVGKKIV  123

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIVEDPD+AFM+ EMR+AVR+ A  FPTAIVSGRCR KVY+FVKL++LYY
Sbjct  124  MFLDYDGTLSPIVEDPDRAFMSDEMREAVRDTASFFPTAIVSGRCRDKVYSFVKLTELYY  183

Query  252  AGSHGMDIKGPTKGN------LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVE  91
            AGSHGMDIKGP  G+      +   ++VLCQPA EFLPMI+EVYK L+E TKS+PGAKVE
Sbjct  184  AGSHGMDIKGPPPGSRCNGNRMNNGESVLCQPASEFLPMIDEVYKTLVESTKSIPGAKVE  243

Query  90   NNKFCLSVHYRCVEEK  43
             NKFCLSVH+RCV+EK
Sbjct  244  TNKFCLSVHFRCVDEK  259



>ref|XP_010428924.1| PREDICTED: trehalose-phosphate phosphatase B [Camelina sativa]
Length=377

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 173/254 (68%), Gaps = 22/254 (9%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MTNQNV+VSD  P  G+  I V+VS   LF ++           F+ +            
Sbjct  1    MTNQNVIVSDRKPILGLQTITVSVSNSPLFSNSFPTYFTFPRRKFLKLLEAADNNNSNLV  60

Query  594  --PGRINALFESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
              P    +  +SMRDSSPTR       S    D   SW++  PSA+SMFD+I+N +KGK+
Sbjct  61   VAPKITTSWVDSMRDSSPTRLRSSSLDSVSDNDDKTSWIVRFPSALSMFDEIVNAAKGKQ  120

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPDKAF+T EMR  V++VA HFPTAIV+GR   KV  FVKL+++
Sbjct  121  IVMFLDYDGTLSPIVEDPDKAFITHEMRGVVKDVALHFPTAIVTGRSIDKVRRFVKLNEI  180

Query  258  YYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDI+GPTK N  G  N+ VL QPAREFLPMIE+V K+L EKTK +PGA VENN
Sbjct  181  YYAGSHGMDIEGPTKENNYGQSNERVLFQPAREFLPMIEKVVKILEEKTKWIPGAMVENN  240

Query  84   KFCLSVHYRCVEEK  43
            KFCLSVH+R V+EK
Sbjct  241  KFCLSVHFRRVDEK  254



>ref|XP_010937497.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Elaeis 
guineensis]
Length=382

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 180/258 (70%), Gaps = 28/258 (11%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAG--------SFISIPRPG--  589
            MT QNVVV +  + +++  VA S P LFP+   +      G         ++S    G  
Sbjct  1    MTKQNVVVPEAMA-ISVAAVANSSP-LFPYLPPRSGCGAGGAGGFALKKKYLSQLELGGA  58

Query  588  RINALFESMRDSSPTRR-------------SFESEDVNKSWMLNHPSAISMFDDIMNFSK  448
            RINA  ESM+ SSPT               +  ++D + +W++ HPSA+S F+ I++ SK
Sbjct  59   RINAWVESMKASSPTHAKAAAALAVAPSVGAVGAQDEHATWIMRHPSALSKFEQIISASK  118

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GK+I MFLDYDGTLSPIV+DPD AFM+  MRDAVRN+A++FPTAIVSGRCR KVYNFV+L
Sbjct  119  GKQIAMFLDYDGTLSPIVDDPDLAFMSDAMRDAVRNLARYFPTAIVSGRCRDKVYNFVRL  178

Query  267  SQLYYAGSHGMDIKGPTKG--NLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAK  97
            ++LYYAGSHGMDIKGP  G   +K   +AV  QPA EFLPMI EVYKVLLEKTKS PGAK
Sbjct  179  AELYYAGSHGMDIKGPATGPRYMKAKAKAVHFQPASEFLPMIYEVYKVLLEKTKSTPGAK  238

Query  96   VENNKFCLSVHYRCVEEK  43
            VENNKFC+SVHYRCV+EK
Sbjct  239  VENNKFCVSVHYRCVDEK  256



>gb|KEH20857.1| trehalose-phosphate phosphatase [Medicago truncatula]
Length=315

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 176/253 (70%), Gaps = 34/253 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGV---ALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR---------  595
            MT +NVVVS+ K+G+     I VA            KP PA  G ++ IPR         
Sbjct  1    MTQKNVVVSETKTGINGSGTITVA-----------QKP-PAAPGGYVHIPRRRILKNLEI  48

Query  594  --PGRINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
                RIN   +SMR SSPT        +E+ N SW+L HPSA+ MF+ IM+ +KGK+IVM
Sbjct  49   NGGQRINTWIDSMRASSPTHVKSSPSLAEEYN-SWILRHPSALDMFEQIMDAAKGKQIVM  107

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD+AFM+  MR  V+ +A+ FPTAIV+GRC  KVYNFV+L +LYYA
Sbjct  108  FLDYDGTLSPIVDDPDRAFMSESMRKTVKKLARCFPTAIVTGRCIDKVYNFVRLDELYYA  167

Query  249  GSHGMDIKGPTKGNL--KGNQA--VLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            GSHGMDIKGPTK +   K N+A  VL QPAREF+PMI EVY+ L+EKTKS PGA+VEN+K
Sbjct  168  GSHGMDIKGPTKESKYNKNNKAEEVLFQPAREFVPMINEVYEQLVEKTKSTPGARVENHK  227

Query  81   FCLSVHYRCVEEK  43
            FC SVH+RCV+EK
Sbjct  228  FCTSVHFRCVDEK  240



>gb|KHN44334.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=361

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 173/251 (69%), Gaps = 33/251 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------P  592
            MT QNVVVSD KSGV+L   + ++         KP PA  G +ISIPR            
Sbjct  1    MTQQNVVVSDTKSGVSLTVFSTTQ---------KP-PAAPGGYISIPRRRVLKNLEINGG  50

Query  591  GRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RINA  ESMR SSPT      S   E  + SW++   S I+      + SKGK+IVMFL
Sbjct  51   QRINAWVESMRASSPTHHKSTPSLSQE--HNSWIVRRTSLIN--SHFFDASKGKQIVMFL  106

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPD+AFM+  MR  VR +A+ FPTAIV+GRC+ KVYNFV+L++LYYAGS
Sbjct  107  DYDGTLSPIVDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGS  166

Query  243  HGMDIKGPTKGNLKGN----QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            HGMDIKGPT+ +        +A+LCQPA +FLPMI+EVY+ L+EKTKS PGA VENNKFC
Sbjct  167  HGMDIKGPTRSSKYNKDSKAEAILCQPASDFLPMIDEVYQQLVEKTKSTPGALVENNKFC  226

Query  75   LSVHYRCVEEK  43
            LSVH+RCV+EK
Sbjct  227  LSVHFRCVDEK  237



>ref|XP_003544198.1| PREDICTED: probable trehalose-phosphate phosphatase 4-like [Glycine 
max]
 gb|KHN21829.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=379

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 152/188 (81%), Gaps = 7/188 (4%)
 Frame = -2

Query  585  INALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            IN   +SMR SSPTR     ++ +++D    W L HPSA+SMFD I+  SKGK+IV FLD
Sbjct  64   INTWIDSMRASSPTRSAKSTQNNQNQDPTSPWTLYHPSALSMFDHIVCESKGKQIVTFLD  123

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV DPDKA+M+ +MR  ++++A+HFPTAIVSGRC  KVYNFV+L++LYYAGSH
Sbjct  124  YDGTLSPIVADPDKAYMSKKMRATLKDLARHFPTAIVSGRCLDKVYNFVRLAELYYAGSH  183

Query  240  GMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGPT  +   KGN+ VL QPA EFLPMI EVY +L+EKTKSVPGAKVENNKFCLSV
Sbjct  184  GMDIKGPTNKRSTKKGNEQVLFQPASEFLPMINEVYNILVEKTKSVPGAKVENNKFCLSV  243

Query  66   HYRCVEEK  43
            H+RCV+EK
Sbjct  244  HFRCVDEK  251



>ref|XP_010444490.1| PREDICTED: probable trehalose-phosphate phosphatase J [Camelina 
sativa]
Length=369

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 180/252 (71%), Gaps = 23/252 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            M +QNVVVSD K+G+  +   VS  ++F  +  KP P   G +ISI +            
Sbjct  1    MVSQNVVVSDAKTGIITVS-TVSNSSVFTPSAQKP-PTAPG-YISISKKKLLKNLEINGA  57

Query  594  -PGRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
               R+ +  +SMR SSPT      S  +++   SW+  HPSA+ MF+ I+  ++GK+IVM
Sbjct  58   QSQRLTSWVDSMRASSPTHLKSLPSLSAQEELNSWIKRHPSALDMFERIIEAARGKQIVM  117

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD+AFM+++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYA
Sbjct  118  FLDYDGTLSPIVDDPDRAFMSSKMRRTVKKMAKSFPTSIVTGRCIDKVYSFVKLAELYYA  177

Query  249  GSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EVYK L+EKTKS  GAKVENNKF
Sbjct  178  GSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKSTAGAKVENNKF  237

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  238  CLSVHFRCVDEK  249



>gb|KHN09128.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=364

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 173/244 (71%), Gaps = 19/244 (8%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIP---------RPGR  586
            MTNQNVV  +  + +  +  ++S   + P A      A  G F  +P            +
Sbjct  1    MTNQNVVTHEVINTLIAMAASISNSTVLPSATVPESMAVLGGFWGLPHNKNLVKRLEGAK  60

Query  585  INALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
            ++A  +SMR SSPTR   ES++  +SW+L HPSA++ F+ I+  +KGK+IV+FLDYDGTL
Sbjct  61   VSAWIDSMRASSPTRAKSESQE-KRSWILYHPSALNTFEQIVYSAKGKQIVVFLDYDGTL  119

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIV DPDKAFMT +MR  ++ +A+HFPTAIV+GRCR KVYNFVKL++L      GMDI 
Sbjct  120  SPIVADPDKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAEL------GMDIT  173

Query  225  GPTKGNLKG---NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            GPTK   +G   N+AVL QPA +FLPMI+EVYK+LLEKTK+VPGAKVENNKFCLSVH+RC
Sbjct  174  GPTKSPKQGNNNNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGAKVENNKFCLSVHFRC  233

Query  54   VEEK  43
            V+EK
Sbjct  234  VDEK  237



>gb|KHG13010.1| Trehalose-phosphate phosphatase [Gossypium arboreum]
Length=347

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 162/219 (74%), Gaps = 17/219 (8%)
 Frame = -2

Query  654  PHAVAKPLPAGAGSFISIPRP-----------GRINALFESMRDSSPT--RRSFESEDVN  514
            P +  KP PA  G FISI R             R+N+  +SMR SSPT  + +  + D  
Sbjct  5    PKSAQKP-PAPPG-FISISRKKLLQNLEINAGARVNSWVDSMRASSPTHMKSAPSTADDQ  62

Query  513  KSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVA  334
             SW LNHPSA+ MF+ I++ SKGK+IVMFLDYDGTLSPIV DPD+AFM+ +MR  VR +A
Sbjct  63   GSWNLNHPSALDMFEQIIDASKGKQIVMFLDYDGTLSPIVADPDRAFMSKKMRKTVRKLA  122

Query  333  KHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKGNL--KGNQAVLCQPAREFL  160
            K FPTAIVSGRCR KVYNFVKL++LYYAGSHGMDIKGP K +   K  ++VL QPA EFL
Sbjct  123  KCFPTAIVSGRCRDKVYNFVKLAELYYAGSHGMDIKGPEKCSKSNKDTESVLFQPASEFL  182

Query  159  PMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            PMI+EVY  L+E TKS PGAKVENNKFCLSVH+RCV+EK
Sbjct  183  PMIDEVYTQLVETTKSTPGAKVENNKFCLSVHFRCVDEK  221



>ref|NP_001119501.1| probable trehalose-phosphate phosphatase J [Arabidopsis thaliana]
 gb|AED98008.1| probable trehalose-phosphate phosphatase J [Arabidopsis thaliana]
Length=325

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 184/253 (73%), Gaps = 24/253 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            M +QNVVVSD K+G+  +   VS  ++F     KP P   G +IS+ +            
Sbjct  1    MVSQNVVVSDAKTGIITVS-TVSNSSVFTPTAQKP-PTAPG-YISVSKKKLLKNLEINGA  57

Query  594  --PGRINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
                R+N+  +SMR SSPT      SF SE+ + SW+  HPSA++MF+ I+  ++GK+IV
Sbjct  58   DQSQRLNSWVDSMRASSPTHLKSLSSFSSEEEHNSWIKRHPSALNMFERIIEEARGKQIV  117

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIV+DPD+AFMT++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYY
Sbjct  118  MFLDYDGTLSPIVDDPDRAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVYSFVKLAELYY  177

Query  252  AGSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            AGSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EVYK L+EKTKS PGAKVENNK
Sbjct  178  AGSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKSTPGAKVENNK  237

Query  81   FCLSVHYRCVEEK  43
            FCLSVH+RCV+EK
Sbjct  238  FCLSVHFRCVDEK  250



>ref|XP_010484318.1| PREDICTED: probable trehalose-phosphate phosphatase J [Camelina 
sativa]
Length=369

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 180/252 (71%), Gaps = 23/252 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            M +QNVVVSD K+G+  +  AVS  ++F  +  KP P   G +ISI +            
Sbjct  1    MVSQNVVVSDAKTGIITVS-AVSNSSVFTPSAQKP-PTAPG-YISISKKKLLKNLEINGA  57

Query  594  -PGRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
               R+ +  +SMR SSPT      S  +++   SW+  HPSA+ MF+ I+  ++GK+IVM
Sbjct  58   QSQRLTSWVDSMRASSPTHLKSLPSLSAQEELNSWIKRHPSALDMFERIIEAARGKQIVM  117

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD+AFM+++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYA
Sbjct  118  FLDYDGTLSPIVDDPDRAFMSSKMRRTVKKMAKSFPTSIVTGRCIDKVYSFVKLAELYYA  177

Query  249  GSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EVYK L+EKTK   GAKVENNKF
Sbjct  178  GSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKPTAGAKVENNKF  237

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  238  CLSVHFRCVDEK  249



>ref|XP_006390024.1| hypothetical protein EUTSA_v10018720mg [Eutrema salsugineum]
 gb|ESQ27310.1| hypothetical protein EUTSA_v10018720mg [Eutrema salsugineum]
Length=376

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 177/262 (68%), Gaps = 39/262 (15%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MTNQNV+VSD  P  G+  I V+VS  ALF         +   ++ + PR          
Sbjct  1    MTNQNVIVSDRKPILGLKTITVSVSNSALF---------SSPPTYFTFPRRKFLKLLEAA  51

Query  594  ----------PGRINALFESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDI  463
                       G+I +  +SMRDSSPTR       SF   D   SW++  PSA+SMFD+I
Sbjct  52   DKNNSKNNLGAGKIASWVDSMRDSSPTRLRSSSHDSFSDNDDQTSWIVRFPSALSMFDEI  111

Query  462  MNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVY  283
            +N +KGK+IVMFLDYDGTLSPIVEDPDKA++T EMR+ V++VA +FPTAIV+GR   KV 
Sbjct  112  VNAAKGKQIVMFLDYDGTLSPIVEDPDKAYITHEMREVVKDVALNFPTAIVTGRSITKVR  171

Query  282  NFVKLSQLYYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKSV  109
            +FVKL+++YYAGSHGMDI+GPT     G  NQ VL QPA EF+PMIE+V K+L EKTK +
Sbjct  172  SFVKLNEIYYAGSHGMDIEGPTNETNYGGSNQGVLFQPASEFVPMIEKVVKILQEKTKWI  231

Query  108  PGAKVENNKFCLSVHYRCVEEK  43
            PGA VENNKFCLSVH+R V+EK
Sbjct  232  PGAMVENNKFCLSVHFRRVDEK  253



>ref|XP_006394074.1| hypothetical protein EUTSA_v10004405mg [Eutrema salsugineum]
 gb|ESQ31360.1| hypothetical protein EUTSA_v10004405mg [Eutrema salsugineum]
Length=379

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 175/249 (70%), Gaps = 17/249 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSF----------ISIPRPG  589
            M +QNVVVSD KSG+  +    +     P A   P   G  S           I+  +  
Sbjct  1    MVSQNVVVSDAKSGIITVSTVSNSSVFTPSAQKPPTAPGHISISKKKILKNLEINGAQSQ  60

Query  588  RINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            R+N+  +SMR SSPT      S  S++   SW+  HPSA+ MF+ I+  S+GK+IVMFLD
Sbjct  61   RLNSWVDSMRASSPTHLKSLPSLSSQEELNSWIKRHPSALDMFERIIEASRGKQIVMFLD  120

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPD+AF++++MR  V+ VAK FPT+IV+GRC  KVY+FVKL++LYYAGSH
Sbjct  121  YDGTLSPIVDDPDRAFISSKMRRTVKKVAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSH  180

Query  240  GMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            GMDIKGPTKG  + N+   +VL QPA +FLPMI+EV+K L+E+TKS  GAKVENNKFCLS
Sbjct  181  GMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVFKQLVERTKSTAGAKVENNKFCLS  240

Query  69   VHYRCVEEK  43
            VH+RCV+EK
Sbjct  241  VHFRCVDEK  249



>ref|XP_006826948.1| hypothetical protein AMTR_s00010p00186780 [Amborella trichopoda]
 gb|ERM94185.1| hypothetical protein AMTR_s00010p00186780 [Amborella trichopoda]
Length=392

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 180/276 (65%), Gaps = 45/276 (16%)
 Frame = -2

Query  738  MTNQNVVVSD--------PKSGVALIRVAVSEPALFPH----------------AVAKPL  631
            MT Q+V+VS+        P   +A + VAVS  +LFP+                A   P 
Sbjct  1    MTKQSVMVSEAANAALTKPGLNIATLSVAVSNSSLFPYTPPSYATPQAFTTPSSAYPPPQ  60

Query  630  PAGAGSFISIPR---------PGRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAI  481
               A S I+I R           RIN   +SM+ SSPT  +S  S D + SW ++HPSA+
Sbjct  61   MPPAASIITISRRKPLQKLDTTSRINGWIDSMKASSPTHIKSSPSLDPS-SWTVHHPSAL  119

Query  480  SMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGR  301
            SMF+ +MN SK K+IVMFLDYDGTLSPIV+DPD+A+M+  MR AVR VA++FPTAIVSGR
Sbjct  120  SMFEQMMNASKEKQIVMFLDYDGTLSPIVDDPDRAYMSDSMRSAVRAVARYFPTAIVSGR  179

Query  300  CRAKVYNFVKLSQLYYAGSHGMDIKGPTK----------GNLKGNQAVLCQPAREFLPMI  151
            CR KVY FV+L++LYYAGSHGMDIKGP +               N+AVL QPA EFLPMI
Sbjct  180  CRDKVYRFVRLAELYYAGSHGMDIKGPARRPRSQRNWALDKTGKNKAVLFQPASEFLPMI  239

Query  150  EEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            + VYK L+E TK +PGAKVENNKFCLSVH+RCV+EK
Sbjct  240  DVVYKALVETTKGIPGAKVENNKFCLSVHFRCVDEK  275



>gb|KEH20856.1| trehalose-phosphate phosphatase [Medicago truncatula]
Length=366

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 174/250 (70%), Gaps = 28/250 (11%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------P  592
            MT +NVVVS+ K+G+                VA+  PA  G ++ IPR            
Sbjct  1    MTQKNVVVSETKTGIN---------GSGTITVAQKPPAAPGGYVHIPRRRILKNLEINGG  51

Query  591  GRINALFESMRDSSPTRRSFE---SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
             RIN   +SMR SSPT        +E+ N SW+L HPSA+ MF+ IM+ +KGK+IVMFLD
Sbjct  52   QRINTWIDSMRASSPTHVKSSPSLAEEYN-SWILRHPSALDMFEQIMDAAKGKQIVMFLD  110

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPD+AFM+  MR  V+ +A+ FPTAIV+GRC  KVYNFV+L +LYYAGSH
Sbjct  111  YDGTLSPIVDDPDRAFMSESMRKTVKKLARCFPTAIVTGRCIDKVYNFVRLDELYYAGSH  170

Query  240  GMDIKGPTKGNL--KGNQA--VLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            GMDIKGPTK +   K N+A  VL QPAREF+PMI EVY+ L+EKTKS PGA+VEN+KFC 
Sbjct  171  GMDIKGPTKESKYNKNNKAEEVLFQPAREFVPMINEVYEQLVEKTKSTPGARVENHKFCT  230

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  231  SVHFRCVDEK  240



>ref|XP_010534065.1| PREDICTED: trehalose-phosphate phosphatase B-like isoform X1 
[Tarenaya hassleriana]
Length=378

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 176/254 (69%), Gaps = 25/254 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------  595
            MTN+ VVVSD K    + I V+VS+  LFP    K LP+    F   PR           
Sbjct  1    MTNRKVVVSDRKPVTGMKITVSVSDTPLFPE---KLLPSPPSYFSIKPRIKFLKRIESDN  57

Query  594  ----PGRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
                  +I +  +S+R SSPTR     S    D   SWM+  PSA++ F++IM+ +KGKK
Sbjct  58   NKLGAAKIASWVDSLRASSPTRLRSSGSVSENDEKISWMVRFPSALNRFNEIMSRAKGKK  117

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPDKA+M+ EMR+AVR VA +FPTAIV+GRC  KV +FVKL+ +
Sbjct  118  IVMFLDYDGTLSPIVEDPDKAYMSDEMREAVREVAAYFPTAIVTGRCVDKVRSFVKLAGI  177

Query  258  YYAGSHGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDIKGPTK N   K +Q +L QPA EFLPMI+EV+K+L EKTKS+ GA VENN
Sbjct  178  YYAGSHGMDIKGPTKANCYNKSDQGMLLQPASEFLPMIDEVFKILKEKTKSIKGAMVENN  237

Query  84   KFCLSVHYRCVEEK  43
            KFCLSVH+R V+EK
Sbjct  238  KFCLSVHFRRVDEK  251



>ref|XP_002866651.1| hypothetical protein ARALYDRAFT_919840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42910.1| hypothetical protein ARALYDRAFT_919840 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 184/252 (73%), Gaps = 23/252 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            M +QNVVVSD K+G+  +   VS  ++F  +  KP P   G +ISI +            
Sbjct  1    MVSQNVVVSDAKTGIITVS-TVSNSSVFTPSAQKP-PTAPG-YISISKKKLLKNLEINGA  57

Query  594  -PGRINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
               R+N+  +SMR SSPT      SF SE+ + SW+  HPSA+ MF+ I+  ++GK+IVM
Sbjct  58   QSQRLNSWVDSMRASSPTHLKSLSSFSSEEEHNSWIKRHPSALDMFERIIEEARGKQIVM  117

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD+AFMT++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYA
Sbjct  118  FLDYDGTLSPIVDDPDRAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVYSFVKLAELYYA  177

Query  249  GSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EVYK L+EKTKS PGAKVENNKF
Sbjct  178  GSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKSTPGAKVENNKF  237

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  238  CLSVHFRCVDEK  249



>gb|KCW54475.1| hypothetical protein EUGRSUZ_I00423 [Eucalyptus grandis]
Length=368

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 164/216 (76%), Gaps = 19/216 (9%)
 Frame = -2

Query  636  PLPAGAGSFISIPR-----------PGRINALFESMRDSSPTR-----RSFESEDVNKSW  505
            P+   AG F  I R             RI++  +SM+ SSPT      RS  +ED + SW
Sbjct  40   PVAPAAGGFFKISRRKLLKNLEVNSAERISSWVDSMKASSPTHVKAAPRSL-TEDHSSSW  98

Query  504  MLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHF  325
            ML+HPSA+ MF+ I++ S+GK+IVMFLDYDGTLSPIV+DPD+AFM+ +MR  V+ +A+ F
Sbjct  99   MLHHPSALDMFEQIIDASQGKQIVMFLDYDGTLSPIVDDPDQAFMSKKMRATVKKLARCF  158

Query  324  PTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMI  151
            PTAIVSGRCR KVY+FV+L +LYYAGSHGMDIKGP KG+   KG+Q+VL QPA EFLPMI
Sbjct  159  PTAIVSGRCRDKVYSFVRLGELYYAGSHGMDIKGPAKGSKYKKGDQSVLFQPASEFLPMI  218

Query  150  EEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            +EVYK L+EKTKS PGAKVENNKFC+SVH+R V+EK
Sbjct  219  DEVYKKLVEKTKSTPGAKVENNKFCVSVHFRRVDEK  254



>ref|XP_010462232.1| PREDICTED: probable trehalose-phosphate phosphatase J [Camelina 
sativa]
Length=369

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 179/252 (71%), Gaps = 23/252 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            M +QNVVVSD K+G+  +   VS  ++F  +  KP P   G +ISI +            
Sbjct  1    MVSQNVVVSDAKTGIITVST-VSNSSVFTPSAQKP-PTAPG-YISISKKKLLKNLEINGA  57

Query  594  -PGRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
               R+ +  +SMR SSPT      S  +++   SW+  HPSA+ MF+ +   ++GK+IVM
Sbjct  58   QSQRLTSWVDSMRASSPTHLKSLPSLSAQEELNSWIKRHPSALDMFERVTEAARGKQIVM  117

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD+AFM+++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYA
Sbjct  118  FLDYDGTLSPIVDDPDRAFMSSKMRRTVKKMAKSFPTSIVTGRCIDKVYSFVKLAELYYA  177

Query  249  GSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EVYK L+EKTKS  GAKVENNKF
Sbjct  178  GSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKSTAGAKVENNKF  237

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  238  CLSVHFRCVDEK  249



>ref|XP_007047993.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Theobroma cacao]
 gb|EOX92150.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Theobroma cacao]
Length=375

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 172/242 (71%), Gaps = 26/242 (11%)
 Frame = -2

Query  720  VVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRP-----------GRINA  577
            V+SD KS + + I + VS       A   P P G   +ISI R            GRINA
Sbjct  18   VISDAKSVLNMSITMTVS-------AQKPPAPPG---YISISRKKLLQNLEINAGGRINA  67

Query  576  LFESMRDSSPTR-RSFESE-DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
              +SMR SSPT  +S  S  D   SW L HPSA+ MF+ I++ S GK+IVMFLDYDGTLS
Sbjct  68   WVDSMRASSPTHIKSTPSLIDDQSSWNLQHPSALEMFEQIIDASTGKQIVMFLDYDGTLS  127

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIVEDPD+AFM+ +MR  VR +AK FPTAIVSGRCR KVY FVKL++LYYAGSHGMDIKG
Sbjct  128  PIVEDPDRAFMSKKMRKTVRKLAKCFPTAIVSGRCRDKVYKFVKLAELYYAGSHGMDIKG  187

Query  222  PTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVE  49
            P K +   K +++VL QPA EFLPMI+EVYK L+E TKS PGAKVENNKFCLSVH+RCV+
Sbjct  188  PEKRSKSNKDSESVLFQPASEFLPMIDEVYKQLVETTKSTPGAKVENNKFCLSVHFRCVD  247

Query  48   EK  43
            EK
Sbjct  248  EK  249



>ref|XP_010321465.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X1 [Solanum lycopersicum]
Length=348

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 154/188 (82%), Gaps = 4/188 (2%)
 Frame = -2

Query  594  PGRINALFESMRDSSPTRR-SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
            P  + +  +SMR SSPT   S    +   SWM++HPSA+ MF+DI++ SKGKKIVMFLDY
Sbjct  51   PKIMKSWIDSMRASSPTHHMSTTLYEDKTSWMVHHPSAVDMFEDIISVSKGKKIVMFLDY  110

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIV+DPD+AFM+ +MR  VR +A++FPTAIVSGRCR KVYNFV+LS+LYYAGSHG
Sbjct  111  DGTLSPIVDDPDQAFMSHDMRGTVRKLARYFPTAIVSGRCRDKVYNFVQLSELYYAGSHG  170

Query  237  MDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            MDIKGP+KG   + KG QA+L QPA +FLPMI EVYK LL+KTKS+ G +VENNKFC+SV
Sbjct  171  MDIKGPSKGSKYSKKGTQAILFQPASKFLPMIIEVYKELLDKTKSIEGVRVENNKFCVSV  230

Query  66   HYRCVEEK  43
            H+RCV+EK
Sbjct  231  HFRCVDEK  238



>emb|CDY08815.1| BnaA06g24090D [Brassica napus]
Length=363

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 172/249 (69%), Gaps = 17/249 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSF----------ISIPRPG  589
            M NQNVVV D  +G+  +    +     P A   P   G  S           I+  +  
Sbjct  1    MVNQNVVVPDATTGIITVSTVSNSSVFTPSAQKPPTAPGHISISKKKLLKSLEINGDQSQ  60

Query  588  RINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            R+N+  +SMR SSPT      S  SE+   SWM  HPSA+ MF+ I+  S+GK+IVMFLD
Sbjct  61   RLNSWVDSMRASSPTHLKSLPSTSSEEELNSWMKRHPSALDMFERIIEASRGKEIVMFLD  120

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV DPD+AF++++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYAGSH
Sbjct  121  YDGTLSPIVADPDRAFISSKMRRTVKKLAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSH  180

Query  240  GMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            GMDIKGPTKG  + N+   +VL QPA +FLPMI+E +K L+EKTKS PGAKVENNKFCLS
Sbjct  181  GMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEAFKQLVEKTKSTPGAKVENNKFCLS  240

Query  69   VHYRCVEEK  43
            VH+RCV+EK
Sbjct  241  VHFRCVDEK  249



>ref|XP_010027843.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Eucalyptus grandis]
Length=374

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 164/216 (76%), Gaps = 19/216 (9%)
 Frame = -2

Query  636  PLPAGAGSFISIPR-----------PGRINALFESMRDSSPTR-----RSFESEDVNKSW  505
            P+   AG F  I R             RI++  +SM+ SSPT      RS  +ED + SW
Sbjct  40   PVAPAAGGFFKISRRKLLKNLEVNSAERISSWVDSMKASSPTHVKAAPRSL-TEDHSSSW  98

Query  504  MLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHF  325
            ML+HPSA+ MF+ I++ S+GK+IVMFLDYDGTLSPIV+DPD+AFM+ +MR  V+ +A+ F
Sbjct  99   MLHHPSALDMFEQIIDASQGKQIVMFLDYDGTLSPIVDDPDQAFMSKKMRATVKKLARCF  158

Query  324  PTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMI  151
            PTAIVSGRCR KVY+FV+L +LYYAGSHGMDIKGP KG+   KG+Q+VL QPA EFLPMI
Sbjct  159  PTAIVSGRCRDKVYSFVRLGELYYAGSHGMDIKGPAKGSKYKKGDQSVLFQPASEFLPMI  218

Query  150  EEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            +EVYK L+EKTKS PGAKVENNKFC+SVH+R V+EK
Sbjct  219  DEVYKKLVEKTKSTPGAKVENNKFCVSVHFRRVDEK  254



>ref|XP_010027842.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Eucalyptus grandis]
Length=376

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 164/216 (76%), Gaps = 19/216 (9%)
 Frame = -2

Query  636  PLPAGAGSFISIPR-----------PGRINALFESMRDSSPTR-----RSFESEDVNKSW  505
            P+   AG F  I R             RI++  +SM+ SSPT      RS  +ED + SW
Sbjct  48   PVAPAAGGFFKISRRKLLKNLEVNSAERISSWVDSMKASSPTHVKAAPRSL-TEDHSSSW  106

Query  504  MLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHF  325
            ML+HPSA+ MF+ I++ S+GK+IVMFLDYDGTLSPIV+DPD+AFM+ +MR  V+ +A+ F
Sbjct  107  MLHHPSALDMFEQIIDASQGKQIVMFLDYDGTLSPIVDDPDQAFMSKKMRATVKKLARCF  166

Query  324  PTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMI  151
            PTAIVSGRCR KVY+FV+L +LYYAGSHGMDIKGP KG+   KG+Q+VL QPA EFLPMI
Sbjct  167  PTAIVSGRCRDKVYSFVRLGELYYAGSHGMDIKGPAKGSKYKKGDQSVLFQPASEFLPMI  226

Query  150  EEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            +EVYK L+EKTKS PGAKVENNKFC+SVH+R V+EK
Sbjct  227  DEVYKKLVEKTKSTPGAKVENNKFCVSVHFRRVDEK  262



>ref|XP_009130492.1| PREDICTED: probable trehalose-phosphate phosphatase J [Brassica 
rapa]
Length=366

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 179/252 (71%), Gaps = 26/252 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISI-------------P  598
            M +QNVVVSD  +G+    + VS  ++F  +  KP P   G  ISI              
Sbjct  1    MVSQNVVVSDANTGI----ITVSNSSVFAPSAQKP-PTVPGH-ISISKKKLLKNLELSGA  54

Query  597  RPGRINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            +  R+N+  +SMR SSPT      S  SED   SW+  HPSA+ MF+ I+  S+GK+IVM
Sbjct  55   QSQRLNSWVDSMRASSPTHLKSLSSLSSEDELNSWLKRHPSALDMFERIIEASRGKQIVM  114

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV DPD+AF+T++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYA
Sbjct  115  FLDYDGTLSPIVADPDRAFITSKMRRTVKKLAKSFPTSIVTGRCIDKVYSFVKLAELYYA  174

Query  249  GSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EV+K L+EKTKS PGAKVENNKF
Sbjct  175  GSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVFKQLVEKTKSTPGAKVENNKF  234

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  235  CLSVHFRCVDEK  246



>ref|XP_010534066.1| PREDICTED: trehalose-phosphate phosphatase B-like isoform X2 
[Tarenaya hassleriana]
Length=366

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 176/254 (69%), Gaps = 25/254 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPR-----------  595
            MTN+ VVVSD K    + I V+VS+  LFP    K LP+    F   PR           
Sbjct  1    MTNRKVVVSDRKPVTGMKITVSVSDTPLFPE---KLLPSPPSYFSIKPRIKFLKRIESDN  57

Query  594  ----PGRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
                  +I +  +S+R SSPTR     S    D   SWM+  PSA++ F++IM+ +KGKK
Sbjct  58   NKLGAAKIASWVDSLRASSPTRLRSSGSVSENDEKISWMVRFPSALNRFNEIMSRAKGKK  117

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPDKA+M+ EMR+AVR VA +FPTAIV+GRC  KV +FVKL+ +
Sbjct  118  IVMFLDYDGTLSPIVEDPDKAYMSDEMREAVREVAAYFPTAIVTGRCVDKVRSFVKLAGI  177

Query  258  YYAGSHGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDIKGPTK N   K +Q +L QPA EFLPMI+EV+K+L EKTKS+ GA VENN
Sbjct  178  YYAGSHGMDIKGPTKANCYNKSDQGMLLQPASEFLPMIDEVFKILKEKTKSIKGAMVENN  237

Query  84   KFCLSVHYRCVEEK  43
            KFCLSVH+R V+EK
Sbjct  238  KFCLSVHFRRVDEK  251



>ref|XP_006366536.1| PREDICTED: probable trehalose-phosphate phosphatase 6-like [Solanum 
tuberosum]
Length=375

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 154/188 (82%), Gaps = 4/188 (2%)
 Frame = -2

Query  594  PGRINALFESMRDSSPTRR-SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
            P  + +  +SMR SSPT   S    +   SWM++HPSA+ MF+DI++ SKGKKIVMFLDY
Sbjct  50   PRIMTSWVDSMRASSPTHHMSTNLYEDKTSWMVHHPSAVDMFEDIISVSKGKKIVMFLDY  109

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIV+DPD+AFM+ +MR  VR +A++FPTAIVSGRCR KVYNFV+L++LYYAGSHG
Sbjct  110  DGTLSPIVDDPDQAFMSDDMRGTVRKLARYFPTAIVSGRCRDKVYNFVQLAELYYAGSHG  169

Query  237  MDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            MDIKGP+KG   + KG QAVL QPA +FLPMI EVYK LL+KTKS+ G +VENNKFC+SV
Sbjct  170  MDIKGPSKGSKNSKKGTQAVLFQPASKFLPMIIEVYKELLDKTKSIEGVRVENNKFCVSV  229

Query  66   HYRCVEEK  43
            H+RCV+EK
Sbjct  230  HFRCVDEK  237



>emb|CDY31283.1| BnaA02g34580D [Brassica napus]
Length=375

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 179/252 (71%), Gaps = 26/252 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISI-------------P  598
            M +QNVVVSD  +G+    + VS  ++F  +  KP P   G  ISI              
Sbjct  1    MVSQNVVVSDANTGI----ITVSNSSVFAPSAQKP-PTVPGH-ISISKKKLLKNLELSGA  54

Query  597  RPGRINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            +  R+N+  +SMR SSPT      S  SED   SW+  HPSA+ MF+ I+  S+GK+IVM
Sbjct  55   QSQRLNSWVDSMRASSPTHLKSLSSLSSEDELNSWLKRHPSALDMFERIIEASRGKQIVM  114

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV DPD+AF+T++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYA
Sbjct  115  FLDYDGTLSPIVADPDRAFITSKMRRTVKKLAKSFPTSIVTGRCIDKVYSFVKLAELYYA  174

Query  249  GSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EV+K L+EKTKS PGAKVENNKF
Sbjct  175  GSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVFKQLVEKTKSTPGAKVENNKF  234

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  235  CLSVHFRCVDEK  246



>ref|XP_010555351.1| PREDICTED: probable trehalose-phosphate phosphatase H [Tarenaya 
hassleriana]
Length=337

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 153/192 (80%), Gaps = 5/192 (3%)
 Frame = -2

Query  609  ISIPRPGRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
            + I   G I++   SMRDSSPT  +SF  +    SWM  HPSA+  F++I+  S GK+IV
Sbjct  28   LQINCGGLISSWVGSMRDSSPTHLKSFAKQ---CSWMTEHPSALDTFEEIIQASDGKQIV  84

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIV+DPD+AFM+ +MR  VRN+AK FPTAIVSGRCR KVYNFVKL++LYY
Sbjct  85   MFLDYDGTLSPIVDDPDRAFMSKKMRRTVRNLAKCFPTAIVSGRCREKVYNFVKLTELYY  144

Query  252  AGSHGMDIKGPTK-GNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            AGSHGMDIKGP K      N+++LCQPA EFLPMI+EVYK L+EKTKS PG+KVENNKFC
Sbjct  145  AGSHGMDIKGPEKESECMNNESLLCQPATEFLPMIDEVYKQLVEKTKSTPGSKVENNKFC  204

Query  75   LSVHYRCVEEKV  40
            +SVH+RCV+E +
Sbjct  205  VSVHFRCVDENM  216



>ref|NP_201319.2| probable trehalose-phosphate phosphatase J [Arabidopsis thaliana]
 sp|Q5HZ05.1|TPPJ_ARATH RecName: Full=Probable trehalose-phosphate phosphatase J; Short=AtTPPJ; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 gb|AAW38967.1| At5g65140 [Arabidopsis thaliana]
 gb|AAW39020.1| At5g65140 [Arabidopsis thaliana]
 dbj|BAD94722.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
 gb|AED98007.1| probable trehalose-phosphate phosphatase J [Arabidopsis thaliana]
Length=370

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 184/253 (73%), Gaps = 24/253 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            M +QNVVVSD K+G+  +   VS  ++F     KP P   G +IS+ +            
Sbjct  1    MVSQNVVVSDAKTGIITVS-TVSNSSVFTPTAQKP-PTAPG-YISVSKKKLLKNLEINGA  57

Query  594  --PGRINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
                R+N+  +SMR SSPT      SF SE+ + SW+  HPSA++MF+ I+  ++GK+IV
Sbjct  58   DQSQRLNSWVDSMRASSPTHLKSLSSFSSEEEHNSWIKRHPSALNMFERIIEEARGKQIV  117

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIV+DPD+AFMT++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYY
Sbjct  118  MFLDYDGTLSPIVDDPDRAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVYSFVKLAELYY  177

Query  252  AGSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            AGSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EVYK L+EKTKS PGAKVENNK
Sbjct  178  AGSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKSTPGAKVENNK  237

Query  81   FCLSVHYRCVEEK  43
            FCLSVH+RCV+EK
Sbjct  238  FCLSVHFRCVDEK  250



>dbj|BAB11650.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
Length=381

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 184/253 (73%), Gaps = 24/253 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            M +QNVVVSD K+G+  +   VS  ++F     KP P   G +IS+ +            
Sbjct  1    MVSQNVVVSDAKTGIITVS-TVSNSSVFTPTAQKP-PTAPG-YISVSKKKLLKNLEINGA  57

Query  594  --PGRINALFESMRDSSPTR----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
                R+N+  +SMR SSPT      SF SE+ + SW+  HPSA++MF+ I+  ++GK+IV
Sbjct  58   DQSQRLNSWVDSMRASSPTHLKSLSSFSSEEEHNSWIKRHPSALNMFERIIEEARGKQIV  117

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIV+DPD+AFMT++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYY
Sbjct  118  MFLDYDGTLSPIVDDPDRAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVYSFVKLAELYY  177

Query  252  AGSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            AGSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EVYK L+EKTKS PGAKVENNK
Sbjct  178  AGSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKSTPGAKVENNK  237

Query  81   FCLSVHYRCVEEK  43
            FCLSVH+RCV+EK
Sbjct  238  FCLSVHFRCVDEK  250



>ref|XP_006280660.1| hypothetical protein CARUB_v10026620mg [Capsella rubella]
 gb|EOA13558.1| hypothetical protein CARUB_v10026620mg [Capsella rubella]
Length=369

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/252 (54%), Positives = 179/252 (71%), Gaps = 23/252 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISI-------------P  598
            M +QNVVV+D K+G+  +   VS  ++F  +  KP P   G +ISI              
Sbjct  1    MVSQNVVVADAKTGIITVST-VSNSSVFTPSAQKP-PTAPG-YISISNKKLLKNLEINGA  57

Query  597  RPGRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            +  R+ +  +SMR SSPT      S  +++   SW+  HPSA+ MF+ I+  + GK+IVM
Sbjct  58   QSQRLTSWVDSMRASSPTHLKSLPSLSAQEELNSWIKRHPSALDMFERIIEAASGKQIVM  117

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD+AFM+++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYA
Sbjct  118  FLDYDGTLSPIVDDPDRAFMSSKMRRTVKKMAKSFPTSIVTGRCIDKVYSFVKLAELYYA  177

Query  249  GSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGPTKG  + N+   ++L QPA +FLPMI+EVYK L+EKTKS  GAKVENNKF
Sbjct  178  GSHGMDIKGPTKGFSRYNKDKPSILYQPAGDFLPMIDEVYKQLVEKTKSTAGAKVENNKF  237

Query  78   CLSVHYRCVEEK  43
            CLSVH+RCV+EK
Sbjct  238  CLSVHFRCVDEK  249



>gb|KFK28197.1| hypothetical protein AALP_AA8G485000, partial [Arabis alpina]
Length=350

 Score =   259 bits (663),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 181/253 (72%), Gaps = 30/253 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            M +QNVVV  P++GV    + VS  ++F  +  KP P   G +ISI +            
Sbjct  1    MVSQNVVV--PETGV----ITVSNSSVFTPSAQKP-PTAPG-YISISKKKLLKNLEINGA  52

Query  594  -PGRINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
               R+N+  +SMR SSPT           E+ N SW+  HPSA+ MF+ I+  S+GK+IV
Sbjct  53   QSQRLNSWVDSMRASSPTHLKSLSSLSSDEEFN-SWIKRHPSALDMFERIIEASRGKQIV  111

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIV+DPD+AFM+++MR  VR +AK+FPT+IV+GRC  KVY+FVKL++LYY
Sbjct  112  MFLDYDGTLSPIVDDPDRAFMSSKMRRTVRKLAKNFPTSIVTGRCIDKVYSFVKLAELYY  171

Query  252  AGSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            AGSHGMDIKGPTKG  + N+   +VL QPA +FLPMI+EV+K L+EKTKS PGAKVENNK
Sbjct  172  AGSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVFKQLVEKTKSTPGAKVENNK  231

Query  81   FCLSVHYRCVEEK  43
            FCLSVH+RCV+EK
Sbjct  232  FCLSVHFRCVDEK  244



>ref|XP_004504061.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X2 [Cicer arietinum]
Length=362

 Score =   260 bits (664),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 171/249 (69%), Gaps = 30/249 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP-----------  592
            MT QNVVVS+ KSG+        +P           PA    +I IPR            
Sbjct  1    MTQQNVVVSETKSGINAAITMTQKP-----------PAPPAGYIPIPRRRILKNLEINAG  49

Query  591  GRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RIN   +SMR SSPT      SF +E+ N SW+L HPSA+ MF+ I + SKGK+IVMFL
Sbjct  50   QRINTCIDSMRASSPTHVKSTPSF-AEEYN-SWILRHPSALDMFEQIKDASKGKQIVMFL  107

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPD+AFM+  MR  VR +A+ FPTAIV+GRC  KVYNF++L++LYYAGS
Sbjct  108  DYDGTLSPIVDDPDRAFMSESMRKTVRKLARCFPTAIVTGRCIDKVYNFIRLAELYYAGS  167

Query  243  HGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            HGMDIKGPTK +   K  +A+L QPAREF+PMI EVY+ L+EKTKS PG  VEN+KFC S
Sbjct  168  HGMDIKGPTKESKYNKVTEALLFQPAREFVPMINEVYQKLVEKTKSTPGVIVENHKFCAS  227

Query  69   VHYRCVEEK  43
            VH+RCV+EK
Sbjct  228  VHFRCVDEK  236



>ref|NP_177932.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
 sp|Q9C9S4.1|TPPB_ARATH RecName: Full=Trehalose-phosphate phosphatase B; Short=AtTPPB; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 gb|AAG52092.1|AC012680_3 trehalose-6-phosphate phosphatase (AtTPPB); 8719-11059 [Arabidopsis 
thaliana]
 gb|AAO22625.1| putative trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis 
thaliana]
 gb|AAO42342.1| putative trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis 
thaliana]
 gb|AEE36066.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
Length=374

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 182/254 (72%), Gaps = 25/254 (10%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHA-----------VAKPLPAG-AGSFISI  601
            MTNQNV+VSD  P  G+  I V+VS   LF ++           + K L A    + +  
Sbjct  1    MTNQNVIVSDRKPILGLKTITVSVSNSPLFSNSFPTYFNFPRRKLLKLLEAADKNNLVVA  60

Query  600  PRPGRINALFESMRDSSPTR---RSFES---EDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
            P+   I ++ +SMRDSSPTR    S++S    D   SW++  PSA++MFD+I+N +KGK+
Sbjct  61   PK---ITSMIDSMRDSSPTRLRSSSYDSVSDNDDKTSWIVRFPSALNMFDEIVNAAKGKQ  117

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPDKAF+T EMR+ V++VA +FPTAIV+GR   KV +FV+++++
Sbjct  118  IVMFLDYDGTLSPIVEDPDKAFITHEMREVVKDVASNFPTAIVTGRSIEKVRSFVQVNEI  177

Query  258  YYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDI+GPT  N  G  N+ VL QPAREFLPMIE+V  +L EKTK +PGA VENN
Sbjct  178  YYAGSHGMDIEGPTNENSNGQSNERVLFQPAREFLPMIEKVVNILEEKTKWIPGAMVENN  237

Query  84   KFCLSVHYRCVEEK  43
            KFCLSVH+R V+EK
Sbjct  238  KFCLSVHFRRVDEK  251



>ref|XP_010939628.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Elaeis 
guineensis]
Length=379

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 151/195 (77%), Gaps = 13/195 (7%)
 Frame = -2

Query  588  RINALFESMRDSSPTRR----------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
            R N   ESM+ SSPT            S  ++D   +W++ HPSA++ F+ I++ SKGK+
Sbjct  59   RTNTWVESMKASSPTHSKAVAALAATPSVGAQDEYATWIMRHPSALNKFEQIISASKGKQ  118

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIV+DPD AFM+  MR AVR+VA+ FPTAIVSGRCR KVYNFV+L++L
Sbjct  119  IVMFLDYDGTLSPIVDDPDSAFMSDAMRAAVRDVARFFPTAIVSGRCRDKVYNFVRLAEL  178

Query  258  YYAGSHGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            YYAGSHGMDIKGP +G        +AVL QPA EFLPMI+EVYK LLEKTKSVPGAKVEN
Sbjct  179  YYAGSHGMDIKGPARGPRYKKAKAKAVLFQPASEFLPMIDEVYKALLEKTKSVPGAKVEN  238

Query  87   NKFCLSVHYRCVEEK  43
            NKFCLSVH+RCV+EK
Sbjct  239  NKFCLSVHFRCVDEK  253



>ref|XP_009150597.1| PREDICTED: probable trehalose-phosphate phosphatase J [Brassica 
rapa]
Length=367

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 172/249 (69%), Gaps = 17/249 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSF----------ISIPRPG  589
            M +QNVVV D  +G+  +    +     P A   P   G  S           I+  +  
Sbjct  1    MVSQNVVVPDATTGIITVSTVSNSSVFTPSAQKPPTAPGHISISKKKLLKSLEINGDQSQ  60

Query  588  RINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            R+N+  +SMR SSPT      S  SE+   SWM  HPSA+ MF+ I+  S+GK+IVMFLD
Sbjct  61   RLNSWVDSMRASSPTHLKSLPSTSSEEELNSWMKRHPSALDMFERIIEASRGKEIVMFLD  120

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV DPD+AF++++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYAGSH
Sbjct  121  YDGTLSPIVADPDRAFISSKMRRTVKKLAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSH  180

Query  240  GMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            GMDIKGPTKG  + N+   +VL QPA +FLPMI+E +K L+EKTKS PGAKVENNKFCLS
Sbjct  181  GMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEAFKQLVEKTKSTPGAKVENNKFCLS  240

Query  69   VHYRCVEEK  43
            VH+RCV+EK
Sbjct  241  VHFRCVDEK  249



>ref|XP_006302406.1| hypothetical protein CARUB_v10020479mg [Capsella rubella]
 gb|EOA35304.1| hypothetical protein CARUB_v10020479mg [Capsella rubella]
Length=376

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 175/253 (69%), Gaps = 21/253 (8%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAV-----------AKPLPAGAGSFISIP  598
            MTNQNV+VSD  P  G+  I V+VS   LF ++             K L A   +     
Sbjct  1    MTNQNVIVSDRKPILGLQTITVSVSNSPLFSNSFPTYFTFPRRKFLKLLEAADNNKNKNN  60

Query  597  RPGRINALFESMRDSSPTRRSFESEDV------NKSWMLNHPSAISMFDDIMNFSKGKKI  436
               +I +  ESMRDSSPTR    S D         SW++  PSA++MFD+++N +KGK+I
Sbjct  61   NAPKITSWVESMRDSSPTRLRSSSHDSVSDNADKTSWIVRFPSALNMFDEVVNAAKGKQI  120

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMFLDYDGTLSPIVEDPDKAF+T EMRD V++VA +FPTAIV+GR   KV +FVK++++Y
Sbjct  121  VMFLDYDGTLSPIVEDPDKAFITHEMRDVVKDVALNFPTAIVTGRSIDKVRSFVKVNEIY  180

Query  255  YAGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            YAGSHGMDI+GPT  N   +  + VL QPAREFLPMIE+V K+L EKTK +PGA VENNK
Sbjct  181  YAGSHGMDIEGPTNENSYCQSKERVLFQPAREFLPMIEKVVKILEEKTKWIPGAMVENNK  240

Query  81   FCLSVHYRCVEEK  43
            FCLSVH+R V+EK
Sbjct  241  FCLSVHFRRVDEK  253



>ref|XP_007141163.1| hypothetical protein PHAVU_008G172400g [Phaseolus vulgaris]
 gb|ESW13157.1| hypothetical protein PHAVU_008G172400g [Phaseolus vulgaris]
Length=369

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 175/250 (70%), Gaps = 24/250 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP-----------  592
            MTN+NV      + +    +++S     P A    + A  G  + +P+            
Sbjct  1    MTNRNV-----NNTLLEFAMSISNSGALPRAAVPGIMALLGGVLGLPQKKLLLKTLEDGS  55

Query  591  ----GRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMF  427
                 ++N   +SMR SSPTR +S +++D +  W L HPSA+++FD I+  SKGK+IV F
Sbjct  56   GKGGTKVNTWIDSMRASSPTRVKSTQNQDPS-PWTLYHPSALNLFDQIICESKGKQIVTF  114

Query  426  LDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAG  247
            LDYDGTLSPIV DPDKA+M+ +MR  ++++A+HFPTAIVSGRC  KVY+FV+L++LYYAG
Sbjct  115  LDYDGTLSPIVADPDKAYMSQKMRATLKDIARHFPTAIVSGRCIDKVYSFVRLAELYYAG  174

Query  246  SHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            SHGMDIKGPT  +   KGN+AVL QPA EFLPMI EVY +L++KTK VPGAKVENNKFCL
Sbjct  175  SHGMDIKGPTNRRSTKKGNEAVLFQPASEFLPMINEVYNILVDKTKPVPGAKVENNKFCL  234

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  235  SVHFRCVDEK  244



>ref|XP_006294548.1| hypothetical protein CARUB_v10023582mg [Capsella rubella]
 gb|EOA27446.1| hypothetical protein CARUB_v10023582mg [Capsella rubella]
Length=336

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 154/187 (82%), Gaps = 6/187 (3%)
 Frame = -2

Query  597  RPGRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            R G I +   SMR  SPTR +SF S+     W+  HPSA++MF+DI++ S+GK+IVMFLD
Sbjct  30   RGGLIKSWVNSMRACSPTRPKSFNSQSC---WIKEHPSALNMFEDILHQSEGKQIVMFLD  86

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPD+AFM+ +MR+ VR +AK FPTAIVSGRCR KV +FVKL++LYYAGSH
Sbjct  87   YDGTLSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRCREKVSSFVKLTELYYAGSH  146

Query  240  GMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            GMDIKGP KG+  +K NQ++LCQPA EFLP+I EVY+ L+EKTKS+ GAKVENNKFC SV
Sbjct  147  GMDIKGPEKGSKYIKENQSLLCQPATEFLPVINEVYEKLVEKTKSIQGAKVENNKFCASV  206

Query  66   HYRCVEE  46
            H+RCVEE
Sbjct  207  HFRCVEE  213



>dbj|BAJ99358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 149/181 (82%), Gaps = 7/181 (4%)
 Frame = -2

Query  579  ALFESMRDSSPTRRSFESEDVN--KSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
            A  E MR +SPTR S    DV+   +WM  HPSA++ F+ I + SKGKKIVMFLDYDGTL
Sbjct  63   AELEVMRAASPTR-SRPGADVDDLTAWMRKHPSALAKFEQIASASKGKKIVMFLDYDGTL  121

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIV +PD A+M+  MR+AVR+VAKHFPTAIVSGRCR KV+NFV LS+LYYAGSHGMDIK
Sbjct  122  SPIVANPDAAYMSDAMREAVRDVAKHFPTAIVSGRCREKVHNFVGLSELYYAGSHGMDIK  181

Query  225  GPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEE  46
            GP+       ++V+CQPAREFLP+IEEVYKVL+EKTKS PGAKVENNKFCLSVH+RCV+E
Sbjct  182  GPS----SNPESVVCQPAREFLPVIEEVYKVLVEKTKSTPGAKVENNKFCLSVHFRCVDE  237

Query  45   K  43
            K
Sbjct  238  K  238



>ref|XP_010416778.1| PREDICTED: trehalose-phosphate phosphatase B [Camelina sativa]
Length=377

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 174/254 (69%), Gaps = 22/254 (9%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MTNQNV+VSD  P  G+  I V+VS   LF ++           F+ +            
Sbjct  1    MTNQNVIVSDRKPILGLQTITVSVSNSPLFSNSFPTYFTFPRRKFLKLLEAADNNNSNLV  60

Query  594  --PGRINALFESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
              P    +  +SMRDSSPTR       S    D   SW++  PSA+SMFD+IMN +KGK+
Sbjct  61   VAPKITTSWVDSMRDSSPTRLRSSSNDSVSDNDDKTSWIVRFPSALSMFDEIMNAAKGKQ  120

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPDKAF+T EMR  V++VA +FPTAIV+GR  AKV  FVK++++
Sbjct  121  IVMFLDYDGTLSPIVEDPDKAFITHEMRGVVKDVALNFPTAIVTGRSIAKVRRFVKVNEI  180

Query  258  YYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDI+GPTK N  G  N+ VL QPAREFLPMIE+V K+L EKTK +PGA VENN
Sbjct  181  YYAGSHGMDIEGPTKENNYGQSNERVLFQPAREFLPMIEKVVKILEEKTKWIPGAMVENN  240

Query  84   KFCLSVHYRCVEEK  43
            KFCLSVH+R V+EK
Sbjct  241  KFCLSVHFRRVDEK  254



>gb|EMT12736.1| hypothetical protein F775_52288 [Aegilops tauschii]
Length=376

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 7/181 (4%)
 Frame = -2

Query  579  ALFESMRDSSPTRRSFESEDVNK--SWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
            A  E+MR +SPTR S    DV++  +WM  HPSA+S F+ I + SKGKKIVMFLDYDGTL
Sbjct  43   AELEAMRAASPTR-SRPGADVDELTAWMRKHPSALSKFEQIASASKGKKIVMFLDYDGTL  101

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIV +PD A+M+  MR+AVR+VAKHFPTAIVSGRCR KV+NFV LS+LYYAGSHGMDIK
Sbjct  102  SPIVANPDAAYMSDAMREAVRDVAKHFPTAIVSGRCRDKVHNFVGLSELYYAGSHGMDIK  161

Query  225  GPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEE  46
            GP        ++VLCQPA EFLPMI+EVYKVL+EKTKS PGAKVENNKFCLSVH+RCV+E
Sbjct  162  GPG----SNPESVLCQPASEFLPMIDEVYKVLVEKTKSTPGAKVENNKFCLSVHFRCVDE  217

Query  45   K  43
            K
Sbjct  218  K  218



>dbj|BAJ33676.1| unnamed protein product [Thellungiella halophila]
Length=226

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 150/186 (81%), Gaps = 4/186 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLMKQSSWLTEHPSALDMFEEILHVSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G    K +Q++LCQPA EFLPM++EVY+ L+EKT+  PGAKVENNKFC+SVH+R
Sbjct  160  IKGPEQGGSKYKEDQSLLCQPATEFLPMVDEVYQKLIEKTRLTPGAKVENNKFCVSVHFR  219

Query  57   CVEEKV  40
             V+EKV
Sbjct  220  RVDEKV  225



>ref|XP_002454258.1| hypothetical protein SORBIDRAFT_04g027650 [Sorghum bicolor]
 gb|EES07234.1| hypothetical protein SORBIDRAFT_04g027650 [Sorghum bicolor]
Length=359

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 168/239 (70%), Gaps = 16/239 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVA-KPLPAGAGSFISIPRPGRIN-----A  577
            MTNQ+VVVS+   G+A      + P   P  +A +   AGA S   +             
Sbjct  1    MTNQDVVVSE--MGIA---AGAALPGASPALLACRGAAAGAMSLRYLDLAAAAARSASCT  55

Query  576  LFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSP  400
              ++MR SSPTR R+    D   +WM  HPSA++ F+ I + SKGKK+VMFLDYDGTLSP
Sbjct  56   WVDAMRASSPTRSRAAADVDEFTAWMRKHPSALAKFEQIASASKGKKVVMFLDYDGTLSP  115

Query  399  IVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGP  220
            IV DPD A+M+  MR AVR+VAKHFPTAIVSGRCR KV NFV LS+LYYAGSHGMDIKGP
Sbjct  116  IVADPDAAYMSDAMRAAVRDVAKHFPTAIVSGRCRDKVRNFVDLSELYYAGSHGMDIKGP  175

Query  219  TKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            +       ++VLCQPA EFLP+I+EVYK L+EKTKS PGAKVENNKFCLSVH+RCV+EK
Sbjct  176  S----SNPESVLCQPASEFLPVIDEVYKALVEKTKSTPGAKVENNKFCLSVHFRCVDEK  230



>ref|XP_004504060.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X1 [Cicer arietinum]
Length=364

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 172/251 (69%), Gaps = 32/251 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP-----------  592
            MT QNVVVS+ KSG+        +P           PA    +I IPR            
Sbjct  1    MTQQNVVVSETKSGINAAITMTQKP-----------PAPPAGYIPIPRRRILKNLEINAG  49

Query  591  GRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             RIN   +SMR SSPT      SF +E+ N SW+L HPSA+ MF+ I + SKGK+IVMFL
Sbjct  50   QRINTCIDSMRASSPTHVKSTPSF-AEEYN-SWILRHPSALDMFEQIKDASKGKQIVMFL  107

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPD+AFM+  MR  VR +A+ FPTAIV+GRC  KVYNF++L++LYYAGS
Sbjct  108  DYDGTLSPIVDDPDRAFMSESMRKTVRKLARCFPTAIVTGRCIDKVYNFIRLAELYYAGS  167

Query  243  HGMDIKGPTKGNL--KGN--QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            HGMDIKGPTK +   K N  +A+L QPAREF+PMI EVY+ L+EKTKS PG  VEN+KFC
Sbjct  168  HGMDIKGPTKESKYNKNNKAEALLFQPAREFVPMINEVYQKLVEKTKSTPGVIVENHKFC  227

Query  75   LSVHYRCVEEK  43
             SVH+RCV+EK
Sbjct  228  ASVHFRCVDEK  238



>emb|CDY14544.1| BnaC03g49150D [Brassica napus]
Length=454

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 172/250 (69%), Gaps = 17/250 (7%)
 Frame = -2

Query  741  KMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSF----------ISIPRP  592
            KM +QNVVV D  +G+  +    +     P A   P   G  S           IS  + 
Sbjct  67   KMVSQNVVVPDATTGIITVSTVSNSSVFTPSAQKPPTAPGHISISKKKLLKSLEISGDQS  126

Query  591  GRINALFESMRDSSPTRR----SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
             R+N+  +SMR SSPT      S  S++   SWM  HPSA+ MF+ I   S+GK+IVMFL
Sbjct  127  QRLNSWVDSMRASSPTHLKSLPSLSSQEELNSWMKRHPSALDMFERITEASRGKEIVMFL  186

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV DPD+AF++++MR  V+ +AK FPT+IV+GRC  KVY+FVKL++LYYAGS
Sbjct  187  DYDGTLSPIVADPDRAFISSKMRRTVKKLAKCFPTSIVTGRCIDKVYSFVKLAELYYAGS  246

Query  243  HGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGPTKG  + N+   +VL QPA +FLPMI+E +K L+EKTKS PGAKVENNKFCL
Sbjct  247  HGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEAFKQLVEKTKSTPGAKVENNKFCL  306

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  307  SVHFRCVDEK  316



>ref|XP_010463168.1| PREDICTED: probable trehalose-phosphate phosphatase D [Camelina 
sativa]
Length=305

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 170/254 (67%), Gaps = 31/254 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTN N ++SD K+ +  + V V   +LF          G G +ISIPR            
Sbjct  1    MTNHNALISDAKASIG-VAVRVPNQSLFS--------PGGGRYISIPRKKLVQKLEADPS  51

Query  594  PGRINALFESMRDSSPTRRS--------FESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
              RIN   E+MR SSPTR             ED + SWM  HPSA+SMF++I   SKGK+
Sbjct  52   QTRINTWIEAMRASSPTRTRPGNISSLPESKEDEHSSWMAQHPSALSMFEEIAEASKGKQ  111

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            I+MFLDYDGTLSPIVEDP++A+M+ EMR+AV+ VAK+FPTAIV+GRCR KV  FVKL  L
Sbjct  112  IIMFLDYDGTLSPIVEDPERAYMSDEMRNAVKGVAKYFPTAIVTGRCRDKVRRFVKLPGL  171

Query  258  YYAGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK + V GA VENN
Sbjct  172  YYAGSHGMDIKGPSKKTKHNKNNKGVLFQAANEFLPMIDQVSKCLVEKMRDVEGASVENN  231

Query  84   KFCLSVHYRCVEEK  43
            KFC+SVHYRCV++K
Sbjct  232  KFCVSVHYRCVDQK  245



>ref|XP_010496062.1| PREDICTED: probable trehalose-phosphate phosphatase D [Camelina 
sativa]
Length=372

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 170/254 (67%), Gaps = 31/254 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTN N ++SD K+ +  + V V   +LF          G G +ISIPR            
Sbjct  1    MTNHNALISDAKASIG-VAVRVPNQSLFS--------PGGGRYISIPRKKLVQKLEADPS  51

Query  594  PGRINALFESMRDSSPTRRS--------FESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
              RIN   E+MR SSPTR             ED + SWM  HPSA+SMF++I   SKGK+
Sbjct  52   QTRINTWIEAMRASSPTRTRPGNISSLPESKEDEHSSWMAQHPSALSMFEEIAEASKGKQ  111

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDP++A+M+ EMRDAV+ VAK+FPTAIV+GRCR KV  FVKL  L
Sbjct  112  IVMFLDYDGTLSPIVEDPERAYMSDEMRDAVKGVAKYFPTAIVTGRCRDKVRRFVKLPGL  171

Query  258  YYAGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK + V GA VENN
Sbjct  172  YYAGSHGMDIKGPSKKTKHNKNNKGVLFQAANEFLPMIDQVSKCLVEKMRDVEGASVENN  231

Query  84   KFCLSVHYRCVEEK  43
            KFC+SVHYRCV++K
Sbjct  232  KFCVSVHYRCVDQK  245



>ref|XP_008808174.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Phoenix 
dactylifera]
Length=370

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/245 (57%), Positives = 177/245 (72%), Gaps = 18/245 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGRINALFESMR  559
            MT QNVVV +  + +++  VA S P LF +    P  +G G+ ++     +INA  ESM+
Sbjct  1    MTKQNVVVPEAMA-ISVAAVANSSP-LFTYP---PPRSGFGAGVAGGFALKINAWVESMK  55

Query  558  DSSPTRR----------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
             SSPT            S  +++ + +W++ HPSA+S F+ I++ S+ K+IVMFLDYDGT
Sbjct  56   ASSPTHAKAAAALAAAPSVGAQEEHATWIMRHPSALSKFEQIISASREKQIVMFLDYDGT  115

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV+DPD AFM+  MRDAVRN+A++FPTAIVSGRCR KVY FVKL++LYYAGSHGMDI
Sbjct  116  LSPIVDDPDSAFMSEAMRDAVRNLARYFPTAIVSGRCRDKVYKFVKLAELYYAGSHGMDI  175

Query  228  KGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            KGP +G        ++VL QPA +FLPMI EVY VL EKTKS PGAKVENNKFC+SVHYR
Sbjct  176  KGPARGPRYRKAKAKSVLFQPASDFLPMITEVYNVLFEKTKSTPGAKVENNKFCVSVHYR  235

Query  57   CVEEK  43
            CV+EK
Sbjct  236  CVDEK  240



>ref|XP_006305131.1| hypothetical protein CARUB_v10009500mg [Capsella rubella]
 gb|EOA38029.1| hypothetical protein CARUB_v10009500mg [Capsella rubella]
Length=369

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 170/255 (67%), Gaps = 32/255 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTN N ++SD K+ +  + V VS  +LF          G G +ISIPR            
Sbjct  1    MTNHNALISDAKASIG-VAVRVSNQSLFS--------PGGGRYISIPRKKLVQKLEADPS  51

Query  594  PGRINALFESMRDSSPTRR---------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGK  442
              RIN   E+MR SSPT+            + ED + SWM  HPSA+ MF++I   SKGK
Sbjct  52   QTRINTWIEAMRASSPTKTRPGNISSLPESDEEDEHSSWMAQHPSALRMFEEIAEASKGK  111

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            +IVMFLDYDGTLSPIVEDP++A+MT EMRDAV+  A++FPTAIV+GRCR KV  FVKL  
Sbjct  112  QIVMFLDYDGTLSPIVEDPERAYMTDEMRDAVKGAARYFPTAIVTGRCRDKVRRFVKLPG  171

Query  261  LYYAGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            LYYAGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK + V GA VEN
Sbjct  172  LYYAGSHGMDIKGPSKKTKHNKNNKGVLFQAANEFLPMIDQVSKCLVEKMRDVQGASVEN  231

Query  87   NKFCLSVHYRCVEEK  43
            NKFC+SVHYRCV++K
Sbjct  232  NKFCVSVHYRCVDQK  246



>ref|XP_002887719.1| trehalose-6-phosphate phosphatase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63978.1| trehalose-6-phosphate phosphatase [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 177/262 (68%), Gaps = 38/262 (15%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG--------  589
            MTNQNV+VSD  P  G+  I V+V+   LF ++          ++ + PR          
Sbjct  1    MTNQNVIVSDRKPILGLKTITVSVTNSPLFSNSFP--------TYFNFPRRKLLKLLEVA  52

Query  588  ------------RINALFESMRDSSPTRRSFESEDV------NKSWMLNHPSAISMFDDI  463
                        +I +L +SMRDSSPTR    S D         SW++  PSA++MFD+I
Sbjct  53   DKNNNNNLVVAPKITSLIDSMRDSSPTRLRSSSHDSVSDIDDKTSWIVRFPSALNMFDEI  112

Query  462  MNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVY  283
            +N +KGK+IVMFLDYDGTLSPIVEDPDKAF+T EMRD V++VA +FPTAIV+GR   KV 
Sbjct  113  VNAAKGKQIVMFLDYDGTLSPIVEDPDKAFITHEMRDVVKDVASNFPTAIVTGRSIDKVR  172

Query  282  NFVKLSQLYYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKSV  109
            +FVK++++YYAGSHGMDI+GPT  N  G  N+ VL QPAREFLPMIE+V K+L EKTK +
Sbjct  173  SFVKVNEIYYAGSHGMDIEGPTNENNYGQSNERVLFQPAREFLPMIEKVIKILEEKTKWI  232

Query  108  PGAKVENNKFCLSVHYRCVEEK  43
             GA VENNKFCLSVH+R V+EK
Sbjct  233  SGAMVENNKFCLSVHFRRVDEK  254



>ref|XP_010472010.1| PREDICTED: trehalose-phosphate phosphatase B-like [Camelina sativa]
Length=379

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 172/256 (67%), Gaps = 24/256 (9%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MTNQNV+VSD  P  G+  I V+VS   LF ++           F+ +            
Sbjct  1    MTNQNVIVSDRKPILGLQTITVSVSNSPLFSNSFPTYFTFPRRKFLKLLEAADNNNNNSN  60

Query  594  ----PGRINALFESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKG  445
                P    +  +SMRDSSPTR       S    D   SW++  PSA+SMFD+IMN +KG
Sbjct  61   LVVAPKITTSWVDSMRDSSPTRLRSSSLDSVSDNDDKTSWIVRFPSALSMFDEIMNAAKG  120

Query  444  KKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLS  265
            K+IVMFLDYDGTLS IVEDPDKAF+T EMR  V++VA +FPTAIV+GR   KV  FVK++
Sbjct  121  KQIVMFLDYDGTLSLIVEDPDKAFITHEMRGVVKDVALNFPTAIVTGRSIDKVRRFVKVN  180

Query  264  QLYYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVE  91
            ++YYAGSHGMDI+GPTK N  G  N+ VL QPAREFLPMIE+V K+L EKTK +PGA VE
Sbjct  181  EIYYAGSHGMDIEGPTKENNYGQSNERVLFQPAREFLPMIEKVVKILEEKTKWIPGAMVE  240

Query  90   NNKFCLSVHYRCVEEK  43
            NNKFCLSVH+R V+EK
Sbjct  241  NNKFCLSVHFRRVDEK  256



>tpg|DAA49101.1| TPA: hypothetical protein ZEAMMB73_457766 [Zea mays]
Length=367

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 172/253 (68%), Gaps = 32/253 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALF----PHAV------AKPLPAGAGSFISIPRPG  589
            MT Q +VV  P++ VA   V  +   LF    P A        K L  GAG+       G
Sbjct  1    MTKQGMVVPVPEAAVA---VPPNSAPLFQYPPPRAAPGVAVRKKCLQMGAGA-------G  50

Query  588  RINALFESMRDSSPTRRSFE-------SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            RI    ESMR SSPT             E+   +WM+ HPSA++MFD ++  SKGK+IV+
Sbjct  51   RIGGWVESMRASSPTHAKAAAALAAGVEEERYAAWMVKHPSALAMFDQLVAASKGKQIVV  110

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD A+M+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYA
Sbjct  111  FLDYDGTLSPIVDDPDAAYMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYA  170

Query  249  GSHGMDIKGPTKGN----LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            GSHGMDIKGP KG+     KG   VL QPA +FLPMIE+V+  L+EKTK +PGAKVENNK
Sbjct  171  GSHGMDIKGPAKGSRHTKAKGG-GVLFQPASQFLPMIEQVHDSLVEKTKCIPGAKVENNK  229

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+EK
Sbjct  230  FCVSVHFRCVDEK  242



>gb|KFK42193.1| hypothetical protein AALP_AA2G223500 [Arabis alpina]
Length=371

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 182/257 (71%), Gaps = 34/257 (13%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG--------  589
            MTNQNV+VSD  P  G   I V+VS   LF  + + P      ++ + PR          
Sbjct  1    MTNQNVIVSDRKPILGSKTITVSVSNSPLF--STSPP------TYFTFPRRKLLQLLESN  52

Query  588  ------RINALFESMRDSSPTR-RS------FESEDVNKSWMLNHPSAISMFDDIMNFSK  448
                  +I++  +SMRDSSPTR RS       E++D N SW++  PSA++MFD+I+N +K
Sbjct  53   NMVGTPKISSWVDSMRDSSPTRLRSSSHDSVLENDDKN-SWIVRFPSALNMFDEIVNVAK  111

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GK+IVMFLDYDGTLSPIVEDPDKA++T EMR+ +++VA +FPTAIV+GR   KV +FVKL
Sbjct  112  GKQIVMFLDYDGTLSPIVEDPDKAYITHEMREVIKDVALNFPTAIVTGRSIDKVRSFVKL  171

Query  267  SQLYYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKV  94
            +++YYAGSHGMDI+ P K N  G  NQ VL QPAREF+PMIE+V K+L EKTK +PGA V
Sbjct  172  NEIYYAGSHGMDIEAPVKENTCGENNQGVLFQPAREFVPMIEKVVKILEEKTKWIPGAMV  231

Query  93   ENNKFCLSVHYRCVEEK  43
            ENNKFCLSVH+R V+EK
Sbjct  232  ENNKFCLSVHFRRVDEK  248



>ref|XP_010472213.1| PREDICTED: probable trehalose-phosphate phosphatase E [Camelina 
sativa]
Length=356

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 151/184 (82%), Gaps = 4/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G I +  +SMR  SPTR   +S D    W+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  52   GLIRSWVDSMRACSPTRP--KSLDSQSCWIKEHPSALKMFEEILHESEGKQIVMFLDYDG  109

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR+ VR +A  FPTAIVSGRCR KV +FVKL++LYYAGSHGMD
Sbjct  110  TLSPIVDDPDRAFMSKKMRNTVRKLADCFPTAIVSGRCREKVSSFVKLTELYYAGSHGMD  169

Query  231  IKGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G  + KGNQ++LCQPA EFLP+I EVY+ L+EKTKSVPGAKVENNKFC SVH+R
Sbjct  170  IKGPEQGSKHKKGNQSLLCQPATEFLPVINEVYEKLVEKTKSVPGAKVENNKFCASVHFR  229

Query  57   CVEE  46
            CVEE
Sbjct  230  CVEE  233



>ref|XP_010461341.1| PREDICTED: probable trehalose-phosphate phosphatase D [Camelina 
sativa]
Length=369

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 169/253 (67%), Gaps = 31/253 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTN N ++SD K+ +  + V V   +LF          G G +ISIPR            
Sbjct  1    MTNHNALISDAKASIG-VAVRVPNQSLFS--------PGGGRYISIPRKKLVQKLEADPS  51

Query  594  PGRINALFESMRDSSPTRRS--------FESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
              RIN   E+MR SSPTR             ED + SWM  HPSA+SMF++I   SKGK+
Sbjct  52   QTRINTWIEAMRASSPTRTRPGNISSLPESKEDEHSSWMAQHPSALSMFEEIAEASKGKQ  111

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            I+MFLDYDGTLSPIVEDP++A+M+ EMRDAV+ VAK+FPTAIV+GRCR KV  FVKL  L
Sbjct  112  IIMFLDYDGTLSPIVEDPERAYMSDEMRDAVKGVAKYFPTAIVTGRCRDKVRRFVKLPGL  171

Query  258  YYAGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK + V GA VENN
Sbjct  172  YYAGSHGMDIKGPSKKTKHNKNNKGVLFQAANEFLPMIDQVSKCLVEKIRDVEGASVENN  231

Query  84   KFCLSVHYRCVEE  46
            KFC+SVHYRCV++
Sbjct  232  KFCVSVHYRCVDQ  244



>ref|XP_010416975.1| PREDICTED: probable trehalose-phosphate phosphatase E [Camelina 
sativa]
Length=355

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 153/185 (83%), Gaps = 6/185 (3%)
 Frame = -2

Query  591  GRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
            G I +  +SMR  SPTR +SF S+     W+  HPSA+ MF++I++ S+GK+IVMFLDYD
Sbjct  51   GLIRSWVDSMRACSPTRPKSFNSQ---ACWIKEHPSALKMFEEILHESEGKQIVMFLDYD  107

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPD+AFM+ +MR+ VR +A  FPTAIVSGRCR KV +FVKL++LYYAGSHGM
Sbjct  108  GTLSPIVDDPDRAFMSKKMRNTVRKLADCFPTAIVSGRCREKVSSFVKLTELYYAGSHGM  167

Query  234  DIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            DIKGP +G+   KGNQ++LCQPA EFLP+I EVY+ L+E+TKSVPGAKVENNKFC SVH+
Sbjct  168  DIKGPEQGSKYKKGNQSLLCQPATEFLPVINEVYEKLVEETKSVPGAKVENNKFCASVHF  227

Query  60   RCVEE  46
            RCVEE
Sbjct  228  RCVEE  232



>ref|XP_010064765.1| PREDICTED: probable trehalose-phosphate phosphatase H [Eucalyptus 
grandis]
Length=365

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 154/198 (78%), Gaps = 8/198 (4%)
 Frame = -2

Query  627  AGAGSFISIPRPGRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSK  448
             G G F+      + +A  +SMRDSSPTR S      + SW+++HPSA+  F+ + N +K
Sbjct  31   GGEGDFVV-----KNHAWVDSMRDSSPTRVSLPGTGEHNSWIVHHPSALKTFELVTNAAK  85

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GK+IV+FLDYDGTLSPIVEDPD+AFM+++MR+AV+  A+HFPTAI+SGR R KVY+FVKL
Sbjct  86   GKEIVIFLDYDGTLSPIVEDPDRAFMSSQMREAVKEAARHFPTAIISGRSRDKVYDFVKL  145

Query  267  SQLYYAGSHGMDIKGPTKGNL---KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAK  97
             +LYYAGSHGMDI+GP+K      KG++ V  QPA EFLPMI EVY+ LL +TKS+PGAK
Sbjct  146  PELYYAGSHGMDIRGPSKSQRKCKKGDEGVPFQPASEFLPMINEVYRALLNRTKSIPGAK  205

Query  96   VENNKFCLSVHYRCVEEK  43
            VENNKFCLSVHYR V+EK
Sbjct  206  VENNKFCLSVHYRNVDEK  223



>ref|XP_009127222.1| PREDICTED: probable trehalose-phosphate phosphatase H [Brassica 
rapa]
Length=345

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 151/184 (82%), Gaps = 3/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLMKQSSWLKEHPSALEMFEEILHASEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VRN+A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKQMRRTVRNLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGN-LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            IKGP +G+  + ++++LCQPA EFLPMI+EVY+ L+EKTKS PGA VENNKFC+SVH+R 
Sbjct  160  IKGPEQGSKYEADKSLLCQPATEFLPMIDEVYQRLMEKTKSTPGANVENNKFCVSVHFRR  219

Query  54   VEEK  43
            V+EK
Sbjct  220  VDEK  223



>emb|CDX72676.1| BnaC07g46980D [Brassica napus]
Length=381

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MFD+I+N S+GKKIVMFLDYDG
Sbjct  78   GLINSWVDSMRACSPTH--LKSSMKQSSWLTEHPSALDMFDEILNVSEGKKIVMFLDYDG  135

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ EMR  VR +AK FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  136  TLSPIVDDPDRAFMSKEMRRTVRKLAKCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  195

Query  231  IKGPTKGN-LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            IKGP +G+  K ++++LCQPA EFLPMI+EVY+ L++KT   PGA +ENNKFC+SVH+R 
Sbjct  196  IKGPEQGSKYKDDKSLLCQPATEFLPMIDEVYQKLVDKTNFTPGANIENNKFCVSVHFRR  255

Query  54   VEEK  43
            V+EK
Sbjct  256  VDEK  259



>gb|EMT32785.1| Trehalose-phosphate phosphatase [Aegilops tauschii]
Length=337

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 149/189 (79%), Gaps = 6/189 (3%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            G ++ L ESMR SSPT     +      +D + +WM  HPSA+  F++I+  SKGK+IVM
Sbjct  18   GMLSGLVESMRASSPTHARAAAALSAGVDDEHAAWMARHPSALGKFEEIVAASKGKQIVM  77

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD AFM+  MR AVR+VAKHFPTAIVSGRCR KV++FVKL++LYYA
Sbjct  78   FLDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFDFVKLAELYYA  137

Query  249  GSHGMDIKGPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            GSHGMDIKGP K +    + VL QPA EFLPMIEEV++ L+E+TK V GAKVENNKFC+S
Sbjct  138  GSHGMDIKGPAKSSKSKAKGVLFQPASEFLPMIEEVHQRLIEETKHVAGAKVENNKFCVS  197

Query  69   VHYRCVEEK  43
            VH+RCV+EK
Sbjct  198  VHFRCVDEK  206



>ref|XP_009128274.1| PREDICTED: trehalose-phosphate phosphatase B isoform X1 [Brassica 
rapa]
Length=377

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 176/264 (67%), Gaps = 40/264 (15%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MTNQNV+VSD  P  G   I V+VS   LF         +   ++ + PR          
Sbjct  1    MTNQNVIVSDRNPILGSKTITVSVSNSPLF---------SSPPTYFTFPRRKFLELLEAA  51

Query  594  -----------PGRINALFESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMFDD  466
                        G+I++  +SMRDSSPTR    S       D   SW++  PSA++MFD 
Sbjct  52   DKNNNNKNNLGAGKISSWVDSMRDSSPTRLRSSSRDSDSDNDEKTSWIVRFPSALNMFDK  111

Query  465  IMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKV  286
            IMN +KGK+IVMFLDYDGTLSPIVEDPDKA++T EMR+ V++VA +FPTAIV+GR   KV
Sbjct  112  IMNAAKGKQIVMFLDYDGTLSPIVEDPDKAYITHEMREVVKDVALNFPTAIVTGRSIDKV  171

Query  285  YNFVKLSQLYYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKS  112
              FVKL+++YYAGSHGMDI+GPT  N  G  NQ VL QPAREF+PMIE+V K+L EKTK 
Sbjct  172  RAFVKLNEIYYAGSHGMDIEGPTNENSYGESNQGVLFQPAREFVPMIEKVVKILEEKTKC  231

Query  111  VPGAKVENNKFCLSVHYRCVEEKV  40
            +PGA VENNKFCLSVH+R V+EK+
Sbjct  232  IPGAMVENNKFCLSVHFRRVDEKI  255



>ref|XP_003524269.1| PREDICTED: probable trehalose-phosphate phosphatase J [Glycine 
max]
Length=362

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 169/243 (70%), Gaps = 23/243 (9%)
 Frame = -2

Query  732  NQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGA--GSFISIPRPG-----RINAL  574
             QN +VS  KSG   I   ++ P        KPL A A  G +I IPR        INA 
Sbjct  2    TQNAIVSKTKSG---INRDITVPQ-------KPLAAAAAAGGYIPIPRRRVLKNLEINAW  51

Query  573  FESMRDSSPTRRSFESE--DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSP  400
             +SMR SSPT     S   + + +W+L HPSA+ MF+ IM+ S+GK+IVMFLDYDGTLSP
Sbjct  52   VDSMRSSSPTNSKSTSSLAEEHSTWILRHPSALDMFEQIMDASRGKQIVMFLDYDGTLSP  111

Query  399  IVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGP  220
            IV+DPD+AFM+  MR  VR +A+ FPTAIV+GRC+ KVYNFV+L++LYYAGSHGMDI+GP
Sbjct  112  IVDDPDRAFMSDSMRRTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIQGP  171

Query  219  TK----GNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCV  52
            T+     N    + VL QPA EFLPMI+EVY  L+EK KS+PGA VENNKFC SVH+RCV
Sbjct  172  TRTSKYSNKDKGEPVLFQPASEFLPMIDEVYHQLVEKMKSIPGAMVENNKFCCSVHFRCV  231

Query  51   EEK  43
            +EK
Sbjct  232  DEK  234



>gb|AAC39370.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
Length=374

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 179/254 (70%), Gaps = 25/254 (10%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHA-----------VAKPLPAG-AGSFISI  601
            MTNQNV+VSD  P  G+  I V+VS   LF ++           + K L A    + +  
Sbjct  1    MTNQNVIVSDRKPILGLKTITVSVSNSPLFSNSFPTYFNFPRRKLLKLLEAADKNNLVVA  60

Query  600  PRPGRINALFESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
            P+   I ++ +SMRDSSPTR       S    D   SW++  PSA++MFD+I+N +KGK+
Sbjct  61   PK---ITSMIDSMRDSSPTRLRSSSYDSDSDNDDKTSWIVRFPSALNMFDEIVNAAKGKQ  117

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPDKAF+T EMR+ V++VA +FPTAIV+GR   KV +FV+++++
Sbjct  118  IVMFLDYDGTLSPIVEDPDKAFITHEMREVVKDVASNFPTAIVTGRSIEKVRSFVQVNEI  177

Query  258  YYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDI+GPT  N  G  N+ VL QPAREFLPMIE+V  +L EKTK +PGA VENN
Sbjct  178  YYAGSHGMDIEGPTNENSNGQSNERVLFQPAREFLPMIEKVVNILEEKTKWIPGAMVENN  237

Query  84   KFCLSVHYRCVEEK  43
            KFCLSVH+R V+EK
Sbjct  238  KFCLSVHFRRVDEK  251



>gb|ACK44515.1| AT5G10100-like protein [Arabidopsis arenosa]
Length=362

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 150/190 (79%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  S+    SW++ HPSA+ MF+ IM  S+GK+IVMFL
Sbjct  64   RINAWVDSMRASSPTHLKSLPSSISSQQQLNSWIMQHPSALEMFEQIMEASRGKQIVMFL  123

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  124  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  183

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP KG   + +  Q++L QPA ++LPMI EVY+ LLEKTKS PGAKVEN+KFC 
Sbjct  184  HGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMINEVYRQLLEKTKSTPGAKVENHKFCA  243

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  244  SVHFRCVDEK  253



>ref|XP_006647910.1| PREDICTED: LOW QUALITY PROTEIN: probable trehalose-phosphate 
phosphatase 4-like [Oryza brachyantha]
Length=356

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 145/178 (81%), Gaps = 6/178 (3%)
 Frame = -2

Query  570  ESMRDSSPTRRSFESEDVNK--SWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPI  397
            E+MR SSPTR S  + DV++  +W+  HPSA++ F++I   S+GKKIVMF+DYDGTLSPI
Sbjct  54   ETMRASSPTRSSRSAADVDEFTAWVSKHPSALTKFEEIAGKSRGKKIVMFMDYDGTLSPI  113

Query  396  VEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPT  217
            V DPD A+M+  MR AVR VAK+FPTAIVSGRCR KV NFV LS LYYAGSHGMDIKGP+
Sbjct  114  VADPDAAYMSDAMRAAVREVAKNFPTAIVSGRCRDKVRNFVGLSDLYYAGSHGMDIKGPS  173

Query  216  KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
                   ++VLCQPA EFLPMI EVYK+L+EKTKS PGAKVENNKFCLSVH+RCV+EK
Sbjct  174  ----SNPESVLCQPASEFLPMINEVYKILVEKTKSTPGAKVENNKFCLSVHFRCVDEK  227



>ref|XP_002880434.1| trehalose-phosphatase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56693.1| trehalose-phosphatase [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 152/183 (83%), Gaps = 6/183 (3%)
 Frame = -2

Query  585  INALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
            I +  +SMR  SPTR +SF ++     W+  HPSA++MF++I+N S+GK++VMFLDYDGT
Sbjct  54   IRSWVDSMRACSPTRPKSFNNQSC---WIKEHPSALNMFEEILNKSEGKQVVMFLDYDGT  110

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV+DPD+AFM+ +MR+ VR +AK FPTAIVSGRCR KV +FVKL++LYYAGSHGMDI
Sbjct  111  LSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRCREKVSSFVKLTELYYAGSHGMDI  170

Query  228  KGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            KGP +G    K NQ++LCQPA EFLP+I EV+K LLEKTKS+PGAKVENNKFC SVH+RC
Sbjct  171  KGPEQGPKYKKENQSLLCQPATEFLPVINEVFKKLLEKTKSIPGAKVENNKFCASVHFRC  230

Query  54   VEE  46
            VEE
Sbjct  231  VEE  233



>ref|XP_004953949.1| PREDICTED: probable trehalose-phosphate phosphatase 4-like [Setaria 
italica]
Length=363

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 168/239 (70%), Gaps = 16/239 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVA-KPLPAGAGS-----FISIPRPGRINA  577
            MTNQ+VVVS+   G+A      + P   P  +A +   AGA S       +         
Sbjct  1    MTNQDVVVSE--MGIA---AGAALPGPRPALLACRGAAAGAMSHRYLDLAAAAARSASCT  55

Query  576  LFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSP  400
              ++MR SSPTR R+    D   +WM  HPSA+  F+ I + SKGKKIVMFLDYDGTLSP
Sbjct  56   WADAMRASSPTRSRAAADVDEFTAWMRKHPSALGKFEQIASSSKGKKIVMFLDYDGTLSP  115

Query  399  IVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGP  220
            IV DPD A+M+  MR AVR+VAK+FPTAIVSGRCR KV NFV LS+LYYAGSHGMDIKGP
Sbjct  116  IVADPDAAYMSDAMRSAVRDVAKYFPTAIVSGRCRDKVRNFVGLSELYYAGSHGMDIKGP  175

Query  219  TKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            +       ++VLCQPA EFLP+I+EVYK+L+EKTKS PGAKVENNKFCLSVH+RCV+EK
Sbjct  176  S----SNPESVLCQPASEFLPVIDEVYKLLVEKTKSTPGAKVENNKFCLSVHFRCVDEK  230



>ref|XP_002871404.1| hypothetical protein ARALYDRAFT_350217 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47663.1| hypothetical protein ARALYDRAFT_350217 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 150/190 (79%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  S+    SW++ HPSA+ MF+ IM  S+GK+IVMFL
Sbjct  53   RINAWVDSMRASSPTHLKSLPSSISSQQQLNSWIMQHPSALEMFEQIMEASRGKQIVMFL  112

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  113  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  172

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP KG   + +  Q++L QPA ++LPMI EVY+ LLEKTKS PGAKVEN+KFC 
Sbjct  173  HGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMINEVYRQLLEKTKSTPGAKVENHKFCA  232

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  233  SVHFRCVDEK  242



>ref|NP_179809.2| probable trehalose-phosphate phosphatase E [Arabidopsis thaliana]
 sp|Q67X99.1|TPPE_ARATH RecName: Full=Probable trehalose-phosphate phosphatase E; Short=AtTPPE; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 dbj|BAD44683.1| putative trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
 gb|AEC07276.1| probable trehalose-phosphate phosphatase E [Arabidopsis thaliana]
Length=354

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 153/185 (83%), Gaps = 6/185 (3%)
 Frame = -2

Query  591  GRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
            G I +  +SMR  SPTR +SF S+     W+  HPSA++MF++I++ S+GK+IVMFLDYD
Sbjct  50   GLIRSWVDSMRACSPTRPKSFNSQSC---WIKEHPSALNMFEEILHKSEGKQIVMFLDYD  106

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPD+AFM+ +MR+ VR +AK FPTAIVSGRCR KV +FVKL++LYYAGSHGM
Sbjct  107  GTLSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRCREKVSSFVKLTELYYAGSHGM  166

Query  234  DIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            DIKGP +G+   K NQ++LCQPA EFLP+I EVYK L+E T+S+PGAKVENNKFC SVH+
Sbjct  167  DIKGPEQGSKYKKENQSLLCQPATEFLPVINEVYKKLVENTQSIPGAKVENNKFCASVHF  226

Query  60   RCVEE  46
            RCVEE
Sbjct  227  RCVEE  231



>ref|NP_001167890.1| hypothetical protein [Zea mays]
 gb|ACN26421.1| unknown [Zea mays]
 gb|AFW64448.1| hypothetical protein ZEAMMB73_364503 [Zea mays]
Length=356

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 167/240 (70%), Gaps = 18/240 (8%)
 Frame = -2

Query  738  MTNQNVVVSDP--KSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGRIN-----  580
            MTNQ+VVVS+    +G AL     S PAL      +   AGA S   +            
Sbjct  1    MTNQDVVVSEMGIAAGTAL---PGSSPALL---ACRGAAAGAMSLRYLDLAAAAARSASC  54

Query  579  ALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
               E+MR SSPTR R+    D   +WM  HPSA+  F+ I + S+GKK+VMFLDYDGTL+
Sbjct  55   TWVEAMRASSPTRSRAAADVDELTAWMRKHPSALGKFEQIASASQGKKVVMFLDYDGTLA  114

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIV DPD A+M+  MR AVR+VAKHFPTAIVSGRCR KV +FV LS+LYYAGSHGMDI+G
Sbjct  115  PIVADPDAAYMSDVMRAAVRDVAKHFPTAIVSGRCRDKVRSFVDLSELYYAGSHGMDIEG  174

Query  222  PTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            P+       ++VLCQPA EFLP+I+EVYK L+EKTKS PGAKVENNKFCLSVH+RCV+EK
Sbjct  175  PS----SNPESVLCQPASEFLPVIDEVYKALVEKTKSTPGAKVENNKFCLSVHFRCVDEK  230



>ref|XP_008790818.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Phoenix 
dactylifera]
Length=374

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 167/252 (66%), Gaps = 24/252 (10%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG-------RIN  580
            MT QNVV+ +  +    I VA             P+  G G  +    P        R N
Sbjct  1    MTKQNVVMPEAMA----ISVAAVANPPPLFPYPPPIRGGGGFALRKKYPSQLDLGGRRTN  56

Query  579  ALFESMRDSSPTRR----------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
               ESM+ SSPT            S  ++D   +W++ HPSA+S F+ I++ SKGK+IVM
Sbjct  57   TWVESMKASSPTHSKAAAALVAAPSVGAQDEYATWIMRHPSALSKFEQIISASKGKQIVM  116

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD AFM+  MR AVR+ A+ FPTAIVSGRCR KVY+FV L++LYYA
Sbjct  117  FLDYDGTLSPIVDDPDSAFMSDAMRAAVRDAARFFPTAIVSGRCRDKVYSFVGLAELYYA  176

Query  249  GSHGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGP +G        +AVL QPA EFLPMI+EVYK LLEKTKSVPGAKVENNKF
Sbjct  177  GSHGMDIKGPARGPRYKKAKAKAVLFQPASEFLPMIDEVYKALLEKTKSVPGAKVENNKF  236

Query  78   CLSVHYRCVEEK  43
            C+SVH+RCV+EK
Sbjct  237  CVSVHFRCVDEK  248



>gb|KHG18855.1| Trehalose-phosphate phosphatase [Gossypium arboreum]
Length=346

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 149/197 (76%), Gaps = 14/197 (7%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESE--DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDY  418
             R+NA  +SMR SSPT     S   D   +W L+HPSA+ MF+ I++ SKGK+IVMFLDY
Sbjct  47   ARVNAWVDSMRASSPTHTKSTSSVTDDQVTWNLHHPSALEMFEQIIDASKGKQIVMFLDY  106

Query  417  DGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHG  238
            DGTLSPIVEDPD+AFM+ +MR+ VR +AK FPTAIVSGRCR KVY FVKL++LYYAGSHG
Sbjct  107  DGTLSPIVEDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRCRDKVYKFVKLAELYYAGSHG  166

Query  237  MDIKGPTKGNLKGN------------QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKV  94
            +D KGP K +   N            ++VL QPA EFLPMI+EVYK L++ TKS PGAKV
Sbjct  167  LDTKGPEKRSKSKNERVCSLVKVMDGESVLFQPASEFLPMIDEVYKQLVDTTKSTPGAKV  226

Query  93   ENNKFCLSVHYRCVEEK  43
            ENNKFCLSVH+RCV+EK
Sbjct  227  ENNKFCLSVHFRCVDEK  243



>ref|XP_004500616.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cicer 
arietinum]
Length=363

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 172/243 (71%), Gaps = 17/243 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFIS-IPRPG-RINALFES  565
            MTNQN  V  P+   + I   +S P      + + L     +FI  +   G  +NA  + 
Sbjct  1    MTNQNNNVVRPEVN-SCINTLISGPESMA-VLGEFLGFSHSNFIKRLDLEGANVNAWIDL  58

Query  564  MRDSSPTRRSFESEDVNKS-WMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVED  388
            MR +SPTR    SE+  KS W+L HPSAI +FD+I+  +KGK+IV FLDYDGTLSPIV D
Sbjct  59   MRAASPTR----SENQEKSSWILYHPSAIKLFDEIIYSAKGKEIVFFLDYDGTLSPIVAD  114

Query  387  PDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKGN  208
            PDKAFMT +MR  ++++A+HFPTAIV+GRCR KV+NFVKL++LYYA SHGMDI GPTK  
Sbjct  115  PDKAFMTRKMRATLKDIARHFPTAIVTGRCRDKVFNFVKLAELYYAASHGMDIMGPTKNG  174

Query  207  --------LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCV  52
                       N+AVL QPA +FLPMI+EVYK+LLEKTK VPGAKVENNKFCLSVH+RCV
Sbjct  175  SAVKSNNNNNTNKAVLFQPAGQFLPMIDEVYKILLEKTKCVPGAKVENNKFCLSVHFRCV  234

Query  51   EEK  43
            +EK
Sbjct  235  DEK  237



>emb|CDX88416.1| BnaC06g38600D [Brassica napus]
Length=378

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 173/255 (68%), Gaps = 23/255 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFP----------HAVAKPLPAGAGSFISIPR--  595
            M NQNV+VSD K+ +    + VS   LF           H   + L A   +  SI +  
Sbjct  1    MMNQNVIVSDRKAILGSKTITVSNSPLFSSPPTYFTFPRHKFLELLEAADKNSNSINKNN  60

Query  594  --PGRINALFESMRDSSPTR------RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
               G+I +  +SMRDSSPTR       S    D   SW++  PSA++MFD+I+N +KGK+
Sbjct  61   LGAGKIASWVDSMRDSSPTRLRPSSRDSVSDNDHKTSWIVRFPSALNMFDEIVNAAKGKQ  120

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPDKA++T EMR+ V+NVA +FPTAIV+GR   KV  FVKL ++
Sbjct  121  IVMFLDYDGTLSPIVEDPDKAYITHEMREVVKNVALNFPTAIVTGRSIDKVRGFVKLDEI  180

Query  258  YYAGSHGMDIKGPTKGNLKG---NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            YYAGSHGMDI+GPT     G   NQ VL QPAREF+P IE+VYK+L EKTK +PGA VEN
Sbjct  181  YYAGSHGMDIEGPTSEYAYGGVSNQGVLFQPAREFVPTIEKVYKILEEKTKWIPGAMVEN  240

Query  87   NKFCLSVHYRCVEEK  43
            NKFCLSVH+R V+EK
Sbjct  241  NKFCLSVHFRRVDEK  255



>ref|XP_003573088.1| PREDICTED: probable trehalose-phosphate phosphatase 4 [Brachypodium 
distachyon]
Length=366

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 142/180 (79%), Gaps = 7/180 (4%)
 Frame = -2

Query  573  FESMRDSSPTR-RSFESEDVNK--SWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
             E+MR  SP R R     DV++  SWM  HPSA+  F+ I    KGKK+VMFLDYDGTLS
Sbjct  60   LEAMRACSPPRSRGGAGADVDELSSWMRKHPSALGKFEQIAGACKGKKVVMFLDYDGTLS  119

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIV +PD A++T  MR AVR+VAKHFPTAIVSGRCR KV+NFV LS+LYYAGSHGMDIKG
Sbjct  120  PIVANPDAAYITDAMRAAVRDVAKHFPTAIVSGRCRDKVHNFVGLSELYYAGSHGMDIKG  179

Query  222  PTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
            PT       ++VLCQPA EFLPMIEEVYKVL+EKTKS PGA VENNKFCLSVH+RCV+EK
Sbjct  180  PT----SNPESVLCQPASEFLPMIEEVYKVLVEKTKSTPGAMVENNKFCLSVHFRCVDEK  235



>emb|CDY26848.1| BnaA02g18730D [Brassica napus]
Length=379

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 175/266 (66%), Gaps = 42/266 (16%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MTNQNV+VSD  P  G   I V+VS   LF         +   ++ + PR          
Sbjct  1    MTNQNVIVSDRNPILGSKTITVSVSNSPLF---------SSPPTYFTFPRRKFLELLEAA  51

Query  594  -------------PGRINALFESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMF  472
                          G+I +  +SMRDSSPTR    S       D   SW++  PSA++MF
Sbjct  52   DKNNNNNNKNNLGAGKIASWVDSMRDSSPTRLRSSSRDSDSDNDEKTSWIVRFPSALNMF  111

Query  471  DDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRA  292
            D IMN +KGK+IVMFLDYDGTLSPIVEDPDKA++T EMR+ V++VA +FPTAIV+GR   
Sbjct  112  DKIMNAAKGKQIVMFLDYDGTLSPIVEDPDKAYITHEMREVVKDVALNFPTAIVTGRSID  171

Query  291  KVYNFVKLSQLYYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKT  118
            KV  FVKL+++YYAGSHGMDI+GPT  N  G  NQ VL QPAREF+PMIE+V K+L EKT
Sbjct  172  KVRAFVKLNEIYYAGSHGMDIEGPTNENSYGESNQGVLFQPAREFVPMIEKVVKILEEKT  231

Query  117  KSVPGAKVENNKFCLSVHYRCVEEKV  40
            K +PGA VENNKFCLSVH+R V+EK+
Sbjct  232  KCIPGAMVENNKFCLSVHFRRVDEKI  257



>gb|EMS59182.1| Trehalose-phosphate phosphatase [Triticum urartu]
Length=373

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 149/189 (79%), Gaps = 6/189 (3%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            G ++ L ESMR SSPT     +      +D + +WM  HPSA+  F++I+  SKGK+IVM
Sbjct  54   GMLSGLVESMRASSPTHARAAAALAAGVDDEHAAWMAKHPSALGKFEEIVAASKGKQIVM  113

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD AFM+  MR AVR+VAKHFPTAIVSGRCR KV++FVKL++LYYA
Sbjct  114  FLDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFDFVKLAELYYA  173

Query  249  GSHGMDIKGPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            GSHGMDIKGP K +    + VL QPA EFLPMIEEV++ L+E+TK V GAKVENNKFC+S
Sbjct  174  GSHGMDIKGPAKSSKSKAKGVLFQPASEFLPMIEEVHQRLIEETKHVAGAKVENNKFCVS  233

Query  69   VHYRCVEEK  43
            VH+RCV+EK
Sbjct  234  VHFRCVDEK  242



>ref|XP_010531388.1| PREDICTED: probable trehalose-phosphate phosphatase H [Tarenaya 
hassleriana]
Length=329

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 149/183 (81%), Gaps = 10/183 (5%)
 Frame = -2

Query  585  INALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
            I++  +SMR SSPT  +SF  +    SWM  HPSA+ MF++I++ S+GK+IVMFLDYDGT
Sbjct  35   ISSWVDSMRSSSPTHLKSFGRQS---SWMTEHPSALEMFEEIIHASEGKQIVMFLDYDGT  91

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV DPD+AFM+ +MR  VRN+AK F TAIVSGRCR KVYNFVKL++LYYAGSHGMDI
Sbjct  92   LSPIVNDPDRAFMSKKMRRTVRNLAKCFFTAIVSGRCREKVYNFVKLTELYYAGSHGMDI  151

Query  228  KGPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVE  49
            KGP  G+L      LCQPA EFLPMI+EVYK L+EKTK+ PG+KVENNKFC+SVH+RCV+
Sbjct  152  KGPENGSL------LCQPATEFLPMIDEVYKKLVEKTKTTPGSKVENNKFCVSVHFRCVD  205

Query  48   EKV  40
            E +
Sbjct  206  ENM  208



>ref|XP_010500057.1| PREDICTED: probable trehalose-phosphate phosphatase D [Camelina 
sativa]
Length=368

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 169/254 (67%), Gaps = 31/254 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTN N ++ D K+ +  + V V   +LF          G G +ISIPR            
Sbjct  1    MTNHNALIPDAKASIG-VAVRVPNQSLFS--------PGGGRYISIPRKKLVQKLEADPS  51

Query  594  PGRINALFESMRDSSPTRRS--------FESEDVNKSWMLNHPSAISMFDDIMNFSKGKK  439
              RIN   E+MR SSPTR             ED + SWM  HPSA+SMF++I   SKGK+
Sbjct  52   QTRINTWIEAMRASSPTRTRPGNISSLPESKEDEHSSWMAQHPSALSMFEEIAEASKGKQ  111

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            I+MFLDYDGTLSPIVEDP++A+M+ EMR+AV+ VAK+FPTAIV+GRCR KV  FVKL  L
Sbjct  112  IIMFLDYDGTLSPIVEDPERAYMSDEMRNAVKGVAKYFPTAIVTGRCRDKVRRFVKLPGL  171

Query  258  YYAGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENN  85
            YYAGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK + V GA VENN
Sbjct  172  YYAGSHGMDIKGPSKKTKHNKNNKGVLFQAANEFLPMIDQVSKCLVEKMRDVEGASVENN  231

Query  84   KFCLSVHYRCVEEK  43
            KFC+SVHYRCV++K
Sbjct  232  KFCVSVHYRCVDQK  245



>ref|XP_006411773.1| hypothetical protein EUTSA_v10025622mg [Eutrema salsugineum]
 gb|ESQ53226.1| hypothetical protein EUTSA_v10025622mg [Eutrema salsugineum]
Length=346

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 149/185 (81%), Gaps = 4/185 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLMKQSSWLTEHPSALDMFEEILHVSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G    K +Q++LCQPA EFLPM++EVY+ L+EKT+  PGAKVENNKFC+SVH+R
Sbjct  160  IKGPEQGGSKYKEDQSLLCQPATEFLPMVDEVYQKLIEKTRLTPGAKVENNKFCVSVHFR  219

Query  57   CVEEK  43
             V+EK
Sbjct  220  RVDEK  224



>ref|NP_001142999.1| uncharacterized protein LOC100275460 [Zea mays]
 gb|ACG28191.1| hypothetical protein [Zea mays]
Length=372

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 147/191 (77%), Gaps = 9/191 (5%)
 Frame = -2

Query  588  RINALFESMRDSSPTRRSFE-------SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            RI    ESMR SSPT             E+   +WM+ HPSA++MFD ++  SKGK+IV+
Sbjct  57   RIGGWVESMRASSPTHAKAAAALAAGVEEERYAAWMVKHPSALAMFDQLVEASKGKQIVV  116

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD A+M+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYA
Sbjct  117  FLDYDGTLSPIVDDPDAAYMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYA  176

Query  249  GSHGMDIKGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            GSHGMDIKGP KG  + K    VL QPA +FLPMIE+V+  L+EKTK +PGAKVENNKFC
Sbjct  177  GSHGMDIKGPAKGSRHTKAKGGVLFQPASQFLPMIEQVHDSLVEKTKCIPGAKVENNKFC  236

Query  75   LSVHYRCVEEK  43
            +SVH+RCV+EK
Sbjct  237  VSVHFRCVDEK  247



>ref|XP_010680570.1| PREDICTED: probable trehalose-phosphate phosphatase I [Beta vulgaris 
subsp. vulgaris]
Length=364

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 170/246 (69%), Gaps = 22/246 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGR-------IN  580
            MT Q++V     S  + +    S  A+  H   KP P      +++P   R       IN
Sbjct  1    MTRQDIV-----SVSSTMNNMTSNSAILSH---KPPPVPGKYMLNLPMCERHLLQDLDIN  52

Query  579  AL--FESMRDSSPTRRSFESEDVNKS---WMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
             +   +SMR SSPT        +  S    ML  PSA+ MF+ I+  SKGK+IVMFLDYD
Sbjct  53   GVSWVDSMRASSPTHLKSIPSSITSSDSLAMLKQPSALDMFEQIIKASKGKQIVMFLDYD  112

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPD+AFM+  MR  VR +A++FPTAIVSGRCR KVYNFVKL++LYYAGSHGM
Sbjct  113  GTLSPIVDDPDRAFMSDAMRRTVRKLARYFPTAIVSGRCRDKVYNFVKLAELYYAGSHGM  172

Query  234  DIKGPTKG--NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            DIKGP KG  +LKG+QAVL QPA +F+PMI+EVYK LLEKTKS+ GA VE+NKFCLSVH+
Sbjct  173  DIKGPAKGSKHLKGSQAVLFQPASKFVPMIDEVYKALLEKTKSILGATVEHNKFCLSVHF  232

Query  60   RCVEEK  43
            RCV+EK
Sbjct  233  RCVDEK  238



>emb|CDY14635.1| BnaC02g24780D [Brassica napus]
Length=377

 Score =   253 bits (646),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 174/263 (66%), Gaps = 40/263 (15%)
 Frame = -2

Query  738  MTNQNVVVSD--PKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR----------  595
            MTNQNV+VSD  P  G   I V+VS   LF         +   ++ + PR          
Sbjct  1    MTNQNVIVSDRNPILGSKTITVSVSNSPLF---------SSPPTYFTFPRRKFLELLEAA  51

Query  594  -----------PGRINALFESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMFDD  466
                        G+I++  +SMRDSSPTR    S       D   SW++  PSA++MFD 
Sbjct  52   DKNNNNKNNLGAGKISSWVDSMRDSSPTRLRSSSRDSDSDNDEKTSWIVRFPSALNMFDK  111

Query  465  IMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKV  286
            IMN +KGK+IVMFLDYDGTLSPIVEDPDKA++T EMR+ V++ A +FPTAIV+GR   KV
Sbjct  112  IMNAAKGKQIVMFLDYDGTLSPIVEDPDKAYITHEMREVVKDAALNFPTAIVTGRSIDKV  171

Query  285  YNFVKLSQLYYAGSHGMDIKGPTKGNLKG--NQAVLCQPAREFLPMIEEVYKVLLEKTKS  112
              FVKL+++YYAGSHGMDI+GPT  N  G  NQ VL QPAREF+PMIE+V K+L EKTK 
Sbjct  172  RAFVKLNEIYYAGSHGMDIEGPTNENSYGESNQGVLFQPAREFVPMIEKVVKILEEKTKC  231

Query  111  VPGAKVENNKFCLSVHYRCVEEK  43
            +PGA VENNKFCLSVH+R V+EK
Sbjct  232  IPGAMVENNKFCLSVHFRRVDEK  254



>gb|KDO56609.1| hypothetical protein CISIN_1g020273mg [Citrus sinensis]
 gb|KDO56610.1| hypothetical protein CISIN_1g020273mg [Citrus sinensis]
Length=328

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 157/201 (78%), Gaps = 14/201 (7%)
 Frame = -2

Query  627  AGAGSFISIPRPGRINALFESMRDSSPTRRSFESEDV---NKSWMLNHPSAISMFDDIMN  457
            A AG+     RP   N   ES+R SSPT     +  +    ++W++ HPSA+ MF +I  
Sbjct  9    AAAGA-----RPN--NCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITE  61

Query  456  FSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNF  277
             SKGK+IVMFLDYDGTLSPIVE+PD+AFM+ +MR AVR +AK+FPTAIV+GRCR KVY+F
Sbjct  62   ASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDF  121

Query  276  VKLSQLYYAGSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVP  106
            VKL++LYYAGSHGMDIKGPTKG LK NQ    V  QPA EFLP+I++VYKVL+EKTKS P
Sbjct  122  VKLAELYYAGSHGMDIKGPTKG-LKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTP  180

Query  105  GAKVENNKFCLSVHYRCVEEK  43
            GA+VENNKFC+SVH+RCV+EK
Sbjct  181  GARVENNKFCISVHFRCVDEK  201



>sp|Q6ZAL2.1|TPP6_ORYSJ RecName: Full=Probable trehalose-phosphate phosphatase 6; Short=OsTPP6; 
AltName: Full=Trehalose 6-phosphate phosphatase [Oryza 
sativa Japonica Group]
 dbj|BAC99626.1| putative trehalose-phosphatase [Oryza sativa Japonica Group]
 dbj|BAH01631.1| unnamed protein product [Oryza sativa Japonica Group]
Length=370

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 146/192 (76%), Gaps = 11/192 (6%)
 Frame = -2

Query  585  INALFESMRDSSPTRRSFES--------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            IN   ESMR SSPT     +        +D   +WM+ HPSA+S F+ I+  SKGKKIVM
Sbjct  54   INGWVESMRASSPTHAKAAAALAAAGAVDDERAAWMVRHPSALSKFEQIVAASKGKKIVM  113

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD AFM+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYA
Sbjct  114  FLDYDGTLSPIVDDPDSAFMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYA  173

Query  249  GSHGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGP K    N    + VL QPA EFLPMIE+V+  L+E+TK +PGAKVENNKF
Sbjct  174  GSHGMDIKGPAKASRHNKAKAKGVLFQPASEFLPMIEQVHDSLIERTKCIPGAKVENNKF  233

Query  78   CLSVHYRCVEEK  43
            C+SVH+RCV+EK
Sbjct  234  CVSVHFRCVDEK  245



>gb|EAZ06967.1| hypothetical protein OsI_29208 [Oryza sativa Indica Group]
Length=370

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 146/192 (76%), Gaps = 11/192 (6%)
 Frame = -2

Query  585  INALFESMRDSSPTRRSFES--------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            IN   ESMR SSPT     +        +D   +WM+ HPSA+S F+ I+  SKGKKIVM
Sbjct  54   INGWVESMRASSPTHAKAAAALAAAGAVDDERAAWMVRHPSALSKFEQIVAASKGKKIVM  113

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD AFM+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYA
Sbjct  114  FLDYDGTLSPIVDDPDSAFMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYA  173

Query  249  GSHGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            GSHGMDIKGP K    N    + VL QPA EFLPMIE+V+  L+E+TK +PGAKVENNKF
Sbjct  174  GSHGMDIKGPAKASRHNKAKAKGVLFQPASEFLPMIEQVHDSLIERTKCIPGAKVENNKF  233

Query  78   CLSVHYRCVEEK  43
            C+SVH+RCV+EK
Sbjct  234  CVSVHFRCVDEK  245



>ref|NP_001190271.1| probable trehalose-phosphate phosphatase I [Arabidopsis thaliana]
 gb|AED91494.1| probable trehalose-phosphate phosphatase I [Arabidopsis thaliana]
Length=343

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  ++    SW++ HPSA+  F+ IM  S+GK+IVMFL
Sbjct  45   RINAWVDSMRASSPTHLKSLPSSISTQQQLNSWIMQHPSALEKFEQIMEASRGKQIVMFL  104

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  105  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  164

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP KG   + +  Q++L QPA ++LPMI+EVY+ LLEKTKS PGAKVEN+KFC 
Sbjct  165  HGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYRQLLEKTKSTPGAKVENHKFCA  224

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  225  SVHFRCVDEK  234



>gb|EEC71779.1| hypothetical protein OsI_04393 [Oryza sativa Indica Group]
Length=367

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 143/178 (80%), Gaps = 6/178 (3%)
 Frame = -2

Query  570  ESMRDSSPTRRSFESEDVNK--SWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPI  397
            ++MR SSPTR S  + DV++  +W+  HPSA+S F++I   S+GKKIVMF+DYDGTLSPI
Sbjct  64   DAMRASSPTRSSRSASDVDEFTAWVRKHPSALSKFEEIAAKSRGKKIVMFMDYDGTLSPI  123

Query  396  VEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPT  217
            V DPD A+M+  MR AVR VAK FPTAIVSGRCR KV NFV LS LYYAGSHGMDIKGP+
Sbjct  124  VADPDTAYMSDAMRAAVREVAKTFPTAIVSGRCRDKVRNFVGLSDLYYAGSHGMDIKGPS  183

Query  216  KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
                   ++ LCQPA EFLPMI+EVYK L+EKTKS PGAKVENNKFCLSVH+RCV+EK
Sbjct  184  ----SNPESALCQPASEFLPMIDEVYKTLVEKTKSTPGAKVENNKFCLSVHFRCVDEK  237



>ref|NP_001048143.1| Os02g0753000 [Oryza sativa Japonica Group]
 sp|Q6ZGP8.1|TPP4_ORYSJ RecName: Full=Probable trehalose-phosphate phosphatase 4; Short=OsTPP4; 
AltName: Full=Trehalose 6-phosphate phosphatase [Oryza 
sativa Japonica Group]
 dbj|BAD15563.1| putative trehalose-6-phosphate phosphatase [Oryza sativa Japonica 
Group]
 dbj|BAF10057.1| Os02g0753000 [Oryza sativa Japonica Group]
 dbj|BAH00277.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57820.1| hypothetical protein OsJ_08413 [Oryza sativa Japonica Group]
Length=367

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 143/178 (80%), Gaps = 6/178 (3%)
 Frame = -2

Query  570  ESMRDSSPTRRSFESEDVNK--SWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPI  397
            ++MR SSPTR S  + DV++  +W+  HPSA+S F++I   S+GKKIVMF+DYDGTLSPI
Sbjct  64   DAMRASSPTRSSRSASDVDEFTAWVRKHPSALSKFEEIAAKSRGKKIVMFMDYDGTLSPI  123

Query  396  VEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPT  217
            V DPD A+M+  MR AVR VAK FPTAIVSGRCR KV NFV LS LYYAGSHGMDIKGP+
Sbjct  124  VADPDTAYMSDAMRAAVREVAKTFPTAIVSGRCRDKVRNFVGLSDLYYAGSHGMDIKGPS  183

Query  216  KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
                   ++ LCQPA EFLPMI+EVYK L+EKTKS PGAKVENNKFCLSVH+RCV+EK
Sbjct  184  ----SNPESALCQPASEFLPMIDEVYKTLVEKTKSTPGAKVENNKFCLSVHFRCVDEK  237



>emb|CAB92051.1| trehalose-6-phosphate phosphatase-like protein [Arabidopsis thaliana]
Length=372

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  ++    SW++ HPSA+  F+ IM  S+GK+IVMFL
Sbjct  58   RINAWVDSMRASSPTHLKSLPSSISTQQQLNSWIMQHPSALEKFEQIMEASRGKQIVMFL  117

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  118  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  177

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP KG   + +  Q++L QPA ++LPMI+EVY+ LLEKTKS PGAKVEN+KFC 
Sbjct  178  HGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYRQLLEKTKSTPGAKVENHKFCA  237

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  238  SVHFRCVDEK  247



>ref|NP_196572.2| probable trehalose-phosphate phosphatase I [Arabidopsis thaliana]
 sp|F4KFG5.1|TPPI_ARATH RecName: Full=Probable trehalose-phosphate phosphatase I; Short=AtTPPI; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 gb|AED91493.1| probable trehalose-phosphate phosphatase I [Arabidopsis thaliana]
Length=369

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  ++    SW++ HPSA+  F+ IM  S+GK+IVMFL
Sbjct  58   RINAWVDSMRASSPTHLKSLPSSISTQQQLNSWIMQHPSALEKFEQIMEASRGKQIVMFL  117

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  118  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  177

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP KG   + +  Q++L QPA ++LPMI+EVY+ LLEKTKS PGAKVEN+KFC 
Sbjct  178  HGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYRQLLEKTKSTPGAKVENHKFCA  237

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  238  SVHFRCVDEK  247



>gb|KHG28413.1| Trehalose-phosphate phosphatase [Gossypium arboreum]
Length=369

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 148/191 (77%), Gaps = 3/191 (2%)
 Frame = -2

Query  609  ISIPRPGRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            + I    R +   +SMR SSPT      +D   +W L+HPSA+ MF+ I++ SKGK+I+M
Sbjct  58   LEINAGARASVWVDSMRASSPTHIKSTPDD-QGAWNLHHPSALEMFEQIIDASKGKQIIM  116

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIVEDPD+AFM+ +MR  VR +AK FPTAIVSGRCR KVY FVKL++LYYA
Sbjct  117  FLDYDGTLSPIVEDPDRAFMSNKMRKTVRKLAKCFPTAIVSGRCRDKVYKFVKLAELYYA  176

Query  249  GSHGMDIKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            GSHGMDIKGP K +   K  + VL QPA EFLPMI+EVYK L+E TKS PGAKVENNKFC
Sbjct  177  GSHGMDIKGPEKRSKTDKVTEHVLFQPASEFLPMIDEVYKQLVETTKSTPGAKVENNKFC  236

Query  75   LSVHYRCVEEK  43
            LSVH+RCV+EK
Sbjct  237  LSVHFRCVDEK  247



>ref|XP_006287992.1| hypothetical protein CARUB_v10001225mg [Capsella rubella]
 gb|EOA20890.1| hypothetical protein CARUB_v10001225mg [Capsella rubella]
Length=366

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  S+    SW++ HPSA+ MF+ IM  S GK+IVMFL
Sbjct  55   RINAWVDSMRASSPTHLRSLPSSISSQQQLNSWIMQHPSALEMFERIMEASGGKQIVMFL  114

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKA+M+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  115  DYDGTLSPIVDDPDKAYMSSKMRTTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  174

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP KG   + +  Q++L QPA ++LPMI+EVY+ LLEKTKS PGA+VEN+KFC 
Sbjct  175  HGMDIKGPAKGFPRHKRVKQSLLYQPASDYLPMIDEVYRQLLEKTKSTPGARVENHKFCA  234

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  235  SVHFRCVDEK  244



>ref|XP_010926273.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Elaeis 
guineensis]
Length=382

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 152/196 (78%), Gaps = 13/196 (7%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFES----------EDVNKSWMLNHPSAISMFDDIMNFSKGK  442
            GRINA  +SMR SSPT    +S          ++  ++WM  HPSA+ MFD+I   SKGK
Sbjct  61   GRINAWVDSMRSSSPTHIKSDSPFASPVVASDDEEYENWMKQHPSALHMFDEITAASKGK  120

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            +IVMFLDYDGTLSPIV+DPD+AFM+  MR AVR VA+ FPTAIVSGRCR KVY+FV+L +
Sbjct  121  QIVMFLDYDGTLSPIVDDPDRAFMSENMRAAVREVARSFPTAIVSGRCRDKVYSFVQLRE  180

Query  261  LYYAGSHGMDIKGPTKG--NLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVE  91
            LYYAGSHGMDIKGP K   + K   +A+L QPA EFLPMI+EVY+ L++KT+S PGAKVE
Sbjct  181  LYYAGSHGMDIKGPAKQPKHTKAKAKALLFQPASEFLPMIDEVYEALVKKTESTPGAKVE  240

Query  90   NNKFCLSVHYRCVEEK  43
            NNKFC+SVH+RCV+EK
Sbjct  241  NNKFCVSVHFRCVDEK  256



>ref|XP_003574465.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Brachypodium 
distachyon]
Length=365

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 172/245 (70%), Gaps = 18/245 (7%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGA--GSFISIPR---PGRINAL  574
            MT Q+VVV  P+  +A+     +  AL+P+   + +P  A    ++        G IN  
Sbjct  1    MTKQSVVV--PELALAM---PPNSAALYPYPPPRAMPGVAVRKKYLQAQMELGSGLINGW  55

Query  573  FESMRDSSPTRRSFES-----EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
             ESMR SSPT     +     +D + +WM+ HPSA+S FD I+  SKGK+IVMFLDYDGT
Sbjct  56   VESMRASSPTHAKAAAALAAVDDDHTAWMVKHPSALSKFDQIVAASKGKRIVMFLDYDGT  115

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV+DPD AFM+  MR AVR+VA+ FPTAIVSGRCR KV++FVKL++LYYAGSHGMDI
Sbjct  116  LSPIVDDPDAAFMSDTMRLAVRSVARQFPTAIVSGRCRDKVFDFVKLAELYYAGSHGMDI  175

Query  228  KGPTKGNLKGN---QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            KGP K +       + VL QPA EFLPMIE+V++ L+EKTK + G+KVENNKFC+SVH+R
Sbjct  176  KGPAKASRHTKAKAKGVLFQPASEFLPMIEQVHESLMEKTKCIAGSKVENNKFCVSVHFR  235

Query  57   CVEEK  43
            CV+EK
Sbjct  236  CVDEK  240



>ref|XP_006399500.1| hypothetical protein EUTSA_v10013874mg [Eutrema salsugineum]
 gb|ESQ40953.1| hypothetical protein EUTSA_v10013874mg [Eutrema salsugineum]
Length=369

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  S+    SW+++HPSA+ MF+ IM  S GK+IVMFL
Sbjct  58   RINAWVDSMRASSPTHLKSLPSSIYSQQQLNSWIMHHPSALDMFEQIMEASGGKQIVMFL  117

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPD+AFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  118  DYDGTLSPIVDDPDRAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  177

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP+KG     +  Q++L QPA ++LPMI+EVY+ LLE TKS PGAKVEN+KFC 
Sbjct  178  HGMDIKGPSKGVSRQKRLKQSLLYQPASDYLPMIDEVYRKLLETTKSTPGAKVENHKFCA  237

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  238  SVHFRCVDEK  247



>ref|XP_006464217.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Citrus 
sinensis]
Length=390

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 175/260 (67%), Gaps = 37/260 (14%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLP----------------------A  625
            M NQNV++ D    + L    +  P+++  A  +  P                      A
Sbjct  13   MGNQNVLIVDA-FNLTLSTEGLPNPSIYSIASQQKRPPVVPCGGYTNKKKLMLQNLETNA  71

Query  624  GAGSFISIPRPGRINALFESMRDSSPTRRSFESEDV---NKSWMLNHPSAISMFDDIMNF  454
             AG+     RP   N   ES+R SSPT     +  +    ++W++ HPSA+ MF +I   
Sbjct  72   AAGA-----RPN--NCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITEA  124

Query  453  SKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFV  274
            SKGK+IVMFLDYDGTLSPIVE+PD+AFM+ +MR AVR +AK+FPTAIV+GRCR KVY+FV
Sbjct  125  SKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFV  184

Query  273  KLSQLYYAGSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPG  103
            KL++LYYAGSHGMDIKGPTKG LK NQ    V  QPA EFLP+I++VYKVL+EKTKS PG
Sbjct  185  KLAELYYAGSHGMDIKGPTKG-LKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPG  243

Query  102  AKVENNKFCLSVHYRCVEEK  43
            A+VENNKFC+SVH+RCV+EK
Sbjct  244  ARVENNKFCISVHFRCVDEK  263



>gb|AAM63513.1| trehalose-phosphatase, putative [Arabidopsis thaliana]
Length=369

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 169/255 (66%), Gaps = 32/255 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTN N ++SD K  +  + V V   +LF          G G +ISIPR            
Sbjct  1    MTNHNALISDAKGSIG-VAVRVPNQSLFS--------PGGGRYISIPRKKLVQKLEADPS  51

Query  594  PGRINALFESMRDSSPTRR---------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGK  442
              RI+   E+MR SSPTR            + ED   SWM  HPSA++MF++I   SKGK
Sbjct  52   QTRIHTWIEAMRASSPTRTRPGNISPLTESDEEDEYSSWMAQHPSALTMFEEIAEASKGK  111

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            +IVMFLDYDGTLSPIVE+PD+A+M+ EMR+AV+ VA++FPTAIV+GRCR KV  FVKL  
Sbjct  112  QIVMFLDYDGTLSPIVENPDRAYMSEEMREAVKGVARYFPTAIVTGRCRDKVRRFVKLPG  171

Query  261  LYYAGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            LYYAGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK + + GA VEN
Sbjct  172  LYYAGSHGMDIKGPSKRNKHNKNNKGVLFQAANEFLPMIDKVSKCLVEKMRDIEGANVEN  231

Query  87   NKFCLSVHYRCVEEK  43
            NKFC+SVHYRCV++K
Sbjct  232  NKFCVSVHYRCVDQK  246



>ref|XP_010429136.1| PREDICTED: probable trehalose-phosphate phosphatase E [Camelina 
sativa]
Length=356

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = -2

Query  591  GRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
            G I +  +SMR  SPTR +SF S+     W+  HPSA+ MF++I+  S+GK+IVMFLDYD
Sbjct  52   GLIRSWVDSMRACSPTRPKSFNSQ---ACWIKEHPSALKMFEEILLESEGKQIVMFLDYD  108

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPD+AF++ +MR+ VR +A+ FPTAIVSGRCR KV +FVKL++LYYAGSHGM
Sbjct  109  GTLSPIVDDPDRAFISKKMRNTVRKLAECFPTAIVSGRCREKVSSFVKLTELYYAGSHGM  168

Query  234  DIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            DIKGP +G+   KGNQ++LCQPA EFLP+I EVY+ L++KTKSV GAKVENNKFC SVH+
Sbjct  169  DIKGPEQGSKYKKGNQSLLCQPATEFLPVINEVYEKLVDKTKSVTGAKVENNKFCASVHF  228

Query  60   RCVEE  46
            RCVEE
Sbjct  229  RCVEE  233



>ref|XP_009398164.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 172/263 (65%), Gaps = 35/263 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGRI--------  583
            MT QNVV+ +  +       A++EP+      + P P  AGS  +  R  ++        
Sbjct  1    MTKQNVVMQEELAVAVPTSAAIAEPS---PCFSYPPPRAAGSGTNYTRYTKLSCRLDLAS  57

Query  582  --------NALFESMRDSSPTRR------------SFESEDVNKSWMLNHPSAISMFDDI  463
                    N+  ESM+  SPT+             S E E+ + SWM+ HPSA+  F+++
Sbjct  58   CGGGGRAANSWIESMKALSPTQAKSAAPREVPSLASREEEEYD-SWMMLHPSALDNFEEV  116

Query  462  MNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVY  283
            M  +KGK+IVMFLDYDGTLSPIV+DPD+AFM+ EMR+AVR VA HFPTAIVSGRC  KV 
Sbjct  117  MTAAKGKQIVMFLDYDGTLSPIVDDPDRAFMSDEMREAVREVASHFPTAIVSGRCTEKVS  176

Query  282  NFVKLSQLYYAGSHGMDIKGPTKGNLKGN---QAVLCQPAREFLPMIEEVYKVLLEKTKS  112
            +FVKLS+L+YAGSHGMDIKGP  G        Q VL QPA EFLPMI EVYK L+E TKS
Sbjct  177  SFVKLSELHYAGSHGMDIKGPNNGPKHPKAMAQNVLFQPASEFLPMIHEVYKSLVETTKS  236

Query  111  VPGAKVENNKFCLSVHYRCVEEK  43
            +PG++VENNKFCLSVH+RCV+EK
Sbjct  237  IPGSRVENNKFCLSVHFRCVDEK  259



>ref|XP_006428166.1| hypothetical protein CICLE_v10025685mg [Citrus clementina]
 gb|ESR41406.1| hypothetical protein CICLE_v10025685mg [Citrus clementina]
Length=390

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 175/260 (67%), Gaps = 37/260 (14%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLP----------------------A  625
            M NQNV++ D    + L    +  P+++  A  +  P                      A
Sbjct  13   MGNQNVLIVDA-FNLTLSTEGLPNPSIYSIASQQKRPPVVPCGGYTNKKKLMLQNLETNA  71

Query  624  GAGSFISIPRPGRINALFESMRDSSPTRRSFESEDV---NKSWMLNHPSAISMFDDIMNF  454
             AG+     RP   N   ES+R SSPT     +  +    ++W++ HPSA+ MF +I   
Sbjct  72   AAGA-----RPN--NCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITEA  124

Query  453  SKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFV  274
            SKGK+IVMFLDYDGTLSPIVE+PD+AFM+ +MR AVR +AK+FPTAIV+GRCR KVY+FV
Sbjct  125  SKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFV  184

Query  273  KLSQLYYAGSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPG  103
            KL++LYYAGSHGMDIKGPTKG LK NQ    V  QPA EFLP+I++VYKVL+EKTKS PG
Sbjct  185  KLAELYYAGSHGMDIKGPTKG-LKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPG  243

Query  102  AKVENNKFCLSVHYRCVEEK  43
            A+VENNKFC+SVH+RCV+EK
Sbjct  244  ARVENNKFCISVHFRCVDEK  263



>gb|KEH34903.1| trehalose-6-phosphate phosphatase [Medicago truncatula]
Length=368

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 4/187 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
             ++NA  +SMR +SPTR          SW+L HPSA+ +FD I+  +K K+IV FLDYDG
Sbjct  56   SKVNAWIDSMRAASPTRVKSSENQEKCSWILYHPSALKLFDQILYSAKRKQIVFFLDYDG  115

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV DP+KAFMT +MR  ++++A++FPTAIV+GRCR KV+NFVKL++LYYA SHGMD
Sbjct  116  TLSPIVADPEKAFMTRKMRATLKDIARNFPTAIVTGRCREKVFNFVKLAELYYAASHGMD  175

Query  231  IKGPTKGNLKG----NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            I GPTK         N+AVL QPA ++LPMI+EVYK+LLEKTKSV GAKVENNKFCLSVH
Sbjct  176  IMGPTKNRSAEKSNVNKAVLFQPASQYLPMIDEVYKILLEKTKSVSGAKVENNKFCLSVH  235

Query  63   YRCVEEK  43
            +RCV+EK
Sbjct  236  FRCVDEK  242



>ref|NP_564464.1| probable trehalose-phosphate phosphatase D [Arabidopsis thaliana]
 sp|Q67XC9.1|TPPD_ARATH RecName: Full=Probable trehalose-phosphate phosphatase D; Short=AtTPPD; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 dbj|BAD44653.1| putative trehalose-phosphatase [Arabidopsis thaliana]
 gb|AEE31836.1| probable trehalose-phosphate phosphatase D [Arabidopsis thaliana]
Length=369

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 169/255 (66%), Gaps = 32/255 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTN N ++SD K  +  + V V   +LF          G G +ISIPR            
Sbjct  1    MTNHNALISDAKGSIG-VAVRVPNQSLFS--------PGGGRYISIPRKKLVQKLEADPS  51

Query  594  PGRINALFESMRDSSPTRR---------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGK  442
              RI+   E+MR SSPTR            + ED   SWM  HPSA++MF++I   SKGK
Sbjct  52   QTRIHTWIEAMRASSPTRTRPGNISPLPESDEEDEYSSWMAQHPSALTMFEEIAEASKGK  111

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            +IVMFLDYDGTLSPIVE+PD+A+M+ EMR+AV+ VA++FPTAIV+GRCR KV  FVKL  
Sbjct  112  QIVMFLDYDGTLSPIVENPDRAYMSEEMREAVKGVARYFPTAIVTGRCRDKVRRFVKLPG  171

Query  261  LYYAGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            LYYAGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK + + GA VEN
Sbjct  172  LYYAGSHGMDIKGPSKRNKHNKNNKGVLFQAANEFLPMIDKVSKCLVEKMRDIEGANVEN  231

Query  87   NKFCLSVHYRCVEEK  43
            NKFC+SVHYRCV++K
Sbjct  232  NKFCVSVHYRCVDQK  246



>ref|XP_004513754.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cicer 
arietinum]
Length=379

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 177/259 (68%), Gaps = 32/259 (12%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGV--ALIRVA--VSEPALFPHA-------------------VAKPLP  628
            MTNQN++V    S V   L+ +A  +S   + P                     + KPL 
Sbjct  1    MTNQNMLVKSRDSRVNHRLMELAMSISNSNVLPRTAMPELMGLLGGLLVQPKNKLIKPLE  60

Query  627  AGAGSFISIPRPGRINALFESMRDSSPTRRSFESEDVNKS-WMLNHPSAISMFDDIMNFS  451
             G+G   +     ++N   +SMR SSPTR    SE+ ++S W + HPSA++MF+ I+  S
Sbjct  61   DGSGKGTT-----KVNTWIDSMRASSPTRVKNSSENRDQSYWTIFHPSALNMFNQIIYKS  115

Query  450  KGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVK  271
              K+IV+FLDYDGTLSPIV DP++A+M+ +MR  ++N+++HFPTAIVSGRC  K+++FV+
Sbjct  116  NEKQIVVFLDYDGTLSPIVADPNRAYMSKKMRATLKNISRHFPTAIVSGRCLDKLFSFVR  175

Query  270  LSQLYYAGSHGMDIKGPT--KGNLKG-NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGA  100
            L++LYYAGSHGMDIKGPT  +   +G N  VL QPA EFLPMI EVYK+L+EKTKSVPGA
Sbjct  176  LAELYYAGSHGMDIKGPTNRRSTERGSNDGVLLQPASEFLPMINEVYKILVEKTKSVPGA  235

Query  99   KVENNKFCLSVHYRCVEEK  43
             VENNKFCLSVH+RCV+EK
Sbjct  236  MVENNKFCLSVHFRCVDEK  254



>ref|XP_009106458.1| PREDICTED: trehalose-phosphate phosphatase B-like [Brassica rapa]
Length=378

 Score =   250 bits (638),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 175/255 (69%), Gaps = 23/255 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFP----------HAVAKPLPAGAGSFISIPR--  595
            M NQNV+VSD K+ +    V VS   LF           H   + L A   +  +I +  
Sbjct  1    MMNQNVIVSDRKAILGSKTVTVSNSPLFSSPPTYFTFPRHKFLELLEAADKNSNNINKNN  60

Query  594  --PGRINALFESMRDSSPTRRSFESEDV------NKSWMLNHPSAISMFDDIMNFSKGKK  439
               G+I +  +SMRDSSPTR    S D         SW++  PSA++MFD+I+N +KGK+
Sbjct  61   LGAGKIASWVDSMRDSSPTRLRSSSRDSVSDNDHKASWIVRFPSALNMFDEIVNAAKGKQ  120

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDGTLSPIVEDPDKA++T EMR+ V+NVA +FPTAIV+GR   KV  FVKL+++
Sbjct  121  IVMFLDYDGTLSPIVEDPDKAYITHEMREVVKNVALNFPTAIVTGRSIDKVRGFVKLNEI  180

Query  258  YYAGSHGMDIKGPTKGNLKG---NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            YYAGSHGMDI+GPT     G   NQ VL QPAREF+PMIE+VYK+L EKTK +PGA VEN
Sbjct  181  YYAGSHGMDIEGPTSEYAYGGESNQGVLFQPAREFVPMIEKVYKILEEKTKWIPGAMVEN  240

Query  87   NKFCLSVHYRCVEEK  43
            NKFCLSVH+R V+EK
Sbjct  241  NKFCLSVHFRRVDEK  255



>ref|XP_004973406.1| PREDICTED: probable trehalose-phosphate phosphatase 6-like [Setaria 
italica]
Length=384

 Score =   250 bits (638),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 148/187 (79%), Gaps = 11/187 (6%)
 Frame = -2

Query  570  ESMRDSSPTRRSFESE-----DVNK--SWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            ESMR SSPT     +      DV +  SWM+ HPSA+S FD ++  SKGK+IV+FLDYDG
Sbjct  73   ESMRASSPTHARAAAALAAGVDVERHASWMVEHPSALSKFDQVVAASKGKQIVVFLDYDG  132

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD A+M+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYAGSHGMD
Sbjct  133  TLSPIVDDPDAAYMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMD  192

Query  231  IKGPTKGNLKGNQA----VLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            IKGP KG+     A    VL QPA +FLPMIE+V++ L+EKTKS+PGAKVENNKFC+SVH
Sbjct  193  IKGPVKGSRHTKAAKAKGVLFQPASQFLPMIEQVHESLVEKTKSIPGAKVENNKFCVSVH  252

Query  63   YRCVEEK  43
            +RCV+EK
Sbjct  253  FRCVDEK  259



>ref|XP_010422894.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X2 [Camelina sativa]
Length=334

 Score =   248 bits (634),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 148/190 (78%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  S+    SW++ HPSA+ MF+ I+  S GK+IVMFL
Sbjct  64   RINAWVDSMRASSPTHLKSLPSSISSQHQLNSWIMQHPSALEMFERIIEASGGKQIVMFL  123

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  124  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  183

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDI GP KG   + +  Q++L QPA ++LPMI+EVYK LLEKTKS PG KVEN+KFC 
Sbjct  184  HGMDIIGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYKQLLEKTKSTPGVKVENHKFCA  243

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  244  SVHFRCVDEK  253



>ref|XP_006428167.1| hypothetical protein CICLE_v10025685mg [Citrus clementina]
 gb|ESR41407.1| hypothetical protein CICLE_v10025685mg [Citrus clementina]
Length=425

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 175/260 (67%), Gaps = 37/260 (14%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLP----------------------A  625
            M NQNV++ D    + L    +  P+++  A  +  P                      A
Sbjct  48   MGNQNVLIVDA-FNLTLSTEGLPNPSIYSIASQQKRPPVVPCGGYTNKKKLMLQNLETNA  106

Query  624  GAGSFISIPRPGRINALFESMRDSSPTRRSFESEDV---NKSWMLNHPSAISMFDDIMNF  454
             AG+     RP   N   ES+R SSPT     +  +    ++W++ HPSA+ MF +I   
Sbjct  107  AAGA-----RPN--NCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITEA  159

Query  453  SKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFV  274
            SKGK+IVMFLDYDGTLSPIVE+PD+AFM+ +MR AVR +AK+FPTAIV+GRCR KVY+FV
Sbjct  160  SKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFV  219

Query  273  KLSQLYYAGSHGMDIKGPTKGNLKGNQ---AVLCQPAREFLPMIEEVYKVLLEKTKSVPG  103
            KL++LYYAGSHGMDIKGPTKG LK NQ    V  QPA EFLP+I++VYKVL+EKTKS PG
Sbjct  220  KLAELYYAGSHGMDIKGPTKG-LKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPG  278

Query  102  AKVENNKFCLSVHYRCVEEK  43
            A+VENNKFC+SVH+RCV+EK
Sbjct  279  ARVENNKFCISVHFRCVDEK  298



>dbj|BAJ88024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 151/193 (78%), Gaps = 10/193 (5%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            G ++ L ESMR SSPT     +      +D + +WM  HPSA++ F++I+  SKGK+IVM
Sbjct  56   GMLSGLVESMRASSPTHARAAAALAAGVDDEHAAWMARHPSALAKFEEIVAASKGKQIVM  115

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD AFM+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYA
Sbjct  116  FLDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYA  175

Query  249  GSHGMDIKGPTK---GNLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            GSHGMDIKGP K   G+ K   + VL QPA EFLPMIEEV++ L+E+TK V GAKVENNK
Sbjct  176  GSHGMDIKGPAKSSSGHAKSKAKGVLFQPASEFLPMIEEVHQRLIEETKHVAGAKVENNK  235

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+EK
Sbjct  236  FCVSVHFRCVDEK  248



>dbj|BAJ96268.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 151/193 (78%), Gaps = 10/193 (5%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            G ++ L ESMR SSPT     +      +D + +WM  HPSA++ F++I+  SKGK+IVM
Sbjct  56   GMLSGLVESMRASSPTHARAAAAPAAGVDDEHAAWMARHPSALAKFEEIVAASKGKQIVM  115

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DPD AFM+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYA
Sbjct  116  FLDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYA  175

Query  249  GSHGMDIKGPTK---GNLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            GSHGMDIKGP K   G+ K   + VL QPA EFLPMIEEV++ L+E+TK V GAKVENNK
Sbjct  176  GSHGMDIKGPAKSSSGHAKSKAKGVLFQPASEFLPMIEEVHQRLIEETKHVAGAKVENNK  235

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+EK
Sbjct  236  FCVSVHFRCVDEK  248



>ref|XP_009380195.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=361

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 164/246 (67%), Gaps = 23/246 (9%)
 Frame = -2

Query  741  KMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGRINALFESM  562
            +M  QNV+V + +  +  +  A S P L                 S    GRI A  +SM
Sbjct  6    EMRKQNVIVPE-EFAITRVMAAPSRPGL---------AVSCKKMFSQLDSGRIGAWVDSM  55

Query  561  RDSSPTRR----------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            R SSPTR           +  S+     W+  HPSA+S FDD++  SKGK++V+FLDYDG
Sbjct  56   RASSPTRVKAAPALAPSITASSDQEYDGWLGQHPSALSNFDDVVAASKGKRVVLFLDYDG  115

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+  MR+AVR+ A+HFPTAIVSGRCR KV++FV+L +LYYAGSHGMD
Sbjct  116  TLSPIVDDPDRAFMSDSMREAVRDAARHFPTAIVSGRCRDKVFSFVQLRELYYAGSHGMD  175

Query  231  IKGP---TKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            I+GP   TK      +AV  QPA EFLPMI+EVYK L+E+TKS+ G+KVENN F LSVH+
Sbjct  176  IRGPVKATKHTKAKAKAVSFQPATEFLPMIDEVYKALVERTKSIQGSKVENNTFSLSVHF  235

Query  60   RCVEEK  43
            RCVEEK
Sbjct  236  RCVEEK  241



>ref|XP_009101851.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X2 [Brassica rapa]
Length=345

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLMKQSSWLTEHPSALDMFEEILHVSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAI+SGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIISGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGN-LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            IKGP +G+  K ++++LCQPA EFLPMI+EVY+ L+EKT   PGA +ENNKFC+SVH+R 
Sbjct  160  IKGPEQGSKYKDDKSLLCQPATEFLPMIDEVYQKLVEKTNLTPGANIENNKFCVSVHFRR  219

Query  54   VEEK  43
            V+EK
Sbjct  220  VDEK  223



>gb|KHN29076.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=352

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 167/246 (68%), Gaps = 25/246 (10%)
 Frame = -2

Query  732  NQNVVVSDPKSGVALIRVAVSEPALFP-----------HAVAKPLPAGAGSFISIPRPGR  586
             QN +VS  KSG+    +AV++  L               V K L    G         R
Sbjct  2    TQNAIVSKTKSGIKG-DIAVAQKPLAAPPPPGYIPIPRRRVLKNLEINGGQ--------R  52

Query  585  INALFESMRDSSPTRRSFESE--DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            INA  +SMR SSPT     S   + + SW+L HPSA+ MF+ IM+ S+GK+IVMFLDYDG
Sbjct  53   INAWVDSMRASSPTNSKSTSSLAEEHSSWILRHPSALDMFEQIMDASRGKQIVMFLDYDG  112

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD AFM+  MR  VR +A+ FPTAIV+GRC+ KVY+FV+L++LYYAGSHGMD
Sbjct  113  TLSPIVDDPDHAFMSDSMRRTVRKLARCFPTAIVTGRCKDKVYSFVRLAELYYAGSHGMD  172

Query  231  IKGPT---KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            I+GPT   K +    + VL QPA EFLPMI+EV++ L+EK KS+PGAKVENNKFC SVH+
Sbjct  173  IQGPTRDCKYSKDKGEPVLFQPASEFLPMIDEVHQQLVEKMKSIPGAKVENNKFCCSVHF  232

Query  60   RCVEEK  43
            RCV+EK
Sbjct  233  RCVDEK  238



>ref|XP_010491664.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X2 [Camelina sativa]
Length=337

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 147/190 (77%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  S+    SW++ HPSA+ MF+ I+  S GK+IVMFL
Sbjct  67   RINAWVDSMRASSPTHLKSLPSSISSQQQLNSWIMQHPSALEMFERIIEASGGKQIVMFL  126

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ + K FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  127  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLGKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  186

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDI GP KG   + +  Q++L QPA ++LPMI+EVYK LLEKTKS PG KVEN+KFC 
Sbjct  187  HGMDIIGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYKQLLEKTKSTPGVKVENHKFCA  246

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  247  SVHFRCVDEK  256



>gb|AAZ66928.1| 117M18_9 [Brassica rapa]
Length=371

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 168/243 (69%), Gaps = 15/243 (6%)
 Frame = -2

Query  744  RKMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG-RINALFE  568
            R   +QNVVVS+  +  ++I    S P  F     K L       + I   G RINA  +
Sbjct  6    RMSESQNVVVSE--AARSIIPNNSSAPPGFISISKKKLLKN----LEIINDGERINAWVD  59

Query  567  SMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
            SMR SSPT       S  SE    SW++ HPSA+ MF+ I   S GK+IV+FLDYDGTLS
Sbjct  60   SMRASSPTHPKSLPSSISSEQQLSSWIMQHPSALEMFEKITEASGGKQIVIFLDYDGTLS  119

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIV+DPD+AFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGSHGMDIKG
Sbjct  120  PIVDDPDRAFMSSKMRRTVKKLAKCFPTAIVTGRCLDKVYNFVKLAELYYAGSHGMDIKG  179

Query  222  PTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCV  52
            P KG   + +  Q++L QPA ++LPMI+EVY+ LLEKTKS PG  VENNKFC SVH+RCV
Sbjct  180  PAKGFSRHKRVKQSLLYQPASDYLPMIDEVYRQLLEKTKSTPGVIVENNKFCASVHFRCV  239

Query  51   EEK  43
            +EK
Sbjct  240  DEK  242



>ref|XP_002893908.1| hypothetical protein ARALYDRAFT_891246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70167.1| hypothetical protein ARALYDRAFT_891246 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 169/255 (66%), Gaps = 32/255 (13%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPR------------  595
            MTN N ++SD K  +  + V V   +LF          G G +ISIPR            
Sbjct  1    MTNHNALISDAKGSIG-VAVRVPNQSLFS--------PGGGRYISIPRKKLVQKLETDQS  51

Query  594  PGRINALFESMRDSSPTRR---------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGK  442
              R ++  E+MR SSPTR            + ED   SW+  HPSA++MF++I   SKGK
Sbjct  52   QTRTHSWIEAMRASSPTRIRPGNISSLPESDEEDEYSSWLAQHPSALTMFEEIAEASKGK  111

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            +IVMFLDYDGTLSPIVE+PD+A+M+ EMR+AV+ VA++FPTAIV+GRCR KV  FVKL  
Sbjct  112  QIVMFLDYDGTLSPIVENPDRAYMSDEMREAVKGVARYFPTAIVTGRCRDKVRRFVKLPG  171

Query  261  LYYAGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            LYYAGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK + + GA VEN
Sbjct  172  LYYAGSHGMDIKGPSKKTKHNKNNKGVLFQAANEFLPMIDQVSKCLVEKMRDIEGANVEN  231

Query  87   NKFCLSVHYRCVEEK  43
            NKFC+SVHYRCV++K
Sbjct  232  NKFCVSVHYRCVDQK  246



>ref|NP_195687.2| probable trehalose-phosphate phosphatase H [Arabidopsis thaliana]
 sp|Q8GWG2.1|TPPH_ARATH RecName: Full=Probable trehalose-phosphate phosphatase H; Short=AtTPPH; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 dbj|BAC43453.1| putative protein [Arabidopsis thaliana]
 gb|AAO63975.1| unknown protein [Arabidopsis thaliana]
 gb|AEE87117.1| probable trehalose-phosphate phosphatase H [Arabidopsis thaliana]
Length=349

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 149/187 (80%), Gaps = 7/187 (4%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLLKQSSWLTEHPSALDMFEEILHLSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRC  KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSRKMRRTVRKLANCFPTAIVSGRCIEKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGN-----LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            IKGP +G+     L+ ++++LCQPA EFLPMI+EVY  L+EKTKS PGA+VENNKFC+SV
Sbjct  160  IKGPEQGSKYEQILQDSKSLLCQPATEFLPMIDEVYHKLVEKTKSTPGAQVENNKFCVSV  219

Query  66   HYRCVEE  46
            H+R V+E
Sbjct  220  HFRRVDE  226



>ref|XP_009419974.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 173/251 (69%), Gaps = 28/251 (11%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRP---------GR  586
            MTNQNVVV      + +  VA S P LF +    P  +G+ +  +IP+          G 
Sbjct  1    MTNQNVVVQ----AITVAAVANS-PPLFTYP--PPRTSGSSAAAAIPKKYLSPVDLGGGW  53

Query  585  INALFESMRDSSPTRR--------SFESE-DVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
             N   E+++ SSPT          + ESE D   +W++ HPSA+S F+ I + +KGK+IV
Sbjct  54   TNGWLEAIKASSPTHAKSALLSAPAVESEQDEQSTWIMRHPSALSKFEQITSATKGKQIV  113

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIV+DPD AFM+  MR AV+ VA+ FPTAIVSGRCR++VY FV+L++LYY
Sbjct  114  MFLDYDGTLSPIVDDPDSAFMSDTMRAAVKKVARLFPTAIVSGRCRSRVYEFVRLTELYY  173

Query  252  AGSHGMDIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            AGSHGMDIK P KG    K  +AVL QPA EFLP++ E++K LLE T+S+PGAKVENNKF
Sbjct  174  AGSHGMDIKVP-KGTRYTKKKKAVLFQPASEFLPLMNEIHKALLETTRSIPGAKVENNKF  232

Query  78   CLSVHYRCVEE  46
            C+SVH+RCV+E
Sbjct  233  CVSVHFRCVDE  243



>ref|XP_003532832.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Glycine 
max]
Length=366

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 166/246 (67%), Gaps = 25/246 (10%)
 Frame = -2

Query  732  NQNVVVSDPKSGVALIRVAVSEPALFP-----------HAVAKPLPAGAGSFISIPRPGR  586
             QN +VS  KSG+    +AV++  L               V K L    G         R
Sbjct  2    TQNAIVSKTKSGIK-GDIAVAQKPLAAPPPPGYIPIPRRRVLKNLEINGGQ--------R  52

Query  585  INALFESMRDSSPTRRSFESE--DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            INA  +SMR SSPT     S   + + SW+L HPSA+ MF+ IM+ S+GK+IVMFLDYDG
Sbjct  53   INAWVDSMRASSPTNSKSTSSLAEEHSSWILRHPSALDMFEQIMDASRGKQIVMFLDYDG  112

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD AFM+  MR  VR +A+ FPTAIV+GRC+ KVY+FV+L++LYYAGSHGMD
Sbjct  113  TLSPIVDDPDHAFMSDSMRRTVRKLARCFPTAIVTGRCKDKVYSFVRLAELYYAGSHGMD  172

Query  231  IKGPT---KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            I+GPT   K +    + VL QPA EFLPMI+EV+  L+EK KS+PGAKVENNKFC SVH+
Sbjct  173  IQGPTRDCKYSKDKGEPVLFQPASEFLPMIDEVHHQLVEKMKSIPGAKVENNKFCCSVHF  232

Query  60   RCVEEK  43
            RCV+EK
Sbjct  233  RCVDEK  238



>ref|XP_009109445.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X2 [Brassica rapa]
Length=334

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G +N+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  31   GFVNSWVDSMRACSPTH--LKSLMKQSSWLTEHPSALDMFEEILHVSEGKQIVMFLDYDG  88

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  89   TLSPIVDDPDRAFMSKKMRRTVRKLAICFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  148

Query  231  IKGPTKGN-LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            IKGP +G+  K  +++LCQPA EFLPMI+EVY+ L+EKTK  PGA VENNKFC SVH+R 
Sbjct  149  IKGPAQGSKYKEGKSLLCQPATEFLPMIDEVYQKLVEKTKVTPGANVENNKFCASVHFRR  208

Query  54   VEEK  43
            V+EK
Sbjct  209  VDEK  212



>ref|XP_010446535.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X1 [Camelina sativa]
Length=346

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF+DI++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLLKQNSWLTEHPSALDMFEDILHLSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G+   + ++++LCQPA EFLPMI+EVY+ L++KTK  PGA+VENNKFC+SVH+R
Sbjct  160  IKGPEQGSKYEEDSKSLLCQPATEFLPMIDEVYQKLVQKTKLTPGAQVENNKFCVSVHFR  219

Query  57   CVEE  46
             V E
Sbjct  220  RVNE  223



>ref|XP_010431963.1| PREDICTED: probable trehalose-phosphate phosphatase H [Camelina 
sativa]
Length=346

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF+DI++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLLKQNSWLTEHPSALDMFEDILHLSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G+   + ++++LCQPA EFLPMI+EVY+ L++KTK  PGA+VENNKFC+SVH+R
Sbjct  160  IKGPEQGSKYEEDSKSLLCQPATEFLPMIDEVYQKLVQKTKLTPGAQVENNKFCVSVHFR  219

Query  57   CVEE  46
             V E
Sbjct  220  RVNE  223



>ref|XP_009109444.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X1 [Brassica rapa]
Length=345

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G +N+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  42   GFVNSWVDSMRACSPTH--LKSLMKQSSWLTEHPSALDMFEEILHVSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLAICFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGN-LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            IKGP +G+  K  +++LCQPA EFLPMI+EVY+ L+EKTK  PGA VENNKFC SVH+R 
Sbjct  160  IKGPAQGSKYKEGKSLLCQPATEFLPMIDEVYQKLVEKTKVTPGANVENNKFCASVHFRR  219

Query  54   VEEK  43
            V+EK
Sbjct  220  VDEK  223



>ref|XP_010437099.1| PREDICTED: probable trehalose-phosphate phosphatase H [Camelina 
sativa]
Length=346

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF+DI++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLLKQNSWLTEHPSALDMFEDILHLSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G+   + ++++LCQPA EFLPMI+EVY+ L++KTK  PGA+VENNKFC+SVH+R
Sbjct  160  IKGPEQGSKYEEDSKSLLCQPATEFLPMIDEVYQKLVQKTKLTPGAQVENNKFCVSVHFR  219

Query  57   CVEE  46
             V E
Sbjct  220  RVNE  223



>emb|CDX87477.1| BnaA07g33960D [Brassica napus]
Length=378

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 174/255 (68%), Gaps = 23/255 (9%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFP----------HAVAKPLPAGAGSFISIPR--  595
            M NQNV+VSD K+ +    V VS   LF           H   + L A   +  +I +  
Sbjct  1    MMNQNVIVSDRKAILGSKTVTVSNSPLFSSPPTYFTFPRHKFLELLEAADKNSNNINKNN  60

Query  594  --PGRINALFESMRDSSPTRRSFESEDV------NKSWMLNHPSAISMFDDIMNFSKGKK  439
               G+I +  +SMRDSSPTR    S D         SW++  PSA++MFD+I+N +KGK+
Sbjct  61   LGAGKIASWVDSMRDSSPTRLRSSSRDSVSDNDHKTSWIVRFPSALNMFDEIVNAAKGKQ  120

Query  438  IVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQL  259
            IVMFLDYDG LSPIVEDPDKA++T EMR+ V+NVA +FPTAIV+GR   KV  FVKL+++
Sbjct  121  IVMFLDYDGMLSPIVEDPDKAYITHEMREVVKNVALNFPTAIVTGRSIDKVRGFVKLNEI  180

Query  258  YYAGSHGMDIKGPTKGNLKG---NQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVEN  88
            YYAGSHGMDI+GPT     G   NQ VL QPAREF+PMIE+VYK+L EKTK +PGA VEN
Sbjct  181  YYAGSHGMDIEGPTSEYAYGGESNQGVLFQPAREFVPMIEKVYKILEEKTKWIPGAMVEN  240

Query  87   NKFCLSVHYRCVEEK  43
            NKFCLSVH+R V+EK
Sbjct  241  NKFCLSVHFRRVDEK  255



>ref|XP_003615055.1| Trehalose-6-phosphate phosphatase [Medicago truncatula]
 gb|AES98013.1| trehalose-6-phosphate phosphatase [Medicago truncatula]
Length=379

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 151/189 (80%), Gaps = 10/189 (5%)
 Frame = -2

Query  588  RINALFESMRDSSPTRRSFESEDVNKS-WMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            ++NA  +SMR SSPTR   +SE+ +++ W L HPSA++MF  IM  + GK+IV+FLDYDG
Sbjct  69   KVNAWIDSMRASSPTRTRHDSENRDQTHWTLFHPSALNMFSKIMYNTNGKQIVVFLDYDG  128

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV DPDKA+M+ +MR  ++++A+HFPTAIVSGRC  K+++FV+L++LYYAGSHGMD
Sbjct  129  TLSPIVADPDKAYMSKKMRVTLKDIARHFPTAIVSGRCLDKLFSFVRLAELYYAGSHGMD  188

Query  231  IKGPT------KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            IKGPT      KGN   N  VL QPA EFLPMI EVYK+L+EKTK VPGA VENNKFCLS
Sbjct  189  IKGPTNRRSTKKGN---NDGVLLQPASEFLPMINEVYKILVEKTKCVPGAMVENNKFCLS  245

Query  69   VHYRCVEEK  43
            VH+R V+EK
Sbjct  246  VHFRNVDEK  254



>gb|AFK47239.1| unknown [Medicago truncatula]
Length=379

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 151/189 (80%), Gaps = 10/189 (5%)
 Frame = -2

Query  588  RINALFESMRDSSPTRRSFESEDVNKS-WMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            ++NA  +SMR SSPTR   +SE+ +++ W L HPSA++MF  IM  + GK+IV+FLDYDG
Sbjct  69   KVNAWIDSMRASSPTRTRHDSENRDQTHWTLFHPSALNMFSKIMYNTNGKQIVVFLDYDG  128

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV DPDKA+M+ +MR  ++++A+HFPTAIVSGRC  K+++FV+L++LYYAGSHGMD
Sbjct  129  TLSPIVADPDKAYMSKKMRVTLKDIARHFPTAIVSGRCLDKLFSFVRLAELYYAGSHGMD  188

Query  231  IKGPT------KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            IKGPT      KGN   N  VL QPA EFLPMI EVYK+L+EKTK VPGA VENNKFCLS
Sbjct  189  IKGPTNRRSTKKGN---NDGVLLQPASEFLPMINEVYKILVEKTKCVPGAMVENNKFCLS  245

Query  69   VHYRCVEEK  43
            VH+R V+EK
Sbjct  246  VHFRNVDEK  254



>emb|CDX90361.1| BnaA08g16230D [Brassica napus]
Length=354

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G +N+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  51   GFVNSWVDSMRACSPTH--LKSLMKQSSWLTEHPSALDMFEEILHVSEGKQIVMFLDYDG  108

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  109  TLSPIVDDPDRAFMSKKMRRTVRKLAICFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  168

Query  231  IKGPTKGN-LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            IKGP +G+  K  +++LCQPA EFLPMI+EVY+ L+EKTK  PGA VENNKFC SVH+R 
Sbjct  169  IKGPAQGSKYKEGKSLLCQPATEFLPMIDEVYQKLVEKTKVTPGANVENNKFCASVHFRR  228

Query  54   VEEK  43
            V+EK
Sbjct  229  VDEK  232



>emb|CDY22393.1| BnaA06g37150D [Brassica napus]
Length=371

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  68   GLINSWVDSMRACSPTH--LKSLMKQSSWLTEHPSALDMFEEILHVSEGKQIVMFLDYDG  125

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +AK FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  126  TLSPIVDDPDRAFMSKKMRRTVRKLAKCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  185

Query  231  IKGPTKGN-LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            IKGP +G+  K ++++LCQPA EFLPMI+EVY+ L++KT   PGA +ENNKFC+SVH+R 
Sbjct  186  IKGPEQGSKYKDDKSLLCQPATEFLPMIDEVYQKLVDKTNFTPGANIENNKFCVSVHFRR  245

Query  54   VEEK  43
            V+EK
Sbjct  246  VDEK  249



>ref|XP_009122089.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X2 [Brassica rapa]
Length=357

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 145/187 (78%), Gaps = 5/187 (3%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            R+NA  +SMR SSPT       S  SE    SW++ HPSA+ MF+ I   S GK+IVMFL
Sbjct  49   RVNAWVDSMRASSPTHLKSLPSSVSSEKHLSSWIMQHPSALEMFEKITQASGGKQIVMFL  108

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  109  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  168

Query  243  HGMDIKGPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            HGMDIKGP KG  +  +++L QPA ++LPMI+EVYK LLEKTKS PG  VEN+KF  SVH
Sbjct  169  HGMDIKGPAKGFSRHKRSLLYQPASDYLPMIDEVYKQLLEKTKSTPGVIVENHKFTASVH  228

Query  63   YRCVEEK  43
            +RCVEEK
Sbjct  229  FRCVEEK  235



>ref|XP_010102586.1| putative glycosyl hydrolase [Morus notabilis]
 gb|EXB93689.1| putative glycosyl hydrolase [Morus notabilis]
Length=456

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 166/238 (70%), Gaps = 22/238 (9%)
 Frame = -2

Query  741  KMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGRINALFESM  562
            KMT Q VV         LIR          HA  K + A       I    +I++  +SM
Sbjct  110  KMTTQKVV---------LIRKE-------QHAAMK-MAASKKKLNVINGGAKISSWVDSM  152

Query  561  RDSSPTRRSFESE--DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVED  388
            R SSP R S      +  KSW L HPSA+SMFD I+  SKGKKIVMFLDYDGTLSPIV++
Sbjct  153  RASSPPRISISPSLTEEEKSWALQHPSALSMFDKIVEASKGKKIVMFLDYDGTLSPIVKN  212

Query  387  PDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKGN  208
            P++AFM+  MR  V+++A+ FPTAIVSGRCR KVYNFV+L++LYYAGSHGMDIKGP KG+
Sbjct  213  PERAFMSDAMRSTVKSLAQCFPTAIVSGRCRDKVYNFVQLAELYYAGSHGMDIKGPEKGS  272

Query  207  --LKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
              +KG+ + +L QPA +FLPMI+EVYK L+ +TKS  GA VE+NKFCLSVHYRCV+EK
Sbjct  273  KYIKGDAKGILFQPAAKFLPMIDEVYKTLVYETKSTRGAMVEHNKFCLSVHYRCVDEK  330


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 87/158 (55%), Gaps = 23/158 (15%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGRINALFESMR  559
            MTNQNVV+  P+   A +++A S+  L        +  GA          +I++  +SMR
Sbjct  1    MTNQNVVLI-PEEQQAAMKMAASKKKL------NVINGGA----------KISSWVDSMR  43

Query  558  DSSPTRRSFESE--DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPI---V  394
             SSP R S      +  KSW L HPSA+SMFD I+  SKGKKIVMFLDYDGTLSPI    
Sbjct  44   ASSPPRISISPSLTEEEKSWALQHPSALSMFDKIVEASKGKKIVMFLDYDGTLSPIRFLK  103

Query  393  EDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYN  280
            E+  KA MTT+    +R   +H    + + + +  V N
Sbjct  104  EEDQKAKMTTQKVVLIRK-EQHAAMKMAASKKKLNVIN  140



>ref|XP_009380850.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 146/191 (76%), Gaps = 8/191 (4%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRR------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            GRI    ESM+ SSPT            ++ + +W++ HPSA++ F+ IM+ SKGK+IVM
Sbjct  49   GRIGTWVESMKASSPTHTKAVGAIGVPVDEQSAAWIMRHPSALTKFEQIMSASKGKQIVM  108

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIVEDPD AFMT  MR AVRNVA++FPTAIV+GRC  KV +FV L++LYYA
Sbjct  109  FLDYDGTLSPIVEDPDSAFMTDAMRAAVRNVARYFPTAIVTGRCLEKVIDFVGLTELYYA  168

Query  249  GSHGMDIKGPTKGNLKGNQA--VLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            GSHGMDIKGP K      +A  VL QPAREFLPMI+ VY+ LLE+TKS  GAKVENNKFC
Sbjct  169  GSHGMDIKGPAKPRHTKAKAKSVLFQPAREFLPMIDGVYRSLLERTKSTAGAKVENNKFC  228

Query  75   LSVHYRCVEEK  43
            +SVH+RCV+EK
Sbjct  229  VSVHFRCVDEK  239



>ref|XP_010422893.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X1 [Camelina sativa]
Length=375

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 168/249 (67%), Gaps = 23/249 (9%)
 Frame = -2

Query  720  VVSDPKSGVALIRVAVSEPALFPHAVA----KPLPAGAGSF--------ISIPRPG---R  586
            VV +P++  A   V VSE  +          + LP G  S         I I   G   R
Sbjct  5    VVENPQTMSASQNVFVSETTMSSIIPNNSSSQKLPPGLISISKKNLLKNIDIINGGGGHR  64

Query  585  INALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLD  421
            INA  +SMR SSPT       S  S+    SW++ HPSA+ MF+ I+  S GK+IVMFLD
Sbjct  65   INAWVDSMRASSPTHLKSLPSSISSQHQLNSWIMQHPSALEMFERIIEASGGKQIVMFLD  124

Query  420  YDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSH  241
            YDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGSH
Sbjct  125  YDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGSH  184

Query  240  GMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLS  70
            GMDI GP KG   + +  Q++L QPA ++LPMI+EVYK LLEKTKS PG KVEN+KFC S
Sbjct  185  GMDIIGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYKQLLEKTKSTPGVKVENHKFCAS  244

Query  69   VHYRCVEEK  43
            VH+RCV+EK
Sbjct  245  VHFRCVDEK  253



>ref|XP_008646283.1| PREDICTED: probable trehalose-phosphate phosphatase 4 [Zea mays]
 gb|AFW73481.1| hypothetical protein ZEAMMB73_506380 [Zea mays]
Length=357

 Score =   246 bits (629),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 142/176 (81%), Gaps = 6/176 (3%)
 Frame = -2

Query  570  ESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVE  391
            ++MR SSPTR    + D   +W+  HPSA+  F+ I + SKGKK+VMFLDYDGTLSPIV 
Sbjct  59   DAMRASSPTRS--RAADEFTAWVRKHPSALGKFEQIASASKGKKVVMFLDYDGTLSPIVA  116

Query  390  DPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKG  211
            DPD A+M+  MR AVR+VAKHFPT+IVSGRCR KV NFV LS+LYYAGSHGMDIKGP+  
Sbjct  117  DPDAAYMSDAMRAAVRDVAKHFPTSIVSGRCRDKVRNFVALSELYYAGSHGMDIKGPS--  174

Query  210  NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
                 ++VLCQPA EFLP+++EVYK L+EKTKS PGAKVE+NKFCLSVH+RCV+EK
Sbjct  175  --SNPESVLCQPASEFLPVMDEVYKALVEKTKSTPGAKVEHNKFCLSVHFRCVDEK  228



>ref|XP_003576467.1| PREDICTED: probable trehalose-phosphate phosphatase 7 [Brachypodium 
distachyon]
Length=385

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 150/193 (78%), Gaps = 10/193 (5%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVM  430
            G +N L ESMR SSPT     +      +D + +WM  HPSA+  F++I+  SKGK+IVM
Sbjct  56   GLLNGLVESMRASSPTHAKAAAALAAGVDDEHAAWMARHPSALGKFEEIVAASKGKQIVM  115

Query  429  FLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYA  250
            FLDYDGTLSPIV+DP+ AFM+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYA
Sbjct  116  FLDYDGTLSPIVDDPEAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYA  175

Query  249  GSHGMDIKGPTK---GNLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            GSHGMDIKGP K   G+ K   + V+ QPA EFLPMIEEV++ L+E+T  VPGAKVENNK
Sbjct  176  GSHGMDIKGPAKSSCGHAKSKAKRVVFQPASEFLPMIEEVHQRLIEETSCVPGAKVENNK  235

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+EK
Sbjct  236  FCVSVHFRCVDEK  248



>ref|XP_009101850.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X1 [Brassica rapa]
Length=346

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 147/185 (79%), Gaps = 4/185 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLMKQSSWLTEHPSALDMFEEILHVSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAI+SGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIISGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGNLKGNQ--AVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G+   +Q  ++LCQPA EFLPMI+EVY+ L+EKT   PGA +ENNKFC+SVH+R
Sbjct  160  IKGPEQGSKYKDQDKSLLCQPATEFLPMIDEVYQKLVEKTNLTPGANIENNKFCVSVHFR  219

Query  57   CVEEK  43
             V+EK
Sbjct  220  RVDEK  224



>gb|EMT31501.1| Trehalose-phosphate phosphatase [Aegilops tauschii]
Length=305

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 142/181 (78%), Gaps = 2/181 (1%)
 Frame = -2

Query  582  NALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
             +L +SM+ SSP      +   ++ W+  HPSA+  F+ ++  ++GK+IVMFLDYDGTLS
Sbjct  3    GSLLDSMKASSPPPPMPPAGADHEEWIEKHPSALEWFEGVLAAAEGKQIVMFLDYDGTLS  62

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIVEDPD+A MT EMRDAVR VA+HFPTAIVSGRCR KV+NFVKL +LYYAGSHGMDIKG
Sbjct  63   PIVEDPDRAVMTEEMRDAVRGVAQHFPTAIVSGRCRDKVFNFVKLEELYYAGSHGMDIKG  122

Query  222  PTK-GNLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVE  49
            PTK  N K     VLCQPA EFLP+I+EVY+ L  K +S+PGA VENNKFCLSVH+RCVE
Sbjct  123  PTKVSNHKAKADEVLCQPATEFLPVIQEVYETLTAKMESIPGAMVENNKFCLSVHFRCVE  182

Query  48   E  46
            E
Sbjct  183  E  183



>ref|XP_002444320.1| hypothetical protein SORBIDRAFT_07g020100 [Sorghum bicolor]
 gb|EES13815.1| hypothetical protein SORBIDRAFT_07g020100 [Sorghum bicolor]
Length=376

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 143/187 (76%), Gaps = 11/187 (6%)
 Frame = -2

Query  570  ESMRDSSPTRRSFE-------SEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            ESMR SSPT             E+    WM+ HPSA+ MFD ++  SKGK+IV+FLDYDG
Sbjct  64   ESMRASSPTHARAAAALAAGVDEERYAEWMVKHPSALGMFDQVVAASKGKQIVVFLDYDG  123

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD A+M+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYAGSHGMD
Sbjct  124  TLSPIVDDPDAAYMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMD  183

Query  231  IKGPTKGNLKGNQA----VLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVH  64
            IKGP KG+     A    VL QPA +FLPMIE+V+  L+EKTK +PGAKVENNKFC+SVH
Sbjct  184  IKGPAKGSRHTKAAKAKGVLFQPASQFLPMIEQVHDSLVEKTKCIPGAKVENNKFCVSVH  243

Query  63   YRCVEEK  43
            +RCV+EK
Sbjct  244  FRCVDEK  250



>ref|XP_009387126.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 148/193 (77%), Gaps = 10/193 (5%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESE--------DVNKSWMLNHPSAISMFDDIMNFSKGKKI  436
            GRI A  ESM+ SSPT     +         D   +W++ HPSA++ F+ IM+ SKGK+I
Sbjct  49   GRIGAWVESMKASSPTHAKATAALPSGDAAVDEQSAWVVRHPSALNKFEQIMSASKGKQI  108

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMF+DYDGTLSPIV+DPD AFM+  MR+AVR+VA++FPTAIVSGRC  KV NFV+L+ LY
Sbjct  109  VMFMDYDGTLSPIVDDPDSAFMSDAMREAVRDVARYFPTAIVSGRCLDKVINFVRLADLY  168

Query  255  YAGSHGMDIKGPTKGNLKGNQA--VLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNK  82
            YAGSHGMDIKGPTK      +A  VL QPA EFLPMI+ V+K LLE+TKS PGA+VENNK
Sbjct  169  YAGSHGMDIKGPTKPRHDKARAKPVLFQPASEFLPMIDAVHKALLERTKSTPGARVENNK  228

Query  81   FCLSVHYRCVEEK  43
            FC+SVH+RCV+EK
Sbjct  229  FCVSVHFRCVDEK  241



>gb|EAZ42700.1| hypothetical protein OsJ_27268 [Oryza sativa Japonica Group]
Length=310

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 142/185 (77%), Gaps = 11/185 (6%)
 Frame = -2

Query  564  MRDSSPTRRSFES--------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
            MR SSPT     +        +D   +WM+ HPSA+S F+ I+  SKGKKIVMFLDYDGT
Sbjct  1    MRASSPTHAKAAAALAAAGAVDDERAAWMVRHPSALSKFEQIVAASKGKKIVMFLDYDGT  60

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV+DPD AFM+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYAGSHGMDI
Sbjct  61   LSPIVDDPDSAFMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMDI  120

Query  228  KGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            KGP K    N    + VL QPA EFLPMIE+V+  L+E+TK +PGAKVENNKFC+SVH+R
Sbjct  121  KGPAKASRHNKAKAKGVLFQPASEFLPMIEQVHDSLIERTKCIPGAKVENNKFCVSVHFR  180

Query  57   CVEEK  43
            CV+EK
Sbjct  181  CVDEK  185



>ref|XP_002868927.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45186.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=349

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 148/187 (79%), Gaps = 7/187 (4%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  42   GLINSWVDSMRACSPTH--LKSLLKQSSWLTEHPSALDMFEEILHLSEGKQIVMFLDYDG  99

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  100  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  159

Query  231  IKGPTKGN-----LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSV  67
            IKGP +G+        ++++LCQPA EFLPMI+EVYK L+EKTK  PGA+VENNKFC+SV
Sbjct  160  IKGPEQGSKFEEVRFDSKSLLCQPATEFLPMIDEVYKKLVEKTKFTPGAQVENNKFCVSV  219

Query  66   HYRCVEE  46
            H+R V+E
Sbjct  220  HFRRVDE  226



>ref|XP_009131141.1| PREDICTED: probable trehalose-phosphate phosphatase I [Brassica 
rapa]
Length=369

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 168/244 (69%), Gaps = 15/244 (6%)
 Frame = -2

Query  747  TRKMTNQNVVVSDPKSGVALIRVAVSEPALFPHAVAKPLPAGAGSFISIPRPG-RINALF  571
             R   +QNVVVS+  +  ++I    S P  F     K L       + I   G RINA  
Sbjct  10   NRMSESQNVVVSE--AARSIIPNNSSAPPGFISISKKKLLKN----LEIINDGERINAWV  63

Query  570  ESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTL  406
            +SMR SSPT       S  SE    SW++ HPSA+ MF+ I   S GK+IV+FLDYDGTL
Sbjct  64   DSMRASSPTHPKSLPSSISSEQQLSSWIMQHPSALEMFEKITEASGGKQIVIFLDYDGTL  123

Query  405  SPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIK  226
            SPIV+DPD+AFM+++MR  V+ +AK FPTAIV+GRC  KVY+FVKL++LYYAGSHGMDIK
Sbjct  124  SPIVDDPDRAFMSSKMRRTVKKLAKCFPTAIVTGRCLDKVYSFVKLAELYYAGSHGMDIK  183

Query  225  GPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            GP KG   + +  Q++L QPA ++LPMI+EVY+ LLEKTKS PG  VENNKFC SVH+RC
Sbjct  184  GPAKGFSRHKRVKQSLLYQPASDYLPMIDEVYRQLLEKTKSTPGVIVENNKFCASVHFRC  243

Query  54   VEEK  43
            V+EK
Sbjct  244  VDEK  247



>ref|XP_010491663.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X1 [Camelina sativa]
Length=378

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 147/190 (77%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  S+    SW++ HPSA+ MF+ I+  S GK+IVMFL
Sbjct  67   RINAWVDSMRASSPTHLKSLPSSISSQQQLNSWIMQHPSALEMFERIIEASGGKQIVMFL  126

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ + K FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  127  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLGKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  186

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDI GP KG   + +  Q++L QPA ++LPMI+EVYK LLEKTKS PG KVEN+KFC 
Sbjct  187  HGMDIIGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYKQLLEKTKSTPGVKVENHKFCA  246

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  247  SVHFRCVDEK  256



>ref|XP_008782128.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Phoenix 
dactylifera]
Length=383

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 148/197 (75%), Gaps = 15/197 (8%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFES----------EDVNKSWMLNHPSAISMFDDIMNFSKGK  442
            GR+NA  +SMR SSPT    +S          ++  ++W   HPSA+  FD+I   SKGK
Sbjct  61   GRLNAWVDSMRASSPTHIKSDSPLASPVVASDDEEYENWKKQHPSALDKFDEITAASKGK  120

Query  441  KIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQ  262
            +IVMFLDYDGTLSPIV+DPD+AFM+  MR AVR VA+ FPTAIVSGRCR KVY+FV+L +
Sbjct  121  QIVMFLDYDGTLSPIVDDPDRAFMSDNMRSAVREVARSFPTAIVSGRCRDKVYSFVQLRE  180

Query  261  LYYAGSHGMDIKGPTK----GNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKV  94
            LYYAGSHGMDIKGP K       K N A+L QPA EFLPMI+ VY+ L+EKT+S PGAKV
Sbjct  181  LYYAGSHGMDIKGPAKQPKHTKAKAN-ALLFQPASEFLPMIDAVYEALVEKTESTPGAKV  239

Query  93   ENNKFCLSVHYRCVEEK  43
            ENNKFC+SVH+RCV+EK
Sbjct  240  ENNKFCVSVHFRCVDEK  256



>ref|XP_009122088.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X1 [Brassica rapa]
Length=360

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 146/190 (77%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            R+NA  +SMR SSPT       S  SE    SW++ HPSA+ MF+ I   S GK+IVMFL
Sbjct  49   RVNAWVDSMRASSPTHLKSLPSSVSSEKHLSSWIMQHPSALEMFEKITQASGGKQIVMFL  108

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  109  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  168

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP KG   + +  Q++L QPA ++LPMI+EVYK LLEKTKS PG  VEN+KF  
Sbjct  169  HGMDIKGPAKGFSRHKRVKQSLLYQPASDYLPMIDEVYKQLLEKTKSTPGVIVENHKFTA  228

Query  72   SVHYRCVEEK  43
            SVH+RCVEEK
Sbjct  229  SVHFRCVEEK  238



>ref|XP_010453031.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X2 [Camelina sativa]
Length=378

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 148/190 (78%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            RINA  +SMR SSPT       S  S+    SW++ HPSA+ MFD I+  S GK+IVMFL
Sbjct  67   RINAWVDSMRASSPTHLKSLPSSISSQHQLNSWIMQHPSALEMFDRIIEASGGKQIVMFL  126

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  K+YNFVKL++LYYAGS
Sbjct  127  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKLYNFVKLAELYYAGS  186

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDI GP KG   + +  Q++L QPA ++LPMI+EV+K LLEKTKS PG KVEN+KFC 
Sbjct  187  HGMDIIGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVHKQLLEKTKSTPGVKVENHKFCA  246

Query  72   SVHYRCVEEK  43
            SVH+RCV+EK
Sbjct  247  SVHFRCVDEK  256



>gb|AAZ67593.1| 80A08_8 [Brassica rapa subsp. pekinensis]
Length=365

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 146/190 (77%), Gaps = 8/190 (4%)
 Frame = -2

Query  588  RINALFESMRDSSPTR-----RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFL  424
            R+NA  +SMR SSPT       S  SE    SW++ HPSA+ MF+ I   S GK+IVMFL
Sbjct  49   RVNAWVDSMRASSPTHLKSLPSSVSSEKHLSSWIMQHPSALEMFEKITQASGGKQIVMFL  108

Query  423  DYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGS  244
            DYDGTLSPIV+DPDKAFM+++MR  V+ +AK FPTAIV+GRC  KVYNFVKL++LYYAGS
Sbjct  109  DYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGS  168

Query  243  HGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCL  73
            HGMDIKGP KG   + +  Q++L QPA ++LPMI+EVYK LLEKTKS PG  VEN+KF  
Sbjct  169  HGMDIKGPAKGFSRHKRVKQSLLYQPASDYLPMIDEVYKQLLEKTKSTPGVIVENHKFTA  228

Query  72   SVHYRCVEEK  43
            SVH+RCVEEK
Sbjct  229  SVHFRCVEEK  238



>ref|XP_008445345.1| PREDICTED: probable trehalose-phosphate phosphatase D isoform 
X1 [Cucumis melo]
Length=370

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 139/178 (78%), Gaps = 4/178 (2%)
 Frame = -2

Query  564  MRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDP  385
            MR SSPTR +         W+   PSA++MFD I   SKGK+IVMFLDYDGTLSPIVEDP
Sbjct  63   MRASSPTRLNSPISVSQSPWIFQLPSALNMFDQITTASKGKQIVMFLDYDGTLSPIVEDP  122

Query  384  DKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKG--  211
            D+AFMT EMR AV+N+A  FPTAIV+GR R KVY FV+L +L+YAGSHGMDI+GPTKG  
Sbjct  123  DRAFMTNEMRAAVKNIATCFPTAIVTGRRRDKVYEFVRLGELFYAGSHGMDIQGPTKGYN  182

Query  210  --NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
                KGN+AVL QPA E LPMIEEV+K L E TKS+ GAKVENNKFC+SVH+RCV+EK
Sbjct  183  NKYKKGNEAVLFQPASELLPMIEEVHKTLSEITKSINGAKVENNKFCISVHFRCVDEK  240



>gb|KFK44322.1| hypothetical protein AALP_AA1G243200 [Arabis alpina]
Length=317

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 149/191 (78%), Gaps = 9/191 (5%)
 Frame = -2

Query  591  GRINALFESMRDSSPTR-RSFESEDV--NK-----SWMLNHPSAISMFDDIMNFSKGKKI  436
            G+I  L ES+RD SPTR RS  S+D   NK     SW+  HPSA+  FD IMN +KGK+I
Sbjct  5    GKIERLVESLRDLSPTRVRSSPSDDYVSNKDGKRSSWIALHPSALDTFDKIMNDAKGKEI  64

Query  435  VMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLY  256
            VMFLDYDGTLS I EDPD+A++T EMR+ V+ VAKHF TAIVSGR   KV +FVKL+ ++
Sbjct  65   VMFLDYDGTLSLITEDPDRAYITDEMREVVKEVAKHFKTAIVSGRSTDKVQSFVKLTGIH  124

Query  255  YAGSHGMDIKGPTKGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFC  76
            YAGSHGMDIKGPTK + K  Q V+ QPAR++LPMI+EV K+L EKTKS+PGA VE+NKFC
Sbjct  125  YAGSHGMDIKGPTKAD-KSTQQVMFQPARDYLPMIDEVVKILREKTKSIPGASVEHNKFC  183

Query  75   LSVHYRCVEEK  43
            LSVH+R V+EK
Sbjct  184  LSVHFRRVDEK  194



>gb|EMT08049.1| Trehalose-phosphate phosphatase [Aegilops tauschii]
Length=358

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 2/181 (1%)
 Frame = -2

Query  582  NALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
             +L +S++ SSP      +    + W+ NHPSA+  F+ ++  ++GK+IVMFLDYDGTLS
Sbjct  56   GSLLDSVKGSSPRHAMSPTGADQEEWIENHPSALEWFEGVLAAAEGKQIVMFLDYDGTLS  115

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIVEDPD+A MT EMR+AVR VA+HFPTAIVSGRCR KV+NFVKL +LYYAGSHGMDIKG
Sbjct  116  PIVEDPDRAVMTEEMREAVRGVAQHFPTAIVSGRCRDKVFNFVKLEELYYAGSHGMDIKG  175

Query  222  PTK-GNLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVE  49
            PTK  N K     VLCQPA +FLP+I++VYK L  K +S+PGA VENNKFCLSVH+RCVE
Sbjct  176  PTKVSNHKAKADEVLCQPATKFLPVIQKVYKTLTAKMESIPGAMVENNKFCLSVHFRCVE  235

Query  48   E  46
            E
Sbjct  236  E  236



>gb|KFK23771.1| hypothetical protein AALP_AAs53909U000100, partial [Arabis alpina]
Length=354

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 168/250 (67%), Gaps = 28/250 (11%)
 Frame = -2

Query  738  MTNQNVVVSDPKSGVAL-IRVAVSEPALFPHAVAKPLPAGAGSFISIPRPGR--------  586
            MTN N ++SD K  + + +RV VS  +LF          G G +ISIPR           
Sbjct  1    MTNHNALISDAKGSLGVAVRVPVSNQSLFS--------PGGGRYISIPRKKLVQKLEAEP  52

Query  585  INALFESMRDSSPTRR---------SFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIV  433
            IN   E+MR SSPTR             S++ + SWM  HPSA+SMF++I+  SKGK+IV
Sbjct  53   INTWIEAMRASSPTRTRPGNISSLPDSSSDEEDSSWMAQHPSALSMFEEIVEGSKGKQIV  112

Query  432  MFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYY  253
            MFLDYDGTLSPIVE+PD A+MT EMR+AV+ VA++FPTAIV+GRC  KV  FVKL  LYY
Sbjct  113  MFLDYDGTLSPIVENPDHAYMTEEMREAVKGVARYFPTAIVTGRCLDKVRRFVKLPGLYY  172

Query  252  AGSHGMDIKGPT--KGNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKF  79
            AGSHGMDIKGP+    + K N+ VL Q A EFLPMI++V K L+EK   V GA VENNKF
Sbjct  173  AGSHGMDIKGPSKKTKHNKNNKGVLFQAANEFLPMIDQVTKRLVEKMGEVKGASVENNKF  232

Query  78   CLSVHYRCVE  49
            C+SVHYRCV+
Sbjct  233  CVSVHYRCVD  242



>ref|XP_010916894.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Elaeis 
guineensis]
Length=384

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 145/198 (73%), Gaps = 16/198 (8%)
 Frame = -2

Query  591  GRINALFESMRDSSPTR------------RSFESEDVNKSWMLNHPSAISMFDDIMNFSK  448
            GRINA  +SM+ SSPT              S + E+   S M   PSA+ MFD+I   SK
Sbjct  60   GRINAWVDSMKASSPTHIKSSSLLVSPIAASHDDEEYENS-MKQQPSALKMFDEITAASK  118

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GK+IVMFLDYDGTLSPIV+DPD+AFM+  MR AVR VA+ FPTAIVSGRCR KVYNFV+L
Sbjct  119  GKQIVMFLDYDGTLSPIVDDPDRAFMSENMRSAVREVARRFPTAIVSGRCRDKVYNFVQL  178

Query  267  SQLYYAGSHGMDIKGPTKG---NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAK  97
            ++LYYAGSHGMDI+GP K         +AVL QPA EFLPMI+ VYK L+ KT+S PGA+
Sbjct  179  AELYYAGSHGMDIEGPAKQPKYTKAKAKAVLFQPASEFLPMIDAVYKALVTKTESTPGAR  238

Query  96   VENNKFCLSVHYRCVEEK  43
            VENNKFC SVHYRCV+EK
Sbjct  239  VENNKFCASVHYRCVDEK  256



>ref|XP_004956679.1| PREDICTED: probable trehalose-phosphate phosphatase 7-like [Setaria 
italica]
Length=380

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 10/187 (5%)
 Frame = -2

Query  570  ESMRDSSPTRRSFES------EDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGT  409
            ESMR SSPT     +      +D   +WM+ HPSA+  F+ I+  S+GK+IVMFLDYDGT
Sbjct  66   ESMRASSPTHAKAAAALAAGVDDERAAWMVRHPSALGKFEQIVAASEGKRIVMFLDYDGT  125

Query  408  LSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDI  229
            LSPIV+DPD AFM+  MR AVR+VAKHFPTAIVSGRCR KV+ FVKL++LYYAGSHGMDI
Sbjct  126  LSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMDI  185

Query  228  KGPTKGNLKGNQA----VLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            KGP K + +  +A    VL QPA EFLPMIEEV++ L E T+ +PGAKVENNKFC+SVH+
Sbjct  186  KGPAKASSRHAKAKAKGVLFQPASEFLPMIEEVHERLAETTRCIPGAKVENNKFCVSVHF  245

Query  60   RCVEEKV  40
            RCV+EK+
Sbjct  246  RCVDEKM  252



>ref|XP_006404674.1| hypothetical protein EUTSA_v10000217mg [Eutrema salsugineum]
 gb|ESQ46127.1| hypothetical protein EUTSA_v10000217mg [Eutrema salsugineum]
Length=354

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 149/185 (81%), Gaps = 6/185 (3%)
 Frame = -2

Query  591  GRINALFESMRDSSPTR-RSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYD  415
            G I +  +SMR  SPT   SF ++     W+  HPSA++MF++I++ S+GK+IVMFLDYD
Sbjct  50   GLIRSWVDSMRACSPTHLNSFNNQSC---WIEEHPSALNMFEEIVHESEGKQIVMFLDYD  106

Query  414  GTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGM  235
            GTLSPIV+DPD+AFM+ +MR+ V+ +A  FPTAIVSGR R KVY FVKL++LYYAGSHGM
Sbjct  107  GTLSPIVDDPDRAFMSKKMRNTVKKLAMCFPTAIVSGRSREKVYGFVKLTELYYAGSHGM  166

Query  234  DIKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHY  61
            DIKGP KG+   K N+++LCQPA EFLP+I EVYK L+EKTKS+PGAKVENNKFC  VH+
Sbjct  167  DIKGPEKGSKYQKKNRSLLCQPATEFLPVITEVYKNLVEKTKSIPGAKVENNKFCACVHF  226

Query  60   RCVEE  46
            RCV+E
Sbjct  227  RCVDE  231



>ref|XP_004150660.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 ref|XP_004170683.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 gb|KGN62169.1| hypothetical protein Csa_2G307340 [Cucumis sativus]
Length=370

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 138/178 (78%), Gaps = 4/178 (2%)
 Frame = -2

Query  564  MRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDP  385
            MR SSPTR +         W+   PSA++MFD I   SKGK+IVMFLDYDGTLSPIVEDP
Sbjct  63   MRASSPTRLNSHISVSQSPWIFQLPSALNMFDQITTASKGKQIVMFLDYDGTLSPIVEDP  122

Query  384  DKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKG--  211
            D+AFMT EMR AV+N+A  FPTAIV+GR R KVY FV L +L+YAGSHGMDI+GPTKG  
Sbjct  123  DRAFMTNEMRAAVKNIATCFPTAIVTGRRRDKVYEFVGLGELFYAGSHGMDIQGPTKGYN  182

Query  210  --NLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
                KGN+AVL QPA E LPMI+EV+K L E TKS+ GAKVENNKFC+SVH+RCV+EK
Sbjct  183  NKYKKGNEAVLFQPASELLPMIDEVHKTLSEITKSINGAKVENNKFCISVHFRCVDEK  240



>gb|EPS68990.1| hypothetical protein M569_05778, partial [Genlisea aurea]
Length=289

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 2/152 (1%)
 Frame = -2

Query  492  PSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAI  313
            PSA+ MFD I N SKGK+IVMFLDYDGTLSPIVEDPD+AFM+  MR  VR +A++FPTAI
Sbjct  1    PSALDMFDQITNASKGKQIVMFLDYDGTLSPIVEDPDQAFMSESMRATVRKLARYFPTAI  60

Query  312  VSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTKG--NLKGNQAVLCQPAREFLPMIEEVY  139
            VSGRCR KVYNFV+L++LYYAGSHGMDIKGP+KG  N K  Q VL QPA E+LPMI++VY
Sbjct  61   VSGRCRDKVYNFVRLAELYYAGSHGMDIKGPSKGYKNKKETQGVLFQPASEYLPMIDQVY  120

Query  138  KVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
              LLE  KS PGAKVENNKFC+SVH+RCV+EK
Sbjct  121  NALLEVVKSTPGAKVENNKFCVSVHFRCVDEK  152



>emb|CDY39454.1| BnaC03g60640D [Brassica napus]
Length=241

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 144/184 (78%), Gaps = 3/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G +N+   SMR  SPT    +S     SW+  HP A+ MF++I++ S+GK+IVMFLDYDG
Sbjct  31   GLVNSWVNSMRACSPTH--LKSLMKQSSWLTEHPPALDMFEEILHVSEGKQIVMFLDYDG  88

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV++PD+AFM+ +MR  +R +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  89   TLSPIVDNPDRAFMSKKMRRTLRKLAICFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  148

Query  231  IKGPTKGN-LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRC  55
            IKGP +G+  K  +++LCQPA EFL MI+EVY+ L+EKTK  PGA VENNKFC SVH+R 
Sbjct  149  IKGPAQGSKYKEGKSLLCQPATEFLAMIDEVYQKLVEKTKVTPGANVENNKFCASVHFRR  208

Query  54   VEEK  43
            V+EK
Sbjct  209  VDEK  212



>gb|EMT24321.1| Trehalose-phosphate phosphatase [Aegilops tauschii]
Length=314

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 142/181 (78%), Gaps = 2/181 (1%)
 Frame = -2

Query  582  NALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
             +L +SM+ SSP      +   ++ W+  HPSA+  F+ ++  ++GK+IVMFLDYDGTLS
Sbjct  12   GSLLDSMKASSPRHAMSPAGADHEEWIEKHPSALEWFEGVLAAAEGKQIVMFLDYDGTLS  71

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIV+DPD+A MT EMRDAVR VA+HFPTAIVSGRCR KV++FVKL +LYYAGSHGMDIKG
Sbjct  72   PIVQDPDRAVMTEEMRDAVRGVAQHFPTAIVSGRCRDKVFSFVKLEELYYAGSHGMDIKG  131

Query  222  PTK-GNLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVE  49
            PTK  N K     VLCQPA EFLP+I+EV++ L  K +S+PGA VENNKFCLSVH+RCVE
Sbjct  132  PTKVSNHKAKADEVLCQPATEFLPVIQEVHEKLTAKMESIPGAMVENNKFCLSVHFRCVE  191

Query  48   E  46
            E
Sbjct  192  E  192



>gb|KHN06593.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=294

 Score =   239 bits (611),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 6/180 (3%)
 Frame = -2

Query  564  MRDSSPTRRSFESE--DVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLSPIVE  391
            MR SSPT     S   + + +W+L HPSA+ MF+ IM+ S+GK+IVMFLDYDGTLSPIV+
Sbjct  1    MRSSSPTNSKSTSSLAEEHSTWILRHPSALDMFEQIMDASRGKQIVMFLDYDGTLSPIVD  60

Query  390  DPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKGPTK-  214
            DPD+AFM+  MR  VR +A+ FPTAIV+GRC+ KVYNFV+L++LYYAGSHGMDI+GPT+ 
Sbjct  61   DPDRAFMSDSMRRTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIQGPTRT  120

Query  213  ---GNLKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVEEK  43
                N    + VL QPA EFLPMI+EVY  L+EK KS+PGA VENNKFC SVH+RCV+EK
Sbjct  121  SKYSNKDKGEPVLFQPASEFLPMIDEVYHQLVEKMKSIPGAMVENNKFCCSVHFRCVDEK  180



>dbj|BAJ98055.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 139/181 (77%), Gaps = 2/181 (1%)
 Frame = -2

Query  582  NALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDGTLS  403
             +L E+M+ SSP          ++ W+ NHPSA+  F+ ++  ++GK+IVMFLDYDGTLS
Sbjct  56   GSLLETMKASSPRHAMSAVGADHEEWIENHPSALEWFEGVLAAAEGKQIVMFLDYDGTLS  115

Query  402  PIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMDIKG  223
            PIV+DPD A MT EMRDAVR VA+HFPTAIVSGRCR KV+NFVKL +LYYAGSHGMDIKG
Sbjct  116  PIVKDPDSAVMTEEMRDAVRGVAQHFPTAIVSGRCRDKVFNFVKLEELYYAGSHGMDIKG  175

Query  222  PTK-GNLKGN-QAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYRCVE  49
            PTK  N K     +LCQPA EFLP+I+EVYK L  K KS+ GA VENNKFCLSVH+R VE
Sbjct  176  PTKVSNHKAKADEILCQPATEFLPVIQEVYKTLTAKMKSIHGAMVENNKFCLSVHFRNVE  235

Query  48   E  46
            E
Sbjct  236  E  236



>ref|XP_006286088.1| hypothetical protein CARUB_v10007631mg [Capsella rubella]
 gb|EOA18986.1| hypothetical protein CARUB_v10007631mg [Capsella rubella]
Length=347

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+  +SMR  SPT    +S     SW+  HPSA+ MF++I+  S+GK+IVMFLDYDG
Sbjct  43   GLINSWVDSMRACSPTH--LKSLLKQSSWLTEHPSALDMFEEILLLSEGKQIVMFLDYDG  100

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  VR +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  101  TLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  160

Query  231  IKGPTKGNL--KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G+   + ++++LCQPA EFLPMI+EVY+ L++KTK   GA+VENNKFC+SVH+R
Sbjct  161  IKGPEQGSKYEEDSKSLLCQPATEFLPMIDEVYQKLVQKTKLTSGAQVENNKFCVSVHFR  220

Query  57   CVEE  46
             V E
Sbjct  221  RVNE  224



>gb|KFK30542.1| hypothetical protein AALP_AA7G275800 [Arabis alpina]
Length=347

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 150/184 (82%), Gaps = 4/184 (2%)
 Frame = -2

Query  591  GRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSKGKKIVMFLDYDG  412
            G IN+L +SMR  SPT    +S     SW+  +PSA+ MF++I++ S+GK+IVMFLDYDG
Sbjct  43   GLINSLVDSMRACSPTH--LKSLMKQTSWLTEYPSALDMFEEILHASQGKQIVMFLDYDG  100

Query  411  TLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKLSQLYYAGSHGMD  232
            TLSPIV+DPD+AFM+ +MR  V+ +A  FPTAIVSGRCR KVYNFVKL++LYYAGSHGMD
Sbjct  101  TLSPIVDDPDRAFMSRKMRRTVKKLANCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMD  160

Query  231  IKGPTKGN--LKGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAKVENNKFCLSVHYR  58
            IKGP +G+  ++ ++++LCQPA EFLPMI+EV + L+++TK  PGAKVENNKFC+SVH+R
Sbjct  161  IKGPEQGSIYMEDSKSLLCQPATEFLPMIDEVCQKLIKQTKLTPGAKVENNKFCVSVHFR  220

Query  57   CVEE  46
             V+E
Sbjct  221  RVDE  224



>gb|KCW68839.1| hypothetical protein EUGRSUZ_F02439, partial [Eucalyptus grandis]
Length=373

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 149/198 (75%), Gaps = 21/198 (11%)
 Frame = -2

Query  627  AGAGSFISIPRPGRINALFESMRDSSPTRRSFESEDVNKSWMLNHPSAISMFDDIMNFSK  448
             G G F+      + +A  +SMRDSSPTR             ++HPSA+  F+ + N +K
Sbjct  52   GGEGDFVV-----KNHAWVDSMRDSSPTR-------------VHHPSALKTFELVTNAAK  93

Query  447  GKKIVMFLDYDGTLSPIVEDPDKAFMTTEMRDAVRNVAKHFPTAIVSGRCRAKVYNFVKL  268
            GK+IV+FLDYDGTLSPIVEDPD+AFM+++MR+AV+  A+HFPTAI+SGR R KVY+FVKL
Sbjct  94   GKEIVIFLDYDGTLSPIVEDPDRAFMSSQMREAVKEAARHFPTAIISGRSRDKVYDFVKL  153

Query  267  SQLYYAGSHGMDIKGPTKGNL---KGNQAVLCQPAREFLPMIEEVYKVLLEKTKSVPGAK  97
             +LYYAGSHGMDI+GP+K      KG++ V  QPA EFLPMI EVY+ LL +TKS+PGAK
Sbjct  154  PELYYAGSHGMDIRGPSKSQRKCKKGDEGVPFQPASEFLPMINEVYRALLNRTKSIPGAK  213

Query  96   VENNKFCLSVHYRCVEEK  43
            VENNKFCLSVHYR V+EK
Sbjct  214  VENNKFCLSVHYRNVDEK  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1676318729358