BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c13989_g2_i1 len=1778 path=[6386:0-472 2151:473-498 2177:499-1777]

Length=1778
                                                                      Score     E

ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              485   4e-163   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              483   5e-162   
ref|XP_010112093.1|  putative pectate lyase 7                           476   1e-159   
gb|EPS66620.1|  hypothetical protein M569_08154                         473   5e-158   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      471   1e-157   
emb|CDP02199.1|  unnamed protein product                                467   2e-157   
ref|XP_002282500.3|  PREDICTED: pectate lyase                           470   4e-157   Vitis vinifera
emb|CAN79927.1|  hypothetical protein VITISV_042447                     469   5e-157   Vitis vinifera
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              470   5e-157   
emb|CBI22159.3|  unnamed protein product                                470   6e-157   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    469   7e-157   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      468   1e-156   Vitis vinifera
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         468   3e-156   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      466   1e-155   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              466   1e-155   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      466   2e-155   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    466   2e-155   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      465   5e-155   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      465   6e-155   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              464   8e-155   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              464   1e-154   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     464   1e-154   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              463   2e-154   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           462   3e-154   
ref|XP_007046218.1|  Pectate lyase family protein, putative             462   5e-154   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              462   5e-154   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              462   6e-154   
gb|KHG08055.1|  putative pectate lyase P59                              462   6e-154   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              460   2e-153   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  460   3e-153   Ricinus communis
ref|XP_010242445.1|  PREDICTED: pectate lyase                           459   7e-153   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         458   1e-152   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      458   2e-152   
emb|CDP14850.1|  unnamed protein product                                458   2e-152   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      457   3e-152   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         458   3e-152   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      457   4e-152   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                457   6e-152   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         456   8e-152   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             456   1e-151   
ref|XP_002311599.2|  pectate lyase family protein                       455   2e-151   Populus trichocarpa [western balsam poplar]
ref|XP_008230729.1|  PREDICTED: pectate lyase                           455   3e-151   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           455   3e-151   Vitis vinifera
ref|XP_007032453.1|  Pectate lyase family protein                       455   4e-151   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                454   9e-151   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      452   3e-150   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         452   4e-150   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              452   7e-150   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    451   2e-149   Solanum lycopersicum
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             449   3e-149   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      449   8e-149   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              448   2e-148   
ref|XP_010105747.1|  putative pectate lyase P59                         447   2e-148   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               447   4e-148   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    447   7e-148   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      446   1e-147   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             445   2e-147   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           443   2e-147   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      444   2e-147   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    444   3e-147   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         445   3e-147   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                445   5e-147   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              444   5e-147   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       444   5e-147   
emb|CDY68729.1|  BnaCnng60280D                                          444   7e-147   
emb|CDP02198.1|  unnamed protein product                                445   7e-147   
gb|KHN08855.1|  Putative pectate lyase P59                              443   7e-147   
emb|CDX96854.1|  BnaA08g23970D                                          444   7e-147   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           442   1e-146   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      442   2e-146   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             443   3e-146   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    442   3e-146   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      442   3e-146   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              441   5e-146   
gb|KHN13652.1|  Pectate lyase                                           441   5e-146   
gb|KEH24975.1|  pectate lyase P59-like protein                          442   6e-146   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              441   7e-146   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             441   8e-146   Populus trichocarpa [western balsam poplar]
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                441   1e-145   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                441   1e-145   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             441   1e-145   
ref|XP_002875142.1|  pectate lyase family protein                       441   1e-145   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      440   2e-145   
emb|CAN77957.1|  hypothetical protein VITISV_021245                     439   2e-145   Vitis vinifera
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      439   2e-145   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             440   2e-145   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      440   2e-145   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                440   3e-145   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                440   3e-145   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      440   3e-145   
ref|XP_007037229.1|  Pectate lyase family protein                       439   3e-145   
ref|NP_197015.4|  putative pectate lyase 19                             440   4e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                440   4e-145   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                440   4e-145   
gb|AES91206.2|  pectate lyase P59-like protein                          439   4e-145   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      439   5e-145   
gb|ABK28696.1|  unknown                                                 440   5e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      438   7e-145   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      439   7e-145   
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      439   8e-145   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      438   8e-145   
emb|CAN69904.1|  hypothetical protein VITISV_001006                     438   8e-145   Vitis vinifera
ref|XP_003543726.1|  PREDICTED: pectate lyase                           438   9e-145   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           438   9e-145   Vitis vinifera
gb|AAA86241.1|  pectate lyase homolog                                   438   1e-144   Medicago sativa [alfalfa]
ref|NP_178375.1|  putative pectate lyase 6                              439   1e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                438   1e-144   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         437   1e-144   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     439   1e-144   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             437   2e-144   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      437   2e-144   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                437   2e-144   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                438   2e-144   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                437   3e-144   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             437   3e-144   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           437   4e-144   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         436   4e-144   
gb|ACU23277.1|  unknown                                                 436   5e-144   Glycine max [soybeans]
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    436   5e-144   
emb|CDY45254.1|  BnaA06g09240D                                          437   6e-144   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    436   6e-144   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             436   7e-144   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              436   1e-143   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           436   1e-143   
ref|XP_003621115.1|  Pectate lyase                                      435   2e-143   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          435   2e-143   
emb|CDY39314.1|  BnaC05g10650D                                          435   3e-143   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                434   4e-143   
emb|CDY41679.1|  BnaC02g34750D                                          434   5e-143   
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      434   6e-143   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      431   9e-143   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                434   1e-142   
emb|CDY53552.1|  BnaA09g57110D                                          435   1e-142   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           433   1e-142   
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                433   1e-142   
emb|CDY09356.1|  BnaA02g26540D                                          433   2e-142   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                432   2e-142   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                433   3e-142   
ref|NP_172894.1|  putative pectate lyase 3                              432   3e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609009.1|  Pectate lyase                                      431   5e-142   
ref|XP_002871648.1|  pectate lyase family protein                       432   6e-142   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      430   8e-142   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          431   9e-142   Sorghum bicolor [broomcorn]
emb|CDX81636.1|  BnaC08g39650D                                          432   9e-142   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             431   1e-141   Populus trichocarpa [western balsam poplar]
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                432   1e-141   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      429   1e-141   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    431   1e-141   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    431   1e-141   
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      430   2e-141   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               430   2e-141   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              429   2e-141   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           429   3e-141   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      427   3e-141   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      429   3e-141   
emb|CDY04133.1|  BnaA09g19110D                                          429   4e-141   
gb|AAB69759.1|  putative pectate lyase                                  429   4e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                429   5e-141   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      426   6e-141   
emb|CDX70590.1|  BnaC03g06740D                                          429   8e-141   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      427   2e-140   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    428   2e-140   Arabidopsis thaliana [mouse-ear cress]
gb|KHN13240.1|  Putative pectate lyase 3                                427   2e-140   
ref|NP_186776.1|  putative pectate lyase 7                              428   3e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      425   4e-140   
gb|EPS62426.1|  hypothetical protein M569_12361                         425   4e-140   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               427   4e-140   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      424   5e-140   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              424   6e-140   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             426   7e-140   
gb|AAM60924.1|  putative pectate lyase                                  427   9e-140   Arabidopsis thaliana [mouse-ear cress]
gb|KHG05193.1|  hypothetical protein F383_30875                         423   1e-139   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             425   1e-139   
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             425   1e-139   Elaeis guineensis
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               427   1e-139   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          425   1e-139   
emb|CDY66593.1|  BnaCnng51570D                                          427   1e-139   
gb|KHG16093.1|  hypothetical protein F383_07683                         425   2e-139   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      425   2e-139   
emb|CDX85564.1|  BnaA02g02490D                                          426   2e-139   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         424   3e-139   
emb|CDX74293.1|  BnaA03g27540D                                          425   4e-139   
emb|CDX91953.1|  BnaC03g32550D                                          425   5e-139   
emb|CDY17432.1|  BnaC09g21050D                                          424   6e-139   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      423   8e-139   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      422   1e-138   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    419   2e-138   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    424   2e-138   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             422   2e-138   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               423   4e-138   
gb|KHG23093.1|  hypothetical protein F383_29772                         419   6e-138   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   421   6e-138   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              419   9e-138   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         420   1e-137   
gb|KHN13490.1|  Putative pectate lyase 3                                417   1e-137   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             419   2e-137   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      420   2e-137   
ref|XP_002511525.1|  Pectate lyase precursor, putative                  419   2e-137   Ricinus communis
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               421   2e-137   
ref|XP_010683248.1|  PREDICTED: pectate lyase-like                      419   3e-137   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                420   4e-137   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         417   5e-137   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      418   7e-137   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      419   8e-137   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             417   9e-137   
ref|XP_009599824.1|  PREDICTED: pectate lyase                           416   1e-136   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               419   1e-136   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          417   1e-136   Sorghum bicolor [broomcorn]
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    419   3e-136   
ref|XP_003613595.1|  Pectate lyase                                      416   5e-136   
ref|XP_008679844.1|  PREDICTED: pectate lyase                           416   6e-136   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      416   1e-135   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          414   1e-135   
dbj|BAK06965.1|  predicted protein                                      414   3e-135   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      414   4e-135   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          413   5e-135   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           413   6e-135   
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                413   7e-135   
gb|ACF87417.1|  unknown                                                 413   7e-135   Zea mays [maize]
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             412   9e-135   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    414   1e-134   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   412   1e-134   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      412   1e-134   
gb|KHN01171.1|  Putative pectate lyase 3                                412   1e-134   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      412   2e-134   
gb|AFW87059.1|  pectate lyase                                           411   4e-134   
ref|NP_001150723.1|  pectate lyase precursor                            411   5e-134   Zea mays [maize]
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    410   6e-134   
gb|AAA16476.1|  pectate lyase homolog                                   409   1e-133   Zea mays [maize]
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     418   2e-133   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          410   3e-133   
emb|CDP00293.1|  unnamed protein product                                409   3e-133   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               409   4e-133   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             408   5e-133   
ref|XP_002882189.1|  pectate lyase family protein                       409   9e-133   
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                408   9e-133   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             406   1e-132   
emb|CDY45202.1|  BnaA06g34060D                                          408   1e-132   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      407   1e-132   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      407   1e-132   
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             407   2e-132   Elaeis guineensis
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      408   2e-132   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         405   2e-132   
gb|KHG07401.1|  putative pectate lyase P59                              406   3e-132   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             409   3e-132   
dbj|BAH20311.1|  AT3G01270                                              403   3e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16687.1|  pectate lyase                                           406   4e-132   
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       405   4e-132   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           406   5e-132   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           405   8e-132   
gb|KHN08706.1|  Putative pectate lyase 3                                405   1e-131   
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             405   1e-131   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      405   1e-131   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             405   1e-131   
emb|CDY28691.1|  BnaCnng05770D                                          404   5e-131   
ref|XP_003613596.1|  Pectate lyase                                      403   5e-131   
gb|KEH19822.1|  pectate lyase-like protein                              403   6e-131   
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      403   6e-131   
ref|XP_011087066.1|  PREDICTED: pectate lyase                           402   8e-131   
emb|CDY63769.1|  BnaCnng42620D                                          403   1e-130   
ref|XP_010096345.1|  putative pectate lyase 7                           400   1e-130   
emb|CDY03043.1|  BnaC07g21840D                                          402   2e-130   
dbj|BAK05605.1|  predicted protein                                      401   2e-130   
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               402   2e-130   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          401   3e-130   Sorghum bicolor [broomcorn]
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    402   4e-130   
ref|NP_001057945.1|  Os06g0583900                                       400   6e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           400   6e-130   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    402   9e-130   
ref|NP_001046281.1|  Os02g0214400                                       400   9e-130   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99626.1|  hypothetical protein OsI_21605                          400   1e-129   Oryza sativa Indica Group [Indian rice]
gb|EAY85003.1|  hypothetical protein OsI_06363                          399   3e-129   Oryza sativa Indica Group [Indian rice]
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                398   4e-129   
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         397   1e-128   
gb|KHN45481.1|  Putative pectate lyase 3                                394   2e-128   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   394   2e-128   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    394   1e-127   Lilium longiflorum [Easter lily]
dbj|BAD68402.1|  putative pectate lyase homolog                         393   4e-127   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056781.1|  Os06g0144200                                       393   4e-127   Oryza sativa Japonica Group [Japonica rice]
gb|EPS73633.1|  hypothetical protein M569_01123                         392   8e-127   
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      391   2e-126   
ref|NP_001056784.1|  Os06g0144900                                       389   2e-125   
gb|EAY99621.1|  hypothetical protein OsI_21600                          389   3e-125   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      386   2e-124   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                384   4e-124   
gb|EMS45831.1|  Pectate lyase                                           388   5e-124   
emb|CDX92652.1|  BnaC07g39100D                                          384   5e-124   
gb|KHG08946.1|  Pectate lyase                                           384   6e-124   
emb|CDY11033.1|  BnaA03g46920D                                          384   6e-124   
emb|CDY56220.1|  BnaAnng14170D                                          382   2e-123   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     381   5e-123   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                381   6e-123   
emb|CDY01846.1|  BnaC06g28860D                                          380   2e-122   
ref|XP_009137472.1|  PREDICTED: probable pectate lyase 18               380   2e-122   
ref|XP_002887143.1|  pectate lyase family protein                       380   2e-122   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                379   4e-122   
dbj|BAI94495.1|  pectate lyase                                          379   4e-122   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                378   6e-122   
ref|NP_564906.1|  putative pectate lyase 5                              378   8e-122   
gb|AAG28907.1|AC008113_23  F12A21.12                                    377   1e-121   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               377   2e-121   
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      375   2e-121   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               377   3e-121   
ref|XP_003608909.1|  Pectate lyase                                      377   3e-121   
ref|NP_001056786.1|  Os06g0145100                                       374   3e-121   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    376   3e-121   
gb|AAM67091.1|  putative pectate lyase                                  376   3e-121   
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      377   4e-121   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             376   5e-121   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      377   6e-121   
ref|XP_010102919.1|  hypothetical protein L484_018936                   376   7e-121   
ref|NP_001150425.1|  LOC100284055 precursor                             377   9e-121   
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                375   1e-120   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                375   1e-120   
emb|CDY03419.1|  BnaC01g16630D                                          374   2e-120   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                374   2e-120   
gb|AFK44189.1|  unknown                                                 374   2e-120   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          376   2e-120   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           374   2e-120   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     373   5e-120   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    373   6e-120   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          373   7e-120   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               373   7e-120   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    375   8e-120   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               375   8e-120   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                372   8e-120   
ref|XP_002870357.1|  pectate lyase family protein                       375   9e-120   
gb|KHG22990.1|  hypothetical protein F383_28754                         372   9e-120   
gb|EMT27253.1|  hypothetical protein F775_20306                         370   1e-119   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    374   1e-119   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    374   1e-119   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    374   1e-119   
gb|KHN34377.1|  Putative pectate lyase 22                               372   1e-119   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          372   2e-119   
gb|ADB90476.1|  pectate lyase                                           372   2e-119   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               372   2e-119   
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             372   2e-119   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          372   2e-119   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               371   3e-119   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         371   3e-119   
emb|CDY08948.1|  BnaC08g11780D                                          371   3e-119   
gb|KHG06252.1|  hypothetical protein F383_10745                         372   4e-119   
gb|AEN70985.1|  pectate lyase                                           371   5e-119   
gb|ADB90479.1|  pectate lyase                                           371   5e-119   
gb|AEN70977.1|  pectate lyase                                           371   5e-119   
gb|ADB90475.1|  pectate lyase                                           370   6e-119   
gb|AEN70981.1|  pectate lyase                                           370   6e-119   
gb|KHG30349.1|  hypothetical protein F383_15991                         373   7e-119   
gb|KHG19997.1|  hypothetical protein F383_02891                         370   7e-119   
ref|NP_001190720.1|  probable pectate lyase 15                          372   7e-119   
ref|NP_567409.1|  probable pectate lyase 15                             372   8e-119   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               370   9e-119   
gb|AEN70964.1|  pectate lyase                                           370   9e-119   
gb|AEN70963.1|  pectate lyase                                           370   9e-119   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          370   1e-118   
emb|CDY24847.1|  BnaA08g14630D                                          370   1e-118   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      370   1e-118   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  368   2e-118   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               369   2e-118   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               371   2e-118   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                369   2e-118   
gb|AAK66161.1|  pectate lyase                                           368   2e-118   
gb|AEN70984.1|  pectate lyase                                           369   2e-118   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                369   2e-118   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               369   2e-118   
gb|KHG22755.1|  hypothetical protein F383_29653                         369   2e-118   
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          369   3e-118   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                369   3e-118   
ref|XP_007151585.1|  hypothetical protein PHAVU_004G059200g             369   3e-118   
emb|CDY01151.1|  BnaA04g06680D                                          370   3e-118   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             369   3e-118   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               370   3e-118   
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18               369   3e-118   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                370   4e-118   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               370   4e-118   
gb|AEN70965.1|  pectate lyase                                           368   5e-118   
dbj|BAB59066.1|  pectate lyase                                          368   5e-118   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               368   6e-118   
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     368   7e-118   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               368   7e-118   
ref|XP_010106682.1|  hypothetical protein L484_004616                   367   9e-118   
gb|ADB90477.1|  pectate lyase                                           368   9e-118   
emb|CDY18738.1|  BnaC08g08780D                                          370   9e-118   
gb|KEH44276.1|  pectate lyase family protein                            368   9e-118   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                368   1e-117   
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             368   1e-117   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                369   1e-117   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          367   1e-117   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          369   1e-117   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                367   1e-117   
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             367   1e-117   
emb|CAA63496.1|  pectate lyase                                          367   1e-117   
gb|ADB90478.1|  pectate lyase                                           367   1e-117   
gb|AAY85180.1|  pectate lyase                                           367   2e-117   
gb|AEN70968.1|  pectate lyase                                           367   2e-117   
emb|CDY28857.1|  BnaC06g26450D                                          367   2e-117   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             369   2e-117   
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     369   3e-117   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    367   3e-117   
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                366   3e-117   
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                366   3e-117   
ref|XP_010100325.1|  hypothetical protein L484_027633                   366   3e-117   
emb|CDY03964.1|  BnaC02g36790D                                          366   3e-117   
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   366   4e-117   
ref|XP_002867644.1|  pectate lyase family protein                       366   4e-117   
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                    366   5e-117   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          367   5e-117   
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                365   5e-117   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               366   5e-117   
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               365   6e-117   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          367   6e-117   
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like          367   6e-117   
gb|KEH42160.1|  pectate lyase-like protein                              368   6e-117   
ref|NP_567707.1|  putative pectate lyase 18                             365   7e-117   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     364   7e-117   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              367   8e-117   
dbj|BAK06362.1|  predicted protein                                      367   8e-117   
gb|AAM61584.1|  putative pectate lyase                                  365   9e-117   
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             365   9e-117   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     366   1e-116   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                365   1e-116   
ref|NP_187357.1|  putative pectate lyase 8                              365   1e-116   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                366   1e-116   
emb|CDY53564.1|  BnaC04g55760D                                          367   1e-116   
ref|XP_010448519.1|  PREDICTED: probable pectate lyase 18               365   1e-116   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               365   1e-116   
ref|XP_010433725.1|  PREDICTED: probable pectate lyase 18               365   1e-116   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     366   1e-116   
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         364   1e-116   
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         364   1e-116   
emb|CDY65626.1|  BnaC03g74840D                                          366   1e-116   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     365   2e-116   
gb|EMT28700.1|  hypothetical protein F775_17439                         364   2e-116   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     365   2e-116   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     366   2e-116   
dbj|BAF43573.1|  pectate lyase                                          365   2e-116   
ref|NP_568967.1|  putative pectate lyase 22                             365   2e-116   
ref|XP_002866540.1|  pectate lyase                                      364   2e-116   
ref|XP_010037136.1|  PREDICTED: probable pectate lyase 12 isoform X2    366   2e-116   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     365   2e-116   
dbj|BAB10560.1|  pectate lyase                                          364   2e-116   
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5-like           363   2e-116   
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                365   2e-116   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          364   3e-116   
emb|CDY41506.1|  BnaA06g22590D                                          364   3e-116   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                363   3e-116   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              366   4e-116   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             365   4e-116   
gb|AAK25850.1|AF360140_1  putative pectate lyase                        363   4e-116   
emb|CDY12666.1|  BnaA02g13340D                                          363   5e-116   
emb|CDY32557.1|  BnaC02g17500D                                          363   5e-116   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           364   5e-116   
ref|NP_001147553.1|  pectate lyase 8                                    365   5e-116   
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5                363   5e-116   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     363   5e-116   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                364   6e-116   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   364   6e-116   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                363   6e-116   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               365   6e-116   
ref|XP_009138507.1|  PREDICTED: probable pectate lyase 18               363   7e-116   
ref|XP_003638513.1|  Pectate lyase                                      363   7e-116   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                364   7e-116   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                363   7e-116   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               362   8e-116   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     364   9e-116   
ref|NP_001280839.1|  probable pectate lyase 18 precursor                363   1e-115   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                363   1e-115   
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     363   1e-115   
gb|AGC94753.1|  putative pectate lyase                                  362   1e-115   
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg                362   1e-115   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                363   1e-115   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          363   1e-115   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                363   1e-115   
ref|XP_004306262.1|  PREDICTED: probable pectate lyase 12-like          364   2e-115   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         363   2e-115   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                363   2e-115   
emb|CDP16631.1|  unnamed protein product                                362   2e-115   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                362   2e-115   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           364   2e-115   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                362   2e-115   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           363   2e-115   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               361   2e-115   
gb|ACB12931.1|  pectate lyase 1-27                                      363   2e-115   
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             361   3e-115   
ref|XP_003618787.1|  Pectate lyase                                      361   3e-115   
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          362   3e-115   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    361   3e-115   
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1    361   3e-115   
emb|CBI33346.3|  unnamed protein product                                362   3e-115   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     362   3e-115   
ref|XP_002304700.1|  pectate lyase family protein                       362   4e-115   
ref|XP_002297822.1|  pectate lyase family protein                       362   4e-115   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          362   4e-115   
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                362   4e-115   
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               361   4e-115   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                362   4e-115   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                360   4e-115   
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           360   4e-115   
emb|CAE02420.2|  OSJNBa0095E20.8                                        363   5e-115   
emb|CDY56668.1|  BnaCnng30870D                                          361   5e-115   



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   485 bits (1249),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 244/448 (54%), Positives = 312/448 (70%), Gaps = 16/448 (4%)
 Frame = -2

Query  1582  LWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVS  1409
             L W+ ++ L+ A+++P   AD++  D+VW++R AEA    +QAYHP+P K+    N+ V+
Sbjct  6     LNWLLISFLAFASILPLLRADIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMHFNKHVN  65

Query  1408  IGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPN  1229
               + E+          ++    N TRR L   K  K PC+ TNPID CWRC   W    N
Sbjct  66    KHVEES-------GGLDDVMMLNTTRRHL--GKAYKGPCKVTNPIDACWRCNPKWH--LN  114

Query  1228  RFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASM  1049
             RFRLADC +GF    TGGKGGRIY+V D SDDDV  PK GTLRHAVIQ+EPLWI F  +M
Sbjct  115   RFRLADCGMGFGSKATGGKGGRIYMVTDKSDDDVLNPKPGTLRHAVIQEEPLWITFRRNM  174

Query  1048  TIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDC  869
              IKL  EL+V  +KTIDGRGA V IA GAG+T+Q V NVIIHN+K+  I    GG+IRD 
Sbjct  175   VIKLKQELMVTSDKTIDGRGAIVQIAYGAGITIQFVKNVIIHNLKIHHIVEKDGGLIRDS  234

Query  868   VDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKV  689
               H G+RT  +GDGI+IFGS  +WIDHVSM  C DGLID   G+T +T+SN HFTDHD  
Sbjct  235   ASHTGLRTQSDGDGISIFGSQDIWIDHVSMTRCADGLIDIIQGSTGITISNSHFTDHDHA  294

Query  688   LLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSG  509
             +LFG N++   D++MQIT+AFNHFGKR+ QRMPRCR+G FH+VNNDYTHW+MYA+GGSS 
Sbjct  295   MLFGGNDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSH  354

Query  508   ATIISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE  329
              TIISQGNRYIA     + K+VT R+CP+  WK WTWV+ GD+F+ GA+F PSGD     
Sbjct  355   PTIISQGNRYIAD--HPYAKQVTKRECPESEWKHWTWVTDGDLFLRGAYFIPSGDQDWPS  412

Query  328   KYGYR-DNLRPLSGKEVGRLARYSGHLG  248
             K+  + DN++P S K V ++ +++G LG
Sbjct  413   KHPEKSDNIKPASAKLVSQMTKFAGRLG  440



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   483 bits (1244),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 251/456 (55%), Positives = 316/456 (69%), Gaps = 21/456 (5%)
 Frame = -2

Query  1576  WVYLALLSIAAVIPATTADVSDD---VWKQREAEARRGLLQAYHPNPEKITTELNERVSI  1406
             +++L  +S AA IP + A+ +D     W++R A AR  +LQAY+PNPE I T+ N++   
Sbjct  26    FLFLFFIS-AAFIPTSGANYTDSHDVYWQERAALARARILQAYNPNPEAIVTDFNQKTKE  84

Query  1405  GLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNR  1226
              L  +  NR  ++          TRR L RK     PC ATNPID+CWRC  +W+   NR
Sbjct  85    ALEHSQVNRAPHNG---------TRRNLGRKY--MGPCVATNPIDRCWRCNPNWAL--NR  131

Query  1225  FRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMT  1046
              +LADCA GF    TGGK G IYVV+D SD+D+  PK GTLRHAVIQ  PLWI+F+ SM 
Sbjct  132   QKLADCAQGFGAAATGGKFGPIYVVRDPSDNDMMNPKPGTLRHAVIQPGPLWIIFSHSMN  191

Query  1045  IKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCV  866
             IKL+ EL++  +KTIDGRGA + I GGAG+T+Q V+N+II N+K+ +I  SPGG IRD V
Sbjct  192   IKLNQELIMTSDKTIDGRGALIQITGGAGLTIQFVHNIIITNLKITNIVPSPGGTIRDSV  251

Query  865   DHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVL  686
             +H G RT  +GD I IFGSH++WIDH+SM    DGLIDA  G+TA+T+SNCHF  HDKVL
Sbjct  252   NHFGFRTGSDGDAINIFGSHNIWIDHLSMSGGADGLIDAVMGSTAITISNCHFVRHDKVL  311

Query  685   LFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGA  506
             LFG  + D ID +MQITLAFNHFGK L QRMPRCR G FH+VNNDYTHW MYA+GGS  A
Sbjct  312   LFGGRDMDEIDSKMQITLAFNHFGKHLVQRMPRCRRGFFHLVNNDYTHWLMYAIGGSHHA  371

Query  505   TIISQGNRYIAQPGENFFKEVTHR--DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGV  332
             TIISQGNRYIA P  +  ++VTHR  D P+  W+KWTWV+  DVF+NGA+F PSGDP G 
Sbjct  372   TIISQGNRYIAPPLPD-KRQVTHREADSPESEWRKWTWVTDHDVFLNGAYFVPSGDPNGA  430

Query  331   EKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               Y   + +RP  G++V  L R++G L +C     C
Sbjct  431   ATYLALEKIRPAPGEQVYDLTRFAGAL-KCVVSLPC  465



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/463 (54%), Positives = 318/463 (69%), Gaps = 29/463 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITT  1430
             M  +TK+     + L+    +IP+  A++ D  + W+QR  EA +  L+AY PNPE++T 
Sbjct  1     MVGTTKL---GLVFLIGFVVLIPSLQANIGDFDESWQQRAEEAHKAALEAYDPNPEEVTD  57

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRA  1250
               NE V   ++ + +                TRRELRR  G   PC ATNPID+CWRCR+
Sbjct  58    SFNEEVDKVIDGSNS----------------TRRELRRYSG---PCAATNPIDRCWRCRS  98

Query  1249  DWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLW  1070
             +W+   NR RLA C LGF + TTGG+ GR YVV D SD+DVQ P+ GTLRHAVIQK+PLW
Sbjct  99    NWAS--NRKRLARCVLGFGRKTTGGRSGRYYVVTDPSDNDVQNPRPGTLRHAVIQKQPLW  156

Query  1069  IVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP  890
             I+FA SM I+LS ELL+  +KTID RGA ++IA GAG+T+Q   NVIIH + + DI +S 
Sbjct  157   IIFAHSMIIRLSQELLITSHKTIDARGANIHIANGAGITIQFARNVIIHGLHIHDIVASG  216

Query  889   GGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCH  710
             GG+IRD VDH G RT  +GDGI+IFGS ++W+DH+SM NC+DGLIDA  G+TA+T+SNCH
Sbjct  217   GGMIRDSVDHFGFRTPADGDGISIFGSTNIWLDHISMSNCQDGLIDAIQGSTAITISNCH  276

Query  709   FTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMY  530
             FT H+ V+LFGA++    DK MQ+T+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MY
Sbjct  277   FTHHNDVMLFGASDSFEGDKIMQVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMY  336

Query  529   AVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDD-SWKKWTWVSSGDVFMNGAFFTP  353
             A+GGSS  TIISQGNR+IA P  N  K+VT RD   +  WK+WTW S GD+ MNGAFF  
Sbjct  337   AIGGSSHPTIISQGNRFIAPP-NNAAKQVTKRDYAAEWEWKRWTWRSEGDLMMNGAFFVQ  395

Query  352   SGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SG+      +   D ++   G  V RL R++G L  C  G+KC
Sbjct  396   SGNRSKKRPFTRHDMIKAKPGTFVTRLTRFAGALN-CYAGKKC  437



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   473 bits (1216),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 255/464 (55%), Positives = 319/464 (69%), Gaps = 23/464 (5%)
 Frame = -2

Query  1585  ILWWVYLALLSIAA-VIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELN--  1421
             + + + L++++I++ ++P + A ++  DD WK+R AEA    L +Y PNP KI T LN  
Sbjct  1     LFFALALSVVAISSCLVPTSDARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLH  60

Query  1420  -ERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADW  1244
               R+   LN T          + +   N TRR LR ++    PC  TNPID+CWRCR+DW
Sbjct  61    SHRLLHELNAT---------DHFHLVGNHTRRSLRGRR-YNGPCTVTNPIDRCWRCRSDW  110

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             +   NRFRLADC LGF     GGK G IYVV D+SD+D+  PK GTLRHAVIQ  PLWIV
Sbjct  111   A--TNRFRLADCGLGFGYKAKGGKNGPIYVVTDSSDNDMVNPKPGTLRHAVIQPGPLWIV  168

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA SM I+LS ELLV  +KTIDGRGA V++A GAG+TLQ V+NVIIH + + DI    GG
Sbjct  169   FARSMVIRLSQELLVTSDKTIDGRGARVHVAYGAGITLQFVSNVIIHGLHIHDIVQGSGG  228

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD VDH G RT  +GDGI+IFGS  +WIDHVSM  C DGLIDA  G+T +T+SN HFT
Sbjct  229   MIRDSVDHYGFRTRSDGDGISIFGSQDLWIDHVSMRRCYDGLIDAIMGSTGITISNSHFT  288

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
             DH++V+LFGA++  S D +MQ+T+AFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+
Sbjct  289   DHNEVMLFGASDGYSPDAKMQMTVAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAI  348

Query  523   GGSSGATIISQGNRYIAQPGE--NFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTP  353
             GGSS  TIISQGNRYIA P +   + KEVT RD  P+  W+ WTW S GDVFM GA+FT 
Sbjct  349   GGSSAPTIISQGNRYIAPPDDVNMYAKEVTKRDYAPESVWQSWTWRSDGDVFMRGAYFTQ  408

Query  352   SGDPKGVEKYGYR-DNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SGDP  + K+  R D ++   G  V  + R++G L  C  G  C
Sbjct  409   SGDPNYMSKHPERYDLMQAADGSNVAAITRFAGAL-LCKVGAPC  451



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 247/452 (55%), Positives = 314/452 (69%), Gaps = 25/452 (6%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             ++  LS+A ++P+  A +   D+ W++R  EA +  L+A++P PE +T + N  V+  L+
Sbjct  6     FILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKVLD  65

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
                +                TRR+L   K S  PC ATNPID+CWRCR +W+   +R RL
Sbjct  66    GNNS----------------TRRQLHMHKYSG-PCLATNPIDRCWRCRKNWAK--DRKRL  106

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             A C LGF + TTGG  G+ YVV D SD+DV  PK GTLRHAVIQK PLWI+FA SM I+L
Sbjct  107   AKCVLGFGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRL  166

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             + EL+V  +KTIDGRGA V+IA GAG+T+Q V NVIIHNI++ DI + PGGIIRD VDH 
Sbjct  167   NQELMVASHKTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHV  226

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFG  677
             G+RT  +GDGI+IFGS ++WIDHVSM  C+DGLIDA  G+TA+T+SN H+T H+ V+LFG
Sbjct  227   GIRTMSDGDGISIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFG  286

Query  676   ANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATII  497
             A++    DK MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW MYA+GGSS  TII
Sbjct  287   ASDLYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTII  346

Query  496   SQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYG  320
             SQGNR+IA P     KEVT RD    D W+ WTW S GD+ +NGAFF  SG P   +KYG
Sbjct  347   SQGNRFIAPPNLA-AKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQPLK-KKYG  404

Query  319   YRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              +D ++   G  V RL R+SG L  C P ++C
Sbjct  405   RKDMIKAKPGTFVRRLTRFSGTLN-CKPKKRC  435



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   467 bits (1202),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 227/355 (64%), Positives = 273/355 (77%), Gaps = 3/355 (1%)
 Frame = -2

Query  1288  ATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAG  1109
             ATN ID+CWRC  +W++  NR RLADCA GF +   GG+GG IYVV D SDD+V EP+ G
Sbjct  2     ATNVIDKCWRCDPNWAN--NRQRLADCAQGFGRAAKGGQGGPIYVVTDPSDDNVAEPRPG  59

Query  1108  TLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVI  929
             TLRHAVIQK PLWI+FA SMTI LS EL++Q +KTIDGRG  V+IA GAG T+Q V N+I
Sbjct  60    TLRHAVIQKGPLWIIFARSMTITLSQELIMQSHKTIDGRGVNVHIAYGAGFTIQFVRNII  119

Query  928   IHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDA  749
             IHN+ + D+K++ GG+IRD VDH G+RT +EGDGI+IFG+  VW+DH+SM  C DGLIDA
Sbjct  120   IHNVHIHDVKTTSGGMIRDSVDHVGLRTANEGDGISIFGARDVWLDHLSMSKCSDGLIDA  179

Query  748   AAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLF  569
                +TA+T+SNCHFTDHDKVLLFGA++   +DK MQ+T+AFNHFGKRL QRMPRCR G F
Sbjct  180   VQASTAITISNCHFTDHDKVLLFGASDVTEVDKNMQVTVAFNHFGKRLVQRMPRCRSGFF  239

Query  568   HIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSS  389
             H+VNNDYTHWEMYA+GGS  ATIISQGNR+IA P   FFKEVTHRD P   W KWTWVS 
Sbjct  240   HLVNNDYTHWEMYAIGGSHDATIISQGNRFIAPPLSQFFKEVTHRDAPVALWSKWTWVSD  299

Query  388   GDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             GDVF+NGA F PSG+P G  ++   + ++   G EV  L R+SG L  C  GR C
Sbjct  300   GDVFLNGARFVPSGNPDGARQFAALELIKAAPGTEVFTLTRFSGFLS-CVIGRAC  353



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   470 bits (1209),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 237/431 (55%), Positives = 300/431 (70%), Gaps = 24/431 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+VW++R  EA++  L+AY PNPE++T + N+ V   +  T                N T
Sbjct  36    DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT----------------NTT  79

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR   G   PC ATNPID+CWRC+ DW+   NR +LADC LGF + TTGGK G  YV
Sbjct  80    RRNLRSNNG---PCMATNPIDRCWRCKQDWAK--NRKKLADCVLGFGRRTTGGKDGEFYV  134

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V DASD+D+ +PK GTLRHAVIQKEPLWI+FA  M I+L  EL++ GNKTIDGRGA V+I
Sbjct  135   VTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHI  194

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A G G+T+Q V N+IIHN+ + DI  + GG+IRD VDH G+RT  +GDG++IFGS +VW+
Sbjct  195   AYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWV  254

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+SM NC+DGL+D    +TA+T+SNCHFT+H++V+LFG +N    DK MQ+T+AFNH+G
Sbjct  255   DHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYG  314

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPRCR+G  H+VNNDYTHW MYA+GGS   TIISQGNR+IA P     KEVT R
Sbjct  315   RGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA-CKEVTKR  373

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             D    D WK WTW+S GD+  NGAFF  SGDPK    +   D ++   G  V RL R+SG
Sbjct  374   DYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPFTRYDMIKAKPGTFVNRLTRFSG  433

Query  256   HLGRCTPGRKC  224
              LG C   + C
Sbjct  434   SLG-CKVNQPC  443



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   469 bits (1208),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 237/431 (55%), Positives = 300/431 (70%), Gaps = 24/431 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+VW++R  EA++  L+AY PNPE++T + N+ V   +  T                N T
Sbjct  32    DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT----------------NTT  75

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR   G   PC ATNPID+CWRC+ DW+   NR +LADC LGF + TTGGK G  YV
Sbjct  76    RRNLRSNNG---PCMATNPIDRCWRCKQDWAK--NRKKLADCVLGFGRRTTGGKDGEFYV  130

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V DASD+D+ +PK GTLRHAVIQKEPLWI+FA  M I+L  EL++ GNKTIDGRGA V+I
Sbjct  131   VTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHI  190

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A G G+T+Q V N+IIHN+ + DI  + GG+IRD VDH G+RT  +GDG++IFGS +VW+
Sbjct  191   AYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWV  250

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+SM NC+DGL+D    +TA+T+SNCHFT+H++V+LFG +N    DK MQ+T+AFNH+G
Sbjct  251   DHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYG  310

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPRCR+G  H+VNNDYTHW MYA+GGS   TIISQGNR+IA P     KEVT R
Sbjct  311   RGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA-CKEVTKR  369

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             D    D WK WTW+S GD+  NGAFF  SGDPK    +   D ++   G  V RL R+SG
Sbjct  370   DYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPFTRYDMIKAKPGTFVNRLTRFSG  429

Query  256   HLGRCTPGRKC  224
              LG C   + C
Sbjct  430   SLG-CKVNQPC  439



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   470 bits (1209),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 248/435 (57%), Positives = 307/435 (71%), Gaps = 21/435 (5%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+VW++R  EA    ++AY P+P  +T    +     L E    +   +          T
Sbjct  28    DEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIKEAKLAVNG---------T  78

Query  1333  RRELRRKKGSKE---PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGR  1163
             RREL  K G K+   PC  TNPID+CWRC+ DW+D  NR RLADCA+GFAKGTTGGK G 
Sbjct  79    RREL--KGGGKKYDGPCSVTNPIDRCWRCQPDWAD--NRKRLADCAMGFAKGTTGGKAGE  134

Query  1162  IYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAF  983
             IYVV D+SDD   +PK GTLR+ VIQKEPLWI+FA SMTI+L  EL+VQ +KTIDGRG  
Sbjct  135   IYVVTDSSDD-TSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVN  193

Query  982   VNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHH  803
             V+IA GAG  LQ V NVIIH +++ DI    GG+IRD +DH G RT  +GDGI+IFGS +
Sbjct  194   VHIANGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGISIFGSSN  253

Query  802   VWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFN  623
             +W+DHVSM +C DGL+DA  G+TAVT+SN HFTDH++V+LFGA++  SID+RMQIT+A+N
Sbjct  254   IWVDHVSMWSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYN  313

Query  622   HFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEV  443
             HFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS   TIISQGNR+IA P + F KEV
Sbjct  314   HFGKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPP-DMFKKEV  372

Query  442   THRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY-GYRDNLRPLSGKEVGRLA  269
             T RD  P+  WK+W+W S GD+FMNGAFF  SGDP   +K+    D +   SG +V  + 
Sbjct  373   TKRDYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTQKHIQLFDGVVSASGDQVTWIT  432

Query  268   RYSGHLGRCTPGRKC  224
             R+SG L  C PG  C
Sbjct  433   RFSGAL-NCKPGEAC  446



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   470 bits (1210),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 237/431 (55%), Positives = 300/431 (70%), Gaps = 24/431 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+VW++R  EA++  L+AY PNPE++T + N+ V   +  T                N T
Sbjct  61    DEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQGT----------------NTT  104

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR   G   PC ATNPID+CWRC+ DW+   NR +LADC LGF + TTGGK G  YV
Sbjct  105   RRNLRSNNG---PCMATNPIDRCWRCKQDWAK--NRKKLADCVLGFGRRTTGGKDGEFYV  159

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V DASD+D+ +PK GTLRHAVIQKEPLWI+FA  M I+L  EL++ GNKTIDGRGA V+I
Sbjct  160   VTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHI  219

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A G G+T+Q V N+IIHN+ + DI  + GG+IRD VDH G+RT  +GDG++IFGS +VW+
Sbjct  220   AYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWV  279

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+SM NC+DGL+D    +TA+T+SNCHFT+H++V+LFG +N    DK MQ+T+AFNH+G
Sbjct  280   DHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYG  339

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPRCR+G  H+VNNDYTHW MYA+GGS   TIISQGNR+IA P     KEVT R
Sbjct  340   RGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA-CKEVTKR  398

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             D    D WK WTW+S GD+  NGAFF  SGDPK    +   D ++   G  V RL R+SG
Sbjct  399   DYASPDEWKSWTWISQGDLLQNGAFFVQSGDPKKKHPFTRYDMIKAKPGTFVNRLTRFSG  458

Query  256   HLGRCTPGRKC  224
              LG C   + C
Sbjct  459   SLG-CKVNQPC  468



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   469 bits (1208),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 315/459 (69%), Gaps = 22/459 (5%)
 Frame = -2

Query  1588  KILWWVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             K+++  +   +  A +IP   A + D  +VW++R  EAR    Q Y PNPE +T   N++
Sbjct  5     KLMYSFFFLFIIFATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQK  64

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
             V   + E               ++N TRR L  KK  K PC  TNPID+CWRC  +W+D 
Sbjct  65    VRDSMKEV------------TVSNNSTRRGLGTKK-YKGPCMVTNPIDRCWRCDPNWAD-  110

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR RLADCA+GF    TGGK G IY+V D SDD   EPK GTLR+AVIQKEPLWI+F  
Sbjct  111   -NRKRLADCAMGFGSKATGGKDGEIYIVTDNSDD-YAEPKPGTLRYAVIQKEPLWIIFER  168

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
             SMTI+L  EL++Q +KTID RGA V+IA GAG+TLQ + NVIIH + + DI    GG++R
Sbjct  169   SMTIRLHQELIMQSDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVR  228

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D VDH G+RT  +GDGI+IFG+ ++WIDHVSM  C DG+IDA  G+TA+T+SN HFTDH+
Sbjct  229   DAVDHIGIRTVSDGDGISIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHN  288

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
             +V+LFGA++  SID+ MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS
Sbjct  289   EVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS  348

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRDC-PDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
                TII+QGNR+IA P + F K+VT R+  P++ WK WTW S G++FMNGA+F  SGDP 
Sbjct  349   MHPTIITQGNRFIAPP-DIFKKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPD  407

Query  337   GVEKYG-YRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               +K+    D +     +EV  + R++G LG C  G+ C
Sbjct  408   WSKKHKELYDGISAAPAEEVTWITRFAGALG-CKKGKAC  445



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   468 bits (1205),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 245/451 (54%), Positives = 309/451 (69%), Gaps = 28/451 (6%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             + L+    ++PA TA++ D  +VW+ R  EAR+  LQAY+P+PEK+T   N++V    + 
Sbjct  9     VILIPFLVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHKSFDS  68

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
             T +                TRR L +  G    C ATNPID+CWRCR+DW+   NR +LA
Sbjct  69    TNH----------------TRRNLSKFSGL---CMATNPIDRCWRCRSDWAS--NRMKLA  107

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
             DC LGF + TTGGKGG+IYVV D SD+D+  PK GTLRHA IQ+EPLWI+FA SM I+L+
Sbjct  108   DCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLN  167

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              EL++  NKTID RGA V+IA GAG+TLQ V+N+IIH + + DIK   GG+IRD   H G
Sbjct  168   EELIMTSNKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYG  227

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
              RT  +GDGI+IFG+ ++WIDH+SM NC DGLIDA   +TA+T+SNCHFT H++V+LFGA
Sbjct  228   FRTRSDGDGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGA  287

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++  S D  MQIT+ FNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+S
Sbjct  288   SDGYSGDAIMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILS  347

Query  493   QGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNR+IA P  N  KEVT RD  P+  WK WTW S GD+ MNGAFF  SGDP     +  
Sbjct  348   QGNRFIAPPDIN-CKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPN--FDFSN  404

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +  +R   G  V RL R+SG L  C  G  C
Sbjct  405   KYVIRAKPGAFVTRLTRFSGALS-CREGMPC  434



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   468 bits (1204),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 247/435 (57%), Positives = 308/435 (71%), Gaps = 21/435 (5%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+VW++R  EA    ++AY P+P  +T    ++    L E    +   +          T
Sbjct  28    DEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIKEAKLAING---------T  78

Query  1333  RRELRRKKGSKE---PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGR  1163
             RREL  K G K+   PC  TNPID+CWRC+ +W+D  NR RLADCA+GFAKGTTGGK G 
Sbjct  79    RREL--KGGGKKYNGPCLVTNPIDRCWRCQPNWAD--NRKRLADCAMGFAKGTTGGKAGE  134

Query  1162  IYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAF  983
             IYVV D+SDD   +PK GTLR+ VIQKEPLWI+FA SMTI+L  EL+VQ +KTIDGRG  
Sbjct  135   IYVVTDSSDD-TSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVN  193

Query  982   VNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHH  803
             V+IA GAG  LQ V NVIIH +++ DI    GG+IRD +DH G RT  +GDGI+IFGS +
Sbjct  194   VHIANGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGISIFGSSN  253

Query  802   VWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFN  623
             +W+DHVSM +C DGL+DA  G+TAVT+SN HFTDH++V+LFGA++  SID+RMQIT+A+N
Sbjct  254   IWVDHVSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYN  313

Query  622   HFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEV  443
             HFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS   TIISQGNR+IA P + F KEV
Sbjct  314   HFGKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPP-DMFKKEV  372

Query  442   THRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYG-YRDNLRPLSGKEVGRLA  269
             T RD  P+  WK+W+W S GD+FMNGAFF  SGDP   +K+    D +   SG +V  + 
Sbjct  373   TKRDYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTKKHTELFDGIVSASGDQVTWIT  432

Query  268   RYSGHLGRCTPGRKC  224
             R+SG L  C PG  C
Sbjct  433   RFSGAL-NCKPGEAC  446



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 249/457 (54%), Positives = 307/457 (67%), Gaps = 38/457 (8%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVS---IGLN  1397
             L + S+   + A      D+ W  R  EA++    A++PNPE +T  LN  VS   +G N
Sbjct  7     LFVCSLLFFVVANANVDEDEYWNTRATEAKKVAKSAFNPNPEIVTDNLNAAVSRAMVGRN  66

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
              T                   RR L++ +G   PC ATNPID+CWRC  +W+   NR +L
Sbjct  67    ST-------------------RRSLKKYRG---PCLATNPIDRCWRCDRNWAK--NRKKL  102

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             A+C LGF   T GGK G IYVV DASDDD+  PK GTLR+ VIQK PLWI+F  SM I+L
Sbjct  103   AECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRYGVIQKGPLWIIFGRSMIIRL  162

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             S EL++  +KTID RGA V+IA GAG+T+Q VNNVIIHN+ + DI S  GG+IRD VDH 
Sbjct  163   SQELMISSDKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIISKSGGMIRDSVDHY  222

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFG  677
             G RT  +GDGI+IFGS HVWIDHVSM NCEDGLIDA  G+TA+T+SNCHFT H++V+LFG
Sbjct  223   GFRTQSDGDGISIFGSSHVWIDHVSMSNCEDGLIDAIMGSTAITISNCHFTHHNEVMLFG  282

Query  676   ANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATII  497
             A++  + D+ MQ+TLAFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+
Sbjct  283   ASDSYAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIV  342

Query  496   SQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD-----PKG  335
             SQGNR+IA P  N  K+VT R+   +D WK W+W S GD  MNGA F PSGD      KG
Sbjct  343   SQGNRFIAPPNPN-AKQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIPSGDQTKGKKKG  401

Query  334   VEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             + +Y   D +    G  V RLAR+SG L  CTPG+ C
Sbjct  402   LSRY---DMISFKPGTYVRRLARFSGTL-ECTPGKPC  434



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 243/453 (54%), Positives = 301/453 (66%), Gaps = 19/453 (4%)
 Frame = -2

Query  1567  LALLSIAAVIP-ATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             L L + A+ +P A  A ++  D+VW++R  EA    L++Y P P KI + LN  V   L 
Sbjct  11    LFLFAFASTLPGAVRAHIAEFDEVWQRRAEEAWNRTLESYEPAPAKIVSHLNLNVHRALK  70

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
             E        +          TRR+L    G   PCR TNPID+CWRC+A+W+   NRFRL
Sbjct  71    EVKEEELSLNS---------TRRQL--SHGYDGPCRVTNPIDRCWRCQANWAQ--NRFRL  117

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             ADC LGF     GGK G+IYVV D SD+D+  PK GTLRHAVIQKEPLWI+F   M I+L
Sbjct  118   ADCVLGFGYKAKGGKNGKIYVVTDPSDNDMVNPKPGTLRHAVIQKEPLWIIFQRDMLIRL  177

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             S EL+VQ +KTIDGRGA V IA GAG+TLQ V NVIIH IK+ +I    GG+IRD VDH 
Sbjct  178   SQELIVQSDKTIDGRGARVLIANGAGITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHY  237

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFG  677
             G+RT  +GDGI+IFGS  +WIDHVSM NC DGLID   G+T VTVSN HFTDH++ +LFG
Sbjct  238   GLRTRSDGDGISIFGSQDIWIDHVSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFG  297

Query  676   ANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATII  497
             A++  + D +MQ+T+AFNHFGKR+ QRMPR R+G  H+VNNDYTHW MYAVGGS    II
Sbjct  298   ASDSHTQDVKMQVTVAFNHFGKRMVQRMPRARYGYIHVVNNDYTHWNMYAVGGSKNPIII  357

Query  496   SQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYG  320
             SQGNRYIA P   + KEVT R+  P+  WK W W S GD+F  GAFF  SGDP    K+ 
Sbjct  358   SQGNRYIAPPTNPYAKEVTKREYSPESVWKSWVWRSEGDIFQGGAFFVQSGDPTYTSKHP  417

Query  319   YR-DNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              + D ++    + V  + +++G LG C  G  C
Sbjct  418   EKYDLIQAAPAQNVAEITKFAGALG-CKVGVPC  449



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/460 (52%), Positives = 308/460 (67%), Gaps = 24/460 (5%)
 Frame = -2

Query  1594  STKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELN  1421
             +TK +  ++L   ++A + P   A ++  D+VW++R  EA++  + AYHPNP+++   LN
Sbjct  3     ATKAILSLFLLAFNLAVITPTLRAHIAEFDEVWQKRAEEAKKNAMDAYHPNPDEVINHLN  62

Query  1420  ERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWS  1241
               V + + E+                  TRR L+ K     PC ATNPID+CWRC+ +WS
Sbjct  63    MNVHLAMQESNG----------------TRRSLKTKPYGG-PCLATNPIDRCWRCQKNWS  105

Query  1240  DGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVF  1061
                NR +LADC +GF + T GGK G+ YVV D SD+D+  PK GTLRHAVIQKEPLWI+F
Sbjct  106   R--NRKKLADCVVGFGRKTIGGKLGKFYVVTDGSDNDMLNPKPGTLRHAVIQKEPLWIIF  163

Query  1060  AASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGI  881
             A  M I+L+ ELL+ G+KTID RGA V++A GAG+T+Q V NVIIH + V DI    GG+
Sbjct  164   ARDMVIRLNQELLMAGDKTIDARGANVHVAYGAGITIQFVKNVIIHGLHVHDIVPGSGGL  223

Query  880   IRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTD  701
             IRD VDH G+RT  +GDGI++FG+ +VWIDH+SM NC+DGLIDA    TAVTVSNCHFT 
Sbjct  224   IRDSVDHYGLRTQSDGDGISLFGATNVWIDHISMSNCKDGLIDAIMSTTAVTVSNCHFTH  283

Query  700   HDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVG  521
             H++V+LFGA+   S D  MQIT+AFNHFG+ L QRMPRCRWG  H+VNNDYTHW MYA+G
Sbjct  284   HNEVMLFGASGSYSGDAVMQITVAFNHFGRGLVQRMPRCRWGFAHVVNNDYTHWIMYAIG  343

Query  520   GSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD  344
             GS   TIISQGNR+IA P     KEVT RD  P+  WK WTW S  D+ MNGAFF  SG+
Sbjct  344   GSEHPTIISQGNRFIAPPTLA-AKEVTKRDYAPESEWKHWTWRSEDDLMMNGAFFVQSGN  402

Query  343   PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             P     +  +D +    G  V  L R+SG LG C   + C
Sbjct  403   PSRKHPFSKKDMIPAKPGTYVSTLTRFSGALG-CKINKPC  441



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 313/459 (68%), Gaps = 23/459 (5%)
 Frame = -2

Query  1588  KILWWVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             K+++  +   +  A +IP   A + D  +VW++R  EAR    Q Y PNPE +T   N++
Sbjct  5     KLMYSFFFLFIIFATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQK  64

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
             V      T +N               TRR L  KK  K PC  TNPID+CWRC  +W+D 
Sbjct  65    VRDMKEVTVSNNS-------------TRRGLGTKK-YKGPCMVTNPIDRCWRCDPNWAD-  109

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR RLADCA+GF    TGGK G IY+V D SDD   EPK GTLR+AVIQKEPLWI+F  
Sbjct  110   -NRKRLADCAMGFGSKATGGKDGEIYIVTDNSDD-YAEPKPGTLRYAVIQKEPLWIIFER  167

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
             SMTI+L  EL++Q +KTID RGA V+IA GAG+TLQ + NVIIH + + DI    GG++R
Sbjct  168   SMTIRLHQELIMQSDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVR  227

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D VDH G+RT  +GDGI+IFG+ ++WIDHVSM  C DG+IDA  G+TA+T+SN HFTDH+
Sbjct  228   DAVDHIGIRTVSDGDGISIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHN  287

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
             +V+LFGA++  SID+ MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS
Sbjct  288   EVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS  347

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRDC-PDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
                TII+QGNR+IA P + F K+VT R+  P++ WK WTW S G++FMNGA+F  SGDP 
Sbjct  348   MHPTIITQGNRFIAPP-DIFKKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPD  406

Query  337   GVEKYG-YRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               +K+    D +     +EV  + R++G LG C  G+ C
Sbjct  407   WSKKHKELYDGISAAPAEEVTWITRFAGALG-CKKGKAC  444



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   465 bits (1197),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 316/460 (69%), Gaps = 22/460 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDD---------VWKQREAEARRGLLQAYHPNPEKITTELN  1421
             + L ++S   ++P+  A+ ++D         VW++R  +A++  L+AY PNPE++T + N
Sbjct  12    LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERAMKAQKAALKAYQPNPEQVTEDFN  71

Query  1420  ERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWS  1241
             E V   + E        D  ++ +  N TRR LR  K  K PC+ATNPID+CWRCRA+W+
Sbjct  72    ESVEQTVVE-------EDLEDDQSAGNSTRRNLR-GKXYKGPCKATNPIDRCWRCRANWA  123

Query  1240  DGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVF  1061
             +  NR +LA C  GF + T GGK G  Y+V D+SDD+V +PK GTLRHAVIQ +PLWI+F
Sbjct  124   N--NRKKLASCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIF  181

Query  1060  AASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGI  881
             A SM I+LS EL+V  +KTID RGA V+IA GAG+TLQ V NVIIH +++ D     GG+
Sbjct  182   ARSMVIRLSQELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGM  241

Query  880   IRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTD  701
             IRD + H G+RT  +GDGI+I+GS ++W+DH+SM NC DGLIDA  G+TA+T+SNCHFT 
Sbjct  242   IRDSLSHIGIRTQSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTH  301

Query  700   HDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVG  521
             H+ V+LFGA++  + D  MQIT+AFNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+G
Sbjct  302   HNDVMLFGASDAFAGDAIMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIG  361

Query  520   GSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD  344
             GSS  TIISQGNR+IA P +   KEVT RD  P+  WK W W S GD+ MNGAFF  SG 
Sbjct  362   GSSHPTIISQGNRFIAPPNQA-AKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGV  420

Query  343   PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             P     +G  D ++   G  V RL R++G L  C  G+KC
Sbjct  421   PNKKHGFGKLDMIKAKPGTFVRRLTRFAGSL-NCKVGKKC  459



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   465 bits (1196),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 317/460 (69%), Gaps = 22/460 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDD---------VWKQREAEARRGLLQAYHPNPEKITTELN  1421
             + L ++S   ++P+  A+ ++D         VW++R  +A++  L+AY PNPE++T + N
Sbjct  7     LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERGMKAQKAALKAYQPNPEQVTEDFN  66

Query  1420  ERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWS  1241
             E V   + E        D  ++ +  N TRR LR K  +K PC+ATNPID+CWRCRA+W+
Sbjct  67    ESVEQTVVE-------EDLEDDQSAGNSTRRHLRGKH-NKGPCKATNPIDRCWRCRANWA  118

Query  1240  DGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVF  1061
             +  NR +LA C  GF + T GGK G  Y+V D+SDD+V +PK GTLRHAVIQ +PLWI+F
Sbjct  119   N--NRKKLASCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIF  176

Query  1060  AASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGI  881
             A SM I+LS EL+V  +KTID RGA V+IA GAG+TLQ V NVIIH +++ D     GG+
Sbjct  177   ARSMVIRLSQELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGM  236

Query  880   IRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTD  701
             IRD + H G+RT  +GDGI+I+GS ++W+DH+SM NC DGLIDA  G+TA+T+SNCHFT 
Sbjct  237   IRDSLSHIGIRTQSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTR  296

Query  700   HDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVG  521
             H+ V+LFGA++  + D  MQIT+AFNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+G
Sbjct  297   HNDVMLFGASDAFAGDAIMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIG  356

Query  520   GSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD  344
             GSS  TIISQGNR+IA P +   KEVT RD  P+  WK W W S GD+ MNGAFF  SG 
Sbjct  357   GSSHPTIISQGNRFIAPPNQA-AKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGV  415

Query  343   PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             P     +G  D ++   G  V RL R++G L  C  G+KC
Sbjct  416   PNRKHGFGKLDMIKAKPGTFVTRLTRFAGSL-NCKVGKKC  454



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   464 bits (1194),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 240/459 (52%), Positives = 312/459 (68%), Gaps = 20/459 (4%)
 Frame = -2

Query  1588  KILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             K++   ++      A+IP+  A +   D+VW++R  EAR+  LQ Y   PE +T   N++
Sbjct  5     KVMHSFFVLFFIFTAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQ  64

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
             V   + E        D          TRREL  KK +  PC  TNPID+CWRC  +W+D 
Sbjct  65    VRDAMKELSEVIPKND----------TRRELGTKKYTG-PCMVTNPIDKCWRCDPNWAD-  112

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR +LADCA+GF    TGGK GR YVV D+SDD   +PK GTLRHAVIQKEPLWI+F  
Sbjct  113   -NRKKLADCAMGFGSKATGGKAGRFYVVNDSSDD-YTDPKPGTLRHAVIQKEPLWIIFDR  170

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
              MTI+L  EL++Q +KTID RGA V+IAGGAG+ +Q   NVIIH + + DI    GG++R
Sbjct  171   GMTIRLHQELIMQSDKTIDARGANVHIAGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVR  230

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D VDH G+RT  +GDGI+IFG+ ++WIDHVSM NC DG+IDA  G+T +T+SN HFTDH+
Sbjct  231   DAVDHIGLRTMSDGDGISIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHN  290

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
             +V+LFGA++  SID++MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS
Sbjct  291   EVMLFGASDSSSIDQQMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS  350

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
                TIISQGNR+IA P + F K++T R+  P+  W +WTW S GD++MNGA+F  SGDP 
Sbjct  351   KNPTIISQGNRFIAPP-DIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPD  409

Query  337   GVEKY-GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               +K+    D +      +V  + R++G LG C  G+ C
Sbjct  410   WSKKHQNLYDGISAAPADQVTWITRFAGALG-CKVGQAC  447



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 242/459 (53%), Positives = 311/459 (68%), Gaps = 20/459 (4%)
 Frame = -2

Query  1588  KILWWVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             K+ +  +   +  A +I    A + D  +VW++R  EAR    Q Y PNPE +T   N++
Sbjct  5     KLKYSFFFLFIIFATIIRNLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQK  64

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
             V   + E                   TRR L  KK  K PC  TNPID+CWRC  +W+D 
Sbjct  65    VRDTMKELRQVTVSNS----------TRRGLGTKK-YKGPCMVTNPIDRCWRCDPNWAD-  112

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR RLADCA+GF    TGGK G IY+V D SDD   EPK GTLR+AVIQKEPLWI+F  
Sbjct  113   -NRKRLADCAMGFGYKATGGKDGEIYIVTDNSDD-YAEPKPGTLRYAVIQKEPLWIIFER  170

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
             SMTI+L  E+++Q +KTID RGA V+IA GAG+TLQ + NVIIH + + DI    GG++R
Sbjct  171   SMTIRLHQEMIMQSDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVR  230

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D VDH G+RT  +GDGI+IFG+ ++WIDHVSM  C DG+IDA  G+T +T+SN HFTDH+
Sbjct  231   DAVDHIGIRTVSDGDGISIFGASNIWIDHVSMKKCYDGIIDAVEGSTGITISNGHFTDHN  290

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
             +V+LFGA++  SID+ MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS
Sbjct  291   EVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS  350

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRDC-PDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
                TII+QGNR+IA P + F K+VT R+  P++ WK+WTW S G++FMNGA+F  SGDP 
Sbjct  351   MHPTIITQGNRFIAPP-DIFKKQVTKREYNPEEVWKQWTWRSEGNLFMNGAYFIESGDPD  409

Query  337   GVEKYG-YRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               +K+    D +   S +EV  + R++G LG C  G+ C
Sbjct  410   WSKKHKELYDGISAASAEEVTWITRFAGALG-CKEGKAC  447



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 247/465 (53%), Positives = 315/465 (68%), Gaps = 38/465 (8%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             ++  LS+A ++P+  A +   D+ W++R  EA +  L+A++P PE +T + N  V+  L+
Sbjct  9     FILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKVLD  68

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
                +                TRR+L   K S  PC ATNPID+CWRCR +W+   +R RL
Sbjct  69    GNNS----------------TRRQLHMHKYSG-PCLATNPIDRCWRCRKNWAK--DRKRL  109

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             A C LGF + TTGG  G+ YVV D SD+DV  PK GTLRHAVIQK PLWI+FA SM I+L
Sbjct  110   AKCVLGFGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRL  169

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             + EL+V  +KTIDGRGA V+IA GAG+T+Q V NVIIHNI++ DI + PGGIIRD VDH 
Sbjct  170   NQELMVASHKTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHV  229

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD------  695
             G+RT  +GDGI+IFGS ++WIDHVSM  C+DGLIDA  G+TA+T+SN H+T H+      
Sbjct  230   GIRTMSDGDGISIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFN  289

Query  694   -------KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWE  536
                    +V+LFGA++    DK MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW 
Sbjct  290   LHPGTYVQVMLFGASDLYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWL  349

Query  535   MYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFF  359
             MYA+GGSS  TIISQGNR+IA P     KEVT RD    D W+ WTW S GD+ +NGAFF
Sbjct  350   MYAIGGSSQPTIISQGNRFIAPPNLA-AKEVTKRDYATPDVWRSWTWRSQGDLLINGAFF  408

Query  358   TPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               SG P   +KYG +D ++   G  V RL R+SG L  C P ++C
Sbjct  409   VQSGQPLK-KKYGRKDMIKAKPGTFVRRLTRFSGTLN-CKPKKRC  451



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 240/460 (52%), Positives = 312/460 (68%), Gaps = 20/460 (4%)
 Frame = -2

Query  1591  TKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNE  1418
             +K+    ++     AA+IP+  A +   D+VW++R  EAR+  LQ Y   PE +T   N+
Sbjct  4     SKVTHSFFVLFFIFAAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNK  63

Query  1417  RVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSD  1238
             +V   + E        D          TRREL  KK +  PC  TNPID+CWRC  +W+D
Sbjct  64    QVRDAMKELSEVIPKND----------TRRELGTKKYTG-PCMVTNPIDKCWRCDPNWAD  112

Query  1237  GPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFA  1058
               NR +LADCA+GF    TGGK GR YVV D SDD   +PK GTLRHAVIQKEPLWI+F 
Sbjct  113   --NRKKLADCAMGFGSKATGGKAGRFYVVNDPSDD-YTDPKPGTLRHAVIQKEPLWIIFD  169

Query  1057  ASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGII  878
               MTI+L  EL++Q +KTID RGA V+I+GGAG+ +Q   NVIIH + + DI    GG++
Sbjct  170   RGMTIRLHQELIMQSDKTIDARGANVHISGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMV  229

Query  877   RDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDH  698
             RD VDH G+RT  +GDGI+IFG+ ++WIDHVSM NC DG+IDA  G+T +T+SN HFTDH
Sbjct  230   RDAVDHIGLRTMSDGDGISIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDH  289

Query  697   DKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGG  518
             ++V+LFGA++  SID++MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GG
Sbjct  290   NEVMLFGASDSSSIDQQMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGG  349

Query  517   SSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDP  341
             S   TIISQGNR+IA P + F K++T R+  P+  W +WTW S GD++MNGA+F  SGDP
Sbjct  350   SKNPTIISQGNRFIAPP-DIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDP  408

Query  340   KGVEKY-GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                +K+    D +      +V  + R++G LG C  G+ C
Sbjct  409   DWSKKHQNLYDGISAAPADQVTWITRFAGALG-CMVGQAC  447



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   462 bits (1189),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 308/452 (68%), Gaps = 26/452 (6%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             +L   S A ++P+  A++   D+ W +R  EA++  L+AY P+PE +T+  N +V   + 
Sbjct  8     FLFFSSFAVLVPSLQANIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNAKVDKAVR  67

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
                               N TRR+L++ KG   PC ATNPID+CWRC  +W+   NR RL
Sbjct  68    GN----------------NSTRRQLKKYKG---PCLATNPIDRCWRCNRNWAR--NRKRL  106

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             A+C LGF + T GGK G  YVV D+SD+D+  PK GTLRHAV+QK PLWI+FA SM I+L
Sbjct  107   ANCVLGFGRKTRGGKRGWFYVVTDSSDNDMVNPKPGTLRHAVVQKGPLWIIFAGSMVIRL  166

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             + EL++  +KTID RGA V+IA GAG+TLQ + NVIIH + + DI    GG+IRD  DH 
Sbjct  167   NQELIMTSDKTIDARGANVHIAYGAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHV  226

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFG  677
             G+RT  +GDGI+IFGS H+WIDHVSM  C DGLIDA  G+TA+T+SNCHFT H++V+LFG
Sbjct  227   GLRTASDGDGISIFGSSHLWIDHVSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFG  286

Query  676   ANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATII  497
             A++  S D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TII
Sbjct  287   ASDGYSQDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTII  346

Query  496   SQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYG  320
             SQGNR+IA P     KEVT RD   +D WK W W S GD+ MNGAFF  SG+P+    + 
Sbjct  347   SQGNRFIAPPNIA-AKEVTKRDYATEDQWKNWLWKSEGDLMMNGAFFVNSGNPRARFPFS  405

Query  319   YRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              RD ++   G  V RL R++G LG C  GR C
Sbjct  406   RRDVIKAKPGTYVRRLTRFAGKLG-CRVGRPC  436



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   462 bits (1189),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 307/448 (69%), Gaps = 30/448 (7%)
 Frame = -2

Query  1549  AAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVS---IGLNETYn  1385
               +IP   A ++  DD W+QREAEA+    +AY+PNPE++T   N  V+   +G N T  
Sbjct  18    VVIIPTLHAHIAEYDDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTLMGFNST--  75

Query  1384  nrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCA  1205
                              RR LR K+ +  PC+ATNPIDQCWRC  +W    NR RLADC+
Sbjct  76    -----------------RRSLRGKRRTG-PCQATNPIDQCWRCDPNWHR--NRKRLADCS  115

Query  1204  LGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGEL  1025
             LGF +GT GGK GR Y+V D SD+D+  PK GTLRHAVIQK PLWI+FA SM IKL+ EL
Sbjct  116   LGFGRGTIGGKNGRYYIVTDPSDNDMVNPKPGTLRHAVIQKRPLWIIFARSMIIKLNQEL  175

Query  1024  LVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRT  845
             ++  +KTID RGA V++A GAG+T+Q   N+IIH + + DI    GG+IRD VDH G RT
Sbjct  176   IMTSDKTIDARGANVHVAYGAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRT  235

Query  844   HDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNE  665
               +GDG+++FG+ ++W+DH+SM+NC DGLIDA  G+TA+T+SNCHFT+H++V+LFGA++ 
Sbjct  236   KSDGDGVSLFGATNIWLDHLSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDS  295

Query  664   DSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGN  485
              S D++MQIT+AF HFGK L QRMPRCRWG  H+VNNDYTHW MYA+GGSS  TIISQGN
Sbjct  296   YSEDQKMQITVAFTHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGN  355

Query  484   RYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDN  308
             R++A P     KEVT RD  P + WK W+W S GD+ +NGAFFT SGDP+   ++     
Sbjct  356   RFVAPPNAA-AKEVTKRDYAPPEVWKNWSWRSEGDLMVNGAFFTQSGDPRASRRFLGNFM  414

Query  307   LRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +    G+ V  L RYSG L  C   R C
Sbjct  415   ISAKPGQMVSLLTRYSGSLD-CVRRRPC  441



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   462 bits (1189),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 312/449 (69%), Gaps = 18/449 (4%)
 Frame = -2

Query  1555  SIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnn  1382
             +  A+IP+    +   D+VW++R  EA    L+AY P+P  +T    ++    + E    
Sbjct  16    TFLAIIPSLNGHIGNFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTRESMKELKEV  75

Query  1381  relyddsnnnnndNVTRRELR-RKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCA  1205
              +L  +         TRRELR   K    PC  TNPID+CWRC+ +W+D  NR RLADCA
Sbjct  76    NKLSTNE--------TRRELRGFHKIYAGPCLVTNPIDRCWRCQGNWAD--NRKRLADCA  125

Query  1204  LGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGEL  1025
             +GF KGTTGGK G+ YVV D+SDD    PK GTLRHAVIQKEPLWI+FA SMTI+L  EL
Sbjct  126   MGFGKGTTGGKAGQFYVVTDSSDDS-SNPKPGTLRHAVIQKEPLWIIFAKSMTIRLHQEL  184

Query  1024  LVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRT  845
             ++Q +KTIDGRG  V+IA GAG+TLQ V NVIIH + + DI    GG++   VDH G+RT
Sbjct  185   IMQSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRT  244

Query  844   HDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNE  665
               +GDGI+IFGS ++WIDHVSM  C DGLIDA  G+TA+T+SN HFTDH++V+LFGA++ 
Sbjct  245   QSDGDGISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDS  304

Query  664   DSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGN  485
              SID+RMQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS   TIISQGN
Sbjct  305   SSIDQRMQITVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGN  364

Query  484   RYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY-GYRD  311
             R+IA P + F KE+T RD  P+  WK+WTW S GD+FMNGAFF  SGDP   +K+    D
Sbjct  365   RFIAPP-DMFKKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFD  423

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              +    G++V  + R++G L  C PG  C
Sbjct  424   GISSAPGEQVTWITRFAGALN-CRPGHAC  451



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   462 bits (1189),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 249/449 (55%), Positives = 311/449 (69%), Gaps = 18/449 (4%)
 Frame = -2

Query  1555  SIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnn  1382
             +  A+IP+    + D  +VW++R  EA    L+AY P+P  +T    ++    + E    
Sbjct  16    TFLAIIPSLNGHIGDFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTKESMKELKEV  75

Query  1381  relyddsnnnnndNVTRRELR-RKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCA  1205
             ++L  +         TRRELR   K    PC  TNPID+CWRC+ +W+D  NR RLADCA
Sbjct  76    KKLATND--------TRRELRGFHKNYAGPCLVTNPIDRCWRCQGNWAD--NRKRLADCA  125

Query  1204  LGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGEL  1025
             LGF KGTTGGK GR YVV D+SDD    PK GTLRHAVIQKEPLWI+FA SM I+L  EL
Sbjct  126   LGFGKGTTGGKAGRFYVVTDSSDDS-SNPKPGTLRHAVIQKEPLWIIFAKSMNIRLHQEL  184

Query  1024  LVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRT  845
             ++Q +KTIDGRG  V+IA GAG+TLQ V NVIIH + + DI    GG++   VDH G+RT
Sbjct  185   IMQSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRT  244

Query  844   HDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNE  665
               +GDGI+IFGS ++WIDHVSM  C DGLIDA  G+TA+T+SN HFTDH++V+LFGA++ 
Sbjct  245   QSDGDGISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDS  304

Query  664   DSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGN  485
              SID+RMQIT+AFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS   TIISQGN
Sbjct  305   SSIDQRMQITVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGN  364

Query  484   RYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY-GYRD  311
             R+IA P E F KE+T RD  P+  WK+WTW S GD+FMNGAFF  SGDP   +K+    D
Sbjct  365   RFIAPP-EMFKKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFD  423

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              +    G++V  + R++G L  C  G  C
Sbjct  424   GISSAPGEQVTWITRFAGALN-CKQGHAC  451



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   462 bits (1188),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 309/455 (68%), Gaps = 32/455 (7%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVS---IG  1403
             L L   AA+IPA    +   D+ WKQRE EA+    QAY+PNPE++T  +N  VS   +G
Sbjct  11    LLLFLFAAIIPALQGHIGEYDENWKQRELEAKENTEQAYNPNPEEVTQHVNHLVSRSLMG  70

Query  1402  LNETYnnrelyddsnnnnndNVTRRELR-RKKGSKEPCRATNPIDQCWRCRADWSDGPNR  1226
             LN T                   RR LR RKKG   PC  TNPIDQCWRC  +W    NR
Sbjct  71    LNST-------------------RRHLRARKKGG--PCDPTNPIDQCWRCDRNWEK--NR  107

Query  1225  FRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMT  1046
              RLADCA+GFA+GT GGK GRIYVV D SDDD+  PK GTLRHAVIQKEPLWI+FA +M 
Sbjct  108   QRLADCAIGFARGTIGGKYGRIYVVTDPSDDDLLNPKPGTLRHAVIQKEPLWIIFARAMI  167

Query  1045  IKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCV  866
             I+L  EL++ GNKTID RGA V++A GAG+T+Q V NVIIH + +  I    GG+IRD V
Sbjct  168   IRLKEELIMSGNKTIDARGANVHVAYGAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSV  227

Query  865   DHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVL  686
             +H G RT  +GDGI++FG+ +VW+DH+SM+ C DGLIDA  G+TA+T+SNCHFT HD+V+
Sbjct  228   NHYGFRTKSDGDGISLFGATNVWLDHLSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVM  287

Query  685   LFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGA  506
             LFGAN+   +D++MQITL FNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+GGSS  
Sbjct  288   LFGANDNHKMDEKMQITLVFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHP  347

Query  505   TIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE  329
             T+ISQGNRYIA+      KEVT RD  P + WK W W S GD+ +NGAFF+ SGDPK   
Sbjct  348   TVISQGNRYIARR-HVASKEVTKRDYAPPEVWKTWNWRSEGDLLLNGAFFSQSGDPKASS  406

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             K+     +      +V  L + SG L  C  GR C
Sbjct  407   KFKGDTKVSAKPAYKVDLLTKDSGTL-ICIRGRAC  440



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   460 bits (1184),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 241/453 (53%), Positives = 307/453 (68%), Gaps = 26/453 (6%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             +   +S+A  +P     +   D+ WK++  EAR+   +A++P+P  +T++ N +V+  L 
Sbjct  11    FSLFVSLAVFVPTLQGHIGEFDEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQVNKVLT  70

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
             ET                N TRR L RK+G +  C ATNPID+CWRC  +W+   +R +L
Sbjct  71    ET----------------NSTRRSLVRKRGGR--CIATNPIDRCWRCDPNWAS--HRQKL  110

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             ADC LGF   T GGK G+IYVV DASD+D+  PK GTLRHAVIQKEPLWI+F+ SM I+L
Sbjct  111   ADCVLGFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRL  170

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             + EL+V  NKTID RG  V+IA GAG+TLQ   NVIIH +++ DI S  GG+IRD VDH 
Sbjct  171   NQELMVASNKTIDSRGFKVHIAYGAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHY  230

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFG  677
             G RT  +GDGI+IFGS ++WIDHVSM NC+DGLID   G+ A+T+SN HFT H++V+LFG
Sbjct  231   GFRTKSDGDGISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFG  290

Query  676   ANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATII  497
             A++  S D  MQIT++FNHFGK L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+
Sbjct  291   ASDSYSGDSIMQITVSFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIV  350

Query  496   SQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYG  320
             SQGNR+IA PG  F KEVT RD   +S WK W W S  D+ MNGAFF  SG P    +  
Sbjct  351   SQGNRFIA-PGNTFAKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRI  409

Query  319   YRDN-LRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              R + ++   G  V RL R+SG LG C  G+ C
Sbjct  410   SRFHVMKSKPGTFVTRLTRFSGSLG-CFKGKPC  441



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   460 bits (1183),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 240/454 (53%), Positives = 306/454 (67%), Gaps = 25/454 (6%)
 Frame = -2

Query  1576  WVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIG  1403
             + ++   S A + P   A++ D  + WKQ+   AR    ++Y+PNP  ++ +LN +V+  
Sbjct  9     FTFVLFASFAVIFPTLHANIGDFDEYWKQKADIAREAAYRSYNPNPFNVSNQLNYQVNKA  68

Query  1402  LNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             ++ T +                TRR L R+KG   PC+ATNPID+CWRC   W+   NR 
Sbjct  69    VSGTNS----------------TRRNLMRRKGGG-PCKATNPIDRCWRCDPKWA--LNRK  109

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             RL +C LGF   TTGGK G+ Y+V D SD+D+  PK GTLRHAVIQ EPLWI+FA SM I
Sbjct  110   RLVECVLGFGHSTTGGKDGKFYIVTDPSDNDMVNPKPGTLRHAVIQNEPLWIIFARSMII  169

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             +L+ EL++  NKTID RGA V+IAGGAG+TLQ V NVIIH I++ DI S  GG++RD VD
Sbjct  170   RLNQELMISSNKTIDARGANVHIAGGAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVD  229

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G RT  +GDGI+IFGS ++WIDHVSM NC+DGLIDA  G+T++T+SNCHFT+H++V+L
Sbjct  230   HYGFRTKSDGDGISIFGSSNIWIDHVSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVML  289

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA++  S D  MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   T
Sbjct  290   FGASDGYSADTIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSRKPT  349

Query  502   IISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             IISQGNR+IA P   F KEVT R+   +S WK W W S  D+ MNGA F  SG P     
Sbjct  350   IISQGNRFIA-PNNIFSKEVTKREYSLESEWKNWNWRSDRDLMMNGAVFVESGKPI-THD  407

Query  325   YGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +     ++   G  V RL RYSG L  C  G+ C
Sbjct  408   FSRLQLIKAKPGTFVTRLTRYSGALD-CFVGKPC  440



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   459 bits (1181),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 239/445 (54%), Positives = 305/445 (69%), Gaps = 24/445 (5%)
 Frame = -2

Query  1549  AAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnre  1376
             AA+IP   A + D  +VW++R  EA+   L+AYHP+P+++    N  V +   E  +   
Sbjct  20    AAIIPTLRAHIGDFDEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVHLATAEVRSGNS  79

Query  1375  lyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGF  1196
                          TRR LR K+  K PC ATNPID+CWRCR+ W  G NR +LADC LGF
Sbjct  80    S------------TRRSLRNKE-YKGPCMATNPIDRCWRCRSKW--GKNRKKLADCVLGF  124

Query  1195  AkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQ  1016
              + T GGK G+ YVV D SDDD++ PK GTLRHAVIQ EPLWI+F   M I+L  EL++ 
Sbjct  125   GRKTVGGKYGKFYVVTDGSDDDMENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMT  184

Query  1015  GNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDE  836
              +KT+DGRGA V+IA GAG+T+Q + NVIIHN+   DI +  GG+IRD V+H G RT  +
Sbjct  185   SDKTLDGRGARVHIAYGAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASD  244

Query  835   GDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSI  656
             GD I+IFGS +VWIDH SM NC+DGL+DA  G+TA+T+SN H T H++V+LFGA++    
Sbjct  245   GDAISIFGSTNVWIDHNSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPD  304

Query  655   DKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYI  476
             D +MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGSS  TIISQGNR+I
Sbjct  305   DSKMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRFI  364

Query  475   AQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRP  299
             A P E   K+VT+R+  P+  WK WTW S GD+ MNGA+F  SG P  ++K   RD +  
Sbjct  365   APPTEA-AKQVTNRNYAPESVWKHWTWRSEGDLMMNGAYFIQSGKP--IKK--KRDMITA  419

Query  298   LSGKEVGRLARYSGHLGRCTPGRKC  224
               G  V RL R+SG L  C  G++C
Sbjct  420   KKGTFVKRLVRFSGALN-CKVGKRC  443



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   458 bits (1179),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 246/467 (53%), Positives = 310/467 (66%), Gaps = 40/467 (9%)
 Frame = -2

Query  1588  KILWWVYLALLSIAAVIPATTADVS---DDVWKQREAEARRGLLQAYHPNPEKITTELNE  1418
             K  W  + + L + +++    A+ +   D+ W+ R  EA++    A++ NPE +T  LN 
Sbjct  4     KTQWLAFFSSLFVCSLLFFVVANANVDEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNA  63

Query  1417  RVS---IGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRAD  1247
              VS   +G N T                   RR LR+K   + PC ATNPID+CWRC  +
Sbjct  64    AVSRTMLGHNST-------------------RRSLRKKY--RGPCLATNPIDRCWRCDRN  102

Query  1246  WSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWI  1067
             W+   NR +LA+C LGF   T GGK G IYVV DASDDD+  PK GTLRH VIQK PLWI
Sbjct  103   WAK--NRRKLAECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWI  160

Query  1066  VFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPG  887
             +F  SM I+LS EL++  +KTID RGA V+IA GAG+T+Q VNNVIIHN+ + DI S  G
Sbjct  161   IFGRSMVIRLSQELMISSHKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSG  220

Query  886   GIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHF  707
             G+IRD VDH G RT  +GDGI+IFGS HVWIDHVSM NC+DGLIDA  G+TA+T+SNCHF
Sbjct  221   GMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHF  280

Query  706   TDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYA  527
             T H++V+LFGA++  + D+ MQ+TLAFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA
Sbjct  281   THHNEVMLFGASDSYAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYA  340

Query  526   VGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPS  350
             +GGS   TI+SQGNR+IA P  N  K++T R+   +D WK W+W S GD  MNGA F  S
Sbjct  341   IGGSQHPTIVSQGNRFIAPPNPN-AKQITKREYAMEDEWKHWSWRSEGDELMNGAVFIAS  399

Query  349   GD-----PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             GD      KG+ +Y   D +    G  V RL R SG +  CTPG+ C
Sbjct  400   GDQTKGKKKGLSRY---DMISFKPGTYVRRLVRLSGTI-ECTPGKPC  442



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   458 bits (1178),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 246/454 (54%), Positives = 303/454 (67%), Gaps = 23/454 (5%)
 Frame = -2

Query  1582  LWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIG  1403
             L++  L  L+ AA   A  AD  D+ W+++   A+     +Y+P+PE +T   NE V   
Sbjct  7     LFFFSLVFLASAAFANAHIADF-DEYWQKKAEVAQSKARNSYNPDPESVTRHFNEAV---  62

Query  1402  LNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
                             +   NVTRR LR +K S  PC ATNPID+CWRC  +W    +R 
Sbjct  63    --------------YEDAQTNVTRRGLRGQKRSHGPCLATNPIDRCWRCNENWIH--HRK  106

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LA CA GF + T GGK G+ YVV DASDDD+  PK GTLR+ VIQ  PLWIVFA  M I
Sbjct  107   QLATCAKGFGRHTIGGKNGKFYVVTDASDDDLVNPKKGTLRYGVIQDRPLWIVFAHDMVI  166

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             +L+ EL+V   KTIDGRGA V I GGAG+T+Q V+NVI+HN+ + DIK+  GG+IRD   
Sbjct  167   RLTEELIVNSYKTIDGRGANVQIMGGAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEH  226

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GDGI+I+GS ++WIDHVSM NC DGLIDA  G+TA+T+SN HFT H++ +L
Sbjct  227   HYGLRTRSDGDGISIYGSSNIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAML  286

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA++  S D  MQIT+AFNHFGK L QRMPRCRWG  H+VNNDYTHWEMYAVGGS   T
Sbjct  287   FGASDAYSPDAIMQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAVGGSQHPT  346

Query  502   IISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             IISQGNRYIA P   F KEVT RD   +S WK+WTW S GD+ +NGAFF  SG   G++K
Sbjct  347   IISQGNRYIA-PSNPFAKEVTKRDYATESVWKQWTWRSEGDLMLNGAFFVKSGGGGGLQK  405

Query  325   YGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             Y   D ++   G  V RL RYSG L  C P R C
Sbjct  406   YDKTDIIKAKPGSFVTRLTRYSGALD-CFPQRPC  438



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   458 bits (1178),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 239/450 (53%), Positives = 304/450 (68%), Gaps = 28/450 (6%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETY  1388
              AL+++   I A  A+  D+VW++R  EA++   QAYHPNPE +T+  NE V   ++   
Sbjct  12    FALIALVYTIEAHIAEF-DEVWQKRAEEAKKAARQAYHPNPENVTSHFNEEVHRSID---  67

Query  1387  nnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
                            N  RR+L +  G   PC ATNPIDQCWRC+ +W    NR +LADC
Sbjct  68    -------------GHNSRRRDLHKYNG---PCTATNPIDQCWRCQKNWRK--NRMKLADC  109

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
             ALGF +  TGGKGGRIY V D SD+D+  PK GTLRHA+IQ EPLW++F  +M I+LS E
Sbjct  110   ALGFGRHATGGKGGRIYKVTDPSDNDLVNPKPGTLRHALIQPEPLWVIFTKNMVIRLSQE  169

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L++  NKTIDGRG  V+IA GAG TLQ V+N+IIHN+ + DIKS  GG+IRD V+H G+R
Sbjct  170   LIMTSNKTIDGRGVQVHIAYGAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYGIR  229

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
             +  +GDGI+I+GS ++WIDH+SM NC DGLIDA   +TA+T+SN HFT H++ +LFGA++
Sbjct  230   SRSDGDGISIYGSTNIWIDHISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGASD  289

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               S D  MQITLAFNHFG+ + QRMPR RWG  H+VNNDYTHW MYA+GGS   TI+SQG
Sbjct  290   SYSDDSIMQITLAFNHFGQGIEQRMPRARWGFVHVVNNDYTHWLMYAIGGSQHPTILSQG  349

Query  487   NRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYR-  314
             NR+IA P   + KEVT RD  P+  WK W W S GD+ MNGAFF  SGDP     +G   
Sbjct  350   NRFIA-PENPYAKEVTKRDYAPESVWKDWVWKSQGDLMMNGAFFVQSGDPN--HNFGSNA  406

Query  313   DNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             D + P  G+   RL R++G L  C   R C
Sbjct  407   DLIGPKPGEFANRLTRFAGAL-NCIAKRPC  435



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   457 bits (1177),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 240/459 (52%), Positives = 310/459 (68%), Gaps = 28/459 (6%)
 Frame = -2

Query  1591  TKILWWVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNE  1418
             T I+    L +     + P   A+++D  +VW++R  EA++   +AY P+PE+ T   N+
Sbjct  6     TTIVGIKLLMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNK  65

Query  1417  RVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSD  1238
             +V   L+                  N TRR LR+  G   PC ATNPID+CWRC  +W+ 
Sbjct  66    QVHRSLD----------------GGNNTRRHLRKYTG---PCLATNPIDRCWRCDRNWAR  106

Query  1237  GPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFA  1058
               NR +LADCALGF + TTGGK G+IYVV+D+SD+D+  PK GTLRHAVIQ+ PLWI+FA
Sbjct  107   --NRKKLADCALGFGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFA  164

Query  1057  ASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGII  878
               M I+LS EL+V  +KT+DGRGA V+IA G  +TLQ V N+IIHN+ + DIK+  GG+I
Sbjct  165   HDMVIRLSEELIVTDDKTLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMI  224

Query  877   RDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDH  698
             RD V H G RT  +GDGI++FG+  VWIDHVSM NC+DGLIDA   +TA+T+SNCHFT H
Sbjct  225   RDSVSHYGFRTRSDGDGISMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHH  284

Query  697   DKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGG  518
             + V+L GA+N  S D+ MQ+TLAFNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+GG
Sbjct  285   NDVILLGASNGYSNDQIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGG  344

Query  517   SSGATIISQGNRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDP  341
             S   TIISQGNR+IA P  N  KEVT R   P+  W+ W W S GD+ MNGAFF  SG+P
Sbjct  345   SHNPTIISQGNRFIAPPNPN-CKEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP  403

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               +++Y  +D +    G  V RL R++G L +C   + C
Sbjct  404   --IKRYSKKDVIHSKPGTFVTRLTRFAGPL-KCKKNQPC  439



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   458 bits (1178),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 239/459 (52%), Positives = 321/459 (70%), Gaps = 14/459 (3%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL-  1400
             ++ +     + P   AD+   D VW++R  EAR+ +++AY P+P  +T E+NE+V+  + 
Sbjct  8     FMFVFWFGFITPNLMADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNEQVNHQID  67

Query  1399  -----NETYnnrelyddsnnnnndNVTRRELRRKKGSKE-PCRATNPIDQCWRCRADWSD  1238
                  N T N+ +  ++       N TRR L++KK     PC+A NPID+CWRCR +W  
Sbjct  68    GNAKTNSTINHTKGTNNFETGAEANNTRRSLKQKKQKYNGPCQANNPIDKCWRCRKNWV-  126

Query  1237  GPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFA  1058
               +R RLA CALGF + TTGGKGG+IYVV D SD D  EPK GTLRHAVIQKEPLWI+FA
Sbjct  127   -KDRQRLASCALGFGRRTTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPLWIIFA  185

Query  1057  ASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGII  878
               M IKLS EL++  NKTIDGRG  V+I+ GAG+T+Q V+N+IIH +++  I S+ GG+I
Sbjct  186   CDMNIKLSQELIMAHNKTIDGRGFNVHISHGAGITIQFVSNIIIHGLRIHHICSTCGGMI  245

Query  877   RDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDH  698
             RD VDH G+RT  +GDGI+IFGS +VWIDHVSM NC+DGLIDA  G+TA+T+SNCHF++H
Sbjct  246   RDSVDHVGLRTASDGDGISIFGSTNVWIDHVSMSNCQDGLIDAIQGSTAITISNCHFSNH  305

Query  697   DKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGG  518
             +  +L GA++  S D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW +YA+GG
Sbjct  306   NDAILLGASDSFSGDQFMQITVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLLYAIGG  365

Query  517   SSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDP  341
             S   TI+SQGN+++A P + + KEVT RD  P   WKKW W S GD+ +NGAFF  SG+P
Sbjct  366   SMHPTIVSQGNQFVA-PDDKYIKEVTKRDYAPMSEWKKWNWRSEGDLMVNGAFFVESGEP  424

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 +   +  ++   G+   ++ R++G L  C  G+KC
Sbjct  425   ALHLRPSKKFMIKAKHGRFATQMTRFAGALD-CKYGKKC  462



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 238/458 (52%), Positives = 312/458 (68%), Gaps = 22/458 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVSDD---------VWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             L ++S   ++P+  A+  +D         VW+QR  +A++  L+AY PNPE++T + NE 
Sbjct  9     LLMISFCMLVPSLKAETQNDTLNIAEFDSVWQQRALKAQKAALKAYQPNPEQVTEDFNES  68

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
             V + + E  ++ +    ++       T R L  K+ +  PC+ATNPID+CWRC+A+W+D 
Sbjct  69    VEMTIIEDDHDDDHAAGNS-------TGRHLLGKRYTG-PCKATNPIDRCWRCQANWAD-  119

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR  LA C  GF + T GGK G  Y+V D+SDD++ +PK GTLRHAVIQK+PLWI+FA 
Sbjct  120   -NRKHLASCVKGFGRKTRGGKKGAYYIVTDSSDDNIHDPKPGTLRHAVIQKQPLWIIFAR  178

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
             SM I+L+ EL+V  +KTID RGA V+IA GAG+TLQ V NVIIH + + D     GG+IR
Sbjct  179   SMVIRLTQELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLHIHDTVPGNGGMIR  238

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D VDH G+RTH +GDGI+I+GS ++W+DH+SM NC DGLIDA  G+TA+T+SN HFT H+
Sbjct  239   DSVDHIGIRTHSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNSHFTRHN  298

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
              V+LFGA++  S D  MQIT+AFNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+GGS
Sbjct  299   DVMLFGASDGFSGDAIMQITVAFNHFGKGLIQRMPRCRWGFIHVVNNDYTHWLMYAIGGS  358

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
             S  TIISQGNR+IA P +   KEVT RD  P+  WK W W S GD+ +NGAFF  SG P 
Sbjct  359   SHPTIISQGNRFIAPPNQA-AKEVTKRDYAPESVWKSWQWRSEGDLMINGAFFVQSGVPS  417

Query  337   GVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 +G  D ++   G  V RL R++G L  C  G  C
Sbjct  418   KNHGFGRLDVMKARPGTYVTRLTRFAGSL-NCKVGHPC  454



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   457 bits (1175),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 309/454 (68%), Gaps = 18/454 (4%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +   L++ A+ +P+ +A+ +D  D W +R  +A    LQ+Y  +P KI + LN      L
Sbjct  7     LLFLLIAFASALPSISANFADFDDYWLKRSVQAWNNTLQSYESHPAKIVSHLNLHSKRAL  66

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
              E  +   + +          +RR+L    G + PC ATNPID+CWRC+A+W+D  NRFR
Sbjct  67    KEIKDINLVSNS---------SRRQL--AHGYEGPCMATNPIDRCWRCQANWAD--NRFR  113

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             LADC LGF     GGKGGRIYVV D+SD D+  PK GTLRHAVIQ EPLWI+F+ SM I+
Sbjct  114   LADCGLGFGYKAKGGKGGRIYVVNDSSDGDMVNPKPGTLRHAVIQTEPLWIIFSRSMVIR  173

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             LS EL++Q +KTIDGRG  V+I GGAG+T+Q V N+IIH I + DI    GG+IRD VDH
Sbjct  174   LSQELIMQSDKTIDGRGVRVHITGGAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSVDH  233

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G+RT  +GDGI+I+G+  +WIDHVSM  C DGLIDA  G+T +T+SN HFTDH++ +LF
Sbjct  234   YGLRTRSDGDGISIYGAQDIWIDHVSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAMLF  293

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             GA++  + D +MQIT+AFNHFGKR+ QRMPRCR+G  H+VNNDYTHW MYA+GGS    I
Sbjct  294   GASDSHTQDVKMQITVAFNHFGKRMVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPII  353

Query  499   ISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY  323
             ISQGNR+IA P   F KEVT R+  P+  W +W W S GD+F+ GAFF  SGD     K+
Sbjct  354   ISQGNRFIAPPDNPFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDATYTSKH  413

Query  322   GYR-DNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               + D ++  S  +VG + +++G LG C  G+ C
Sbjct  414   PEKYDLIQAASATQVGIMTKFAGALG-CKVGQPC  446



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   456 bits (1173),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 304/457 (67%), Gaps = 37/457 (8%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVS---IGLN  1397
             L + S+   + A      D+ W+ R  EA++    A++ NPE +T  LN  VS   +G N
Sbjct  7     LFVCSLLFFVVANANVDEDEYWETRATEAKKVAQGAFNANPEIVTDTLNAAVSRTMLGHN  66

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
              T                   RR LR+K   + PC ATNPID+CWRC  +W+   NR +L
Sbjct  67    ST-------------------RRSLRKKY--RGPCLATNPIDRCWRCDRNWAK--NRRKL  103

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             A+C LGF   T GGK G IYVV DASDDD+  PK GTLRH VIQK PLWI+F  SM I+L
Sbjct  104   AECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRL  163

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             S EL++  +KTID RGA V+IA GAG+T+Q VNNVIIHN+ + DI S  GG+IRD VDH 
Sbjct  164   SQELMISSHKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHY  223

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFG  677
             G RT  +GDGI+IFGS HVWIDHVSM NC+DGLIDA  G+TA+T+SNCHFT H++V+LFG
Sbjct  224   GFRTQSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFG  283

Query  676   ANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATII  497
             A++  + D+ MQ+TLAFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+
Sbjct  284   ASDSYAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIV  343

Query  496   SQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD-----PKG  335
             SQGNR+IA P  N  K+VT R+   +D WK W+W S GD  MNGA F  SGD      KG
Sbjct  344   SQGNRFIAPPNPN-AKQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKG  402

Query  334   VEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             + +Y   D +    G  V RL R SG +  CTPG+ C
Sbjct  403   LSRY---DMISFKPGTYVRRLVRLSGTI-ECTPGKPC  435



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   456 bits (1173),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 310/459 (68%), Gaps = 22/459 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDD--------VWKQREAEARRGLLQAYHPNPEKITTELNE  1418
             + L ++S   ++P+  A +++D        VWK+RE +A +  L+AY PNPEK+T + NE
Sbjct  7     LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDDFNE  66

Query  1417  RVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSD  1238
              V    +  + + +   +        +T R L  KK  K PC+ATNPID+CWRCR DW++
Sbjct  67    SVQEFDDLNFEDDDQVSN--------ITGRHLLGKK-YKGPCKATNPIDRCWRCRKDWAN  117

Query  1237  GPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFA  1058
               +R +LA+C  GF + T GGK G  YVV D SD +V +PK GTLRHAVIQ +PLWI+FA
Sbjct  118   --DRKKLANCVKGFGRRTRGGKRGGFYVVTDPSDSNVVDPKPGTLRHAVIQPQPLWIIFA  175

Query  1057  ASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGII  878
              SMTI+L+ EL++  +KTID RGA V IA GAG+TLQ V NVIIH + + DI    GG I
Sbjct  176   RSMTIRLTQELILTSHKTIDARGANVRIAHGAGITLQFVQNVIIHGLHIHDIVPGSGGTI  235

Query  877   RDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDH  698
             RD VDH G RT  +GDGI+IFGS H+W+DH+SM NC DGLID   G+TA+T+SNCHFT H
Sbjct  236   RDSVDHFGTRTQSDGDGISIFGSSHIWLDHLSMWNCGDGLIDVIQGSTAITISNCHFTRH  295

Query  697   DKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGG  518
             + VLLFGA++  + D  MQIT+AFNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+GG
Sbjct  296   NDVLLFGASDSFAGDAIMQITVAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGG  355

Query  517   SSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDP  341
             SS  TIISQGNR+IA P  +  KEVT RD  P D WK W W S GD+ +NGAFF  SG  
Sbjct  356   SSHPTIISQGNRFIAPP-NHAAKEVTKRDYAPVDVWKNWQWRSEGDLMLNGAFFVESGVA  414

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             K    +G  D +    G  V RL R++G LG C  G+KC
Sbjct  415   KKNHGFGKLDMMTAKPGTFVTRLTRFAGTLG-CRVGQKC  452



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   455 bits (1171),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/453 (53%), Positives = 305/453 (67%), Gaps = 26/453 (6%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             +   +S+AA +P     +   D+ WK++  EA +   +A++P+P  +T + N +V+  + 
Sbjct  11    FSLFVSLAAFVPTLQGHIGEFDEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQVNKVMT  70

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
             ET                N TRR L  K+G +  C ATNPID+CWRC  +W+   +R +L
Sbjct  71    ET----------------NSTRRSLVSKRGGR--CMATNPIDRCWRCDPNWAS--HRQKL  110

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             ADC LGF   T GGK G+IYVV DASD+D+  PK GTLRHAVIQKEPLWI+F+ SM I+L
Sbjct  111   ADCVLGFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRL  170

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             + EL+V  NKTID RGA V+IA GAG+TLQ V NVIIH +++ DI    GG++RD VDH 
Sbjct  171   NQELMVASNKTIDSRGAKVHIAYGAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHY  230

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFG  677
             G RT  +GDGI+IFGS ++WIDHVSM NC+DGLID   G+ A+T+SN HFT H++V+LFG
Sbjct  231   GFRTKSDGDGISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFG  290

Query  676   ANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATII  497
             A++  S D  MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+
Sbjct  291   ASDSYSGDSIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIV  350

Query  496   SQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYG  320
             SQGNR+IA P   F KEVT RD   +S WK W W S  D+ MNGAFF  SG P    +  
Sbjct  351   SQGNRFIA-PNNTFAKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRI  409

Query  319   YRDN-LRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              R + ++   G  V RL R+SG LG C  G+ C
Sbjct  410   SRFHVMKSKPGTFVTRLTRFSGSLG-CFKGKPC  441



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   455 bits (1171),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 309/459 (67%), Gaps = 22/459 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDD--------VWKQREAEARRGLLQAYHPNPEKITTELNE  1418
             + L ++S   ++P+  A +++D        VWK+RE +A +  L+AY  NPEK+T + NE
Sbjct  7     LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKTALKAYQRNPEKVTDDFNE  66

Query  1417  RVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSD  1238
              V    +  + + +   +        +T R L  KK  K PC+ATNPID+CWRCR DW++
Sbjct  67    SVQEVDDLNFEDDDQVSN--------ITGRHLLGKK-YKGPCKATNPIDRCWRCRKDWAN  117

Query  1237  GPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFA  1058
               +R +LA+C  GF + T GGK G  YVV D SD +V EPK GTLRHAVIQ +PLWI+FA
Sbjct  118   --DRKKLANCVKGFGRRTRGGKRGEFYVVTDPSDSNVVEPKPGTLRHAVIQPQPLWIIFA  175

Query  1057  ASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGII  878
              SMTI+L+ EL++  +KTID RGA V+IA GAG+TLQ V NVIIH + + DI    GG I
Sbjct  176   RSMTIRLTQELIMTSHKTIDARGANVHIAHGAGLTLQFVQNVIIHGLHIHDIVPGSGGTI  235

Query  877   RDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDH  698
             RD VDH G RT  +GDGI+IFGS HVW+DH+SM NC DGLID   G+TAVT+SNCHFT H
Sbjct  236   RDSVDHFGTRTQSDGDGISIFGSSHVWLDHLSMWNCADGLIDVIQGSTAVTISNCHFTRH  295

Query  697   DKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGG  518
             + VLLFGA++  + D  MQIT+AFNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+GG
Sbjct  296   NDVLLFGASDSFAGDAIMQITVAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGG  355

Query  517   SSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDP  341
             SS  TIISQGNR+IA P +   KEVT RD  P   WK W W S GD+ +NGAFF  SG  
Sbjct  356   SSHPTIISQGNRFIAPPNQA-AKEVTKRDYAPMGVWKNWQWRSEGDLMLNGAFFVESGVA  414

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             K    +G  D +    G  V RL R++G LG C  G+KC
Sbjct  415   KKNHGFGKLDMMTAKPGTFVSRLTRFAGTLG-CRVGQKC  452



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 301/449 (67%), Gaps = 30/449 (7%)
 Frame = -2

Query  1549  AAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnre  1376
             A + P   A ++  DD WK+RE EA++  L+A+HP P+++    N  V   L  +     
Sbjct  18    AVIAPTIRAHIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDELTGSNG---  74

Query  1375  lyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGF  1196
                          TRR LR  KG   PC+ATNPID+CWRCR +W+    R RLADC LGF
Sbjct  75    -------------TRRSLRVNKG---PCKATNPIDRCWRCRPNWAS--QRKRLADCVLGF  116

Query  1195  AkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQ  1016
              + T GGK G+ Y V D SD+D+  PK GTLRHAVIQ  PLWIVFA SM I+L+ EL++ 
Sbjct  117   GRNTVGGKYGKYYFVTDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMT  176

Query  1015  GNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDE  836
              +KTIDGRG  V+IA GAG+T+Q V NVIIH + + DI S  GG+IRD V+H G R+  +
Sbjct  177   SDKTIDGRGVNVHIAYGAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSD  236

Query  835   GDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSI  656
             GDGI+I+GS HVWIDH SM NC+DGLIDA  G+TA+T+SN HFT H++V+LFGA++ +S 
Sbjct  237   GDGISIYGSSHVWIDHNSMSNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSA  296

Query  655   DKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYI  476
             D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS+  TIISQGNRY 
Sbjct  297   DEIMQITVAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAIGGSAHPTIISQGNRYT  356

Query  475   A----QPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRD  311
             A     P  +  K+VT RD   +S WKKWTW S GD+  NGAFF PSG+P     Y   D
Sbjct  357   APHLVDPKHD-AKQVTKRDYAMESEWKKWTWRSEGDLMRNGAFFVPSGNPSKRMPYSRLD  415

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              ++   G  V RL R+SG L  C  G  C
Sbjct  416   MIKAKPGTYVSRLTRFSGAL-TCRRGGPC  443



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   455 bits (1170),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 251/451 (56%), Positives = 310/451 (69%), Gaps = 12/451 (3%)
 Frame = -2

Query  1561  LLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETY  1388
             L S AA+IP+  AD++  D+VWKQR  +A +  L+AY P PE +T+ LN  V+  L    
Sbjct  11    LFSFAALIPSLWADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNKAL---L  67

Query  1387  nnrelyddsnnnnndNVTRRELR-RKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLAD  1211
               R     +      N TRR LR   K    PC ATNPID+CWRCR +W+   NR +LA+
Sbjct  68    KGRANKTRAFEGVTTNSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWAR--NRKQLAN  125

Query  1210  CALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSG  1031
             C LGF   T GGK G  Y+V D SDD+V  P+ GTLRHAVIQKEPLWI+FA  M IKLS 
Sbjct  126   CVLGFGHKTEGGKQGGYYLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIKLSQ  185

Query  1030  ELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGM  851
             EL+VQ  KTIDGRGA V+IA GAG+TLQ V+NVIIHN+ +  I+ S GG+IRD VDH G 
Sbjct  186   ELIVQSKKTIDGRGANVHIAYGAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGF  245

Query  850   RTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGAN  671
             RT  +GDGI+IFGS ++W+DH+SM  CEDGLIDA  G+TA+T+SNCHFT H+ V+L GA+
Sbjct  246   RTVGDGDGISIFGSTNIWLDHLSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGAS  305

Query  670   NEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQ  491
             +  S DK MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW+MYA+GGS   TIISQ
Sbjct  306   DSYSRDKLMQVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSQHPTIISQ  365

Query  490   GNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE-KYGY  317
             GNR+IA P + + KE+T+R+  P+  W+ W W S GD+FMNGAFF  SG P     KY  
Sbjct  366   GNRFIA-PNDPWAKEITNRNYAPESVWRHWVWRSEGDLFMNGAFFRTSGPPAPPHLKYNK  424

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                ++      V RL R+SG L  C    KC
Sbjct  425   LQMIKAKPATFVRRLTRFSGALN-CKKRVKC  454



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   454 bits (1167),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 237/454 (52%), Positives = 307/454 (68%), Gaps = 20/454 (4%)
 Frame = -2

Query  1567  LALLSIA--AVIPATTADV--SDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             L  LSIA    +P+ +A+   SD+ W +R  +A    L++Y P+P KI + LN   +  L
Sbjct  7     LLFLSIAFAYALPSISANFLDSDEYWVKRSVQAWNNTLESYEPHPAKIVSHLNLHSTRAL  66

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
              E  +   + +          +RR L    G   PC ATNPID+CWRC+A+W+D  NRFR
Sbjct  67    EEIKDLELVSNS---------SRRHL--AHGYDGPCMATNPIDRCWRCQANWAD--NRFR  113

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             LADC LGF     GGKGGRIYVV D+SD D+  P  GTLRHAVIQ EPLWI+F+ SM I+
Sbjct  114   LADCGLGFGYKAKGGKGGRIYVVNDSSDSDMVNPIPGTLRHAVIQTEPLWIIFSRSMVIR  173

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             LS EL++Q +KTIDGRG  V+I GGAG+T+Q V N+IIH + + DI    GG+IRD VDH
Sbjct  174   LSQELIMQSDKTIDGRGVRVHITGGAGITIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDH  233

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G RT  +GDGI+I+G+  +WIDHVSM NC DGLIDA  G+T +T+SN HFTDH++ +LF
Sbjct  234   YGFRTRSDGDGISIYGAQDIWIDHVSMTNCSDGLIDAIMGSTGITISNGHFTDHNEAMLF  293

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             GA++  + D +MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTHW MYA+GGS    I
Sbjct  294   GASDSHTQDVKMQITVAFNHFGKRLVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPII  353

Query  499   ISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY  323
             ISQGNR+IA P   F KEVT R+  P+  W +W W S GD+F+ GAFF  SGDP    K+
Sbjct  354   ISQGNRFIAPPDNPFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDPTYTSKH  413

Query  322   GYR-DNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               + D ++  S  +V  + +++G LG C  G+ C
Sbjct  414   PEKYDLIQAASATQVEIMTKFAGALG-CKIGQVC  446



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   452 bits (1163),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 241/467 (52%), Positives = 311/467 (67%), Gaps = 30/467 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             MA  T+ + ++ L L   A  IP   A ++  DD  K++   AR+  L++Y PNPE ITT
Sbjct  1     MAGITRKITFIVLIL---AITIPCLEAGIAEFDDYLKEQADLARQIALKSYVPNPENITT  57

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRR--KKGSKEPCRATNPIDQCWRC  1256
             ELN  V++ + E Y+N               TRRELR+  K G    C ++NPID CWRC
Sbjct  58    ELNLHVNMAMEEAYSNS--------------TRRELRQRQKHGGSSACMSSNPIDNCWRC  103

Query  1255  RADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEP  1076
             + DW+   NR +LA C  GF +   GG GG+ YVV D SD+D+  PK GTLR+  +QK P
Sbjct  104   KKDWAQ--NRQQLAQCGKGFGRKAVGGLGGKFYVVTDESDNDLVTPKFGTLRYGAVQKGP  161

Query  1075  LWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKS  896
             LWI+FA SM I+L+ ELLV  +KTIDGRGA V+I  GAG+T+Q VNNVIIH + + +IK+
Sbjct  162   LWIIFARSMIIRLNQELLVSSDKTIDGRGANVHIRDGAGITMQFVNNVIIHGLHIRNIKA  221

Query  895   SPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSN  716
               GG+IRD  +H G+RT  +GD +++FGS ++WIDH+S+   EDGLID   G+TA+T+SN
Sbjct  222   RSGGMIRDSYNHVGLRTRSDGDALSVFGSSNIWIDHISLSESEDGLIDVIQGSTAITISN  281

Query  715   CHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWE  536
             CH T H+ V+LFGA++  S DK MQIT+AFNHFG+ L QRMPRCRWG FH++NNDYTHW 
Sbjct  282   CHMTKHNDVMLFGASDSYSDDKIMQITVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWL  341

Query  535   MYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFF  359
             MYA+GGSSG TI+SQGNR+IA P  N  K +THRD    D W KW W S  D+FMNGA F
Sbjct  342   MYAIGGSSGPTILSQGNRFIA-PNNNAAKTITHRDYASQDVWSKWQWRSENDLFMNGATF  400

Query  358   TPSGDP-KGVE-KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               SG P K +  K GY   ++P  G +  RL RY+G L  C  GR C
Sbjct  401   IESGAPIKNLPFKKGYL--MKPRPGTQANRLTRYAGAL-NCQIGRPC  444



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   452 bits (1163),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 230/467 (49%), Positives = 310/467 (66%), Gaps = 26/467 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITT  1430
             M    K+   +++      A+IPA  A + D  +VW++R  EA +  +Q Y   P  IT 
Sbjct  1     MNNQPKMTHSLFVLFFVFGAIIPAFNAHIGDFDEVWRRRAEEAMKFTIQTYESEPANITL  60

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKE---PCRATNPIDQCWR  1259
               N++    + E               +  V++ E RR+ G+K+   PC  TNPID+CWR
Sbjct  61    AFNQKTRDSVKEL--------------SAVVSKNETRRELGTKKYEGPCTVTNPIDKCWR  106

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             C  +W+D  NR +L +C++GF   TTGG+ G+ YVV D+SDD    PK GTLRHAVIQKE
Sbjct  107   CDPNWAD--NRKKLVECSMGFGYKTTGGRDGKYYVVSDSSDD-YTTPKPGTLRHAVIQKE  163

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+F  +M IKL  EL++QG+KTIDGRGA V+I GGA + +Q   NVIIH + + DI 
Sbjct  164   PLWIIFDRNMKIKLHQELIMQGDKTIDGRGATVHITGGASIMIQYTKNVIIHGLHIHDIV  223

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
                GG++RD VDH G RT  +GDGI+IFGS ++WIDH+SM NC DG+IDA  G+T +T+S
Sbjct  224   EGNGGMVRDAVDHIGFRTKSDGDGISIFGSSNIWIDHMSMENCYDGIIDAVEGSTGITIS  283

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             N H+TDH++V+LFGA++  SID++MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW
Sbjct  284   NGHYTDHNEVMLFGASDSSSIDQKMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHW  343

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
              MYA+GGS   TIISQGNR+IA P + F K++T R+  P+  W +WTW S GD++MNGA+
Sbjct  344   NMYAIGGSKNPTIISQGNRFIAPP-DIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAY  402

Query  361   FTPSGDPKGVEKY-GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  +GDP   +K+    D +      +V  + R++G L  C  G+ C
Sbjct  403   FVQAGDPDWSKKHQNLYDGIAAAPADQVTWMTRFAGAL-NCKVGKAC  448



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   452 bits (1162),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 309/459 (67%), Gaps = 18/459 (4%)
 Frame = -2

Query  1588  KILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             KI +      ++ A +IP+  A +   D+VW++R  EA+    + Y P+PE +T   N++
Sbjct  5     KIKYSFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARKIYEPHPENVTLAFNQK  64

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
             +   + E               ++N TRR L  KK +  PC  TNPID+CWRC  +W+D 
Sbjct  65    LRDTMKEL--------KKVKGTHNNSTRRGLGTKKYTG-PCMVTNPIDKCWRCDPNWAD-  114

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR +LADCA+GF     GGK G  YVV D SDD   +PK GTLRHAVIQKEPLWI+F  
Sbjct  115   -NRKKLADCAMGFGSKAIGGKDGEFYVVTDNSDD-YNDPKPGTLRHAVIQKEPLWIIFKR  172

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
              M I+L  E+++Q +KTID RG  V+I  GAG+TLQ + NVIIH + + DI    GG++R
Sbjct  173   GMNIRLHQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVR  232

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D VDH G+RT  +GDGI+IFG+ ++WIDHVSM  C DGLIDA  G+T +T+SN HFTDH+
Sbjct  233   DAVDHIGIRTKSDGDGISIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHN  292

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
             +V+LFGA++  SID+ MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS
Sbjct  293   EVMLFGASDSSSIDQVMQITLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGS  352

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRDC-PDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
                TII+QGNR+IA P + F K+VT R+  P+  W +WTW S G++FMNGA+FT SGDP+
Sbjct  353   MHPTIITQGNRFIAPP-DIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPE  411

Query  337   GVEKY-GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                K+    D +     ++V  + R++G LG C PG+ C
Sbjct  412   WSSKHKDLYDGISAAPAEDVTWMTRFAGVLG-CKPGKPC  449



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 307/459 (67%), Gaps = 18/459 (4%)
 Frame = -2

Query  1588  KILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             KI +      ++ A +IP+  A +   D+VW++R  EA+      Y P+PE +T   N++
Sbjct  5     KIKYSFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARNIYEPHPENVTLAFNQK  64

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
             +   + E               ++N TRR L  KK +  PC  TNPID+CWRC  +W+D 
Sbjct  65    LRDTMKEL--------KKVKGTHNNSTRRGLGTKKYTG-PCMVTNPIDKCWRCDPNWAD-  114

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR +LADCA+GF     GGK G  YVV D SDD   +PK GTLRHAVIQKEPLWI+F  
Sbjct  115   -NRKKLADCAMGFGSKAIGGKDGEFYVVTDNSDD-YNDPKPGTLRHAVIQKEPLWIIFKR  172

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
              M I+L  E+++Q +KTID RG  V+I  GAG+TLQ + NVIIH + + DI    GG++R
Sbjct  173   GMNIRLHQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVR  232

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D VDH G+RT  +GDGI+IFG+ ++WIDHVSM  C DGLIDA  G+T +T+SN HFTDH+
Sbjct  233   DAVDHIGIRTKSDGDGISIFGASYIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHN  292

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
             +V+LFGA++  SID+ MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS
Sbjct  293   EVMLFGASDSSSIDQVMQITLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGS  352

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRDC-PDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
                TII QGNR+IA P + F K+VT R+  P+  W +WTW S G++FMNGA+FT SGDP+
Sbjct  353   MHPTIIHQGNRFIAPP-DIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPE  411

Query  337   GVEKY-GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                K+    D +     ++V  + R++G LG C PG+ C
Sbjct  412   WSSKHKDLYDGISAAPAEDVTWMTRFAGVLG-CKPGKPC  449



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   449 bits (1156),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 244/463 (53%), Positives = 301/463 (65%), Gaps = 32/463 (7%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             M +S   L + Y+  L   A++P   A++   D VW +R  EAR    QAY PNP K+T 
Sbjct  1     MESSNFSLLFFYVIFL---AILPTLQANIGQFDHVWHRRLKEAREAAKQAYKPNPMKVTA  57

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRA  1250
             E N  V   +  + +                TRR L +K    + C A NPID+CWRC  
Sbjct  58    EFNTHVMRAMKGSNS----------------TRRGLGKKN---DECEAANPIDKCWRCDP  98

Query  1249  DWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLW  1070
             DW    NR +LADCA+GF  GTTGGK G+IYVV D SD D+  PK GTLRHAVIQ EPLW
Sbjct  99    DWEK--NRKKLADCAIGFGHGTTGGKDGKIYVVGDNSDKDLVNPKPGTLRHAVIQTEPLW  156

Query  1069  IVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP  890
             I+F+ +M I+L+ ELL+  NKTID RGA V+I  GA MT+Q V N+IIH + + DI+   
Sbjct  157   IIFSRNMNIRLTAELLITDNKTIDARGANVHILDGAQMTIQFVKNIIIHGLHIHDIQPIS  216

Query  889   GGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCH  710
             GG+IRD + H G+R   +GDGI++FGS H+WIDHVSM NC DGLID  + +TAVT+SNCH
Sbjct  217   GGLIRDSMSHYGVRAMSDGDGISVFGSTHIWIDHVSMTNCSDGLIDVVSASTAVTISNCH  276

Query  709   FTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMY  530
             F  H+ VLLFGA +  S DK MQ+TLAFNHFGK L QRMPRCRWG FHIVNNDYTHW MY
Sbjct  277   FVKHNDVLLFGATDSFSRDKVMQVTLAFNHFGKGLVQRMPRCRWGFFHIVNNDYTHWLMY  336

Query  529   AVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTP  353
             AVGGS   TIISQGNR++A P +   KEVT RD  P+  WK W W S GD+F NGAFF  
Sbjct  337   AVGGSQQPTIISQGNRFVA-PKDRNAKEVTKRDYAPESEWKNWNWRSEGDLFENGAFFVE  395

Query  352   SGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SG  K V K+   D  + +S K V  L + +G + +C P + C
Sbjct  396   SG--KKVTKFPKTD-AKAVSAKSVAFLTKDAGPI-KCIPNKPC  434



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   449 bits (1154),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 245/454 (54%), Positives = 304/454 (67%), Gaps = 24/454 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERV-SIG  1403
             ++  L+SI   +    A++   DD WKQRE  A+    +AY+ +P  IT + N+RV ++G
Sbjct  10    LFFMLVSII-FLQHVEANIGNYDDHWKQREQAAKANAARAYNTDPHGITHQTNQRVHNMG  68

Query  1402  LNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             +N T            N  +N  RR L + +G   PC+A NPID+CWRC  +WS   +R 
Sbjct  69    MNRT------------NRTNNYARRGLGKYEG---PCQADNPIDRCWRCDDNWS--KDRQ  111

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC +GF   TTGGK G IYVV D SD+++ +PK GTLRHAVIQ  PLWI+F   M I
Sbjct  112   KLADCVVGFGHKTTGGKKGNIYVVTDDSDNELLDPKPGTLRHAVIQDGPLWIIFKHGMVI  171

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  ELLV  NKTIDGRG  V+IAGGAG+ LQ V+NVIIHN+ + DIK+  GG IRD V 
Sbjct  172   KLKEELLVSSNKTIDGRGGHVHIAGGAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVS  231

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G RT  +GDGI+IFGS ++WIDHVSM NC DGLIDA   +TA+TVSNCHFTDH+ V+L
Sbjct  232   HFGFRTASDGDGISIFGSTNIWIDHVSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVML  291

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA +  S D+ MQ+T+AFNHFGKRL QRMPRCR+G FH++NNDYTHWEMYA+GGS   T
Sbjct  292   FGARDSSSQDEIMQVTIAFNHFGKRLIQRMPRCRFGFFHVLNNDYTHWEMYAIGGSQHPT  351

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             II QGNR+IA P   F KEVT R+  P   WK W W S  D+ MNGAFF  SGD      
Sbjct  352   IICQGNRFIAPPNI-FAKEVTKREYAPYSVWKDWLWTSEDDIMMNGAFFNQSGDTSKKPS  410

Query  325   YGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             Y  +D ++   G EV  L R++G L  C  G  C
Sbjct  411   YAKKDMIKAKPGSEVTHLTRFAGAL-NCKEGTAC  443



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 237/445 (53%), Positives = 310/445 (70%), Gaps = 17/445 (4%)
 Frame = -2

Query  1576  WVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIG  1403
             W+ +    +A+++P   A+++  D+VW++R AEA    LQAY P+P K+    NE V   
Sbjct  8     WLPILFFVVASILPVLRANIAEYDEVWRRRAAEAYNRTLQAYEPDPLKVVMHFNENVHRH  67

Query  1402  LNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             + E+           +    N TRR L +K   + PC+ TNPID CWRC  +W    NRF
Sbjct  68    IKES--------GGVDMMMLNSTRRRLGKK--YRGPCKVTNPIDACWRCDPNWH--LNRF  115

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC+LGF +  TGGKGGRIYVV D SDDD+  PK GTLRHAVIQ+EPLWI F  SM I
Sbjct  116   KLADCSLGFGRKATGGKGGRIYVVTDPSDDDILTPKPGTLRHAVIQEEPLWITFKRSMVI  175

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
              L+ EL++  +KTIDGRG  V IA GAG+T+Q V N+IIHNIK+ +I    GGIIRD   
Sbjct  176   TLAQELIMTSDKTIDGRGVKVQIAHGAGITVQYVRNIIIHNIKIHNIVEKKGGIIRDSTT  235

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GDGI+IFG+  +WIDHVSM  C+DGLIDA  G+TA+T+SN HFTDHD  +L
Sbjct  236   HSGLRTQSDGDGISIFGAQDIWIDHVSMTRCDDGLIDAIQGSTAITISNGHFTDHDHAML  295

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGAN++   D++MQIT+AFNHFGKR+ QRMPRCR+G FH+VNNDYTHW+MYA+GGSS  T
Sbjct  296   FGANDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPT  355

Query  502   IISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY  323
             IISQGNRYIA     + K+VT R+CP+  W+ WTWV+ GD+F+NGA+F  SGD     K+
Sbjct  356   IISQGNRYIAD--HPYAKQVTKRECPESEWRHWTWVTDGDIFLNGAYFRASGDQDWHHKH  413

Query  322   GYR-DNLRPLSGKEVGRLARYSGHL  251
               + D ++P     V ++ +++G L
Sbjct  414   PEKSDGIKPGPATLVAQMTQFAGRL  438



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   447 bits (1149),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 247/432 (57%), Positives = 299/432 (69%), Gaps = 22/432 (5%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD WK R  +A++  LQAYHP+PE++T +LN  V   L                   N T
Sbjct  10    DDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDVEEALT----------------VKNST  53

Query  1333  RRELRRKKGSKE-PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             RR LR KK  K  PC ATNPID+CWRC  +W+   NR RLADCA GF + + GGK GR Y
Sbjct  54    RRVLRGKKNKKGGPCMATNPIDRCWRCDPNWAS--NRKRLADCARGFGRNSVGGKFGRYY  111

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV D+SD D+  PK GTLRHAVIQK PLWI+FA SM I+LS EL++ G+KTIDGRGA V 
Sbjct  112   VVTDSSDTDLVNPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDGRGANVR  171

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             IA GAG+T+Q V NVIIHNI + DI +  GG IRD ++H G RT  +GDGI+IFGS H+W
Sbjct  172   IAYGAGITIQFVKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGDGISIFGSSHIW  231

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM NC+DGLIDA  G+TA+T+SNCHFT H++V+LFGA++  S D+RMQ+T+AFNHF
Sbjct  232   IDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQRMQVTVAFNHF  291

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             G+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TIISQGNR+IA P +   K+VT 
Sbjct  292   GQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIA-PLDLNAKQVTK  350

Query  436   RD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             RD  P+  WK W W S GD+ MNGAFF  SG      +Y     ++   G  V RL RY+
Sbjct  351   RDYAPESDWKNWRWRSEGDLLMNGAFFVQSGKRLSKRRYSRPGMIKYKPGTFVTRLTRYA  410

Query  259   GHLGRCTPGRKC  224
             G L  C  GR C
Sbjct  411   GTL-VCGIGRPC  421



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   447 bits (1149),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 233/463 (50%), Positives = 308/463 (67%), Gaps = 25/463 (5%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             M A  KI   + + L+S+A ++P   A ++  DD   Q+  EA++  L+A+HP+P  +T 
Sbjct  1     MVAGCKIK--LLMVLVSMAVLMPTLRAGIAEFDDYLLQKAEEAKQASLEAFHPDPMNVTD  58

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRA  1250
               N+ V + L     +               TRR L + KG   PC ATNPID+CWRC  
Sbjct  59    HFNQHVHLALEGIEGSNS-------------TRRSLAKYKG---PCLATNPIDRCWRCDP  102

Query  1249  DWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLW  1070
             +W+   NR +LA C LGF + TTGGK GRIYVV D SD+DV  PK GTLR+  +QK PLW
Sbjct  103   NWAK--NRKKLAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVVNPKPGTLRYGALQKRPLW  160

Query  1069  IVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP  890
             I+FA SM I+LS EL+V  +KTID RG+ V+IA GAG+++Q   NVIIH +++  + S+ 
Sbjct  161   IIFARSMIIRLSKELMVTSHKTIDARGSNVHIAYGAGLSIQFARNVIIHGLRIHHVISTG  220

Query  889   GGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCH  710
             GG+IRD  +H G+RT  +GDGI+IFGS ++W+DH+SM NC+DGLIDA  G+TA+T+SN H
Sbjct  221   GGMIRDTANHVGLRTVSDGDGISIFGSSNIWLDHLSMSNCQDGLIDAIQGSTAITISNSH  280

Query  709   FTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMY  530
             FT H+ V+LFGA++    D  MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW MY
Sbjct  281   FTHHNDVMLFGASDSYQGDSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMY  340

Query  529   AVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTP  353
             A+GGS   TIISQGNR+IA P     +++T+R+  P+  WK WTW S GD+ MNGA+F  
Sbjct  341   AIGGSQHPTIISQGNRFIAPPNPA-ARQITNRNYAPESVWKTWTWRSEGDLMMNGAYFIQ  399

Query  352   SGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SG+P     Y   D ++   G  V RL R+SG L  C  GR C
Sbjct  400   SGNPSKRRPYSRFDMIKAKPGTFVRRLTRFSGSLN-CFVGRPC  441



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   447 bits (1150),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 246/475 (52%), Positives = 305/475 (64%), Gaps = 33/475 (7%)
 Frame = -2

Query  1600  AASTKILWWVYLALLSIAAVIPATT---ADVSDDVWKQREAEARRGLLQAYHPNPEKITT  1430
             AA   I  +V++  LS  A  P  +     V D+ W QR+ +A R  + +Y PNP  +T 
Sbjct  3     AAFLNIYGYVFVFFLSFIATFPPESRAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTD  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELR--RKKGSK-----EPCRATNPID  1271
               N  VS+ ++ T +N               TRREL   RK G K       C A N ID
Sbjct  63    HFNHHVSLAMDATESNNG-------------TRRELTQVRKSGRKIHKSSGKCLAYNAID  109

Query  1270  QCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAV  1091
             +CWRC  +W+   NR +L DC LGF + TTGGK G IYVV DASD+D+  PK GTLR+AV
Sbjct  110   KCWRCDRNWAK--NRKKLTDCVLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAV  167

Query  1090  IQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKV  911
              +  PLWI+FA SM IKL  EL++  +KTIDGRGA + I  GAG+TLQ VNNVIIHNI V
Sbjct  168   TRDGPLWIIFARSMIIKLQQELMITSDKTIDGRGARIYIMEGAGLTLQYVNNVIIHNIYV  227

Query  910   GDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATA  731
               I    GG+IRD   H G+RT  +GDGI++FG+ +VWIDHVSM  C DG+IDA  G+TA
Sbjct  228   KHIVPGNGGLIRDSEHHLGLRTKSDGDGISLFGATNVWIDHVSMTRCADGMIDAIQGSTA  287

Query  730   VTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNND  551
             VT+SN HFTDH +V+LFGA +ED IDK+MQIT+AFNHFGKRL QRMPRCR+GL H+VNND
Sbjct  288   VTISNSHFTDHQEVMLFGARDEDVIDKKMQITVAFNHFGKRLEQRMPRCRFGLIHVVNND  347

Query  550   YTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFM  374
             YTHWEMYA+GG+   TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+
Sbjct  348   YTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-AKQITKREYTPFIEWKSWNWQSEGDYFL  406

Query  373   NGAFFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             NGA+F  SG      PK V     +  +RP  G  V +L   +G LG C  G+ C
Sbjct  407   NGAYFVQSGKANAWSPKPVNPLPNKFRIRPKPGTMVRKLTMDAGALG-CKHGKAC  460



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   446 bits (1146),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 238/451 (53%), Positives = 298/451 (66%), Gaps = 24/451 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             V+L  L +     A    V D VW++R   A++   QAY PNP ++   LNE V   +  
Sbjct  9     VFLISLFVVFTTVAGNIGVHDAVWQERREAAKKAARQAYQPNPGEVLDHLNENVHKSVEG  68

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
             + N                 RR L + KGS   C ATNPIDQCWRC+ +W++  NR +L 
Sbjct  69    SNNQ----------------RRGLSKYKGS---CLATNPIDQCWRCQPNWAN--NRKKLV  107

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
             DCALGF + TTGGK G++YVV D SD D+  PK GTLRHAVIQ EPLWI+F  +M I+LS
Sbjct  108   DCALGFGRHTTGGKAGKMYVVTDPSDSDLVSPKKGTLRHAVIQPEPLWIIFKNNMNIRLS  167

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              EL++  NKTIDGRGA V+IA GAG+TLQ ++NVIIHNI+V DIK+  GG+IRD   H G
Sbjct  168   EELIMTSNKTIDGRGAQVHIANGAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYG  227

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
              RT  +GDGI++FGS ++WIDHVS+  C+DGLIDA   +TA+T+SNCHF  H+ VLLFGA
Sbjct  228   FRTRSDGDGISLFGSTNIWIDHVSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGA  287

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++  S D  MQIT+AFNHFGK L QRMPR RWG  HIVNNDYT W+MYA+GGS   TI+S
Sbjct  288   SDSRSEDHIMQITVAFNHFGKGLIQRMPRVRWGFVHIVNNDYTRWQMYAIGGSQQPTILS  347

Query  493   QGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNR++A P   F KEVT RD   +S WK W W S GDV  NGAFF  SGD    +    
Sbjct  348   QGNRFVA-PDNPFAKEVTKRDYATESVWKNWVWKSEGDVMNNGAFFVQSGDVAHHKFAKG  406

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              D + P  G    +L++++G L  C PG+ C
Sbjct  407   PDMVTPKPGGFASKLSQFAGPL-NCIPGKPC  436



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   445 bits (1145),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 230/451 (51%), Positives = 299/451 (66%), Gaps = 20/451 (4%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             + L++ A  IP     +   DD  K +  EA    L++Y P+P  +T +LN  V   L E
Sbjct  11    IILVAFAITIPCLEGGIGEFDDFLKGQALEAHEIALESYVPDPVNMTDDLNINVHGALTE  70

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
              +     +           TRREL++K G   PC A NPID+CWRC+  W+   NRF+LA
Sbjct  71    VFKEESNH-----------TRRELKQKYGG--PCLALNPIDRCWRCKKGWAK--NRFKLA  115

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
              CA GF +  TGG  G++Y+V D SDDD   PK GTLR  V+QKEPLWI+FA SM IKL+
Sbjct  116   HCAKGFGRKATGGLEGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPLWIIFARSMIIKLN  175

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              ELL+  +KTIDGRGA V I  G+G+T+Q VNNVIIH +++ +IKS+PGG IRD  +H G
Sbjct  176   YELLISSDKTIDGRGANVMIKDGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVG  235

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
             +RT  +GD I+IFGS ++WIDH+S+ +CEDGL+D   G+T +T+SNCH T H+ V+LFGA
Sbjct  236   IRTKADGDAISIFGSSNIWIDHLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGA  295

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++  + DK MQ+T+AFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGSS  TI+S
Sbjct  296   SDTFTGDKIMQVTVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSAPTILS  355

Query  493   QGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNR+IA P  N  KEVTHRD  + S W+KW W S  DVFMNGA F  SG P G   +  
Sbjct  356   QGNRFIA-PNNNAAKEVTHRDYAEPSVWEKWQWRSENDVFMNGANFVQSGPPLGKLPFNK  414

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                ++P  G +  RL R++G L  C     C
Sbjct  415   GFLMKPRHGSQANRLTRFAGAL-NCKANSPC  444



>ref|XP_009757256.1| PREDICTED: pectate lyase [Nicotiana sylvestris]
 sp|P40972.1|PLY_TOBAC RecName: Full=Pectate lyase; Flags: Precursor [Nicotiana tabacum]
 emb|CAA47630.1| pectate lyase [Nicotiana tabacum]
 emb|CAA43414.1| pectate lyase [Nicotiana tabacum]
Length=397

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/375 (59%), Positives = 277/375 (74%), Gaps = 8/375 (2%)
 Frame = -2

Query  1339  VTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             + RR+L  KK  K PCRA N ID+CWRC  +W++  NR ++ADCALGF     GGK GRI
Sbjct  28    IPRRQLSNKK-YKGPCRAENAIDKCWRCDPNWAE--NRQKMADCALGFGSNAIGGKLGRI  84

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV D SDDDV +PK GTLR+ VIQKEPLWI+F  +M IKLS EL+V  NKTIDGRG  V
Sbjct  85    YVVTDNSDDDVVDPKPGTLRYGVIQKEPLWIIFGKNMKIKLSRELIVTSNKTIDGRGFNV  144

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
             +I  GAG+ +QS +N+II N+++ +I  +PGG++R+  DH G+R  DEGDGI+IF SH +
Sbjct  145   HIQNGAGIKIQSASNIIISNLRIHNIVPTPGGLLRESEDHVGLRGSDEGDGISIFSSHDI  204

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             WIDH+SM    DGLIDA A +T +T+SNCHFTDH+KV+LFGAN+   +DK M+ITLA+NH
Sbjct  205   WIDHISMSRATDGLIDAVAASTNITISNCHFTDHEKVMLFGANDHYVLDKDMKITLAYNH  264

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGKRL QRMPRCR+G FH+VNNDYTHWE YA+GGSSGATIISQGNR+IA+  E   KEVT
Sbjct  265   FGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGNRFIAED-ELLVKEVT  323

Query  439   HRDCPDDS---WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLA  269
             +R+    S   W KWTW+S GD   NGA FTPSGD   ++K  + + ++P    +VG L 
Sbjct  324   YREKLTASVAEWMKWTWISDGDDMENGATFTPSGDQNLLDKIDHLNLIKPEPSSKVGILT  383

Query  268   RYSGHLGRCTPGRKC  224
             ++SG L  C  GR C
Sbjct  384   KFSGALS-CVKGRPC  397



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   444 bits (1143),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 236/446 (53%), Positives = 297/446 (67%), Gaps = 24/446 (5%)
 Frame = -2

Query  1558  LSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnr  1379
             ++ AA   A  A+  D+ W+++EA AR  +  AY+PNPE +T   N+ V   L +     
Sbjct  1     MAAAAFCNAHIAEF-DEYWQKKEAMARANVQNAYNPNPESVTKHFNDAVLKDLEKNN---  56

Query  1378  elyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALG  1199
                           TRR LR K+    PC ATNPID+CWRC+ +W+   +R RLA CA G
Sbjct  57    --------------TRRGLRGKRRYDGPCMATNPIDRCWRCQENWAH--HRKRLATCAKG  100

Query  1198  FAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLV  1019
             F +  TGGK G  YVV D SD D+  P+ GTLR+ VIQ  PLWIVFA  M I+L+ EL+V
Sbjct  101   FGRHVTGGKNGDFYVVTDPSDLDLVNPRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIV  160

Query  1018  QGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHD  839
               NKTIDGRG  V I  GAG+T+Q V+N+IIHN+++ DIK+  GG+IRD   H G+RT  
Sbjct  161   NSNKTIDGRGVDVQIMNGAGITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRS  220

Query  838   EGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDS  659
             +GDGI+IFG+ +VWIDHVSM NC DGLIDA  G+TA+T+SN HFT H+ V+LFGA++  S
Sbjct  221   DGDGISIFGASNVWIDHVSMSNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFS  280

Query  658   IDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRY  479
              D  MQIT+AFNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+GGS   TI+SQGNR+
Sbjct  281   GDAVMQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWMMYAIGGSQHPTILSQGNRF  340

Query  478   IAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLR  302
             IA P   F KEVT R+  P++ WK W W S GD+  NGAFF PSG  K +    Y+D ++
Sbjct  341   IAPPTL-FAKEVTKREYSPEEVWKSWQWRSEGDLLKNGAFFVPSGAGK-LGNVSYKDLIK  398

Query  301   PLSGKEVGRLARYSGHLGRCTPGRKC  224
                G  V RL R+SG L +C P R C
Sbjct  399   AKPGTFVTRLTRFSGAL-KCVPNRPC  423



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   444 bits (1143),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 236/459 (51%), Positives = 306/459 (67%), Gaps = 33/459 (7%)
 Frame = -2

Query  1591  TKILWWVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNE  1418
             T I+    L +     + P   A+++D  +VW++R  EA++   +AY P+PE+ T   N+
Sbjct  6     TTIVGIKLLMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNK  65

Query  1417  RVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSD  1238
             +V   L+                  N TRR LR+  G   PC ATNPID+CWRC  +W+ 
Sbjct  66    QVHRSLD----------------GGNNTRRHLRKYTG---PCLATNPIDRCWRCDRNWAR  106

Query  1237  GPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFA  1058
               NR +LADCALGF + TTGGK G+IYVV+D+SD+D+  PK GTLRHAVIQ+ PLWI+FA
Sbjct  107   --NRKKLADCALGFGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFA  164

Query  1057  ASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGII  878
               M I+LS EL+V  +KT+DGRGA V+IA G  +TLQ V N+IIHN+ + DIK+  GG+I
Sbjct  165   HDMVIRLSEELIVTDDKTLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMI  224

Query  877   RDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDH  698
             RD V H G RT  +GDGI++FG+  VWIDHVSM NC+DGLIDA   +TA+T+SNCHFT H
Sbjct  225   RDSVSHYGFRTRSDGDGISMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHH  284

Query  697   DKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGG  518
             + V+L GA+N  S D+ MQ+TLAFNHFGK L QRMPRCRWG  H+VNNDYTHW MYA+GG
Sbjct  285   NDVILLGASNGYSNDQIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGG  344

Query  517   SSGATIISQGNRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDP  341
             S       QGNR+IA P  N  KEVT R   P+  W+ W W S GD+ MNGAFF  SG+P
Sbjct  345   SH-----XQGNRFIAPPNPN-CKEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP  398

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               +++Y  +D +    G  V RL R++G L +C   + C
Sbjct  399   --IKRYSKKDVIHSKPGTFVTRLTRFAGPL-KCKKNQPC  434



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   445 bits (1144),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 305/459 (66%), Gaps = 20/459 (4%)
 Frame = -2

Query  1588  KILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             KI +      ++ A +IP+  A +   D+VW++R  EA+    Q Y  +PE +T   N++
Sbjct  5     KIKYTFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARQIYERHPENVTLAFNQK  64

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
             +   + E                 N TRR L  KK    PC  TNPID+CWRC  +W+D 
Sbjct  65    LRNTMKEL----------KEVKGTNSTRRGLGTKKYCG-PCIVTNPIDRCWRCDPNWAD-  112

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR RLADCA+GF    TGGK G  YVV D SDD   +PK GTLR+AVIQKEPLWI+F  
Sbjct  113   -NRKRLADCAMGFGSKVTGGKNGEFYVVTDNSDD-YNDPKPGTLRYAVIQKEPLWIIFKR  170

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
              M I+L  E+++Q +KTID RG  V+I  GAG+TLQ + NVIIH + + DI    GG++R
Sbjct  171   GMNIRLHQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVR  230

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D VDH G+RT  +GDGI+IFG+ ++WIDHVSM  C DGLIDA  G+T +T+SN HFTDH+
Sbjct  231   DAVDHIGIRTKSDGDGISIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHN  290

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
             +V+LFGA++  SID+ MQITLAFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS
Sbjct  291   EVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS  350

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRDC-PDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
                TII+QGNR+IA P + F K+VT R+  P+  W +WTW S G++FMNGA+FT SGDP 
Sbjct  351   MHPTIITQGNRFIAPP-DIFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPD  409

Query  337   GVEKY-GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               +K+    D +     ++V  + R++G L  C PG+ C
Sbjct  410   WSKKHKDLYDGISAAPAEDVTWMTRFAGVLA-CKPGKPC  447



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   445 bits (1144),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 241/473 (51%), Positives = 308/473 (65%), Gaps = 31/473 (7%)
 Frame = -2

Query  1600  AASTKILWWVYLALLSIAAVI-PATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             AA   I  ++++  LS+ A + P   A+V+  D+ W QR+ +A +  + ++ PNP  +T 
Sbjct  3     AAVLNIGGYLFVFCLSLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTD  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELR-----RKKGSKEPCRATNPIDQC  1265
              LN  V++ ++ T +                TRREL      RK      C A NPID+C
Sbjct  63    HLNYHVALAVDATESTNS-------------TRRELSQVRNGRKLKRSGKCVAYNPIDRC  109

Query  1264  WRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQ  1085
             WRC  DW    NR +LADC LGF + TTGGK G IYVV DASDDD+  PK GTLRHAV +
Sbjct  110   WRCNGDWEK--NRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTR  167

Query  1084  KEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGD  905
               PLWI+F +SM I L  EL++  +KTIDGRGA V I  GAG+TLQ VNNVIIHNI V  
Sbjct  168   DGPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKH  227

Query  904   IKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVT  725
             +    GG+IRD   H G+RT  +GDGI++FG+ +VWIDHVSM  C DG+IDA  G+TA+T
Sbjct  228   VVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAIT  287

Query  724   VSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYT  545
             +SN HFTDH++V+LFGAN++  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYT
Sbjct  288   ISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYT  347

Query  544   HWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNG  368
             HWEMYA+GG+   TIISQGNR+IA P E   K++T R+  P  +WK W W S GD F+NG
Sbjct  348   HWEMYAIGGNMNPTIISQGNRFIAPPNEQ-AKQITKREYTPYVNWKMWNWQSEGDYFLNG  406

Query  367   AFFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             A+F  SG      PK +     +  +RP  G  V +L   +G LG C PG  C
Sbjct  407   AYFVQSGKQNAWSPKPINPVPKKFAIRPQPGTMVRKLTMDAGALG-CKPGTPC  458



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   444 bits (1141),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 239/431 (55%), Positives = 293/431 (68%), Gaps = 24/431 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD WK R AEA +    AY PNPE I   LN  V   L+ +                N T
Sbjct  25    DDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQALSGS----------------NST  68

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR L++  G   PCRATNPID+CWRC  +W+   NR +LADC LGF + T GGK G  YV
Sbjct  69    RRNLKKYTG---PCRATNPIDRCWRCDPNWAQ--NRKKLADCVLGFGRKTIGGKLGPYYV  123

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D+SD D+  PK GTLRHAVIQK PLWI F+ +M I+L+ EL+V  +KTID RGA V I
Sbjct  124   VNDSSDSDLMNPKPGTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARGANVQI  183

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A GAG+TLQ V NVIIH +++  I    GG+IRD VDH G+RT  +GDGI+IFGS +VWI
Sbjct  184   AYGAGITLQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWI  243

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM NC+DGLIDA  G+TA+T+SNCHFT H++V+LFGA++  S D+ MQ+T+AFNHFG
Sbjct  244   DHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQVTVAFNHFG  303

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+SQGNR+IA P   + KEVT R
Sbjct  304   QGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNV-YAKEVTKR  362

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             +  P+  WK WTW S GD+ MNGAFF  SGD +    +  +D +    G  V R+ R+SG
Sbjct  363   EYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQRKRRPFSSKDMISYKPGTYVKRMTRFSG  422

Query  256   HLGRCTPGRKC  224
              L  C  GR C
Sbjct  423   ALA-CFVGRPC  432



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   444 bits (1142),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 228/453 (50%), Positives = 304/453 (67%), Gaps = 23/453 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             V + L+S+A ++P   A ++  DD   Q+  EA++  L+A+HP+P  +T   N+ V + L
Sbjct  9     VVMVLVSMAVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLAL  68

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
                  +               TRR L +  G   PC ATNPID+CWRC  +W+   NR +
Sbjct  69    EGIEGSNS-------------TRRSLSKYNG---PCLATNPIDRCWRCDPNWAK--NRKK  110

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             LA C LGF + TTGGK GRIYVV D SD+DV  P+ GTLR+  +QK+PLWI+FA SM I+
Sbjct  111   LAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIR  170

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             LS EL++  +KTID RGA V+IA GAG+++Q   NVIIH +++  + S+ GG+IRD  +H
Sbjct  171   LSKELMITSHKTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANH  230

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G+RT  +GDGI+IFGS ++W+DH+SM NC+DGLIDA  G+TA+T+SN HFT H+ V+LF
Sbjct  231   VGLRTVSDGDGISIFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLF  290

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             GA++    D  MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI
Sbjct  291   GASDSYQGDSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTI  350

Query  499   ISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY  323
             ISQGNR+IA P     +++T+R+   +S WK WTW S GD+ MNGA+F  SG+P     Y
Sbjct  351   ISQGNRFIAPPNPA-ARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPY  409

Query  322   GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                D ++   G  V RL R+SG L  C  GR C
Sbjct  410   SRFDMIKAKPGTFVRRLTRFSGSLN-CYVGRPC  441



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   444 bits (1143),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 238/461 (52%), Positives = 300/461 (65%), Gaps = 30/461 (7%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
              +LL +A + P   A+V+  D+ W QR+ +A +  + ++ PNP  +T  LN  V++ +  
Sbjct  15    FSLLLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVGA  74

Query  1393  TYnnrelyddsnnnnndNVTRRELR-----RKKGSKEPCRATNPIDQCWRCRADWSDGPN  1229
             T +                TRREL      RK      C A NPID+CWRC  DW    N
Sbjct  75    TESINS-------------TRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCHGDWEK--N  119

Query  1228  RFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASM  1049
             R +LADC LGF + TTGGK G IYVV DASDDD+  PK GTLRHAV +  PLWI+F +SM
Sbjct  120   RKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSM  179

Query  1048  TIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDC  869
              I L  EL++  +KTIDGRGA V I  GAG+TLQ VNNVIIHNI +  +    GG+IRD 
Sbjct  180   IINLQQELIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYIKHVVPKSGGLIRDS  239

Query  868   VDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKV  689
               H G+RT  +GDGI++FG+ +VWIDHVSM  C DG+IDA  G+TA+T+SN HFTDH++V
Sbjct  240   EQHIGLRTVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEV  299

Query  688   LLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSG  509
             +LFGAN++  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTHWEMYA+GG+  
Sbjct  300   MLFGANDKHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMN  359

Query  508   ATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG-----  347
              TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+NGA+F  SG     
Sbjct  360   PTIISQGNRFIAPPNEQ-AKQITKREYTPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAW  418

Query  346   DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              PK V     +  +RP  G  V +L   +G LG C PG  C
Sbjct  419   SPKPVNPVPRKFAIRPQPGTMVRKLTMDAGALG-CKPGTPC  458



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   445 bits (1144),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 251/483 (52%), Positives = 310/483 (64%), Gaps = 30/483 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS----DDVWKQREAEARRGLLQAYHPNPEKI  1436
             M      L  V+L   +I  V    TA  S    ++ W+ R  EA    L+AY  NP  +
Sbjct  1     MGEPVSKLVCVFLCAFTIVVVPTLITAQGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTV  60

Query  1435  TTELNERVSIGLNETYnnrely-------------ddsnnnnndNVTRRELRRKKGSKEP  1295
                 N++ S   NE                           +  N TRRELR KK     
Sbjct  61    IGAFNKQAS--ENEMPGKTAAQDDKLTKLNLPPCCHTQQFLSEKNSTRRELRGKKWGGG-  117

Query  1294  CRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPK  1115
             C ATNPID+CWRC+ +W+D  NR RLADC +GF +GTTGGK G  YVV D+SDD +  PK
Sbjct  118   CLATNPIDRCWRCQPNWAD--NRKRLADCVVGFGRGTTGGKNGAFYVVTDSSDDSILAPK  175

Query  1114  AGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNN  935
              GTLRHAVIQKEPLWI+F   M I+L+ EL++QG+KTIDGRG  V+IA GAG+T+Q V N
Sbjct  176   PGTLRHAVIQKEPLWIIFERDMVIRLTQELIMQGDKTIDGRGVSVHIAYGAGITIQFVKN  235

Query  934   VIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLI  755
             VIIH + + DI    GG++RD VDH G+RT  +GDGI+IFGS +VWIDHVSM  C DGLI
Sbjct  236   VIIHGLHIHDIHQGSGGLVRDSVDHFGIRTMSDGDGISIFGSSNVWIDHVSMWKCYDGLI  295

Query  754   DAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWG  575
             DA   +TA+T+SN HFTDH++V+LFGA++  S D  MQIT+AFNHFGKRL QRMPRCRWG
Sbjct  296   DAVEASTAITISNSHFTDHNEVMLFGASDSQSKDAVMQITVAFNHFGKRLIQRMPRCRWG  355

Query  574   LFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKE----VTHRDCPDDS-WK  410
               H+VNNDYTHWEMYA+GGS    IISQGNR+IA P + F KE    VT RD  +++ WK
Sbjct  356   FIHVVNNDYTHWEMYAIGGSQHPIIISQGNRFIAPP-DIFKKEVRRTVTKRDYAEEARWK  414

Query  409   KWTWVSSGDVFMNGAFFTPSGDPKGVEKYG-YRDNLRPLSGKEVGRLARYSGHLGRCTPG  233
             +WTW S GD+FMNGAFF  SGDP   +K+    D + P    EV  + R++G L  C PG
Sbjct  415   EWTWRSEGDLFMNGAFFVQSGDPDFTKKHPEIFDGIAPADSSEVTWITRFAGAL-MCRPG  473

Query  232   RKC  224
               C
Sbjct  474   SPC  476



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   443 bits (1140),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 245/463 (53%), Positives = 300/463 (65%), Gaps = 31/463 (7%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             M  S   L + Y+  L   A+ P   A++   D VW +R  EAR    QAY PNP K+T 
Sbjct  1     METSKFSLLFFYVICL---AIFPTLNANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTA  57

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRA  1250
             E N  V   +  + N                +RR L  +     PC+ATNPID+CWRC  
Sbjct  58    EFNTHVIRAMRGSNN----------------SRRGLSNQYDG--PCKATNPIDKCWRCDP  99

Query  1249  DWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLW  1070
             +W    NR RLADCALGF  GTTGGK G+IYVV D+SD+D+  PK GTLRHA IQ+EPLW
Sbjct  100   NWEK--NRKRLADCALGFGHGTTGGKDGKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLW  157

Query  1069  IVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP  890
             I+F  +M IKL  EL++  NKTID RGA V+I+ GA +TLQ V N+IIH + + DIK   
Sbjct  158   IIFDRNMNIKLHAELMLTDNKTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDIKKCS  217

Query  889   GGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCH  710
             GG+IRD +DH G+R   +GD I++FGS +VWIDHVS  NC+DGLID  + +TAVT+SNCH
Sbjct  218   GGLIRDSMDHYGVRAMSDGDAISVFGSTYVWIDHVSFTNCDDGLIDVVSASTAVTISNCH  277

Query  709   FTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMY  530
              T H+ VLLFGA++  S DK MQ+TLAFNHFGK L QRMPRCRWG FHIVNNDYTHW MY
Sbjct  278   LTKHNDVLLFGASDSYSGDKIMQVTLAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMY  337

Query  529   AVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTP  353
             A+GGS   TIISQGNR+IA P +   KEVT RD  P+  WK W W S GD+ MNGAFF  
Sbjct  338   AIGGSQQPTIISQGNRFIA-PNDRNAKEVTKRDYAPESVWKNWNWRSEGDLLMNGAFFVQ  396

Query  352   SGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SG  K V K   +  +    GK V  L R++G L +C   + C
Sbjct  397   SG--KNVAK-NPKAEIIAKPGKAVSSLTRFAGPL-KCEVNKSC  435



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   444 bits (1142),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 240/473 (51%), Positives = 309/473 (65%), Gaps = 31/473 (7%)
 Frame = -2

Query  1600  AASTKILWWVYLALLSIAAVI-PATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             AA   I  ++++  LS+ A + P   A+V+  D+ W QR+ +A +  + ++ PNP  +T 
Sbjct  3     AAFLNIGGYLFVFCLSLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTD  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKE-----PCRATNPIDQC  1265
              LN  V++ ++ T +                TRREL + +  ++      C A NPID+C
Sbjct  63    HLNYHVALAVDATESINS-------------TRRELSQVRNGRKLKRSGKCVAYNPIDRC  109

Query  1264  WRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQ  1085
             WRC  DW    NR +LADC LGF + TTGGK G IYVV DASDDD+  PK GTLRHAV +
Sbjct  110   WRCNGDWEK--NRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTR  167

Query  1084  KEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGD  905
               PLWI+F +SM I L  EL++  +KTIDGRGA V I  GAG+TLQ VNNVIIHNI V  
Sbjct  168   DGPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKH  227

Query  904   IKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVT  725
             +    GG+IRD   H G+RT  +GDGI++FG+ +VWIDHVSM  C DG+IDA  G+TA+T
Sbjct  228   VVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAIT  287

Query  724   VSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYT  545
             +SN HFTDH++V+LFGAN++  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYT
Sbjct  288   ISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYT  347

Query  544   HWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNG  368
             HWEMYA+GG+   TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+NG
Sbjct  348   HWEMYAIGGNMNPTIISQGNRFIAPPNEQ-AKQITKREYTPYVDWKMWNWQSEGDYFLNG  406

Query  367   AFFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             A+F  SG      PK V     +  +RP  G  V +L   +G LG C PG  C
Sbjct  407   AYFVQSGKQNAWSPKPVNPVPKKFAIRPQPGTMVRKLTMDAGALG-CKPGTPC  458



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   442 bits (1138),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 227/451 (50%), Positives = 303/451 (67%), Gaps = 23/451 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             + L+S+A ++P   A ++  DD   Q+  EA++  L+A+HP+P  +T   N+ V + L  
Sbjct  1     MVLVSMAVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLALEG  60

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
                +               TRR L +  G   PC ATNPID+CWRC  +W+   NR +LA
Sbjct  61    IEGSNS-------------TRRSLSKYNG---PCLATNPIDRCWRCDPNWAK--NRKKLA  102

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
              C LGF + TTGGK GRIYVV D SD+DV  P+ GTLR+  +QK+PLWI+FA SM I+LS
Sbjct  103   KCVLGFGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLS  162

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              EL++  +KTID RGA V+IA GAG+++Q   NVIIH +++  + S+ GG+IRD  +H G
Sbjct  163   KELMITSHKTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVG  222

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
             +RT  +GDGI+IFGS ++W+DH+SM NC+DGLIDA  G+TA+T+SN HFT H+ V+LFGA
Sbjct  223   LRTVSDGDGISIFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGA  282

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++    D  MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TIIS
Sbjct  283   SDSYQGDSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIIS  342

Query  493   QGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNR+IA P     +++T+R+   +S WK WTW S GD+ MNGA+F  SG+P     Y  
Sbjct  343   QGNRFIAPPNPA-ARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPYSR  401

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              D ++   G  V RL R+SG L  C  GR C
Sbjct  402   FDMIKAKPGTFVRRLTRFSGSLN-CYVGRPC  431



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   442 bits (1137),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 238/465 (51%), Positives = 306/465 (66%), Gaps = 32/465 (7%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             + ++TK+    +  L++ A VIP   A ++  DD  K +  EA++  L+AY P PE +T 
Sbjct  6     VGSATKV---AFNLLVTFAIVIPCLEAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTD  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKG-SKEPCRATNPIDQCWRCR  1253
             ELN  V + L  +                  TRRELR++KG S + C A+NPID CWRC 
Sbjct  63    ELNFHVHLSLENS------------------TRRELRQRKGRSGKKCVASNPIDTCWRCN  104

Query  1252  ADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPL  1073
              +W++  +R+RLA C  GF +  TGG GG IYVV D SDDD+  PK GT+RHAV Q+ PL
Sbjct  105   KNWAN--DRYRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPL  162

Query  1072  WIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSS  893
             WI+F  SM IKL+ EL++  +KTIDGRGA V    GAG+T+Q VNNVIIH +++ +I   
Sbjct  163   WIIFQRSMMIKLNQELMISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPK  222

Query  892   PGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNC  713
              GG+IRD  +H G+RT  +GD I+IFG+ +VWIDHVS+ NC DGLID   G+TA+T+SNC
Sbjct  223   EGGMIRDSYNHVGLRTKSDGDAISIFGASNVWIDHVSLSNCADGLIDVIQGSTAITISNC  282

Query  712   HFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEM  533
             H T H+ V+LFGA++  S DK MQIT+AFNHFG+ L QRMPRCRWG  H++NNDYTHW M
Sbjct  283   HMTKHNDVMLFGASDSYSGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWMM  342

Query  532   YAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFT  356
             YA+GGSSG TI+SQGNR+IA P  N  K +THRD  +   WK W W S  D+F+NGA F 
Sbjct  343   YAIGGSSGPTILSQGNRFIA-PNNNAAKLITHRDYAEPQVWKNWQWQSEMDLFINGAQFI  401

Query  355   PSGDP-KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             PSG P K   K G    ++P  G    RL R SG L  C  GR C
Sbjct  402   PSGSPIKTTYKKGLL--MKPRDGTHASRLTRNSGAL-NCIVGRPC  443



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   443 bits (1139),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 241/466 (52%), Positives = 305/466 (65%), Gaps = 32/466 (7%)
 Frame = -2

Query  1576  WVYLALLSIAAVI-PATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSI  1406
             +V++   S  A++ P   A+V+  D  W QR+++A +  + +Y PNP  +T   N  V+I
Sbjct  11    YVFVFFSSFLAIVAPQVRANVAVFDSYWTQRQSDALKQTMGSYDPNPINVTNHFNYHVNI  70

Query  1405  GLNETYnnrelyddsnnnnndNVTRREL------RRKKGSKEPCRATNPIDQCWRCRADW  1244
              ++ + +N +             TRREL      R+ K     C A NPID+CWRC  +W
Sbjct  71    AVDVSESNND-------------TRRELTQVRSGRKTKKHSGKCLAYNPIDKCWRCDRNW  117

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             +   NR +LADC LGF + TTGGK G IYVVKDASDDD+  PK GTLRHAV +  PLWI+
Sbjct  118   AK--NRKKLADCVLGFGRRTTGGKDGPIYVVKDASDDDLINPKPGTLRHAVTRNGPLWII  175

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA SM IKL  EL++  +KTIDGRGA V I  GAG+TLQ VNNVIIHNI V  I    GG
Sbjct  176   FARSMIIKLQQELMITSDKTIDGRGARVYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGG  235

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD  DH G+RT  +GDGI++FG+ ++WIDHVSM  C DG+IDA  G+TAVT+SN HFT
Sbjct  236   LIRDSEDHIGLRTKSDGDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFT  295

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
             DH +V+LFGA +E  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTHWEMYA+
Sbjct  296   DHQEVMLFGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAI  355

Query  523   GGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG  347
             GG+   TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+NGA+F  SG
Sbjct  356   GGNMNPTIISQGNRFIAPPNEQ-AKQITKREYTPYTEWKSWNWQSEGDYFLNGAYFVQSG  414

Query  346   -----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                    K       +  +RP  G  V +L   +G LG C  G+ C
Sbjct  415   KANAWSSKPKNPLPNKFAIRPKPGTMVRKLTMDAGALG-CKQGKAC  459



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   442 bits (1138),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 306/471 (65%), Gaps = 35/471 (7%)
 Frame = -2

Query  1591  TKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERV  1412
             T +L +V LAL  IA  + A  A V D+ W QR+ EA R  L++Y P+P  +T   N   
Sbjct  10    TYVLAFVSLALAIIAPSVQAHIA-VYDEYWTQRQTEALRRTLESYEPDPLNVTDHFNYHS  68

Query  1411  SIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCR-------ATNPIDQCWRCR  1253
             ++ +  T                  TRRELR   G ++  +       + N ID+CWR  
Sbjct  69    ALAMETTEAVNG-------------TRRELRVVGGGRKTIKKRGGRFQSLNAIDKCWRGD  115

Query  1252  ADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPL  1073
              +W+   NR +LADC LGF + TTGGK G IY V DASD+DV  P+ GTLRHAV +  PL
Sbjct  116   KNWAK--NRKKLADCVLGFGRKTTGGKAGPIYEVTDASDNDVMNPRPGTLRHAVTRDRPL  173

Query  1072  WIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSS  893
             WI+FA SM IKL  EL++  +KTIDGRG  V+I GGAG+T+Q V NVIIHNI +  I+  
Sbjct  174   WIIFAKSMVIKLQQELIITNDKTIDGRGVSVHITGGAGLTIQFVKNVIIHNIHMKFIERR  233

Query  892   PGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNC  713
              GG+IRD  +H G+RT  +GDGI IFG+ +VWIDHVSM NC DG+IDA  G+TA+T+SNC
Sbjct  234   AGGMIRDSENHFGLRTESDGDGINIFGATNVWIDHVSMRNCSDGMIDAIMGSTAITISNC  293

Query  712   HFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEM  533
             HFTDH++V+LFGA N D IDK+MQIT+AFNHFGKRL QRMPR R+G+ H+VNNDYTHW+M
Sbjct  294   HFTDHEEVMLFGAKNGDVIDKKMQITVAFNHFGKRLDQRMPRVRYGMVHVVNNDYTHWQM  353

Query  532   YAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFT  356
             YA+GG+   TIISQGNR+IA P E+  K++T R+  P   WK W W S  D F+NGA+F 
Sbjct  354   YAIGGNMNPTIISQGNRFIAPPEED-KKQITKREYTPYPEWKSWNWQSERDYFLNGAYFV  412

Query  355   PSGD-------PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              SG        PK      +   +RP  G +V RL + +G LG C PG+ C
Sbjct  413   QSGKSNAWSSTPKNPIPRKF--TIRPQPGTKVRRLTKDAGTLG-CKPGKSC  460



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   442 bits (1136),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 228/463 (49%), Positives = 302/463 (65%), Gaps = 26/463 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             MA S   + +++L   +I+  IP   A ++  DD  K +  EA    L++Y P+P  +T 
Sbjct  1     MAGSASKVTFIFLVAFAIS--IPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTA  58

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRA  1250
             E N  V   L E  N+               TRREL++K   + PC ATNPID+CWRCR 
Sbjct  59    EFNIHVHRALMEESND---------------TRRELKQK--YRGPCLATNPIDRCWRCRK  101

Query  1249  DWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLW  1070
             DW+   +R+RLA C  GF +   GG  G+IYVV D+SDD+   P+ GTLR+ V+Q+EPLW
Sbjct  102   DWAQ--DRYRLASCGKGFGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLW  159

Query  1069  IVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP  890
             I+FA SM I L  ELL+  +KTIDGRGA V I GGAG+ +Q VNN+IIH I++  IKS  
Sbjct  160   IIFAQSMVITLKFELLISSDKTIDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSME  219

Query  889   GGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCH  710
             G ++RD  +H G+RT  +GD ++IFGS ++W+DH+S+  CEDGLID   G+T +T+SNCH
Sbjct  220   GTMLRDLWNHVGIRTRCDGDAVSIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCH  279

Query  709   FTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMY  530
              T H+ V+LFGA++  + DK MQ+T+AFNHFG+ L QRMPRCRWG  H++NNDYTHW MY
Sbjct  280   MTKHNDVMLFGASDTYAGDKIMQVTVAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMY  339

Query  529   AVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTP  353
             A+GGSS  TI+SQGNR+IA P  N  KE+THRD  P + W KW W S  D+FMNGA F  
Sbjct  340   AIGGSSEPTILSQGNRFIA-PNNNAAKEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQ  398

Query  352   SGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SG P G   +     ++P  G E  RL R++G L  C  G+ C
Sbjct  399   SGSPLGKLPFNKGLMMKPRPGAEANRLTRFAGAL-NCKVGKPC  440



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   441 bits (1135),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 232/431 (54%), Positives = 291/431 (68%), Gaps = 25/431 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+VWK+R  +A++    AY+PNP+ +   LN +V   +  + +                 
Sbjct  29    DEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVRGSKSR----------------  72

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR+L+R  G    C ATNPIDQCWRC  +W+   NR +L DC LGF + TTGGKGG+IYV
Sbjct  73    RRDLQRYSGK---CMATNPIDQCWRCDPNWAR--NRMKLTDCVLGFGRKTTGGKGGKIYV  127

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SD+++  PK GTLRHAVIQ EPLWI+FA +M IKL+ EL++  NKTID RG  V+I
Sbjct  128   VMDNSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIKLNQELIMTSNKTIDARGRQVHI  187

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A G G+ LQ ++NVII N+ + D K+  GG+IRD V H G R+  +GDGI+IFGS +VWI
Sbjct  188   AHGGGLMLQFIHNVIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWI  247

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+SM NC+DGLIDA  G+TA+T+SNCHFT H+ V+LFGA++  S D  MQITLAFNHFG
Sbjct  248   DHISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFG  307

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
               L QRMPR RWG  H+VNNDYTHW MYA+GGS   TI+SQGNR+IA P  N  KEVT R
Sbjct  308   HGLTQRMPRVRWGFVHVVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPN-AKEVTKR  366

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             D  P++ WK W W S GD+ MNGAFF  SGDPK     G  D +    G  V  L ++SG
Sbjct  367   DYAPENVWKNWVWKSQGDLMMNGAFFVESGDPKHAFLKG-PDMITSKPGSSVSSLTQFSG  425

Query  256   HLGRCTPGRKC  224
              L +C  GR C
Sbjct  426   SL-KCIEGRPC  435



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   441 bits (1135),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 228/463 (49%), Positives = 302/463 (65%), Gaps = 26/463 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             MA S   + +++L   +I+  IP   A ++  DD  K +  EA    L++Y P+P  +T 
Sbjct  1     MAGSASKVTFIFLVAFAIS--IPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTA  58

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRA  1250
             E N  V   L E  N+               TRREL++K   + PC ATNPID+CWRCR 
Sbjct  59    EFNIHVHRALMEESND---------------TRRELKQK--YRGPCLATNPIDRCWRCRK  101

Query  1249  DWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLW  1070
             DW+   +R+RLA C  GF +   GG  G+IYVV D+SDD+   P+ GTLR+ V+Q+EPLW
Sbjct  102   DWAQ--DRYRLASCGKGFGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLW  159

Query  1069  IVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP  890
             I+FA SM I L  ELL+  +KTIDGRGA V I GGAG+ +Q VNN+IIH I++  IKS  
Sbjct  160   IIFAQSMVITLKFELLISSDKTIDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSME  219

Query  889   GGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCH  710
             G ++RD  +H G+RT  +GD ++IFGS ++W+DH+S+  CEDGLID   G+T +T+SNCH
Sbjct  220   GTMLRDLWNHVGIRTRCDGDAVSIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCH  279

Query  709   FTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMY  530
              T H+ V+LFGA++  + DK MQ+T+AFNHFG+ L QRMPRCRWG  H++NNDYTHW MY
Sbjct  280   MTKHNDVMLFGASDTYAGDKIMQVTVAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMY  339

Query  529   AVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTP  353
             A+GGSS  TI+SQGNR+IA P  N  KE+THRD  P + W KW W S  D+FMNGA F  
Sbjct  340   AIGGSSEPTILSQGNRFIA-PNNNAAKEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQ  398

Query  352   SGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SG P G   +     ++P  G E  RL R++G L  C  G+ C
Sbjct  399   SGAPLGKLPFNKGLMMKPRPGAEANRLTRFAGAL-NCKVGKPC  440



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   442 bits (1136),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 238/467 (51%), Positives = 304/467 (65%), Gaps = 32/467 (7%)
 Frame = -2

Query  1597  ASTKILWWVYLALLSIAAVIPA-------TTADVSDDVWKQREAEARRGLLQAYHPNPEK  1439
             +STKI    ++ L++ A  IP        + A++ DD  K R  EA +  ++ Y P PE 
Sbjct  10    SSTKI---AFILLVTFAITIPCLEAAHVLSPAEI-DDFVKARAEEAHKVAVETYVPIPEG  65

Query  1438  ITTELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRK-KGSKEPCRATNPIDQCW  1262
             +  +LN  V + +    NN               TRRE+R+K K    PC ATNPID CW
Sbjct  66    VAHDLNVAVHMSMEAEENN---------------TRREMRQKGKKHDGPCEATNPIDSCW  110

Query  1261  RCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQK  1082
             RC+ADW+   NRF+LA C+ GF + TTGG GG IYVV D SD+D+  PK GTLR   +QK
Sbjct  111   RCKADWA--ANRFQLAKCSKGFGRKTTGGLGGPIYVVTDESDNDMVNPKPGTLRFGAVQK  168

Query  1081  EPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDI  902
              PLWI FA SM I+L+ EL+V  +KTIDGRGA V I  GAG+T+Q VNNVIIH + + +I
Sbjct  169   GPLWITFARSMVIRLNQELMVSSDKTIDGRGANVQIRDGAGITMQFVNNVIIHGLHIQNI  228

Query  901   KSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTV  722
             K+ PGG+IRD  DH G RT  +GD I+I+GS ++WIDH+S+  CEDGL+D   G+T +T+
Sbjct  229   KAKPGGLIRDSFDHTGQRTRSDGDAISIYGSSNIWIDHLSLSECEDGLVDIIQGSTGITI  288

Query  721   SNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTH  542
             SNCH T H+ V+LFGA++  + DK MQIT+AFNHFG+ L QRMPRCR+G  H++NNDYTH
Sbjct  289   SNCHMTKHNDVMLFGASDSYTGDKLMQITVAFNHFGQGLIQRMPRCRYGFVHVLNNDYTH  348

Query  541   WEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGA  365
             W MYA+GGSS  TI+SQGNR+IA P     KEVTHRD  P D WK W W S  DVFMNGA
Sbjct  349   WIMYAIGGSSSPTILSQGNRFIA-PDNGAAKEVTHRDYAPPDVWKNWQWSSELDVFMNGA  407

Query  364   FFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              F PSG P   + +     ++P  G  V RL R +G L  C  G+ C
Sbjct  408   KFVPSGAPINRKPFKKAYMMQPRDGSHVSRLTRNAGAL-NCVVGKPC  453



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   441 bits (1133),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 235/455 (52%), Positives = 300/455 (66%), Gaps = 30/455 (7%)
 Frame = -2

Query  1585  ILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSI  1406
              L+ +++ +LSI A I        D+VW++R  +A++    AYHPNP+ +   LN +V  
Sbjct  9     FLFVMFVLVLSIEAHIGEF-----DEVWRKRAQQAKKAARHAYHPNPKIVADHLNNQVDK  63

Query  1405  GLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNR  1226
              +  + +                 RR+L R  G    C+ATNPIDQCWRC  +W+   NR
Sbjct  64    AVRGSNSR----------------RRDLHRYNGQ---CKATNPIDQCWRCDPNWAR--NR  102

Query  1225  FRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMT  1046
              +LADC LGF + TTGGKGG+ YVV D SD+D+  PK GTLRHAVIQ +PLWI+FA +M 
Sbjct  103   MKLADCVLGFGRKTTGGKGGKSYVVTDNSDNDLVNPKPGTLRHAVIQPQPLWIIFAKNMV  162

Query  1045  IKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCV  866
             I+L+ EL++  NKTID RG  V+IA G G+ LQ ++NVII N+++ D K+  GG+IRD V
Sbjct  163   IRLNEELIMTSNKTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSV  222

Query  865   DHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVL  686
             +H G RT  +GDGI+IFGS +VWIDHVSM NC+DGLIDA   +TA+T+SNCHFT H++V+
Sbjct  223   NHYGYRTKSDGDGISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNCHFTKHNEVM  282

Query  685   LFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGA  506
             LFGA++  S D  MQITLAFNHFG+ L QRMPR RWG  H VNNDYTHW MYA+GGS   
Sbjct  283   LFGASDSSSRDSIMQITLAFNHFGQGLRQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHP  342

Query  505   TIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE  329
             TI+SQGNR+IA P  N  KEVT RD  P+  WK W W S GD+ MNGAFF  SG+P    
Sbjct  343   TILSQGNRFIAPPNPN-AKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPNHAF  401

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                  D +    G  V  L R+SG L  C  G+ C
Sbjct  402   LRS-PDMISSKPGSFVSSLTRFSGSLN-CIEGKPC  434



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   441 bits (1133),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 314/464 (68%), Gaps = 36/464 (8%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             MA    +L +V+    ++A +IP+  AD+   DDVW++R  +A++  L+AY P+PE+ T 
Sbjct  1     MAVGKAMLIFVF----TLATLIPSLLADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATD  56

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRR-KKGSKEPCRATNPIDQCWRCR  1253
               N  V+                        TRR LR+ +K    PC+ TNPID+CWRC+
Sbjct  57    AFNVEVN-----------------------NTRRNLRQGRKKYAGPCQVTNPIDRCWRCQ  93

Query  1252  ADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPL  1073
              +W+   NR +LA CALGF + TTGG  GRIYVV D+SD++V +PK GTLRHAVIQKEPL
Sbjct  94    RNWAK--NRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPL  151

Query  1072  WIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSS  893
             WI+F+ +M IKLS EL++  +KTIDGRG  V+I+ G G+T+Q ++NVIIH I++  I ++
Sbjct  152   WIIFSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGGGITIQFIHNVIIHGIRIHHIIAT  211

Query  892   PGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNC  713
              GG IRD VDH G+RT+ +GDGI+IFGS  VWIDHVSM  C DGLIDA  G+TA+T+SNC
Sbjct  212   SGGNIRDSVDHYGIRTNSDGDGISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNC  271

Query  712   HFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEM  533
             HFT H+  +L GA++  S D  MQ+T+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW +
Sbjct  272   HFTHHNDAILLGASDSYSGDHLMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRL  331

Query  532   YAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFT  356
             YA+GGS   TIISQGNR+IA P E+  K+VT RD      W KWTW S  D+ MNGAFF 
Sbjct  332   YAIGGSKHPTIISQGNRFIAPP-ESHLKQVTKRDYATKGEWSKWTWRSENDLMMNGAFFV  390

Query  355   PSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              SG P+  +K   +  ++   G    R+ R++G L  C PGRKC
Sbjct  391   QSGQPR-TKKPNRKFMIKAKPGAVATRMTRFAGALD-CKPGRKC  432



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   441 bits (1135),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 240/474 (51%), Positives = 304/474 (64%), Gaps = 35/474 (7%)
 Frame = -2

Query  1597  ASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNE  1418
             A   +L +++ ++  +A  + A  A V D+ W QR+A A R  L+ Y PNP  +T   N 
Sbjct  10    AGNFVLCFLFSSISDVAQPVKAHVA-VFDEYWTQRQAHALRQTLRFYDPNPFNVTDHFNH  68

Query  1417  RVSIGLNETYnnrelyddsnnnnndNVTRREL--------RRKKGSKEPCRATNPIDQCW  1262
              V++ + E                   TRREL          K+ +   C A NPID+CW
Sbjct  69    HVNLAVEEATEASNG------------TRRELWQVGSGGKHLKRRNTGKCVAYNPIDRCW  116

Query  1261  RCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQK  1082
             RC+ +W+   +R +LADC LGF + TTGGK GR YVV DASD D+  P+ GTLRHAV + 
Sbjct  117   RCQPNWAK--DRKKLADCVLGFGRRTTGGKAGRYYVVTDASDTDLINPRPGTLRHAVTRD  174

Query  1081  EPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDI  902
             EPLWIVF  SM I+L+ EL++  NKTIDGRG  V+I GGAG+T+Q VNNVIIHNI + DI
Sbjct  175   EPLWIVFERSMVIRLAQELIITSNKTIDGRGVRVHITGGAGLTVQFVNNVIIHNIYIKDI  234

Query  901   KSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTV  722
                 GG+IRD   H G+RT  +GDGI IFG+ +VWIDHVSM +C DG+IDA  G+T +T+
Sbjct  235   VPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDHVSMAHCSDGMIDAIQGSTGITI  294

Query  721   SNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTH  542
             SNCH TDH +V+LFGA ++D ID +MQIT+AFNHFGKRL QRMPRCR+GL H+VNNDYTH
Sbjct  295   SNCHLTDHGEVMLFGATDKDEIDTKMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTH  354

Query  541   WEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGA  365
             WEMYA+GG+   TIISQGNR+IA P E   K+VT R+  P   WK W W S GD F+NGA
Sbjct  355   WEMYAIGGNMNPTIISQGNRFIAPPNEQ-AKQVTKREYTPYPEWKSWNWQSEGDYFLNGA  413

Query  364   FFTPSGD-------PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +F  SG        PK      +   +RP  G  V +L   SG LG C  G+ C
Sbjct  414   YFVQSGRANAWSVAPKNPVPSKFA--IRPQPGTLVRKLTMNSGVLG-CKKGKPC  464



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   441 bits (1134),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 233/432 (54%), Positives = 288/432 (67%), Gaps = 24/432 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D  WK+R  EA +  +++YH NPE+   E +  V+  L++                +N T
Sbjct  43    DAYWKERAQEALKEAMESYHKNPEQAAEEFHTGVAELLSK----------------ENTT  86

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR  KG   PC ATNPID CWRC A+W++  NR ++  CA GF K  TGGK G IYV
Sbjct  87    RRNLRGNKGYNGPCMATNPIDACWRCDANWAN--NRKKIVGCAQGFGKKATGGKDGPIYV  144

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V   +D+DVQ PK GTLRHAVIQK PLWI+FA SM I+L  EL+V  +KTIDGRGA V I
Sbjct  145   VTVGTDNDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRGANVVI  204

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
               G G+TLQ V NVII N+ +  I S PGG+IRD VDH G+RT  +GDGI++FG+ +VWI
Sbjct  205   EEGGGITLQFVKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGISLFGASNVWI  264

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM  C DGLIDA   +TA+T+SN HFTDHD V+LFGANN  + DK MQITLAFNHFG
Sbjct  265   DHVSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFG  324

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPR R G FH+VNNDYTHW MYA+GG+   TIISQGNR+IA P     K+VTHR
Sbjct  325   QGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIA-PANAATKQVTHR  383

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLS-GKEVGRLARYS  260
             +  P+  WK W W S GD+ MNGAFF  SG   G  ++  + ++ P   G    +L ++S
Sbjct  384   EHTPESEWKNWEWRSEGDLMMNGAFFVESG--SGASQHPAKLDMMPFQPGTFATKLTKFS  441

Query  259   GHLGRCTPGRKC  224
             G L  C  G+ C
Sbjct  442   GAL-NCVVGKPC  452



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   441 bits (1134),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 304/461 (66%), Gaps = 35/461 (8%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             LS+A V+P+  A ++  D+ W QR+ EA +  L+AY P P  +T   N + ++ +  T  
Sbjct  14    LSLAVVVPSVQAHIAVHDEYWTQRQTEALQQTLEAYDPEPLNVTDHFNHQAALAMVPT--  71

Query  1384  nrelyddsnnnnndNVTRRELRR-KKGSKEPCR-----ATNPIDQCWRCRADWSDGPNRF  1223
                           N TRRELR+  +G+K+P R     + N ID+CWR   +W    NR 
Sbjct  72    -----------GIVNETRRELRQVGRGNKKPRRGRRYESLNAIDKCWRGDKNWDK--NRK  118

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC LGF + TTGGK G  YVV D SD D+  PK GTLR+AV +  PLWI+FA SM I
Sbjct  119   KLADCVLGFGRKTTGGKNGPFYVVTDPSDTDLMNPKPGTLRYAVTRDRPLWIIFARSMII  178

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  +KTIDGRGA V+I GGAG+TLQ V NVIIHNI +  IK   GG+IRD   
Sbjct  179   KLQQELIITNDKTIDGRGANVHITGGAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEH  238

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GDGI IFG+ +VWIDHVSM +C DG+IDA  G+TA+T+SN HFTDHD+V+L
Sbjct  239   HFGLRTVSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVML  298

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FG  N+D IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+   T
Sbjct  299   FGGTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPT  358

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD------  344
             IISQGNR+IA P E+  K+VT R+  P   WK W W S  D F+NGA+F  SG       
Sbjct  359   IISQGNRFIAPPIED-SKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWST  417

Query  343   -PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              PK      +   +RP  G +V RL + +G LG C PG+ C
Sbjct  418   APKNPIPRKFA--IRPQPGTKVRRLTKDAGTLG-CKPGKSC  455



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 239/461 (52%), Positives = 302/461 (66%), Gaps = 35/461 (8%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             LS+  V+P+  A ++  DD W QR+  A R  L++Y PNP+ +T   N   ++ +  T  
Sbjct  14    LSLTVVVPSVQAHIAVYDDYWTQRQTIALRQTLESYDPNPDNVTDHFNYHAALAMETT--  71

Query  1384  nrelyddsnnnnndNVTRRELRR-KKGSKEPCR-----ATNPIDQCWRCRADWSDGPNRF  1223
                           N TRR+LR+ + G K+P R     + N ID+CWR   +W    NR 
Sbjct  72    -----------GIVNETRRDLRQVRSGKKKPRRGGRFESLNAIDKCWRGDKNWDK--NRK  118

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC LGF + TTGGK G IYVV D SD+D+  PK GT+RHAV +  PLWIVFA SM I
Sbjct  119   KLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTIRHAVTRDRPLWIVFARSMII  178

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  +KTIDGRGA + I GGAG+TLQ V NVIIHN+ +  IK   GG+IRD   
Sbjct  179   KLQQELIITNDKTIDGRGARIYITGGAGLTLQFVRNVIIHNVHIKLIKKGVGGVIRDSEH  238

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G RT  +GDGI IFG+ +VWIDHVSM +C DG+IDA  G+TA+T+SN HFTDHD+V+L
Sbjct  239   HYGHRTMSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVML  298

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FG  N+D IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+   T
Sbjct  299   FGGTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPT  358

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD------  344
             IISQGNR+IA P E+  K+VT R+  P   WK W W S  D F+NGA+F  SG       
Sbjct  359   IISQGNRFIAPPIED-SKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSS  417

Query  343   -PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              PK      +   +RP  G +V RL + +G LG C PG+ C
Sbjct  418   TPKNPIPRKFA--IRPQPGTKVRRLTKDAGTLG-CKPGKSC  455



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 310/464 (67%), Gaps = 29/464 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPAT-TADVS--DDVWKQREAEARRGLLQAYHPNPEKIT  1433
             M A+ K+  ++ L +  +A  IPAT TA+++  D+ W+ R  EA++   +AY+ NP ++T
Sbjct  3     MEAAYKLNVFI-LCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVT  61

Query  1432  TELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCR  1253
                N+ V    + T+++               TRR L+ K   K PC ATNPID+CWRC 
Sbjct  62    GSFNKEV----HNTFDSMNN------------TRRNLKEK--YKGPCLATNPIDRCWRCD  103

Query  1252  ADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPL  1073
              +W    NR +LADCA GF   TTGGK G IYVV D SD+D+  PK GTLRHAVIQ  PL
Sbjct  104   PNWE--TNRKKLADCAQGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPL  161

Query  1072  WIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSS  893
             WI+FA  M IKLS EL+V  +KTID RGA V+I  G  +TLQ V NVIIHN+ + D K+ 
Sbjct  162   WIIFAHDMKIKLSEELMVTSDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAG  221

Query  892   PGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNC  713
              GG+IRD V+H G RT  +GDGI+++G+ +VWIDHVS  NCEDGLIDA  G+TA+T+SNC
Sbjct  222   NGGMIRDSVNHYGQRTRSDGDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNC  281

Query  712   HFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEM  533
             HFT+H+ V+LFG+++ +S D+ MQITLAFNHFG+ L QRMPRCRWG FH+VNNDYTHW M
Sbjct  282   HFTNHNDVMLFGSSDSNSQDEVMQITLAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLM  341

Query  532   YAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFT  356
             YA+GGS   TIISQGNR+IA P     KEVT R+   ++ WK W W S  D+ MNGAFF 
Sbjct  342   YAIGGSQHPTIISQGNRFIA-PLNEASKEVTKREYAAENVWKSWNWRSENDLMMNGAFFV  400

Query  355   PSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              SG P  +      D ++   G  V +L R++G L +C  G+ C
Sbjct  401   ESGSP--IRNLPEADMIQAKPGTFVAKLTRFAGPL-KCIKGKPC  441



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   439 bits (1128),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 232/451 (51%), Positives = 293/451 (65%), Gaps = 55/451 (12%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             + L+    ++PA TA++ D  +VW+ R  EAR+  LQAY+P+PEK+T   N++V      
Sbjct  9     VILIPFLVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVH-----  63

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
                                                      +CWRCR+DW+   NR +LA
Sbjct  64    -----------------------------------------KCWRCRSDWAS--NRMKLA  80

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
             DC LGF + TTGGKGG+IYVV D SD+D+  PK GTLRHA IQ+EPLWI+FA SM I+L+
Sbjct  81    DCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLN  140

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              EL++  NKTID RGA V+IA GAG+TLQ V+N+IIH + + DIK   GG+IRD   H G
Sbjct  141   EELIMTSNKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYG  200

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
              RT  +GDGI+IFG+ ++WIDH+SM NC DGLIDA   +TA+T+SNCHFT H++V+LFGA
Sbjct  201   FRTRSDGDGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGA  260

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++  S D  MQIT+ FNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+S
Sbjct  261   SDGYSGDAIMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILS  320

Query  493   QGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNR+IA P  N  KEVT RD  P+  WK WTW S GD+ MNGAFF  SGDP     +  
Sbjct  321   QGNRFIAPPDIN-CKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPN--FDFSN  377

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +  +R   G  V RL R+SG L  C  G  C
Sbjct  378   KYVIRAKPGAFVTRLTRFSGALS-CREGMPC  407



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   439 bits (1130),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/451 (51%), Positives = 295/451 (65%), Gaps = 26/451 (6%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             ++   +++   I A  ++  D+VW+ R  +A++    +Y+P+PE +   LN+ V      
Sbjct  9     IFFVSVTLVLSIEANISEF-DEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHTS---  64

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
                              N TRR+L +  G   PC +TNPID+CWRC  +W+    R +LA
Sbjct  65    -------------EEGSNSTRRDLHKYNG---PCMSTNPIDRCWRCDPNWAK--TRMKLA  106

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
             DC LGF   TTGGKGG+IYVV D SDDD+  PK GTLRHAVIQ EPLWI+F   M I+L+
Sbjct  107   DCVLGFGHHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLN  166

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              EL++  NKTID RG  V+IA GA   LQ +NNVIIH + + DIK+  GG+IRD ++H G
Sbjct  167   QELIMTSNKTIDARGQQVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYG  226

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
              R+  +GDGI+IFGS ++WIDHVSM NC+DGLIDA   +TA+T+SNCHFT+H+ V+LFGA
Sbjct  227   FRSRSDGDGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGA  286

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++  S D  +QITLAFNHFG+ L QRMPR RWG  H VNNDYTHW MYA+GGS   TI+S
Sbjct  287   SDSYSEDSILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILS  346

Query  493   QGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNR+IA P  N  KEVT R+  P+  WK W W S GD+ MNGAFF  SG+P  +   G 
Sbjct  347   QGNRFIAPPNPN-AKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMKG-  404

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              D + P  G    RL R+SG L  C  G+ C
Sbjct  405   PDMIHPRPGSYASRLTRFSGSLN-CIEGKPC  434



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 238/450 (53%), Positives = 296/450 (66%), Gaps = 33/450 (7%)
 Frame = -2

Query  1549  AAVIPATTADVS---DDVWKQREAEARRGLLQAYHPNPEKITTELNERVS---IGLNETY  1388
             AA+I    +D     D+ WK+R  +A    +++Y PNP+++T E N  V    +G NET 
Sbjct  19    AAIIANAESDQPQQLDEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELIMGKNET-  77

Query  1387  nnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
                               RR L+ +K    PC+ TNPID CWRC  +W++  NR ++ DC
Sbjct  78    ------------------RRNLKGQKKYVGPCKVTNPIDSCWRCDPNWAN--NRMKIVDC  117

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
               GF + TTGGKGG IYVV D SD D+  P+ GTLRHAVIQK PLWI FA +M IKL  E
Sbjct  118   IQGFGRKTTGGKGGPIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQE  177

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L+V  +KTIDGRGA VNI  GAG+T+Q V NVII N+ +  IK+  GGIIRD VDH G R
Sbjct  178   LMVASDKTIDGRGANVNIFDGAGITIQFVKNVIITNLHIKQIKAKEGGIIRDSVDHFGQR  237

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
             T  +GDGI+IFGS ++WIDHVSM NC DGLIDA  G+T +T+SNCHFT H++VLLFGA+N
Sbjct  238   TKSDGDGISIFGSSNIWIDHVSMENCTDGLIDAIMGSTGITISNCHFTKHNEVLLFGASN  297

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               + DK MQIT+AFNHFGK L QRMPRCR G FH+VNNDYTHW MYA+GGS   TIISQG
Sbjct  298   SYTQDKMMQITVAFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQG  357

Query  487   NRYIAQPGEN-FFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYR  314
             NR+IA  G N   KEVT R+   +  WK W W S GD+FMNGAFF  SG P  + +    
Sbjct  358   NRFIA--GLNSATKEVTKREYTAEAEWKNWLWKSEGDLFMNGAFFVESGSPANL-RADKL  414

Query  313   DNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             D +    G  V ++ +++G L  C  G+ C
Sbjct  415   DMIPFKPGTYVTKMTKFAGALD-CFVGKPC  443



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 235/431 (55%), Positives = 285/431 (66%), Gaps = 23/431 (5%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+ W+++   AR     +Y+P+PE +T   NE VS  L                    VT
Sbjct  29    DEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAVSKDLEGN-----------------VT  71

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR K     PC ATNPID+CWRC+ DW    NR RLA CA GF + T GGK G +YV
Sbjct  72    RRSLRGKHKFNGPCVATNPIDRCWRCKKDWMQ--NRKRLAKCAKGFGRHTIGGKNGDLYV  129

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V DASD+D+  PK GTLR+ VIQ  PLWIVFA+ M I+L+ ELLV  +KTID RG+ V+I
Sbjct  130   VTDASDNDLISPKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDARGSNVHI  189

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
              GGAG+ LQ V+NVIIH + + DIK+  GG+IRD   H G+RT  +GDGI+I+GS ++WI
Sbjct  190   MGGAGIMLQFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGISIYGSSNIWI  249

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM NC DGLID   G+TA+T+SN HFT H+ V+LFGA++    D  MQIT+AFNHFG
Sbjct  250   DHVSMSNCMDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQITVAFNHFG  309

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             K L QRMPRCRWG  H+VNNDYTHW MYAVGGS   TI+SQGNRYIA P     KEVT R
Sbjct  310   KGLVQRMPRCRWGFVHVVNNDYTHWLMYAVGGSQHPTILSQGNRYIA-PHSLAAKEVTKR  368

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             D  P   WK WTW S GD+  NGAFF  SG P  + K+  +D ++   G  V RL R+SG
Sbjct  369   DYAPQAVWKDWTWRSEGDLMQNGAFFVESGPPNRM-KFNTKDLIKAKPGSFVTRLTRFSG  427

Query  256   HLGRCTPGRKC  224
              L  C PGR C
Sbjct  428   AL-NCFPGRPC  437



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   440 bits (1132),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 237/464 (51%), Positives = 299/464 (64%), Gaps = 33/464 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +    LS+A V+P+  A V+  D+ W QR+ EA    L++Y P P  +T   N   ++ +
Sbjct  9     IVFVSLSLAVVVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAM  68

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEP----CRATNPIDQCWRCRADWSDGP  1232
               T                N TRR+LR+ K  K+       + N ID+CWR   +W    
Sbjct  69    ETT-------------GISNETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGNKNWDK--  113

Query  1231  NRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAAS  1052
             NR +LADC LGF + TTGGK G IYVV D SD+D+  PK GTLR+AV +  PLWI+FA  
Sbjct  114   NRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRYAVTRDRPLWIIFARH  173

Query  1051  MTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRD  872
             M IKL  EL++  +KTIDGRG  V I GGAG+TLQ V NVIIHNI +  IK  PGG+IRD
Sbjct  174   MIIKLQQELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRD  233

Query  871   CVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK  692
                H G+RT  +GDGI+IFG+ +VWIDHVSM +C DG+IDA  G+TA+T+SN HFTDHD+
Sbjct  234   SEHHFGLRTMSDGDGISIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDE  293

Query  691   VLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSS  512
             V+LFG  N D IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+ 
Sbjct  294   VMLFGGKNTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNM  353

Query  511   GATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD---  344
               TIISQGNR+IA P E+  K+VT R+  P   WK W W S  D F+NGA+F  SG    
Sbjct  354   NPTIISQGNRFIAPPNED-SKQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGKANA  412

Query  343   ----PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 PK      +   +RP  G +V RL + +G LG C PG+ C
Sbjct  413   WSTAPKNPIPRKFA--IRPQPGTKVRRLTKDAGALG-CKPGKSC  453



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   440 bits (1132),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 239/466 (51%), Positives = 307/466 (66%), Gaps = 17/466 (4%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTEL  1424
             MAA+   L   +L+LL+I A        V D  W QR+++A +    +Y PNP  +T   
Sbjct  1     MAAAFLTLGGFFLSLLAIVAPQVGAHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHF  60

Query  1423  NERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADW  1244
             N  V++ ++ T +  +   +         +RR+L++  G    C A NPID+CWRC  +W
Sbjct  61    NYHVNLAVDATESINDTRRELTQVR----SRRKLQKHGGK---CVAYNPIDKCWRCDRNW  113

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             ++  NR +LADCALGF + TTGGK G IYVV DASD+D+  PK GTLR+AV +  PLWI+
Sbjct  114   AN--NRKKLADCALGFGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWII  171

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA SM IKL  EL++  +KTIDGRGA V I  GAG+TLQ VNNVIIHNI V  I +  GG
Sbjct  172   FARSMIIKLQQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVTGNGG  231

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD   H G+RT  +GDGI++FG+ ++WIDHVSM  CEDG+IDA  G+TAVT+SN HFT
Sbjct  232   LIRDSEQHIGLRTKSDGDGISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFT  291

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
             DH +V+LFGA +E  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTHWEMYA+
Sbjct  292   DHQEVMLFGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAI  351

Query  523   GGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG  347
             GG+   TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+NGA+F  SG
Sbjct  352   GGNMDPTIISQGNRFIAPPNEQ-AKQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSG  410

Query  346   -----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                    K       +  +RP  G  V +L   +G LG C  G+ C
Sbjct  411   KANAWSAKLHNPIPNKFAIRPKPGMMVRKLTMEAGVLG-CKHGKAC  455



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   440 bits (1131),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 230/463 (50%), Positives = 301/463 (65%), Gaps = 26/463 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             + +STKI     + L++    IP   A ++  DD  + +  EA +  L +Y P P  +  
Sbjct  8     VESSTKI---ALILLVTFTITIPCLEAGIAEFDDFLRAQAEEAHKLALASYVPIPGDVAH  64

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRA  1250
             +LN  V + L    +                TRREL++K  + E C ATNPID CWRC+ 
Sbjct  65    DLNFHVHLALEGAND----------------TRRELKQKHAAGEACEATNPIDSCWRCQK  108

Query  1249  DWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLW  1070
             DW++  +RF+LA C+ GF +  TGG GG IYVV D SD+D+Q PK GTLR+  +QK PLW
Sbjct  109   DWAN--DRFKLAKCSKGFGRRATGGLGGPIYVVTDESDNDMQNPKPGTLRYGAVQKGPLW  166

Query  1069  IVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP  890
             I F  SM I+L+ ELLV  +KTIDGRGA V I  G G+T+Q VNNVIIH + + +IKS P
Sbjct  167   ITFQRSMIIRLNQELLVSSDKTIDGRGANVQIRDGGGITMQFVNNVIIHGLHISNIKSKP  226

Query  889   GGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCH  710
             G +IRD  +H G RT  +GD ++IFGS ++WIDHVS+  CEDGLID   G+TA+T+SNCH
Sbjct  227   GAMIRDSYNHVGQRTRSDGDALSIFGSSNIWIDHVSLSQCEDGLIDVIQGSTAITISNCH  286

Query  709   FTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMY  530
              T H+ V+LFGA++  + DK MQIT+AFNHFG+ L QRMPRCR+G  H+VNNDYTHW+MY
Sbjct  287   MTKHNDVMLFGASDTYNGDKLMQITVAFNHFGQGLIQRMPRCRFGFVHVVNNDYTHWQMY  346

Query  529   AVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPD-DSWKKWTWVSSGDVFMNGAFFTP  353
             A+GGSSG TI+SQGNR+IA P  +  KE+THRD  + + WK W W S  D+FMNGA F  
Sbjct  347   AIGGSSGPTILSQGNRFIA-PDNDAAKEITHRDYAEPEVWKNWQWQSEMDLFMNGAKFVT  405

Query  352   SGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SG P     +     ++P  G  V RL R+SG L  C  G+ C
Sbjct  406   SGSPINKAPFKKGFIMKPRDGSHVSRLTRHSGAL-NCVVGKPC  447



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   439 bits (1129),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 233/441 (53%), Positives = 294/441 (67%), Gaps = 28/441 (6%)
 Frame = -2

Query  1537  PATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelydd  1364
             P   A++   D+VW++R  EA++  L+AY PNPEK+T  LN+     L  + +       
Sbjct  19    PIVKANIGEFDEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKALKGSNS-------  71

Query  1363  snnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgt  1184
                      TRR L R +G   PC ATNPID+CWRC   W++  NR +LA C LGF + T
Sbjct  72    ---------TRRNLGRYRG---PCLATNPIDRCWRCDPHWAE--NRKKLATCVLGFGRRT  117

Query  1183  tggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKT  1004
             TGGK GR YVV D SD+D+  PK GT+RHAVIQKEPLWI+FA  M I+L+ EL++  +KT
Sbjct  118   TGGKDGRFYVVTDPSDNDMINPKPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKT  177

Query  1003  IDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGI  824
             IDGRGA V+   GA +TLQ + NVIIH I +     + GG+IRD VDH G RT  +GDGI
Sbjct  178   IDGRGANVHFFRGAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGI  237

Query  823   TIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRM  644
             +IFGSH++WIDHVSM  C DGLID    +TA+T+SNCHFTDH+ V+LFGA++  S DK M
Sbjct  238   SIFGSHNIWIDHVSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIM  297

Query  643   QITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPG  464
             Q+T+AFNHFG+ L QRMPRCRWG  H+VNNDYTHW MYA+GGS+  TI+SQGNR+IA P 
Sbjct  298   QVTVAFNHFGQGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSNQPTILSQGNRFIAPPN  357

Query  463   ENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGK  287
                 KEVT R+  P+  WK W W S  D+ MNGAFF  SG P G  +   +D ++   G 
Sbjct  358   IA-CKEVTKREYAPESEWKSWNWRSENDLMMNGAFFVQSGSPIG--RGNRQDVIKAKPGT  414

Query  286   EVGRLARYSGHLGRCTPGRKC  224
              V RL R+SG L  C   + C
Sbjct  415   FVTRLTRFSGAL-HCFKNKPC  434



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   440 bits (1132),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 302/466 (65%), Gaps = 21/466 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             +    IA +IP    ++S  D+ W QR  EAR   LQAYH +P +I    +ER      +
Sbjct  10    MFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1393  TYnnre----------lyddsnnnnndNVTRRELRRK-KGS----KEPCRATNPIDQCWR  1259
                  E                  ++ N TRR LR K KG     K PC A+NPID+CWR
Sbjct  70    VTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             CR+DW+    R +L  C  GF   TTGGK GRIYVV    D+D+  PK GTLRHAVIQKE
Sbjct  130   CRSDWAK--RRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKE  187

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+F   M+I+L+ ELL+  +KTID RGA V++A GAG+T+Q V NV+IH + +  I 
Sbjct  188   PLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHIS  247

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
              S GG+IRD VDH GMRT  +GDG++I+GS ++W+DH+SM  C+DGLIDA  G+T +T+S
Sbjct  248   ESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITIS  307

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             N HFT H+ V+L GA N +  DK MQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTHW
Sbjct  308   NSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  367

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
             E+YA+GGS G TI+S GNR+IA P +  ++EVT RD   +D WK W W S  DVFMNGA+
Sbjct  368   ELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAY  427

Query  361   FTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  SG+P+    +  +  ++P +G  V +L +Y+G L  C  GR+C
Sbjct  428   FRQSGNPQYKCAHTRQQMIKPKNGLAVSKLTKYAGALD-CRVGRRC  472



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   440 bits (1131),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 237/464 (51%), Positives = 298/464 (64%), Gaps = 33/464 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +    LS+A  +P+  A V+  D+ W QR+ EA    L++Y P P  +T   N   ++ +
Sbjct  9     IVFVSLSLAVAVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAM  68

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEP----CRATNPIDQCWRCRADWSDGP  1232
               T                N TRR+LR+ K  K+       + N ID+CWR   +W    
Sbjct  69    ETT-------------GTANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDK--  113

Query  1231  NRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAAS  1052
             NR +LADC LGF + TTGGK G IYVV D SD+D+ +PK GTLRHAV +  PLWI+FA  
Sbjct  114   NRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLDPKPGTLRHAVTRDRPLWIIFARH  173

Query  1051  MTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRD  872
             M IKL  EL++  +KTIDGRG  V I GGAG+TLQ V NVIIHNI +  IK  PGG+IRD
Sbjct  174   MIIKLQQELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKRGPGGLIRD  233

Query  871   CVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK  692
                H G+RT  +GDGI IFG+ +VWIDHVSM +C DG+IDA  G+TA+T+SN HFTDHD+
Sbjct  234   SEHHFGLRTMSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDE  293

Query  691   VLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSS  512
             V+LFG  N D IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+ 
Sbjct  294   VMLFGGKNTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNM  353

Query  511   GATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD---  344
               TIISQGNR+IA P E+  K+VT R+  P   WK W W S  D F+NGA+F  SG    
Sbjct  354   NPTIISQGNRFIAPPNED-SKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANA  412

Query  343   ----PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 PK      +   +RP  G +V RL + +G LG C PG+ C
Sbjct  413   WSTAPKNPIPRKFA--IRPQPGTKVRRLTKDAGALG-CKPGKSC  453



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   440 bits (1131),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 238/466 (51%), Positives = 307/466 (66%), Gaps = 17/466 (4%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTEL  1424
             MAA+   L   +L+LL+I A        V D  W QR+ +A +    +Y PNP  +T   
Sbjct  1     MAAAFLTLGGFFLSLLAIVAPQVGAHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHF  60

Query  1423  NERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADW  1244
             N  V++ ++ T +  +   +         +RR+L++  G    C A NPID+CWRC  +W
Sbjct  61    NYHVNLAVDATESINDTRRELTQVR----SRRKLQKHGGK---CVAYNPIDKCWRCDRNW  113

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             ++  NR +LA+CALGF + TTGGK G IYVV DASD+D+  PK GTLR+AV +  PLWI+
Sbjct  114   AN--NRKKLAECALGFGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWII  171

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA SM IKL  EL++  +KTIDGRGA V I  GAG+TLQ VNNVIIHNI V  I +  GG
Sbjct  172   FARSMIIKLQQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKQIVTGNGG  231

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD   H G+RT  +GDGI++FG+ ++WIDHVSM  CEDG+IDA  G+TAVT+SN HFT
Sbjct  232   LIRDSEQHIGLRTKSDGDGISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFT  291

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
             DH +V+LFGA +E  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTHWEMYA+
Sbjct  292   DHQEVMLFGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAI  351

Query  523   GGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG  347
             GG+   TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+NGA+F  SG
Sbjct  352   GGNMDPTIISQGNRFIAPPNEQ-AKQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSG  410

Query  346   -----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                    K       +  +RP  G  V +L   +G LG C  G++C
Sbjct  411   KANAWSAKLHNPIPSKFAIRPKPGTMVRKLTMEAGVLG-CKHGKEC  455



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   439 bits (1128),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 234/444 (53%), Positives = 295/444 (66%), Gaps = 29/444 (7%)
 Frame = -2

Query  1546  AVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrel  1373
             A++P   A++   D  W+ R  +A++   QAY PNP++IT+ LN  V   L+ +      
Sbjct  17    AIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKALSGS------  70

Query  1372  yddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFA  1193
                       N TRREL + KG   PC ATNPID CWRC  +W    NR +LADC LGF 
Sbjct  71    ----------NSTRRELAKYKG---PCSATNPIDSCWRCDPNWEK--NRKKLADCVLGFG  115

Query  1192  kgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQG  1013
              GTTGGK G+IYVV D+SD+D+  PK GTLR A IQKEPLWI+F  +M IKL  ELL+  
Sbjct  116   HGTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTS  175

Query  1012  NKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEG  833
             +KTID RGA V+I+ GA +TLQ V N+IIH + + D K + GG IRD +DH G R+  +G
Sbjct  176   DKTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDG  235

Query  832   DGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSID  653
             D I++FG+ HVWIDH+SM NC DGL+DA AG+TA+T+SNCH T H+ V+LFGAN+  S D
Sbjct  236   DAISMFGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGFSGD  295

Query  652   KRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIA  473
             +  QIT+AFNHFGK L QRMPRCRWG FHIVNNDYTHW MYA+GGS+  TI+SQGNR+IA
Sbjct  296   QISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIA  355

Query  472   QPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPL  296
              P  N  KEVT RD  P+  WK W+W S  D+ MNGAFF  SG          + +++  
Sbjct  356   PPNPN-AKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTKAANFP---KSDIKAK  411

Query  295   SGKEVGRLARYSGHLGRCTPGRKC  224
              G     L R+SG L +C  G+ C
Sbjct  412   PGSFAAALTRFSGCL-KCEVGKPC  434



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   439 bits (1128),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 233/453 (51%), Positives = 302/453 (67%), Gaps = 28/453 (6%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +  A   +A  +P   A+++D  +VW++R  EA++  ++AY P+P K+  + N RV   +
Sbjct  8     LVFAFAFLAVAVPVLRANIADFDEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVHEDM  67

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
               + N                TRR L+R KG    C ATNPID+CWRCR DW+   +R R
Sbjct  68    QRSNN----------------TRRSLKRTKGG---CLATNPIDRCWRCRKDWAS--HRKR  106

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             LA+CALGF +GTTGGK G+IY V D SDD++  PK GTLRHAVIQ EPLWI+FA +M I+
Sbjct  107   LANCALGFGRGTTGGKAGKIYKVTDPSDDNLMNPKPGTLRHAVIQPEPLWIIFAHNMVIR  166

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             LS EL+V  NKTIDGRGA V+I  GA +TLQ V NVIIH + + D     GG+IRD ++H
Sbjct  167   LSEELIVTDNKTIDGRGANVHICDGAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEH  226

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G RT  +GDGI++FG+ +VWIDHVSM +C DGLID    +TA+T+SNCHFT H++V+LF
Sbjct  227   YGFRTGSDGDGISLFGATNVWIDHVSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLF  286

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             G ++  S D  MQIT+AFNHFG+ L QRMPRCRWG  H+VNNDYTHW MYA+GGS   TI
Sbjct  287   GGSDTYSDDAHMQITVAFNHFGQGLVQRMPRCRWGFVHVVNNDYTHWLMYAIGGSQHPTI  346

Query  499   ISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY  323
             ISQGNR+IA P +   KEVT RD   +D WK W+W S  D+ +NGAFF  SG P  +   
Sbjct  347   ISQGNRFIA-PLDPNCKEVTKRDYAAEDVWKSWSWRSEDDLMLNGAFFVQSGSP--IRNV  403

Query  322   GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                + ++   G  V RL R++G L  C  G+ C
Sbjct  404   NKNNVIKAKPGSFVTRLTRFAGALN-CVKGKPC  435



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   440 bits (1132),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 302/466 (65%), Gaps = 21/466 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             +    IA +IP    ++S  D+ W QR  EAR   LQAYH +P +I    +ER      +
Sbjct  10    MFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1393  TYnnre----------lyddsnnnnndNVTRRELRRK-KGS----KEPCRATNPIDQCWR  1259
                  E                  ++ N TRR LR K KG     K PC A+NPID+CWR
Sbjct  70    VTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             CR+DW+    R +L  C  GF   TTGGK GRIYVV    D+D+  PK GTLRHAVIQKE
Sbjct  130   CRSDWAK--RRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKE  187

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+F   M+I+L+ ELL+  +KTID RGA V++A GAG+T+Q V NV+IH + +  I 
Sbjct  188   PLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHIS  247

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
              S GG+IRD VDH GMRT  +GDG++I+GS ++W+DH+SM  C+DGLIDA  G+T +T+S
Sbjct  248   ESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITIS  307

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             N HFT H+ V+L GA N +  DK MQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTHW
Sbjct  308   NSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  367

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
             E+YA+GGS G TI+S GNR+IA P +  ++EVT RD   +D WK W W S  DVFMNGA+
Sbjct  368   ELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAY  427

Query  361   FTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  SG+P+    +  +  ++P +G  V +L +Y+G L  C  GR+C
Sbjct  428   FRQSGNPQYKCAHTRQQMIKPKNGLAVSKLTKYAGALD-CRVGRRC  472



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   438 bits (1127),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 230/451 (51%), Positives = 295/451 (65%), Gaps = 26/451 (6%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             ++  L+++   I A  ++  D+VW+ R  +A++    +Y+P+PE +   LN+ V      
Sbjct  9     IFFVLVTLVLSIEANISEF-DEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVH-----  62

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
                              N TRR+L +  G   PC +TNPID+CWRC  +W    NR +LA
Sbjct  63    -----------KWEEGSNSTRRDLHKYDG---PCMSTNPIDRCWRCDPNWVK--NRMKLA  106

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
             DC LGF   TTGGKGG+IYVV D SDDD+  PK GTLRHAVIQ EPLWI+F   M I+L+
Sbjct  107   DCVLGFGHHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLN  166

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              EL++  NKTID RG  V+IA GA   LQ +NNVIIH + + DIK+  GG+IRD ++H G
Sbjct  167   QELIMTSNKTIDARGQKVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYG  226

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
              R+  +GDGI+IFGS ++WIDHVSM NC+DGLIDA   +TA+T+SN HFT+H+ V+LFGA
Sbjct  227   FRSRSDGDGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNSHFTNHNDVMLFGA  286

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++  S D  +QITLAFNHFG+ L QRMPR RWG  H VNNDYTHW MYA+GGS   TI+S
Sbjct  287   SDSYSEDSILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILS  346

Query  493   QGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNR+IA P  N  KEVT R+  P+  WK W W S GD+ MNGAFF  SG+P  +   G 
Sbjct  347   QGNRFIAPPNPN-AKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMKG-  404

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              D + P  G    RL R+SG L  C  G+ C
Sbjct  405   PDMIHPRPGSYASRLTRFSGSLN-CIEGKPC  434



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   439 bits (1128),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 237/464 (51%), Positives = 310/464 (67%), Gaps = 29/464 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPAT-TADVS--DDVWKQREAEARRGLLQAYHPNPEKIT  1433
             M A+ K+  ++ L +  +A  IPAT TA+++  D+ W+ R  EA++   +AY+ NP ++T
Sbjct  3     MEAAYKLFVFI-LCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVT  61

Query  1432  TELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCR  1253
                N+ V    + T+++               TRR L+ K   K PC ATNPID+CWRC 
Sbjct  62    GSFNKEV----HNTFDSMNN------------TRRNLKEK--YKGPCVATNPIDRCWRCD  103

Query  1252  ADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPL  1073
              +W    NR +LADCA GF   TTGGK G IYVV D SD+D+  PK GTLRHAVIQ  PL
Sbjct  104   PNWE--TNRKKLADCAKGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPL  161

Query  1072  WIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSS  893
             WI+FA  M IKLS EL+V  +KTID RGA V+I  G  +TLQ V NVIIHN+ + D K+ 
Sbjct  162   WIIFAHDMKIKLSEELMVTSDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAG  221

Query  892   PGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNC  713
              GG+IRD V+H G RT  +GDGI+++G+ +VWIDHVS  NCEDGLIDA  G+TA+T+SNC
Sbjct  222   NGGMIRDSVNHYGQRTRSDGDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNC  281

Query  712   HFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEM  533
             HFT+H+ V+LFG+++ +S D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW M
Sbjct  282   HFTNHNDVMLFGSSDSNSQDEVMQITIAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLM  341

Query  532   YAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFT  356
             YA+GGS   TIISQGNR+IA P     KEVT R+   ++ WK W W S  D+ +NGAFF 
Sbjct  342   YAIGGSQHPTIISQGNRFIA-PXNEASKEVTKREYAAENVWKSWNWRSENDLMVNGAFFI  400

Query  355   PSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              SG P  +      D ++   G  V +L R++G L +C  G+ C
Sbjct  401   ESGSP--IRNLPEADMIQAKPGTFVAKLTRFAGPL-KCIKGKPC  441



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   439 bits (1130),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 243/483 (50%), Positives = 320/483 (66%), Gaps = 32/483 (7%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTAD--VSDDVWKQREAEARRGLLQAYHPNPEKITT  1430
             MA    +L +V+    ++A +IP+  AD  + DDVW++R  EA++  L+AY P+PE+ T 
Sbjct  1     MAGGKAMLIFVF----TLATLIPSLLADLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATD  56

Query  1429  ELNERV---SIGLNETYnnrelyddsnn----------------nnndNVTRRELRR-KK  1310
               N  V   S+  N +         +                      N TRR LR+ +K
Sbjct  57    AFNVEVNKYSLAKNSSSLYGAFGSTNITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRK  116

Query  1309  GSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDD  1130
                 PC+ TNPID+CWRC+ +W+   NR +LA CALGF + TTGG  GRIYVV D+SD++
Sbjct  117   KYAGPCQVTNPIDRCWRCQRNWAK--NRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNN  174

Query  1129  VQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTL  950
             V +PK GTLRHAVIQKEPLWI+F+ +M IKLS EL++  +KTIDGRG  V+I+ GAG+T+
Sbjct  175   VMKPKPGTLRHAVIQKEPLWIIFSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGAGITI  234

Query  949   QSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNC  770
             Q ++NVIIH I++  I ++ GG IRD VDH G+RT+ +GDGI+IFGS  VWIDHVSM  C
Sbjct  235   QFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGDGISIFGSTDVWIDHVSMSRC  294

Query  769   EDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMP  590
              DGLIDA  G+TA+T+SNCHFT H+  +L GA++  S D  MQ+T+AFNHFG+ L QRMP
Sbjct  295   TDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDHLMQVTVAFNHFGQGLVQRMP  354

Query  589   RCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSW  413
             RCRWG FH+VNNDYTHW +YA+GGS   TIISQGNR+IA P E+  K+VT RD      W
Sbjct  355   RCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPP-ESHLKQVTKRDYATKGEW  413

Query  412   KKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPG  233
              KWTW S  D+ MNGAFF  SG P+  +K   +  ++   G    R+ R++G L  C PG
Sbjct  414   SKWTWRSENDLMMNGAFFVQSGQPR-TKKPNRKFMIKAKPGAVATRMTRFAGALD-CKPG  471

Query  232   RKC  224
             R+C
Sbjct  472   REC  474



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   438 bits (1127),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 296/450 (66%), Gaps = 26/450 (6%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNET  1391
             ++ L ++   I A   +  D+VW+ R  +A +   ++Y+P+PEK+   LN+ V       
Sbjct  11    FVILCTLVFSIEANIGEF-DEVWRTRATQANKNAKESYNPHPEKVAANLNKHVH------  63

Query  1390  YnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLAD  1211
                        +    N TRR+L +  G   PC ATNPID+CWRC   W+   NR +LAD
Sbjct  64    ----------RSEEGSNSTRRDLHKYNG---PCVATNPIDRCWRCDPHWAK--NRQKLAD  108

Query  1210  CALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSG  1031
             C LGF   TTGGKGG+IY+V D  D+D+  PK GTLRHAVIQ  PLWI+FA  M IKL+ 
Sbjct  109   CVLGFGHHTTGGKGGKIYIVTDPGDNDMVNPKPGTLRHAVIQPGPLWIIFAHHMVIKLNQ  168

Query  1030  ELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGM  851
             EL++ G+KTID RG  V+I GGA + LQ +NNVIIH + + DIKS  GG+IRD ++H G 
Sbjct  169   ELIMTGDKTIDARGQQVHITGGASLMLQYINNVIIHGLHIHDIKSGNGGLIRDSINHYGF  228

Query  850   RTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGAN  671
             RT  +GDGI+IFGS ++WIDHVSM NC+DGLIDA   +TA+T+SNCHFT H+ V+LFGA+
Sbjct  229   RTRSDGDGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTHHNDVMLFGAS  288

Query  670   NEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQ  491
             +    D  +QITLAFNHFG+ L QRMPR RWG  H VNNDYTHW MYA+GGS   TI+SQ
Sbjct  289   DSYKQDAILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWIMYAIGGSQHPTILSQ  348

Query  490   GNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYR  314
             GNR+IA P  N  KEVT RD  P+  WK W W S GD+ MNGAFF  SG+       G  
Sbjct  349   GNRFIAPPNPN-AKEVTKRDYSPESVWKNWVWRSQGDLMMNGAFFVESGNRNHKFMTG-P  406

Query  313   DNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             D + P +G + GRL R+SG L  C  G+ C
Sbjct  407   DMIHPRAGSDAGRLTRFSGSL-NCIEGKPC  435



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   438 bits (1127),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 231/425 (54%), Positives = 287/425 (68%), Gaps = 25/425 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD WK RE EA+   + A+ P+PE +  + N+ V   +                   N T
Sbjct  32    DDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSI----------------FGKNGT  75

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR L+  KG   PC+ATNPID+CWRCR +W+   +R RLADC LGF + T GGK GR+Y+
Sbjct  76    RRNLKVNKG---PCKATNPIDRCWRCRRNWA--MDRRRLADCVLGFGRRTVGGKHGRLYI  130

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SD+D+  PK GTLR+AVIQ +PLWIVF  SM IKL  EL+V  +KTIDGRG  V+I
Sbjct  131   VTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHI  190

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A GAG+T+Q   NVIIH + + DI S PGG+IRD V H G+RT  +GDGI+IFGS HVWI
Sbjct  191   AYGAGITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWI  250

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH SM  CEDGL+DA  G+TA+T+SN HFT H++ +L GA++  S D  MQ+T+AFNHFG
Sbjct  251   DHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFG  310

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQP---GENFFKEV  443
             + L QRMPRCRWG FH+VNNDYTHW MYAVGGS+  TI+SQGNRY+A P    ++  KEV
Sbjct  311   RGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEV  370

Query  442   THRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLAR  266
             T RD      W KWTW S GD+ +NGAFF  SG P   + +   D ++   GK V RL R
Sbjct  371   TKRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVPFKKKPFSRYDMIKAKPGKFVPRLTR  430

Query  265   YSGHL  251
             YSG L
Sbjct  431   YSGAL  435



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   438 bits (1127),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 239/468 (51%), Positives = 301/468 (64%), Gaps = 38/468 (8%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             + ++TK+    +  L + A VIP   A ++  DD  K +  EA +  L +Y P P  +  
Sbjct  6     VGSATKV---AFTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAH  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKK---GSKEPCRATNPIDQCWR  1259
             ELN  V + L  +                  TRRELR++K   G K  C+A+NPID CWR
Sbjct  63    ELNFHVHMALENS------------------TRRELRQRKLRGGGK--CQASNPIDACWR  102

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             C  DW++  +RFRLA C  GF +  TGG GG IYVV D SDDD+  PK GT+RHAV QK 
Sbjct  103   CNKDWAN--DRFRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQKG  160

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+F  SM I L  EL++  +KTIDGRGA V   GGAG+T+Q VNNVIIH +++ DI 
Sbjct  161   PLWIIFGHSMIISLRQELMISSDKTIDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIV  220

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
                GG+IRD  DH G+RT  +GD I+IFGS ++WIDHVS+ NC DGLID   G+TA+T+S
Sbjct  221   PKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITIS  280

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             NCH T H+ V LFGA++  + DK MQIT+AFNHFG+ L QRMPRCRWG  H++NNDYTHW
Sbjct  281   NCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHW  340

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
              MYA+GGSSG TI+SQGNR+IA P  +  KE+THRD    D WK W W S  D+FMNGA 
Sbjct  341   LMYAIGGSSGPTILSQGNRFIA-PNNDNAKEITHRDYAGPDVWKNWQWQSEMDLFMNGAK  399

Query  361   FTPSGDPKGVEKYGYRDNL--RPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  SG P    K  Y+  L  +P  G  V RL R++G L  C  G+ C
Sbjct  400   FVTSGSPI---KMTYKKGLIMKPRDGTHVSRLTRHAGAL-NCFVGKPC  443



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   438 bits (1127),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 231/425 (54%), Positives = 287/425 (68%), Gaps = 25/425 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD WK RE EA+   + A+ P+PE +  + N+ V   +                   N T
Sbjct  32    DDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSI----------------FGKNGT  75

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR L+  KG   PC+ATNPID+CWRCR +W+   +R RLADC LGF + T GGK GR+Y+
Sbjct  76    RRNLKVNKG---PCKATNPIDRCWRCRRNWA--MDRRRLADCVLGFGRRTVGGKHGRLYI  130

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SD+D+  PK GTLR+AVIQ +PLWIVF  SM IKL  EL+V  +KTIDGRG  V+I
Sbjct  131   VTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHI  190

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A GAG+T+Q   NVIIH + + DI S PGG+IRD V H G+RT  +GDGI+IFGS HVWI
Sbjct  191   AYGAGITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWI  250

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH SM  CEDGL+DA  G+TA+T+SN HFT H++ +L GA++  S D  MQ+T+AFNHFG
Sbjct  251   DHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFG  310

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQP---GENFFKEV  443
             + L QRMPRCRWG FH+VNNDYTHW MYAVGGS+  TI+SQGNRY+A P    ++  KEV
Sbjct  311   RGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEV  370

Query  442   THRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLAR  266
             T RD      W KWTW S GD+ +NGAFF  SG P   + +   D ++   GK V RL R
Sbjct  371   TKRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVPFKKKPFSRYDMIKAKPGKFVPRLTR  430

Query  265   YSGHL  251
             YSG L
Sbjct  431   YSGAL  435



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   438 bits (1127),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 235/458 (51%), Positives = 295/458 (64%), Gaps = 23/458 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +   LL +A  IP     +   DD  K +   AR+   ++Y PNPE ITTE+N  V + +
Sbjct  8     ISFILLVLAITIPCLEGRIGEFDDYLKAQADLARQIAFKSYVPNPENITTEINIHVHLAM  67

Query  1399  NETYnnrelyddsnnnnndNVTRREL-----RRKKGSKEPCRATNPIDQCWRCRADWSDG  1235
                                  TRREL     R  KG +  C ATNPID CWRCR DW++ 
Sbjct  68    EAAMKAEAND-----------TRRELMSQKSRGGKGRRARCMATNPIDSCWRCRKDWAE-  115

Query  1234  PNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAA  1055
              NR  LA CA GF + TTGG GGRIYVV D SD+D+  P+ GTLR   +Q+ PLWI+F  
Sbjct  116   -NRQLLAKCAKGFGRRTTGGLGGRIYVVTDPSDNDMVNPRPGTLRFGAVQRGPLWIIFQR  174

Query  1054  SMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIR  875
             SM I L+ EL+V  +KTIDGRGA V I  GAG+T+Q VNNVIIH +++ +IK+  GG+IR
Sbjct  175   SMVITLTQELMVSSDKTIDGRGANVQIRDGAGITMQFVNNVIIHGLRIKNIKARNGGLIR  234

Query  874   DCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHD  695
             D  DH G+RT  +GD I++FGS ++WIDH+S+ +CEDGL+D   G+TAVT+SNCH T H+
Sbjct  235   DSFDHIGVRTRSDGDAISVFGSSNIWIDHISLSDCEDGLVDVIQGSTAVTISNCHMTKHN  294

Query  694   KVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGS  515
              V+LFGA++    DK MQIT+AFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GGS
Sbjct  295   DVMLFGASDTYQDDKIMQITVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGS  354

Query  514   SGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPK  338
             S  TI+SQGNR+IA P  N  K VTHRD  P+  W KW W S GD FMNGA F  SG P 
Sbjct  355   SAPTILSQGNRFIA-PHNNAAKTVTHRDYAPESVWSKWQWRSEGDHFMNGATFIQSGPPI  413

Query  337   GVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 +     ++P  G +  RL R+SG L  C  GR C
Sbjct  414   KNLPFKKGFLMKPRHGSQANRLTRFSGALN-CVVGRPC  450



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   439 bits (1128),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 238/467 (51%), Positives = 305/467 (65%), Gaps = 36/467 (8%)
 Frame = -2

Query  1576  WVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIG  1403
             +V++AL S+  V+P+  A ++  D+ W QR+  A R  L++Y PNPE +T   N   ++ 
Sbjct  9     FVFVAL-SLTVVVPSVQAHIAEYDEYWTQRQTNALRETLESYDPNPENVTDHFNYHAALA  67

Query  1402  LNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCR------ATNPIDQCWRCRADWS  1241
             +  T                N TRR+LR+    K+  R      + N ID+CWR   +W 
Sbjct  68    METT-------------GIVNETRRDLRQVGRGKKTTRRGGRFESLNAIDKCWRGDKNWD  114

Query  1240  DGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVF  1061
                NR +LADC LGF + TTGGK G IYVV D SD+D+ +PK GT+RHAV +  PLWI+F
Sbjct  115   K--NRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLKPKPGTIRHAVTRDRPLWIIF  172

Query  1060  AASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGI  881
             A SM IKL  EL++  +KTIDGRGA + I GGAG+TLQ V NVIIHNI +  IK   GG+
Sbjct  173   ARSMIIKLQQELIITNDKTIDGRGAKIYITGGAGLTLQFVRNVIIHNIHIKQIKRGAGGL  232

Query  880   IRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTD  701
             I D   H G+RT  +GDGI IFG+ +VWIDHVSM +C DG+IDA  G+TA+T+SN HFTD
Sbjct  233   IIDSEQHFGLRTVSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTD  292

Query  700   HDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVG  521
             HD+V+LFG  N+D IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+G
Sbjct  293   HDEVMLFGGTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRFGLVHVVNNDYTHWEMYAIG  352

Query  520   GSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD  344
             G+   TIISQGNR+IA P E+  K+VT R+  P   WK W W S  D F+NGA+F  SG 
Sbjct  353   GNMNPTIISQGNRFIAPPIED-SKQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGK  411

Query  343   -------PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                    PK      +   +RP  G +V RL + +G LG C PG+ C
Sbjct  412   ANAWSATPKNPIPRKFA--IRPQPGTKVRRLTKDAGTLG-CKPGKSC  455



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   438 bits (1127),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 236/459 (51%), Positives = 298/459 (65%), Gaps = 27/459 (6%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             Y  +  +A ++P   ++V+  D+ W QR+ +A +  + +Y PNP  +T  LN  V++ ++
Sbjct  11    YTLVFLLAILVPHVQSNVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVD  70

Query  1396  ETYnnrelyddsnnnnndNVTRREL--RRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
              T +                TRREL  R+ +     C A NPID+CWRC  +W    NR 
Sbjct  71    ATESTNN-------------TRRELIGRKTQEGSGKCIAYNPIDKCWRCDPNWEK--NRK  115

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LA+C LGF + TTGGK G IYVV D+SDDD+  PK GTLRHAV +  PLWI+FA SM I
Sbjct  116   KLAECVLGFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVI  175

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  NKTIDGRGA V I  G G+TLQ VNNVII+NI V  I    GG+IRD  +
Sbjct  176   KLQQELMITSNKTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEE  235

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GDGI++FG+ +VWIDHVSM  C DG+IDA  G+TAVT+SN HFTDH +V+L
Sbjct  236   HVGIRTKSDGDGISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVML  295

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA +E  IDK MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTHWEMYA+GG+   T
Sbjct  296   FGAKDEHVIDKNMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPT  355

Query  502   IISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSG-----DP  341
             IISQGNR+IA P E   KEVT R+    + WK W W S GD F+NGA+F  SG      P
Sbjct  356   IISQGNRFIAPPNEQ-AKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSP  414

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             K       +  +RP  G  V  L   +G LG C  G+ C
Sbjct  415   KPKNPVPSKFAIRPKPGTMVRELTMDAGALG-CEAGKAC  452



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   437 bits (1125),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 232/431 (54%), Positives = 289/431 (67%), Gaps = 25/431 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+VWK+R  +A++    AY+PNP+ +   LN +V   +  + +                 
Sbjct  29    DEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVRGSNSR----------------  72

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR+L R  G    C ATNPIDQCWRC  +W+   NR +L DC LGF + TTGGKGG+IYV
Sbjct  73    RRDLHRYSGK---CMATNPIDQCWRCDPNWAR--NRMKLTDCVLGFGRKTTGGKGGKIYV  127

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SD+++  PK GTLRHAVIQ EPLWI+FA +M I+L+ EL++  NKTID RG  V+I
Sbjct  128   VMDNSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARGRQVHI  187

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A G G+ LQ V+NV+I N+ + D K+  GG+IRD V H G R+  +GDGI+IFGS +VWI
Sbjct  188   AHGGGLMLQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWI  247

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+SM NC+DGLIDA  G+TA+T+SNCHFT H+ V+LFGA++  S D  MQITLAFNHFG
Sbjct  248   DHISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFG  307

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
               L QRMPR RWG  H VNNDYTHW MYA+GGS   TI+SQGNR+IA P  N  KEVT R
Sbjct  308   HGLTQRMPRIRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPN-AKEVTKR  366

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             D  P++ WK W W S GD+ MNGAFF  SGDPK     G  D +    G  V  L R+SG
Sbjct  367   DYAPENVWKNWVWKSQGDLMMNGAFFVESGDPKHAFLKG-PDMITSKPGSFVSSLTRFSG  425

Query  256   HLGRCTPGRKC  224
              L +C  GR C
Sbjct  426   SL-KCIEGRPC  435



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   439 bits (1128),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 242/475 (51%), Positives = 300/475 (63%), Gaps = 41/475 (9%)
 Frame = -2

Query  1576  WVYLALLSIAAVIPATTADVS------DDVWKQREAEARRGLLQAYHPNPEKITTELNER  1415
             W ++ L+ + A+    ++ V       D+ W QR+ +A R  L+ Y PNP  +T   N  
Sbjct  4     WDFVKLVILFAISSWASSSVRGHVAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYH  63

Query  1414  VSIGLNETYnnrelyddsnnnnndNVTRREL------------RRKKGSKEPCRATNPID  1271
             V++ + ET                  TRREL            RR  G K  C A NPID
Sbjct  64    VNLAVEETMKTGNNG-----------TRRELLQVGQSRGQHPKRRNLGGK--CVAYNPID  110

Query  1270  QCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAV  1091
             +CWRC   WS   NR +LADCALGF + TTGGK G  YVV DASDDD+  PKAGTLRHAV
Sbjct  111   RCWRCDPGWSK--NRKKLADCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAV  168

Query  1090  IQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKV  911
              ++EPLWIVFA SM IKL  EL++  +KTIDGRG  V+I GGAG TLQ VNNVIIHNI +
Sbjct  169   TREEPLWIVFAKSMVIKLQQELIMTSDKTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYI  228

Query  910   GDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATA  731
              +I    GG+IRD   H G+RT  +GDGI IFG+ +VWIDHVSM +C DG+IDA  G+T 
Sbjct  229   KNIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDHVSMSHCSDGMIDAIQGSTG  288

Query  730   VTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNND  551
             +T+SNCH TDH +V+LFG  ++D IDK+MQIT+AFNHFGKRL QRMPRCR+GL H+VNND
Sbjct  289   ITISNCHLTDHQEVMLFGGTDKDVIDKKMQITVAFNHFGKRLVQRMPRCRYGLIHVVNND  348

Query  550   YTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFM  374
             YTHWEMYA+GG+   TIISQGNR+IA P E   K+VT R+  P   WK W W S GD F+
Sbjct  349   YTHWEMYAIGGNMNPTIISQGNRFIAPPNEE-AKQVTKREYTPFTEWKSWNWQSEGDYFL  407

Query  373   NGAFFTPSGDPKGVE-----KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             NGA+F  SG    +          +  +RP  G  V +L   +G L  C   + C
Sbjct  408   NGAYFVQSGRANALSAAPKNPVPSKFAIRPQPGTLVRKLTMDAGVLS-CKKRKPC  461



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   437 bits (1124),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 236/461 (51%), Positives = 296/461 (64%), Gaps = 27/461 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTEL  1424
             M A    +  V+ AL    + + A  A+  D+ WK+R  EA+    +AY PNP K+T   
Sbjct  1     MGAVKNYMLLVFFALAMQTSTLKAGIANF-DEYWKKRAEEAKEASREAYEPNPAKVTKHF  59

Query  1423  NERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADW  1244
             N+ V   L                   N TRR L + KG   PC ATNPID+CWRC  +W
Sbjct  60    NDEVHKSLE----------------GGNSTRRNLGKNKG---PCLATNPIDRCWRCDKNW  100

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             +   NR +L  CALGF + T GGK G+ Y V D SD+D+  PKAGTLR+ VIQ +PLWI+
Sbjct  101   AK--NRKKLGGCALGFGRKTIGGKHGKYYRVTDPSDNDMVNPKAGTLRYGVIQDKPLWII  158

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA  M I+LS EL+V  NKTIDGRG  V+I  GA +TLQ V NVIIH I + D K+  GG
Sbjct  159   FAHDMVIRLSEELMVASNKTIDGRGVNVHIYNGAQITLQFVKNVIIHGIHIHDAKAGNGG  218

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD VDH G R+  +GDGI+IFGS  +WIDH+S+ NCEDGLIDA  G+ A+T+SNCHFT
Sbjct  219   MIRDSVDHYGFRSRSDGDGISIFGSTDIWIDHISLSNCEDGLIDAIMGSNAITISNCHFT  278

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
              H+ V+LFGA++  S D  MQIT+AFNHFG+ L QRMPR RWG  H+VNNDYTHWEMYA+
Sbjct  279   KHNDVMLFGASDSYSGDSVMQITVAFNHFGRGLVQRMPRVRWGFVHVVNNDYTHWEMYAI  338

Query  523   GGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSG  347
             GGS   TIISQGNR++A P +   KEVT RD   +S WK W W S GD+ +NGAFF  SG
Sbjct  339   GGSQHPTIISQGNRFVAPP-DPACKEVTKRDYAVESVWKSWNWRSEGDLMLNGAFFVQSG  397

Query  346   DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +   ++    +  +    G+ V RL R+SG L  C  GR C
Sbjct  398   N--AIKTMNKQAVISAKPGRYVSRLTRFSGAL-NCVRGRPC  435



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   437 bits (1125),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 230/430 (53%), Positives = 294/430 (68%), Gaps = 18/430 (4%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+ W +R  EA +   +AYHP P  +T   N +V +              + N    N T
Sbjct  33    DEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVHL-------------HARNMKKLNST  79

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR L   KG   PC ATNPID CWRC+ +W++  NR RLADCA+GF KGTTGGK GRIYV
Sbjct  80    RRGLL-GKGHIGPCVATNPIDACWRCQPNWAE--NRKRLADCAIGFGKGTTGGKDGRIYV  136

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D+SD+D+Q PK GTLRHAVIQ EPLWI+FA SM I+L+ EL++ G+KTID RGA V+I
Sbjct  137   VTDSSDNDMQNPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARGANVHI  196

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A GAG+T+Q + NVIIH + +  I    GG+IRD  +H G+RT  +GD I+IFG+ ++WI
Sbjct  197   AHGAGITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAISIFGASNIWI  256

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM    DGLID   G+TA+T+SNCH TDH++V LFGA N+ + D++MQ+T+AFNHFG
Sbjct  257   DHVSMARGTDGLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQKMQVTVAFNHFG  316

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             K L QRMPR R+G  H+VNNDYTHW+MYA+GGS   TIISQGNR++A P   F KEVT R
Sbjct  317   KGLVQRMPRARFGFIHVVNNDYTHWQMYAIGGSQHPTIISQGNRFVA-PFNPFAKEVTKR  375

Query  433   DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGH  254
             + P+  WK WTW+S  D F+NGAFF  SG    ++          ++G +VG L R SG 
Sbjct  376   EAPESEWKSWTWLSDKDWFLNGAFFRDSGRGNAIDSKNKAQMFSAMAGTKVGELTRCSGP  435

Query  253   LGRCTPGRKC  224
               +CTPG+ C
Sbjct  436   R-KCTPGKPC  444



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   437 bits (1125),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 232/432 (54%), Positives = 286/432 (66%), Gaps = 24/432 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D  WK+R  EA +  +++Y+ NPEK+T E N  V   +++                +N T
Sbjct  43    DAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGKLMSK----------------ENTT  86

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR  K    PC ATNP+D CWRC  +W++  NR ++  CA GF K TTGGK G  YV
Sbjct  87    RRNLRGNKAYTGPCMATNPMDACWRCDPNWAN--NRKKIVGCAQGFGKKTTGGKDGPFYV  144

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V   +DDDVQ PK GTLRHAVIQK PLWI+F  SM I+L  EL+V  +KTID RGA V I
Sbjct  145   VTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDARGANVVI  204

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
               GAG+TLQ V NVII N+ +  I + PGG+IRD VDH G+RT  +GDGI++FG+ +VWI
Sbjct  205   EEGAGITLQFVKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGISLFGASNVWI  264

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM  C DGLIDA  G+TA+T+SN HFTDHD+ +LFGANN  + DK MQITLAFNHFG
Sbjct  265   DHVSMSRCADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHFG  324

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPR R G FH+VNNDYTHW MYA+GG+   TIISQGNR+IA P     K+VTHR
Sbjct  325   QGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIA-PINGVTKQVTHR  383

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLS-GKEVGRLARYS  260
             +  P+  WK W W S GD+ MNGAFF  SG   G  K+  + +  P   G  V  L ++S
Sbjct  384   ENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLDXMPFKPGTXVXTLTKFS  441

Query  259   GHLGRCTPGRKC  224
             G L  C  G+ C
Sbjct  442   GAL-NCAVGKPC  452



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   438 bits (1126),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 241/473 (51%), Positives = 306/473 (65%), Gaps = 31/473 (7%)
 Frame = -2

Query  1600  AASTKILWWVYLALLS-IAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             AA   I  ++++ LLS +A + P   A+++  DD W QR+ +A +  L ++ P P  +T 
Sbjct  3     AAFLNIGSYIFVFLLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTN  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELR-----RKKGSKEPCRATNPIDQC  1265
              LN  V++ L+ T +                TRREL      RK  ++  C A NPID+C
Sbjct  63    HLNYHVALALDTTESTNS-------------TRRELSQARRGRKMQNRGKCVAHNPIDKC  109

Query  1264  WRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQ  1085
             WRC  DW    NR +LA CALGF + TTGGK G IYVV DASDD++  P+ GTLRHAV +
Sbjct  110   WRCDRDWEK--NRKKLAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTR  167

Query  1084  KEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGD  905
               PLWI+FA SM IKL  EL++  +KTIDGRGA V I GG+G+TLQ VNNVIIHNI +  
Sbjct  168   DGPLWIIFARSMVIKLQQELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQ  227

Query  904   IKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVT  725
             I  + GG+IRD   H G+RT  +GDGI +FG+ +VWIDHVSM  C DG+IDA  G+TAVT
Sbjct  228   IVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVT  287

Query  724   VSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYT  545
             VSN HFTDH +V+LFGAN++  IDK+MQIT+AFNHFGKRL QRMPR R+G  H+VNNDYT
Sbjct  288   VSNSHFTDHQEVMLFGANDKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYT  347

Query  544   HWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDD-SWKKWTWVSSGDVFMNG  368
             HWEMYA+GG+   TIIS GNR+IA P E   K++T R+      WK W W S GD F+NG
Sbjct  348   HWEMYAIGGNMNPTIISHGNRFIAPPNEQ-AKQITKREYTSYVDWKLWNWQSEGDYFLNG  406

Query  367   AFFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             A+F  SG      PK       +  +RP  G  V +L   +G LG C  G+ C
Sbjct  407   AYFVQSGKPNAWSPKPKNPIPNKFAIRPKPGTMVRKLTMDAGVLG-CKQGQAC  458



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   437 bits (1124),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 297/464 (64%), Gaps = 33/464 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +    LS+A V+P   A V+  D+ W QR+ EA    L++Y P P  +T   N   ++ +
Sbjct  9     IVFVSLSLAVVVPTVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAM  68

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEP----CRATNPIDQCWRCRADWSDGP  1232
               T                N TRR+LR+ K  K+       + N ID+CWR   +W    
Sbjct  69    ETT-------------GIANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDK--  113

Query  1231  NRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAAS  1052
             NR +LADC LGF + TTGGK G IYVV D SD+D+  PK GTLRHAV +  PLWI+FA  
Sbjct  114   NRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRHAVTRDRPLWIIFARH  173

Query  1051  MTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRD  872
             M IKL  EL++  +KTIDGRG  V I GGAG+TLQ V NVIIHNI +  IK  PGG+IRD
Sbjct  174   MIIKLQQELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRD  233

Query  871   CVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK  692
                H G+RT  +GDGI+IFG+ ++WIDHVSM +C DG+IDA  G+TA+T+SN HFTDHD+
Sbjct  234   SEHHFGLRTMSDGDGISIFGATNIWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDE  293

Query  691   VLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSS  512
             V+LFG  N D IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+ 
Sbjct  294   VMLFGGKNTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNM  353

Query  511   GATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD---  344
               TIISQGNR+IA P E+  K+VT R+  P   WK W W S  D F+NGA+F  SG    
Sbjct  354   NPTIISQGNRFIAPPNED-SKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANA  412

Query  343   ----PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 PK      +   +RP  G +V RL + +G LG C  G+ C
Sbjct  413   WSTAPKNPIPRKFA--IRPQPGTKVRRLTKDAGALG-CKAGKSC  453



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   437 bits (1124),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 239/472 (51%), Positives = 303/472 (64%), Gaps = 29/472 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTEL  1424
             MAA    L   +L+LL+I A        V D  W QR+++A +  + +Y PNP  +T  L
Sbjct  1     MAAVFLNLGVFFLSLLAIVAPQVKAHVAVFDSYWTQRQSDALKRTMGSYDPNPLNVTNHL  60

Query  1423  NERVSIGLNETYnnrelyddsnnnnndNVTRREL------RRKKGSKEPCRATNPIDQCW  1262
             N  V++ ++   +  +             TRREL       RK      C A NPID+CW
Sbjct  61    NYHVNLAVDAAESFND-------------TRRELTQVRSGHRKLKRSGKCLAYNPIDKCW  107

Query  1261  RCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQK  1082
             RC  +W++  NR +LADC LGF + TTGGK G IYVV DASD+D+  PK GTLR+AV + 
Sbjct  108   RCDRNWAN--NRKKLADCVLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRD  165

Query  1081  EPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDI  902
              PLWI+FA SM IKL  EL++  +KTIDGRGA V I  GAG+T+Q VNNVIIH+I V  I
Sbjct  166   GPLWIIFARSMIIKLQQELMIASDKTIDGRGAKVYIMEGAGLTMQYVNNVIIHSIYVKHI  225

Query  901   KSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTV  722
                 GG+IRD   H G+RT  +GDGI++FG+ ++WIDHVSM  C DG+IDA  G+TAVT+
Sbjct  226   VPGNGGLIRDSEHHVGLRTKSDGDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTI  285

Query  721   SNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTH  542
             SN HFTDH +V+LFGA +E  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTH
Sbjct  286   SNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTH  345

Query  541   WEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGA  365
             WEMYA+GG+   TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+NGA
Sbjct  346   WEMYAIGGNMNPTIISQGNRFIAPPSEQ-AKQITKREYTPLAEWKSWNWQSEGDYFLNGA  404

Query  364   FFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +F  SG      PK       +  +RP  G  V +L   +G LG C  G+ C
Sbjct  405   YFVQSGKANAWSPKPQNPIPNKFAIRPKPGTMVRKLTMEAGALG-CRQGQAC  455



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   437 bits (1123),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 242/454 (53%), Positives = 293/454 (65%), Gaps = 25/454 (6%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             +L  L   A    + AD+   DD W+++  EA      AYHP+PE +T   N+ V + L 
Sbjct  11    FLCSLIFLASAALSGADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLALA  70

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRK--KGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             E  N+               TRR LR    K  K  C ATNPID+CWRC+ +W    +R 
Sbjct  71    EARNS---------------TRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIK--HRK  113

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LA C  GF +  TGGK G  YVV D SDDD+  PK GTLR  VIQ  PLWIVFA  M I
Sbjct  114   KLATCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMII  173

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             +LS EL++  NKTID RGA V+IA GA +T+Q VNNVIIH + + DIK S GG+IRD + 
Sbjct  174   RLSEELMINSNKTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLH  233

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GDGI+I+GS  VWIDH SM NC DGLIDA  G+TA+T+SNCHFT H+ VLL
Sbjct  234   HFGLRTKSDGDGISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLL  293

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA++ +  D  MQ T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW MYA+GGS   T
Sbjct  294   FGASDSNENDSIMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPT  353

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             IISQGNR+IA P   F KEVT RD   +D WK+WTW S GD+  NGAFF  SG P     
Sbjct  354   IISQGNRFIAPP-LRFAKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESGTPN-TRT  411

Query  325   YGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +  +D +R   G  V RL R++G LG C  GR C
Sbjct  412   FHRKDFIRAKPGTWVRRLTRFAGPLG-CKAGRAC  444



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   436 bits (1121),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 234/434 (54%), Positives = 289/434 (67%), Gaps = 30/434 (7%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERV---SIGLNETYnnrelyddsnnnnnd  1343
             DD WK R A A +    AY P+PE +   +N  +   S G N T                
Sbjct  25    DDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHASSGRNST----------------  68

Query  1342  NVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGR  1163
                RR L++  G   PC ATNPID+CWRC  +W+   NR +LADC LGF + TTGGK G 
Sbjct  69    ---RRNLKKYAG---PCLATNPIDRCWRCDPNWAQ--NRKKLADCVLGFGRKTTGGKLGP  120

Query  1162  IYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAF  983
              YVV D+SD D+  PK GTLRHAVIQK PLWI+F+ +M I+LS EL++  +KTID RGA 
Sbjct  121   YYVVNDSSDSDLMNPKPGTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARGAN  180

Query  982   VNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHH  803
             V IA GAG+TLQ + NVIIH +++  I    GG+IRD VDH G+RT  +GDGI+IFGS +
Sbjct  181   VQIAYGAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSN  240

Query  802   VWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFN  623
             VWIDHVSM NC DGLIDA  G+TA+T+SNCHFT H++V+LFGA++  S D+ MQIT+AFN
Sbjct  241   VWIDHVSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFN  300

Query  622   HFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEV  443
             HFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+SQGNR+IA P   + KEV
Sbjct  301   HFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNV-YAKEV  359

Query  442   THRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLAR  266
             T R+  P+  WK WTW S GD+ MNGAFF  SGD      +   D +    G  V R+ R
Sbjct  360   TKREYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRMDMISYKPGTYVKRMTR  419

Query  265   YSGHLGRCTPGRKC  224
             ++G L  C  GR C
Sbjct  420   FAGSLA-CFVGRPC  432



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   436 bits (1122),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 238/468 (51%), Positives = 300/468 (64%), Gaps = 38/468 (8%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             + ++TK+    +  L + A VIP   A ++  DD  K +  EA +  L +Y P P  +  
Sbjct  6     VGSATKV---AFTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAH  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKK---GSKEPCRATNPIDQCWR  1259
             ELN  V + L  +                  TRRELR++K   G K  C+A+NPID CWR
Sbjct  63    ELNFHVHMALENS------------------TRRELRQRKLRGGGK--CQASNPIDACWR  102

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             C  DW++  +RFRLA C  GF +  TGG GG IY V D SDDD+  PK GT+RHAV QK 
Sbjct  103   CNKDWAN--DRFRLAKCGKGFGRRATGGLGGPIYAVTDNSDDDMVNPKPGTIRHAVTQKG  160

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+F  SM I L  EL++  +KTIDGRGA V   GGAG+T+Q VNNVIIH +++ DI 
Sbjct  161   PLWIIFGHSMIISLRQELMISSDKTIDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIV  220

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
                GG+IRD  DH G+RT  +GD I+IFGS ++WIDHVS+ NC DGLID   G+TA+T+S
Sbjct  221   PKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITIS  280

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             NCH T H+ V LFGA++  + DK MQIT+AFNHFG+ L QRMPRCRWG  H++NNDYTHW
Sbjct  281   NCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHW  340

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
              MYA+GGSSG TI+SQGNR+IA P  +  KE+THRD    D WK W W S  D+FMNGA 
Sbjct  341   LMYAIGGSSGPTILSQGNRFIA-PNNDNAKEITHRDYAGPDVWKNWQWQSEMDLFMNGAK  399

Query  361   FTPSGDPKGVEKYGYRDNL--RPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  SG P    K  Y+  L  +P  G  V RL R++G L  C  G+ C
Sbjct  400   FVTSGSPI---KMTYKKGLIMKPRDGTHVSRLTRHAGAL-NCFVGKPC  443



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   436 bits (1121),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 234/434 (54%), Positives = 289/434 (67%), Gaps = 30/434 (7%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERV---SIGLNETYnnrelyddsnnnnnd  1343
             DD WK R A A +    AY P+PE +   +N  +   S G N T                
Sbjct  25    DDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHASSGRNST----------------  68

Query  1342  NVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGR  1163
                RR L++  G   PC ATNPID+CWRC  +W+   NR +LADC LGF + TTGGK G 
Sbjct  69    ---RRNLKKYAG---PCLATNPIDRCWRCDPNWAQ--NRKKLADCVLGFGRKTTGGKLGP  120

Query  1162  IYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAF  983
              YVV D+SD D+  PK GTLRHAVIQK PLWI+F+ +M I+LS EL++  +KTID RGA 
Sbjct  121   YYVVNDSSDSDLMNPKPGTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARGAN  180

Query  982   VNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHH  803
             V IA GAG+TLQ + NVIIH +++  I    GG+IRD VDH G+RT  +GDGI+IFGS +
Sbjct  181   VQIAYGAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSN  240

Query  802   VWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFN  623
             VWIDHVSM NC DGLIDA  G+TA+T+SNCHFT H++V+LFGA++  S D+ MQIT+AFN
Sbjct  241   VWIDHVSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFN  300

Query  622   HFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEV  443
             HFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+SQGNR+IA P   + KEV
Sbjct  301   HFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNV-YAKEV  359

Query  442   THRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLAR  266
             T R+  P+  WK WTW S GD+ MNGAFF  SGD      +   D +    G  V R+ R
Sbjct  360   TKREYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRMDMISYKPGTYVKRMTR  419

Query  265   YSGHLGRCTPGRKC  224
             ++G L  C  GR C
Sbjct  420   FAGSLA-CFVGRPC  432



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   437 bits (1123),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 241/473 (51%), Positives = 305/473 (64%), Gaps = 31/473 (7%)
 Frame = -2

Query  1600  AASTKILWWVYLALLS-IAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             AA   I  ++++ LLS  A + P   A+++  DD W QR+ +A +  L ++ P P  +T 
Sbjct  3     AAFLNIGSYIFVFLLSSFATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTN  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELR-----RKKGSKEPCRATNPIDQC  1265
              LN  V++ L+ T +                TRREL      RK  ++  C A NPID+C
Sbjct  63    HLNYHVALALDTTESINS-------------TRRELSQARRGRKMQNRGKCVAHNPIDKC  109

Query  1264  WRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQ  1085
             WRC  DW    NR +LA CALGF + TTGGK G IYVV DASDD++  P+ GTLRHAV +
Sbjct  110   WRCDRDWEK--NRKKLAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTR  167

Query  1084  KEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGD  905
               PLWI+FA SM IKL  EL++  +KTIDGRGA V I GG+G+TLQ VNNVIIHNI +  
Sbjct  168   DGPLWIIFARSMVIKLQQELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQ  227

Query  904   IKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVT  725
             I  + GG+IRD   H G+RT  +GDGI +FG+ +VWIDHVSM  C DG+IDA  G+TAVT
Sbjct  228   IVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVT  287

Query  724   VSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYT  545
             VSN HFTDH +V+LFGAN++  IDK+MQIT+AFNHFGKRL QRMPR R+G  H+VNNDYT
Sbjct  288   VSNSHFTDHQEVMLFGANDKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYT  347

Query  544   HWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDD-SWKKWTWVSSGDVFMNG  368
             HWEMYA+GG+   TIIS GNR+IA P E   K++T R+      WK W W S GD F+NG
Sbjct  348   HWEMYAIGGNMNPTIISHGNRFIAPPNEQ-AKQITKREYTSYVDWKLWNWQSEGDYFLNG  406

Query  367   AFFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             A+F  SG      PK       +  +RP  G  V +L   +G LG C  G+ C
Sbjct  407   AYFVQSGKPNAWSPKPKNPIPNKFAIRPKPGTMVRKLTMDAGVLG-CKQGQAC  458



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   436 bits (1122),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 231/431 (54%), Positives = 284/431 (66%), Gaps = 22/431 (5%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D  WK+R  EA +  +++YH NPE++T E N  V+  L++                +N T
Sbjct  43    DAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAELLSK----------------ENTT  86

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR  KG   PC ATNPID CWRC  +W+D  NR ++  CA GF K  TGGK G IYV
Sbjct  87    RRNLRGNKGYNGPCMATNPIDACWRCDPNWAD--NRKKIVGCAQGFGKKATGGKDGPIYV  144

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V   +DDDVQ PK GTLRHAVIQK PLWI+FA SM I+L  EL+V  +KTIDGRGA V I
Sbjct  145   VTVGTDDDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRGANVVI  204

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
               G G+TLQ V NVI+ N+ +  I S  GG+IRD VDH G+RT  +GDGI++FG+ +VWI
Sbjct  205   EEGGGITLQFVKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGISLFGASNVWI  264

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+SM  C DGLIDA   +TA+T+SN HFTDHD V+LFGANN  + DK MQITLAFNHFG
Sbjct  265   DHMSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFG  324

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPR R G FH+VNNDY HW MYA+GG+   TIISQGNR+IA P     K+VTHR
Sbjct  325   RGLVQRMPRVRHGFFHLVNNDYNHWIMYAIGGNMNPTIISQGNRFIA-PVNEATKQVTHR  383

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             +  P+  WK W W S GD+ MNGAFF  SG  +  +     D +    G    +L ++SG
Sbjct  384   EHTPESEWKNWEWRSEGDLMMNGAFFVESGS-RASQNPAKLDMMPFQPGTFATKLTKFSG  442

Query  256   HLGRCTPGRKC  224
              L  C  G+ C
Sbjct  443   ALS-CVVGKPC  452



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   436 bits (1121),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 238/432 (55%), Positives = 284/432 (66%), Gaps = 24/432 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D  WKQR  EA++  +Q++  +PE++T E N  V   L +                   T
Sbjct  37    DIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELLMKQNG----------------T  80

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR  K    PC ATNP+D CWRC  +W+   NR RLADC  GF K TTGGK G IYV
Sbjct  81    RRHLRGNKKYNGPCMATNPMDACWRCDKNWAK--NRKRLADCVQGFGKKTTGGKAGPIYV  138

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SD D+  PK GTLRHAVIQK PLWI+FA +M I+L  ELLV  +KTIDGRGA VNI
Sbjct  139   VTDPSDLDLVNPKPGTLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRGANVNI  198

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
               GAG+TLQ V NVII N+ +  I    GG+IRD VDH G RT  +GDGI+IFGS +VWI
Sbjct  199   HNGAGITLQFVKNVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGISIFGSSNVWI  258

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM NC DGLIDA  G+TA+T+SN HFT H+ V+LFGA+N  + DK MQIT+AFNHFG
Sbjct  259   DHVSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFG  318

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPRCR G FH+VNNDYTHW MYA+GGS   TIISQGNR+IA P +   KEVT R
Sbjct  319   QGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQG-AKEVTKR  377

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLS-GKEVGRLARYS  260
             D   +  WK W W S GD+ MNGA F  SG   G  K+  + +L P   G  V +L ++S
Sbjct  378   DHTAEAEWKNWEWRSEGDLMMNGAVFVQSG--SGKSKHPAKMDLMPFKPGTYVAKLTKFS  435

Query  259   GHLGRCTPGRKC  224
             G L  C  G+ C
Sbjct  436   GALD-CFVGKPC  446



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   436 bits (1120),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 235/449 (52%), Positives = 310/449 (69%), Gaps = 12/449 (3%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             +++A +IPA  AD++  D+VW++R  EA++  L +Y PNPE  T + N  V+   N   +
Sbjct  12    ITLATLIPALLADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVN---NTLVD  68

Query  1384  nrelyddsnnnnndNVTRRELRR-KKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
               +  +D+      N TRR L++ KK    PC+ TNPID+CWRCR +W+   NR RLA C
Sbjct  69    FDDDGNDAGFELLANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWAR--NRKRLAKC  126

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
             ALGF +  TGG  GR+YVV + SDDDV  PK GTLRHAVIQKEPLWI+F+ +M I+LS E
Sbjct  127   ALGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNIRLSKE  186

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L++  +KTIDGRG  ++IA GAG+T+Q + NVIIH I++  I ++ GG IRD V H G+R
Sbjct  187   LIMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVGHYGIR  246

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
             T+ +GDGI+IFGS ++WIDHVSM  C DGLIDA  G+TA+T+SN HFT H+  +L GA++
Sbjct  247   TNSDGDGISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASD  306

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               S D+ MQ+T+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI+SQG
Sbjct  307   SFSGDELMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIVSQG  366

Query  487   NRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRD  311
             NR+IA P E   K+VT RD  P+  WK WTW S  D+ MNGAFF  SG P+  ++   + 
Sbjct  367   NRFIAPP-ELHLKQVTKRDYAPESEWKTWTWRSENDLMMNGAFFIESGKPR-TKRPHKKF  424

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              +    G    R+  ++G L  C  GRKC
Sbjct  425   MITAKPGSLATRMTLFAGALD-CKSGRKC  452



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   436 bits (1120),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 238/466 (51%), Positives = 289/466 (62%), Gaps = 39/466 (8%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADV-------------SDDVWKQREAEARRGLLQAYHPNPEKITT  1430
             Y  LLS+A  IP   A+               D  W++R   A+     AY  +P  +++
Sbjct  8     YFLLLSLAIFIPTLNANSLEKDEYWQSHVYEFDSYWQERAKAAKVDSQAAYFEDPYSVSS  67

Query  1429  ELNERVS---IGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWR  1259
                  VS   IG  +                    RR L+ K     PC ATNPID+CWR
Sbjct  68    NFTSSVSELTIGKKDL-------------------RRNLKGKYRGDGPCIATNPIDRCWR  108

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             C  +W++  NR +LADC  GF + T GGKGG  YVV D SDDD+  PK GTLRHAV +  
Sbjct  109   CDPNWAN--NRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMVNPKPGTLRHAVTRDG  166

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+FA SM I L  EL++  NKTIDGRG  V IA GAG+T+Q V N+IIH IKV DI 
Sbjct  167   PLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGITVQFVKNIIIHGIKVFDIV  226

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
                GG+IRD   H G RT  +GDGI+IFGS +VWIDHVSM NC DGLIDA  G+TA+T+S
Sbjct  227   IREGGMIRDSETHYGFRTKSDGDGISIFGSSNVWIDHVSMRNCSDGLIDAIMGSTAITIS  286

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             N HFTDH++V+LFGA++  S DK MQITLAFNHFGKRL QRMPR R+G  H VNNDYTHW
Sbjct  287   NSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQRMPRVRYGFVHSVNNDYTHW  346

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
             EMYA+GGS   TIIS+GNR+IA P   F K++T R+  P++ W  W W S  DV+MNGAF
Sbjct  347   EMYAIGGSKNPTIISEGNRFIA-PDNQFAKQITKREYAPENVWANWQWRSINDVYMNGAF  405

Query  361   FTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  SG       +   D +    G  VGRL RYSG+L +C  GR C
Sbjct  406   FVQSGPELASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  451



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score =   435 bits (1119),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 232/459 (51%), Positives = 292/459 (64%), Gaps = 24/459 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +   LL +A  IP     +   DD  K +   AR+   ++Y PNPE ITTE+N  V + +
Sbjct  8     ISFILLVLAITIPCLEGRIGEFDDYLKAQAEMARQIAFKSYVPNPENITTEINIHVHLAM  67

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEP------CRATNPIDQCWRCRADWSD  1238
                                  TRREL  +K           C ATNPID CWRCR DW+ 
Sbjct  68    EAAMKAEAND-----------TRRELMSQKSRGGKGRRRARCMATNPIDSCWRCRNDWAK  116

Query  1237  GPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFA  1058
               NR  LA CA GF + TTGG GGRIYVV D SD+D+  P+ GTLR   +QK PLWI+F 
Sbjct  117   --NRQLLATCAKGFGRRTTGGLGGRIYVVTDPSDNDLVNPRPGTLRFGAVQKGPLWIIFQ  174

Query  1057  ASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGII  878
              +M I L+ EL+V  +KTIDGRGA V I  GAG+T+Q VNNVIIH +++ +IK+  GG+I
Sbjct  175   RNMVITLTQELMVSSDKTIDGRGANVQIREGAGITMQFVNNVIIHGLRIKNIKAKNGGLI  234

Query  877   RDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDH  698
             RD  DH G+RT  +GD I++FGS ++WIDH+S+ NCEDGL+D   G+TAVT+SNCH T H
Sbjct  235   RDSFDHLGVRTRSDGDAISVFGSSNIWIDHISLSNCEDGLVDVIQGSTAVTISNCHMTKH  294

Query  697   DKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGG  518
             + V+LFGA++    DK MQ+T+AFNHFG+ L QRMPRCRWG FH++NNDYTHW MYA+GG
Sbjct  295   NDVMLFGASDTYQDDKIMQVTVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGG  354

Query  517   SSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDP  341
             SS  TI+SQGNR+IA P  N  K +THRD  P+  W KW W S GD FMNGA F  SG P
Sbjct  355   SSAPTILSQGNRFIA-PHNNAAKTITHRDYAPEAVWSKWQWRSEGDHFMNGANFIQSGPP  413

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                  +     ++P  G +  RL R+SG L  C  GR C
Sbjct  414   IKSLPFKKGFLMKPRHGSQANRLTRFSGALN-CVVGRPC  451



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 236/445 (53%), Positives = 291/445 (65%), Gaps = 27/445 (6%)
 Frame = -2

Query  1576  WVYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIG  1403
             +V L L S +  +P   A ++D  + W+ R A AR+  L+AY   P  +T  +N  V   
Sbjct  10    FVVLVLASSSFTVPKAEAHIADFDETWQNRSAIARQVALEAYVHEPHNVTDHVNHMVHKA  69

Query  1402  LNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             L                     TRR L +  G+   C ATNPID+CWRC+ +W+   +R 
Sbjct  70    LEGN-----------------STRRHLGKYTGA---CMATNPIDRCWRCQRNWAR--DRK  107

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             RLA CALGF + TTGG  GR YVV DASD+ + +PK GTLRHAVIQ  PLWI F   M I
Sbjct  108   RLAKCALGFGRKTTGGLKGRFYVVTDASDESLTDPKPGTLRHAVIQDRPLWITFKHDMII  167

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             +L+ ELLV  +KTIDGRG  V+IA GAG+T+Q   NVIIH + + DIK+  GG+IRD  +
Sbjct  168   RLTEELLVNSHKTIDGRGTNVHIAYGAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPE  227

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GD I+IF S  VWIDH SM NC DGLIDA  G+TA+T+SN HFT+H++V L
Sbjct  228   HYGLRTKSDGDAISIFASSFVWIDHNSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSL  287

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
              GA++  S DK MQ+T AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYAVGGS   T
Sbjct  288   MGASDSFSDDKIMQVTFAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWGMYAVGGSQHPT  347

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             IISQGNRYIA P  N+ KEVT RD   +D WK+WTW S GDV  NGAFF  SG P   +K
Sbjct  348   IISQGNRYIA-PTANYAKEVTKRDYASEDVWKQWTWRSEGDVMKNGAFFRESG-PPSTDK  405

Query  325   YGYRDNLRPLSGKEVGRLARYSGHL  251
             Y  +D +    G  VGRL R++G L
Sbjct  406   YTRQDKITAKPGTFVGRLTRFAGAL  430



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   435 bits (1119),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 239/474 (50%), Positives = 306/474 (65%), Gaps = 32/474 (7%)
 Frame = -2

Query  1600  AASTKILWWVYLALLS-IAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             AA   I  +V++  LS +A + P   A+++  DD W QR+ +A +  L ++ P P  +T 
Sbjct  3     AAFLNIGSYVFVFFLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTN  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRREL------RRKKGSKEPCRATNPIDQ  1268
              LN  V++ L+ T              + N TRREL      R+ +  +  C A NPID+
Sbjct  63    HLNYHVALALDTT-------------GSINSTRRELSQARRGRKMQNRRGKCVAHNPIDK  109

Query  1267  CWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVI  1088
             CWRC  DW    NR +LA CALGF + T+GGK G IYVV DASDD++  P+ GTLRHAV 
Sbjct  110   CWRCDRDWEK--NRKKLAVCALGFGRRTSGGKDGPIYVVTDASDDELISPRPGTLRHAVT  167

Query  1087  QKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVG  908
             +  PLWI+FA SM IKL  EL++  +KTIDGRGA V I GG+G+TLQ VNNVI+HNI + 
Sbjct  168   RDGPLWIIFARSMVIKLQQELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIVHNIYIK  227

Query  907   DIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAV  728
              I  + GG+IRD   H G+RT  +GDGI +FG+ +VWIDHVSM  C DG+IDA  G+TAV
Sbjct  228   QIVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAV  287

Query  727   TVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDY  548
             TVSN HFTDH +V+LFGAN++  IDK+MQIT+AFNHFGKRL QRMPR R+G  H+VNNDY
Sbjct  288   TVSNSHFTDHQEVMLFGANDKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDY  347

Query  547   THWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDD-SWKKWTWVSSGDVFMN  371
             THWEMYA+GG+   TIIS GNR+IA P E   K++T R+      WK W W S GD F+N
Sbjct  348   THWEMYAIGGNMNPTIISHGNRFIAPPNEQ-AKQITKREYTSYVDWKLWNWQSEGDYFLN  406

Query  370   GAFFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             GA+F  SG      PK       +  +RP  G  V +L   +G LG C  G+ C
Sbjct  407   GAYFVQSGKPNAWSPKPKNPIPNKFAIRPKPGTMVRKLTMDAGVLG-CKQGQAC  459



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   434 bits (1116),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 238/432 (55%), Positives = 283/432 (66%), Gaps = 24/432 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D  WKQR  EA +  +Q++  +PE +T E N  V   L +                   T
Sbjct  34    DAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELLMKLNG----------------T  77

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR  K    PC ATNPID CWRC  +W+   NR RLA+C  GF + TTGGKGG IYV
Sbjct  78    RRNLRGVKKYNGPCMATNPIDACWRCDKNWAK--NRKRLANCVQGFGRKTTGGKGGPIYV  135

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SD D+  PK GTLRHAVIQK PLWI+FA SM I+L  EL+V  +KTIDGRGA VNI
Sbjct  136   VTDPSDLDLVNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRGANVNI  195

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
               GAG+TLQ V NVII N+ +  I    GG+IRD VDH G RT  +GDGI+IFGS +VWI
Sbjct  196   HDGAGITLQFVKNVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGISIFGSSNVWI  255

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM NC DGLIDA  G+TA+T+SN HFT H+ V+LFGA+N  + DK MQIT+AFNHFG
Sbjct  256   DHVSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFG  315

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPRCR G FH+VNNDYTHW MYA+GGS   TIISQGNR+IA P +   KEVT R
Sbjct  316   QGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQG-AKEVTKR  374

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLS-GKEVGRLARYS  260
             D  P+  WKKW W S GD+ MNGA F  SG   G   +  + +L P   G  V  L +++
Sbjct  375   DHTPEAEWKKWEWRSEGDLMMNGAIFVQSG--SGKSNHPAKMDLMPFKPGTYVAELTKFA  432

Query  259   GHLGRCTPGRKC  224
             G L  C  G+ C
Sbjct  433   GALD-CFVGKPC  443



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   434 bits (1117),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 297/464 (64%), Gaps = 33/464 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +    LSIA V P+  A ++  DD W QR+A A R  +++Y PNP  +T   N   ++ +
Sbjct  13    IVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAM  72

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEP----CRATNPIDQCWRCRADWSDGP  1232
               T               DN  RREL + K  ++      R+ N ID+CWR   +W+   
Sbjct  73    ETT-------------GADNGPRRELGQVKAGQKTRGGRFRSLNAIDRCWRGDKNWAK--  117

Query  1231  NRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAAS  1052
             NR +LADC LGF   T GGK G IYVV DASDDD+  PK GTLRHAV +  PLWI+FA +
Sbjct  118   NRKKLADCVLGFGLKTIGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFART  177

Query  1051  MTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRD  872
             M IKL  EL++  +KTIDGRG  V I GGAG TLQ V NVIIHNI +  IK   GG+IRD
Sbjct  178   MVIKLQQELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRD  237

Query  871   CVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK  692
               +H G+RT  +GDGI IFG+ ++WIDHVSM NC DG+IDA  G+TA+T+SN HFTDH +
Sbjct  238   SEEHFGLRTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKE  297

Query  691   VLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSS  512
             V+LFGA N D  DK+MQIT+AFNHFGKRL+QRMPR R+G+ H+VNNDYTHWEMYA+GG+ 
Sbjct  298   VMLFGAKNGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNM  357

Query  511   GATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD---  344
               TIISQGNR+IA P E+  K+VT R+  P   WK W W S  D F+NGA+F  SG    
Sbjct  358   NPTIISQGNRFIAPPKED-CKQVTKREYTPYPEWKSWNWQSERDYFLNGAYFVQSGKSNA  416

Query  343   ----PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 PK      +   +RP  G +V  L + +G L  C PG+ C
Sbjct  417   WSAAPKNPIPKEF--TIRPQPGTKVRSLTKDAGTLD-CRPGKSC  457



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   434 bits (1115),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 226/455 (50%), Positives = 301/455 (66%), Gaps = 30/455 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSD-DVWKQREA-EARRGLLQAYHPNPEKITTELNERVSIGL  1400
             + +  + +A+++P   A +++ D + +++A E     L+AY  NPE++T   N+ V   L
Sbjct  10    LLILFIWLASLVPHIHARIAEFDAYLEKQALEDLNSSLEAYTHNPEEVTNAFNKEVGNAL  69

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
                                 +  + LRR    K  C ATNPID+CWRC  +W++  NR  
Sbjct  70    --------------------LKYKSLRRNLKEKNKCMATNPIDRCWRCDKNWAE--NRMD  107

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             L +CA GF   TTGGK G+ YVV D SDD+VQEPK GTLRHAVIQ+EPLWI+F  SM IK
Sbjct  108   LEECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIK  167

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             L  EL++  +KTIDGRG  V+IA GAG+T+Q V+NVIIHNI++ +I S+ GG+IRD V+H
Sbjct  168   LQQELMITSDKTIDGRGVAVHIANGAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNH  227

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G+RT  +GDGI+IFGS+H+WIDH ++  C DGL+DA   +TA+T+SNC F  H+ V+L 
Sbjct  228   IGLRTVSDGDGISIFGSNHIWIDHCTLSECTDGLVDAIMASTAITISNCKFNHHNDVMLL  287

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             GA +    D  MQ+T+AFN FG+ L QRMPRCRWG FH+VNNDYTHW+MYA+GGS+  TI
Sbjct  288   GATDAFPQDSIMQVTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTI  347

Query  499   ISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY  323
             ISQGNR+ A    N  K+VT RD  P+  WKKW WVS GD F+NGA+F  SG P+  +K 
Sbjct  348   ISQGNRFKAADNPN-TKQVTKRDYAPESEWKKWQWVSEGDSFLNGAYFVESG-PQDKKKT  405

Query  322   GYRDN--LRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 N  ++   G   GRL R++G L +C PG  C
Sbjct  406   ALTKNHKIKFKPGSHAGRLTRFAGVL-KCKPGIPC  439



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   431 bits (1109),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 219/372 (59%), Positives = 272/372 (73%), Gaps = 6/372 (2%)
 Frame = -2

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR LR K+  K PC+ATNPID+CWRCRA+W++  NR +LA C  GF + T GGK G  Y
Sbjct  30    TRRNLRGKQ-YKGPCKATNPIDRCWRCRANWAN--NRKKLASCVKGFGRKTRGGKKGAYY  86

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             +V D+SDD+V +PK GTLRHAVIQ +PLWI+FA SM I+LS EL+V  +KTID RGA V+
Sbjct  87    IVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARGANVH  146

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             IA GAG+TLQ V NVIIH +++ D     GG+IRD + H G+RT  +GDGI+I+GS ++W
Sbjct  147   IAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIW  206

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             +DH+SM NC DGLIDA  G+TA+T+SNCHFT H+ V+LFGA++  + D  MQIT+AFNHF
Sbjct  207   LDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQITVAFNHF  266

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             GK L QRMPRCRWG  H+VNNDYTHW MYA+GGSS  TIISQGNR+IA P +   KEVT 
Sbjct  267   GKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQA-AKEVTK  325

Query  436   RD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             RD  P+  WK W W S GD+ MNGAFF  SG P     +G  D ++   G  V RL R++
Sbjct  326   RDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGFGKLDMIKAKPGTFVRRLTRFA  385

Query  259   GHLGRCTPGRKC  224
             G L  C  G+KC
Sbjct  386   GSL-NCKVGKKC  396



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   434 bits (1116),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 227/467 (49%), Positives = 302/467 (65%), Gaps = 22/467 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADV--SDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             + ++ IA++IP   A+V  +D+ W  +  EAR+  L AYHP+P  I    +ER      +
Sbjct  10    VCVICIASLIPTILANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTD  69

Query  1393  TYnnrelyddsnnnnndNV---------TRREL---RRKKGS----KEPCRATNPIDQCW  1262
                  E     +  + D +         TRR L   RR +G     K PC A+NPID+CW
Sbjct  70    VEGTEEDKAVDSTEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCW  129

Query  1261  RCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQK  1082
             RC+ DW+    R RL  C  GF   TTGGK GRIYVV    DDD   P+ GTLRHAVIQK
Sbjct  130   RCQPDWAR--RRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQK  187

Query  1081  EPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDI  902
             EPLWI+F   M+I+LS EL++  +KTID RGA V+IA GAG+T+Q V+N+IIH + V  I
Sbjct  188   EPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHI  247

Query  901   KSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTV  722
              SS GG+IRD +DH G R   +GDGI+IFG+ ++W+DH+SM  C+DGLIDA  G+TA+T+
Sbjct  248   VSSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITI  307

Query  721   SNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTH  542
             SN HFT H+ V+L GA + +  DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTH
Sbjct  308   SNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTH  367

Query  541   WEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGA  365
             WE+YA+GGS G TI+S GNR+IA P +  ++EVT RD  P+  WK W W S  D F+NGA
Sbjct  368   WELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGA  427

Query  364   FFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +F  SG+P     +  +  ++P  G  V +L +Y+G L  C  G+ C
Sbjct  428   YFRQSGNPHFKCSHSRQQMIKPKHGVAVSKLTKYAGALD-CRVGKAC  473



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 234/451 (52%), Positives = 294/451 (65%), Gaps = 26/451 (6%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             Y  +  +A ++P   A+V+  D+ W QR+ +A +  + +Y PNP  +T  LN  V++ ++
Sbjct  11    YALVFLLAILVPHVQANVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVD  70

Query  1396  ETYnnrelyddsnnnnndNVTRREL--RRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
              T +                TRREL  R+ +     C A NPID+CWRC  +W    NR 
Sbjct  71    ATESTNN-------------TRRELIGRKTQEGSGKCIAHNPIDKCWRCDPNWEK--NRK  115

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LA+C LGF + TTGGK G IYVV D+SDDD+  PK GTLRHAV +  PLWI+FA SM I
Sbjct  116   KLAECVLGFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVI  175

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  NKTIDGRGA V I  G G+TLQ VNNVII+NI V  I    GG+IRD  +
Sbjct  176   KLQQELMITSNKTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEE  235

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GDGI++FG+ +VWIDHVSM  C DG+IDA  G+TAVT+SN HFTDH +V+L
Sbjct  236   HVGLRTKSDGDGISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVML  295

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA +E  IDK MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTHWEMYA+GG+   T
Sbjct  296   FGAKDEHVIDKNMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPT  355

Query  502   IISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSG-----DP  341
             IISQGNR+IA P E   KEVT R+    + WK W W S GD F+NGA+F  SG      P
Sbjct  356   IISQGNRFIAPPNEQ-AKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSP  414

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLG  248
             K       +  +RP  G  V  L   +G LG
Sbjct  415   KPKNPVPSKFAIRPKPGTMVRELTMDAGALG  445



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   433 bits (1113),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 293/440 (67%), Gaps = 30/440 (7%)
 Frame = -2

Query  1528  TADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVS---IGLNETYnnrelyddsn  1358
             T ++ D+ WKQR A+A R    + HP+PE +T E N +V    +G N T           
Sbjct  29    TVELEDEYWKQRAADAMRIANASVHPDPENVTEEFNAKVHEHIMGQNRT-----------  77

Query  1357  nnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttg  1178
                     RR LR  K  + PCRATNPID CWRC  +W+D  NR +L DC++GF K TTG
Sbjct  78    --------RRTLRGFKRYEGPCRATNPIDACWRCDPEWAD--NRQKLVDCSMGFGKKTTG  127

Query  1177  gkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTID  998
             GKGG IYVV D SDDD+  PK GTLR+AV +K PLWI+FA SM I+L  EL+V  +KTID
Sbjct  128   GKGGPIYVVTDGSDDDIVNPKEGTLRYAVTRKRPLWIIFAHSMVIRLQQELMVTCDKTID  187

Query  997   GRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITI  818
             GRGA + IA G G+TLQ VNNVII NIKV DI+S PGG++RD  DH G+RT  +GDGI++
Sbjct  188   GRGANIVIAYGGGITLQYVNNVIITNIKVKDIQSLPGGMLRDAEDHVGLRTRSDGDGISL  247

Query  817   FGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQI  638
             F + ++WIDHVSM    DGLID   G+TAVT+SN HFTDH++ +LFGA N  + DK MQI
Sbjct  248   FSASNIWIDHVSMARTADGLIDCIMGSTAVTISNGHFTDHNEAMLFGAKNTHTQDKNMQI  307

Query  637   TLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGEN  458
             TLAFNHFG+ L QRMPRCR+G FH+VNNDYT W MYA+GG+   TIISQGNR+IA P  +
Sbjct  308   TLAFNHFGQGLVQRMPRCRFGFFHVVNNDYTQWIMYAIGGNMNPTIISQGNRFIA-PESH  366

Query  457   FFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLS-GKE  284
               KEVT R+  D+S WK W W S GDV  NGAFF  SG+P   +       + P   GK 
Sbjct  367   VAKEVTKREYTDESEWKNWNWRSEGDVMENGAFFVESGNPNCAKSTNIE--MMPFKPGKL  424

Query  283   VGRLARYSGHLGRCTPGRKC  224
               +L  ++G L  C  GR C
Sbjct  425   APQLTSFAGAL-ECFVGRPC  443



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 298/464 (64%), Gaps = 33/464 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +    LSIA V P+  A ++  DD W QR+A A R  +++Y PNP  +T   N   ++ +
Sbjct  13    IVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAM  72

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEP----CRATNPIDQCWRCRADWSDGP  1232
               T               DN TRREL + K  ++      ++ N ID+CWR   +W+   
Sbjct  73    ETT-------------GADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAK--  117

Query  1231  NRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAAS  1052
             NR +LADC LGF   TTGGK G IYVV DASDDD+  PK GTLRHAV +  PLWI+FA +
Sbjct  118   NRKKLADCVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFART  177

Query  1051  MTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRD  872
             M IKL  EL++  +KTIDGRG  V I GGAG TLQ V NVIIHNI +  IK   GG+IRD
Sbjct  178   MVIKLQQELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRD  237

Query  871   CVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK  692
               +H G+RT  +GDGI IFG+ ++WIDHVSM NC DG+IDA  G+TA+T+SN HFTDH +
Sbjct  238   SEEHFGLRTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKE  297

Query  691   VLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSS  512
             V+LFGA N D  DK+MQIT+AFNHFGKRL+QRMPR R+G+ H+VNNDYTHWEMYA+GG+ 
Sbjct  298   VMLFGAKNGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNM  357

Query  511   GATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD---  344
               TIISQGNR+IA P E+  K+VT R+      WK W W S  D F+NGA+F  SG    
Sbjct  358   NPTIISQGNRFIAPPKED-CKQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKSNA  416

Query  343   ----PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 PK      +   +RP  G +V  L + +G L  C PG+ C
Sbjct  417   WSAAPKNPIPKEF--TIRPQPGTKVRSLTKDAGTLD-CRPGKSC  457



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   433 bits (1113),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 298/464 (64%), Gaps = 33/464 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +    LSIA V P+  A ++  DD W QR+A A R  +++Y PNP  +T   N   ++ +
Sbjct  13    IVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAM  72

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEP----CRATNPIDQCWRCRADWSDGP  1232
               T               DN TRREL + K  ++      ++ N ID+CWR   +W+   
Sbjct  73    ETT-------------GADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAK--  117

Query  1231  NRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAAS  1052
             NR +LADC LGF   TTGGK G IYVV DASDDD+  PK GTLRHAV +  PLWI+FA +
Sbjct  118   NRKKLADCVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFART  177

Query  1051  MTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRD  872
             M IKL  EL++  +KTIDGRG  V I GGAG TLQ V NVIIHNI +  IK   GG+IRD
Sbjct  178   MVIKLQQELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRD  237

Query  871   CVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK  692
               +H G+RT  +GDGI IFG+ ++WIDHVSM NC DG+IDA  G+TA+T+SN HFTDH +
Sbjct  238   SEEHFGLRTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKE  297

Query  691   VLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSS  512
             V+LFGA N D  DK+MQIT+AFNHFGKRL+QRMPR R+G+ H+VNNDYTHWEMYA+GG+ 
Sbjct  298   VMLFGAKNGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNM  357

Query  511   GATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD---  344
               TIISQGNR+IA P E+  K+VT R+      WK W W S  D F+NGA+F  SG    
Sbjct  358   NPTIISQGNRFIAPPKED-CKQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKSNA  416

Query  343   ----PKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 PK      +   +RP  G +V  L + +G L  C PG+ C
Sbjct  417   WSAAPKNPIPKEF--TIRPQPGTKVRSLTKDAGTLD-CRPGKSC  457



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 235/433 (54%), Positives = 284/433 (66%), Gaps = 26/433 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERV-SIGLNETYnnrelyddsnnnnndNV  1337
             D  WKQR  EA +  L++Y+ NPE++T E N  V  + L E                   
Sbjct  43    DAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLMLKEN-----------------T  85

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR LR  K  K PC ATNPID CWRC   W++  NR ++  CA GF K  TGGK G  Y
Sbjct  86    TRRNLRGNKAYKGPCMATNPIDACWRCDPYWAN--NRKKIVGCAQGFGKKATGGKDGPFY  143

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV   +DDDVQ PK GTLRHAVIQK PLWI+FA SM I+L  EL+V  +KTID RGA V 
Sbjct  144   VVTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDARGANVV  203

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             I  GAG+TLQ V NVII N+ +  I   PGG+IRD VDH G+RT  +GDGI++FG+ +VW
Sbjct  204   IEEGAGITLQFVKNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGISLFGASNVW  263

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM  C DGLIDA  G+T++T+SN HFTDHD+ +LFGANN  + DK MQITLAFNHF
Sbjct  264   IDHVSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHF  323

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             G+ L QRMPR R G FH+VNNDYTHW MYA+GG+   TIISQGNR+IA P     K+VTH
Sbjct  324   GQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIA-PINGVTKQVTH  382

Query  436   RD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLS-GKEVGRLARY  263
             R+  P+  WK W W S GD+ MNGAFF  SG   G  K+  + ++ P   G  V  L ++
Sbjct  383   RENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLDMMPFKPGTFVATLTKF  440

Query  262   SGHLGRCTPGRKC  224
             SG L  C  G+ C
Sbjct  441   SGAL-NCAVGKPC  452



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   433 bits (1113),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 226/467 (48%), Positives = 302/467 (65%), Gaps = 22/467 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADV--SDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             + ++ IA++IP   A+V  +D+ W  +  EAR+  L AYHP+P  I    +ER      +
Sbjct  10    VCVICIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTD  69

Query  1393  TYnnrelyddsnnnnndNV---------TRREL---RRKKGS----KEPCRATNPIDQCW  1262
                  E     +  + D +         TRR L   RR +G     K PC A+NPID+CW
Sbjct  70    VEGTEEDTAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCW  129

Query  1261  RCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQK  1082
             RC+ DW+    R RL  C  GF   TTGGK GRIYVV    DDD   P+ GTLRHAVIQK
Sbjct  130   RCQPDWAK--RRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQK  187

Query  1081  EPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDI  902
             EPLWI+F   M+I+LS EL++  +KTID RGA V+IA GAG+T+Q V+N+IIH + V  I
Sbjct  188   EPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHI  247

Query  901   KSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTV  722
              +S GG+IRD +DH G R   +GDGI+IFG+ ++W+DH+SM  C+DGLIDA  G+TA+T+
Sbjct  248   VTSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITI  307

Query  721   SNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTH  542
             SN HFT H+ V+L GA + +  DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTH
Sbjct  308   SNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTH  367

Query  541   WEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGA  365
             WE+YA+GGS G TI+S GNR+IA P +  ++EVT RD  P+  WK W W S  D F+NGA
Sbjct  368   WELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSDKDYFLNGA  427

Query  364   FFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +F  SG+P     +  +  ++P  G  V +L +Y+G L  C  G+ C
Sbjct  428   YFRQSGNPHFKCSHSRQQMIKPKHGVAVSKLTKYAGALD-CRVGKAC  473



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   432 bits (1111),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 238/474 (50%), Positives = 304/474 (64%), Gaps = 32/474 (7%)
 Frame = -2

Query  1600  AASTKILWWVYLALLSIAAVI-PATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             AA   +  +V++   S  A++ P    +V+  D  W QR+++A +  + +Y P+P  +T 
Sbjct  3     AAFLNLGGYVFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTN  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRREL------RRKKGSKEPCRATNPIDQ  1268
               N  V+I ++ + +  +             TRREL      R+   S   C A NPID 
Sbjct  63    HFNYHVNIAVDASESRND-------------TRRELTQVRSGRKTHKSSGKCLAYNPIDN  109

Query  1267  CWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVI  1088
             CWRC  +W++  NR +LADC LGF + TTGGK G IYVVKDASD+D+  PK GTLRHAV 
Sbjct  110   CWRCDRNWAN--NRKKLADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVT  167

Query  1087  QKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVG  908
             +  PLWI+FA SM IKL  EL++  +KTIDGRGA V I  GAG+TLQ VNNVIIHNI V 
Sbjct  168   RDGPLWIIFARSMIIKLQQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVK  227

Query  907   DIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAV  728
              I    GG+IRD   H G+RT  +GDGI++FG+ ++WIDHVSM  C DG+IDA  G+TAV
Sbjct  228   HIVPGNGGLIRDSEAHIGLRTKSDGDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAV  287

Query  727   TVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDY  548
             T+SN HFTDH +V+LFGA +E  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDY
Sbjct  288   TISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDY  347

Query  547   THWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMN  371
             THWEMYA+GG+   TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+N
Sbjct  348   THWEMYAIGGNMNPTIISQGNRFIAPPNEE-AKQITKREYTPYGEWKSWNWQSEGDYFLN  406

Query  370   GAFFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             GA+F  SG       K       +  +RP  G  V +L   +G LG C  G  C
Sbjct  407   GAYFVQSGKANAWSSKPKTPLPNKFTIRPKPGTMVRKLTMDAGVLG-CKLGEAC  459



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 234/455 (51%), Positives = 295/455 (65%), Gaps = 40/455 (9%)
 Frame = -2

Query  1546  AVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrel  1373
             A++P   A++   D  W+ R  +A++   QAY PNP++IT+ LN  V   L+ +      
Sbjct  17    AIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKALSGS------  70

Query  1372  yddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFA  1193
                       N TRREL + KG   PC ATNPID CWRC  +W    NR +LADC LGF 
Sbjct  71    ----------NSTRRELAKYKG---PCSATNPIDSCWRCDPNWEK--NRKKLADCVLGFG  115

Query  1192  kgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQG  1013
              GTTGGK G+IYVV D+SD+D+  PK GTLR A IQKEPLWI+F  +M IKL  ELL+  
Sbjct  116   HGTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTS  175

Query  1012  NKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEG  833
             +KTID RGA V+I+ GA +TLQ V N+IIH + + D K + GG IRD +DH G R+  +G
Sbjct  176   DKTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDG  235

Query  832   DGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK-----------VL  686
             D I++FG+ HVWIDH+SM NC DGL+DA AG+TA+T+SNCH T H+            V+
Sbjct  236   DAISMFGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVINNISSTYSFVM  295

Query  685   LFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGA  506
             LFGAN+  S D+  QIT+AFNHFGK L QRMPRCRWG FHIVNNDYTHW MYA+GGS+  
Sbjct  296   LFGANDGFSGDQISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHP  355

Query  505   TIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE  329
             TI+SQGNR+IA P  N  KEVT RD  P+  WK W+W S  D+ MNGAFF  SG      
Sbjct  356   TILSQGNRFIAPPNPN-AKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTKAANF  414

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 + +++   G     L R+SG L +C  G+ C
Sbjct  415   P---KSDIKAKPGSFAAALTRFSGCL-KCEVGKPC  445



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   432 bits (1111),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 236/478 (49%), Positives = 309/478 (65%), Gaps = 26/478 (5%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             MA  +K+++     +  IA +IP    ++S  D+ W QR  EAR   LQAYH +P +I  
Sbjct  3     MARLSKLMF-----MFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVD  57

Query  1429  ELNER---VSIGLNETYnnrelyddsnnnnndNV-------TRRELRRK-KGS----KEP  1295
               +ER    S  +  T    +   +        +       TRR LR K KG     K P
Sbjct  58    HFHERHYDNSTDVTTTEEEGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGP  117

Query  1294  CRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPK  1115
             C A+NPID+CWRCR+DW+    R RL  C  GF   TTGGK GRIYVV    DDD+  PK
Sbjct  118   CTASNPIDKCWRCRSDWA--KRRKRLTRCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPK  175

Query  1114  AGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNN  935
              GTLRHAVIQKEPLWI+F   M+I+L+ ELL+  +KTID RGA V++A GAG+T+Q V N
Sbjct  176   PGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKN  235

Query  934   VIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLI  755
             VIIH + +  I  S GG+IRD VDH GMRT  +GDG++I+GS ++W+DH+SM  C+DGLI
Sbjct  236   VIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLI  295

Query  754   DAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWG  575
             DA  G+T +T+SN HFT H+ V+L GA N +  DK MQ+T+A+NHFGK L QRMPR RWG
Sbjct  296   DAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWG  355

Query  574   LFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTW  398
               H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P +  ++EVT RD   +D WK W W
Sbjct  356   FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNW  415

Query  397   VSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              S  DVFMNGA+F  SG+P+    +  +  ++P  G  V +L +Y+G L  C  G++C
Sbjct  416   RSEKDVFMNGAYFRQSGNPQYKCAHTRQQMIKPKHGLAVSKLTKYAGALD-CRVGKRC  472



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   430 bits (1105),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 232/432 (54%), Positives = 285/432 (66%), Gaps = 28/432 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+ WK+R  EA+    +AY PNPEK+    N+ V   L                   N T
Sbjct  14    DEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKSLE----------------GGNST  57

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR L + KG   PC ATNPID+CWRC  +W+   NR +L  CALGF + T GGK G+ Y 
Sbjct  58    RRNLGKYKG---PCLATNPIDRCWRCDKNWA--KNRKKLGGCALGFGRKTIGGKNGKYYR  112

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SD+D+  PK GTLR+ VIQ +PLWI+FA  M I+LS EL+V  NKTIDGRG  V+I
Sbjct  113   VTDPSDNDMVNPKPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHI  172

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
               GA +TLQ V NVIIH I + D K+  GG+IRD VDH G R+  +GDGI+IFGS  +WI
Sbjct  173   YNGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWI  232

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+S+ NCEDGLIDA  G+ A+T+SNCHFT H+ V+LFGA++  S D  MQIT+AFNHFG
Sbjct  233   DHISLSNCEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQITVAFNHFG  292

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPR RWG  H+VNNDYTHWEMYA+GGS   TIISQGNR+IA P +   KEVT R
Sbjct  293   RGLVQRMPRVRWGFAHVVNNDYTHWEMYAIGGSQHPTIISQGNRFIAPP-DLACKEVTKR  351

Query  433   DCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDP-KGVEKYGYRDNLRPLSGKEVGRLARYS  260
             D   +S WK W W S GD+ +NGAFF  SG+  K + K G    +  + G+ V RL R+S
Sbjct  352   DYAVESVWKSWNWRSEGDLMLNGAFFVQSGNAIKTMNKQGV---INAMPGRHVSRLTRFS  408

Query  259   GHLGRCTPGRKC  224
             G L  C  GR C
Sbjct  409   GALD-CVRGRPC  419



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   431 bits (1108),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 233/455 (51%), Positives = 288/455 (63%), Gaps = 24/455 (5%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNET  1391
             YL L   AAV         DD W+QR+  A       Y  +P ++T +LN  V   + + 
Sbjct  18    YLVLFLSAAVSSEANIGDFDDYWRQRKLMADAAAEATYKHDPLEVTNQLNRAVHRSVEK-  76

Query  1390  YnnrelyddsnnnnndNVTRRE--LRRKKG--SKEPCRATNPIDQCWRCRADWSDGPNRF  1223
                            D  TRR   +  KKG  +  PC ATNPID+CWRCR DW+   +R 
Sbjct  77    --------------EDMSTRRRAMMGHKKGKLNNGPCEATNPIDRCWRCRQDWA--TDRK  120

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             RLA CA GF + TTGG  G+ YVV D +DDDV  P+ GTLR AVIQ EPLWI FA +M I
Sbjct  121   RLARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFARTMII  180

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP--GGIIRDC  869
              L  EL++QG+KTIDGRGA V IA GA +T+Q  NNVIIHN+ + DI SS   GG IRD 
Sbjct  181   TLKEELIIQGDKTIDGRGAQVRIANGAQLTVQFANNVIIHNVHINDIMSSNKNGGNIRDS  240

Query  868   VDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKV  689
              DH G RT  +GDGIT+FGS +VW+DH+S+ NC+DGLID    +T VT+SNCH T+H+ V
Sbjct  241   PDHFGWRTVSDGDGITLFGSTNVWLDHLSLSNCQDGLIDVIVKSTGVTISNCHMTNHNDV  300

Query  688   LLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSG  509
             +LF ++++   D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS  
Sbjct  301   MLFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKA  360

Query  508   ATIISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE  329
              TIISQGNRYIA P         H D P+  WK W W S  D+FM GA FT SG  K   
Sbjct  361   PTIISQGNRYIAPPNLAAKLVTKHHDAPESEWKNWVWHSENDLFMEGANFTVSGGQKINR  420

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              +  +D ++P +G  V RL RY+G L  C PG+ C
Sbjct  421   NFHKKDLIKPKNGSYVTRLTRYAGALA-CRPGKPC  454



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   432 bits (1111),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 239/466 (51%), Positives = 300/466 (64%), Gaps = 28/466 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             MAA+   +    L  LS+  ++P   A+V+  D+ WKQR+ +A +  + +Y PNP  +T 
Sbjct  1     MAATFLNIGGYTLVFLSVI-LVPHVQANVAIFDNYWKQRQGDALKQTIASYDPNPLNVTD  59

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRREL--RRKKGSKEPCRATNPIDQCWRC  1256
              LN  V++ ++ T +                TRREL  R  +     C A NPID+CWRC
Sbjct  60    HLNYHVALAVDATESTNN-------------TRRELIGRETQEGSGKCIAYNPIDKCWRC  106

Query  1255  RADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEP  1076
               +W    NR +L +C LGF + TTGGK G IYVV D+SD+D+  PK GTLRHAV +  P
Sbjct  107   DPNWEK--NRKKLVECVLGFGRKTTGGKDGPIYVVNDSSDEDLVNPKPGTLRHAVTRDGP  164

Query  1075  LWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKS  896
             LWI+FA SM IKL  EL++  NKTIDGRGA V I  GAG+T Q VNNVII+NI V  I  
Sbjct  165   LWIIFANSMVIKLQQELMITSNKTIDGRGARVYIMEGAGLTQQFVNNVIINNIYVKHIIP  224

Query  895   SPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSN  716
               GG+IRD  +H G+RT  +GDGI++FG+ +VWIDHVSM  C DG+IDA  G+TAVT+SN
Sbjct  225   GNGGLIRDSEEHVGLRTKSDGDGISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISN  284

Query  715   CHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWE  536
              HFTDH +V+LFGA +E  IDK MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDYTHWE
Sbjct  285   SHFTDHQEVMLFGAKDEHVIDKNMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWE  344

Query  535   MYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFF  359
             MYA+GG+   TIISQGNR+IA P E   KEVT R+    + WK W W S GD F+NGA+F
Sbjct  345   MYAIGGNMNPTIISQGNRFIAPPNEQ-AKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYF  403

Query  358   TPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTP  236
               SG      PK       +  +RP  G  V  L   +G LG C P
Sbjct  404   VQSGRPNAWSPKPKNPVPSKFAIRPKPGTMVRELTMDAGVLG-CEP  448



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   431 bits (1108),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 234/449 (52%), Positives = 310/449 (69%), Gaps = 12/449 (3%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             +++A +IP   AD++  D+VW++R  EA++  L +Y PNPE  T + N  V+   N   +
Sbjct  12    ITLATLIPGLLADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVN---NTLVD  68

Query  1384  nrelyddsnnnnndNVTRRELRR-KKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
               +  +D+    + N TRR L++ KK    PC+ TNPID+CWRCR +W+   NR RLA C
Sbjct  69    FDDDRNDAGFELHANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWAR--NRKRLAKC  126

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
             ALGF +  TGG  GR+YVV + SDDDV  PK GTLRHAVIQK PLWI+F+ +M I+LS E
Sbjct  127   ALGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNIRLSKE  186

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L++  +KTIDGRG  ++IA GAG+T+Q + NVIIH I++  I ++ GG IRD V+H G+R
Sbjct  187   LIMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVEHYGIR  246

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
             T+ +GDGI+IFGS ++WIDHVSM  C DGLIDA  G+TA+T+SN HFT H+  +L GA++
Sbjct  247   TNSDGDGISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASD  306

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               S D+ MQ+T+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TIISQG
Sbjct  307   SFSGDELMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIISQG  366

Query  487   NRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRD  311
             NR+IA P E   K+VT RD   +S WK WTW S  D+ MNGAFF  SG P+  ++   + 
Sbjct  367   NRFIAPP-ELHLKQVTKRDYATESEWKTWTWRSENDLMMNGAFFIESGKPR-TKRPHKKF  424

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              +    G    R+  ++G L  C  GRKC
Sbjct  425   MITAKPGSLATRMTLFAGALD-CKSGRKC  452



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 226/467 (48%), Positives = 300/467 (64%), Gaps = 22/467 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADV--SDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             + ++ IA++IP   A+V  +D+ W  +  EAR+  L AYHP+P  I    +ER      +
Sbjct  10    VCVICIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTD  69

Query  1393  TYnnrelyddsnnnnndNV---------TRREL---RRKKGS----KEPCRATNPIDQCW  1262
                  E     +  + D +         TRR L   RR +G     K PC A+NPID+CW
Sbjct  70    VEGTEEDKAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCW  129

Query  1261  RCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQK  1082
             RC+ DW+    R RL  C  GF   TTGGK GRIYVV    DDD   P+ GTLRHAVIQK
Sbjct  130   RCQPDWAR--RRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQK  187

Query  1081  EPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDI  902
             EPLWI+F   M+I+LS EL++  +KTID RGA V+IA GAG+T+Q V N+IIH + V  I
Sbjct  188   EPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVKNIIIHGLHVHHI  247

Query  901   KSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTV  722
              +S GG+IRD +DH G R   +GDGI+IFG+  +W+DH+SM  C+DGLIDA  G+TA+T+
Sbjct  248   VTSSGGLIRDSIDHFGQRGQADGDGISIFGATDIWLDHISMSKCQDGLIDAIMGSTAITI  307

Query  721   SNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTH  542
             SN HFT H+ V+L GA + +  DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTH
Sbjct  308   SNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTH  367

Query  541   WEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGA  365
             WE+YA+GGS G TI+S GNR+IA P +  ++EVT RD  P+  WK W W S  D F+NGA
Sbjct  368   WELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGA  427

Query  364   FFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +F  SG+P     +  +  ++P  G  V +L +Y+G L  C  G+ C
Sbjct  428   YFRQSGNPHFKCSHSRQQMIKPKHGVAVSKLTKYAGALD-CRVGKAC  473



>ref|XP_006357121.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=397

 Score =   429 bits (1102),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 220/372 (59%), Positives = 267/372 (72%), Gaps = 7/372 (2%)
 Frame = -2

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR L +K   K PC ATN ID+CWRC   W+D  +R + ADCA+GF     GGKGGR+Y
Sbjct  32    TRRHLAKK--YKGPCMATNLIDKCWRCDPHWAD--HREKYADCAMGFGSKAIGGKGGRVY  87

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV D SD DV+ P  GTLRHAVIQKEPLWI+F   M IKL  ELL+Q +KTIDGRG  ++
Sbjct  88    VVTDNSDKDVENPTPGTLRHAVIQKEPLWIIFERHMHIKLKRELLMQSHKTIDGRGFNIH  147

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             I  GAG+ +QSVNN+II N+ V +I  +PGG+IRD VDH G+R+ DEGDGI++F +  VW
Sbjct  148   IEKGAGLKMQSVNNIIITNLHVHNIGITPGGMIRDSVDHVGIRSEDEGDGISLFAATDVW  207

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM    DGLIDA  G+T +T+SNCHFTDHDK +LFGAN+    DK+MQITLA+NHF
Sbjct  208   IDHVSMSRATDGLIDAVQGSTGITISNCHFTDHDKAMLFGANDNHVEDKKMQITLAYNHF  267

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             GKRL QRMPR R+G FHIVNNDYTHW  YA+GG+SGATIISQGNR+IAQ      KEVTH
Sbjct  268   GKRLDQRMPRVRFGFFHIVNNDYTHWMRYAIGGNSGATIISQGNRFIAQASL-LIKEVTH  326

Query  436   RDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R+  ++S WK WTW+S  D   NGAFF  SGD   + K    + +      +VG L +++
Sbjct  327   REKAEESEWKNWTWLSIDDDMQNGAFFRTSGDQDALRKLKNLNLIPAEPSYKVGILTKFA  386

Query  259   GHLGRCTPGRKC  224
             G L  CT GR C
Sbjct  387   GSLS-CTAGRPC  397



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 233/466 (50%), Positives = 303/466 (65%), Gaps = 21/466 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNER---VSIG  1403
             + +  IA +IP    ++S  D+ W +R  EAR   LQAYH +P +I    +ER    S  
Sbjct  10    MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1402  LNETYnnrelyddsnnnnndNV-------TRRELRRK-KGS----KEPCRATNPIDQCWR  1259
               ET  +     +        +       TRR LR K KG     K PC A+NPID+CWR
Sbjct  70    ATETEEDGGAKPEEEEEEGIKMVGNSTKSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             CR +W+    R +L  C  GF   TTGGK GRIYVV    D+D+  PK GTLRHAVIQKE
Sbjct  130   CRTNWAK--RRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKE  187

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+F   M+I+LS ELL+  +KTID RGA V+IA GAG+T+Q V NVIIH + +  I 
Sbjct  188   PLWIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGITMQFVKNVIIHGLHIHHIS  247

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
              S GG+IRD VDH GMRT  +GDG++I+GS ++W+DH+SM  C+DGLIDA  G+T +T+S
Sbjct  248   ESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITIS  307

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             N HFT H+ V+L GA N +  DK MQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTHW
Sbjct  308   NSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  367

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
             E+YA+GGS G TI+S GNR+IA P +  ++EVT RD  P+D WK W W S  DVFMNGA+
Sbjct  368   ELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAY  427

Query  361   FTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  SG+P     +  +  ++P +G  V +L +Y+G L  C  G++C
Sbjct  428   FRQSGNPHFKCAHTRKQMIKPKNGMAVSKLTKYAGALD-CRVGKRC  472



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 223/433 (52%), Positives = 287/433 (66%), Gaps = 22/433 (5%)
 Frame = -2

Query  1519  VSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndN  1340
             +SD  WK++   A +   +AY P+P  ++  L   +S                       
Sbjct  39    LSDSYWKEKAEIAAKANEEAYTPDPYAVSGNLTSTIS----------------EMIIGGK  82

Query  1339  VTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
               RR LR +K +  PC ATNPID+CWRC  +W++  NR +LADC  GF + TTGGK G  
Sbjct  83    KGRRNLRGRK-TAGPCMATNPIDRCWRCDPNWAN--NRKKLADCVQGFGRKTTGGKAGPF  139

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV D SD D+  P+ GTLRHAV +  PLWI+FA SM I+L+ EL++  +KTIDGRGA +
Sbjct  140   YVVTDPSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADI  199

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
              IA GAG+T+Q + NVIIH IKV DI    GG++RD  +H G+RT  +GDGI+IFGS ++
Sbjct  200   VIANGAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNI  259

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             WIDHVSM NC DGLIDA  G+TA+T+SN HFTDH++V+LFGA++    D++MQIT+AFNH
Sbjct  260   WIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNH  319

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGKRL QRMPRCR+G  H+VNNDYTHWEMYA+GGS   TIIS+GNR+IA P   + KE+T
Sbjct  320   FGKRLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PDNGYAKEIT  378

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
              R+  P+  WK W W S  DV+MNGAFF   G       +  +D +    G  VGRL RY
Sbjct  379   KREYSPESEWKNWQWRSINDVYMNGAFFRQGGSELTNRPFSKKDMITAKPGAYVGRLTRY  438

Query  262   SGHLGRCTPGRKC  224
             SG L +C  G+ C
Sbjct  439   SGSL-KCIVGKPC  450



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 290/455 (64%), Gaps = 25/455 (5%)
 Frame = -2

Query  1582  LWWVYLALLSIAAVIPATTADVS-DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSI  1406
             L +++ +LL +A+   + T     D+ W +REAEA   ++QAY   PE +    N     
Sbjct  5     LGYLFYSLLFLASAASSNTNITDYDEYWVKREAEALSNIMQAYVSEPESVVNHFNTPDIF  64

Query  1405  GLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNR  1226
              +  +                  TRR LR  KG    C ATNPID+CWRCR+DW+   NR
Sbjct  65    QVFNS------------------TRRSLRHGKGKGRKCVATNPIDRCWRCRSDWAS--NR  104

Query  1225  FRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMT  1046
               LA CA GF +   GG  G IYVV + SDD++ +P+ GTLR+ V +  PLWI+FA  M 
Sbjct  105   KLLAKCAKGFGRHAEGGLSGSIYVVTNPSDDNLLDPRPGTLRYGVTRDRPLWIIFARDMV  164

Query  1045  IKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCV  866
             IKL  EL++   KTIDGRGA V+IA GAG+T+Q V +VI+HN+ + DIK   GG IRD  
Sbjct  165   IKLQQELMINNYKTIDGRGANVHIAYGAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSE  224

Query  865   DHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVL  686
              H G+RT  +GDG++IFG+ HVW+DH+SM NC DGLIDA   +TA+T+SNCH T H+ V+
Sbjct  225   GHWGIRTRSDGDGVSIFGASHVWVDHLSMSNCADGLIDAVKASTAITISNCHLTRHNDVI  284

Query  685   LFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGA  506
             L GA+++   D  MQ+T+A+NHFGK L QRMPRCRWG FH+VNNDYTHW MYAVGGS   
Sbjct  285   LLGASDKSQEDAVMQVTVAYNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAVGGSQHP  344

Query  505   TIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE  329
             TIISQGNR++  P + F KEVTHR+  P+  WK W W S  D F +GAFF  SG  K   
Sbjct  345   TIISQGNRFVGPPIQ-FAKEVTHREYAPESEWKNWIWTSEDDEFKSGAFFIQSGH-KYQG  402

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             K+   D ++   G   GRL R+SG L +C+P R C
Sbjct  403   KHSRYDVIKAKPGSIAGRLTRFSGAL-QCSPNRPC  436



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   430 bits (1106),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 232/455 (51%), Positives = 303/455 (67%), Gaps = 12/455 (3%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             Y+ L+   + IP     +   DD  +++EAEA+   L+AY P  ++   + +       N
Sbjct  10    YVFLVCFVSQIPNLRGKIGEYDDYLRKQEAEAQEQALRAYDPEFDQTVKKFDHNDPSHQN  69

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKE---PCRATNPIDQCWRCRADWSDGPNR  1226
              T + +  Y  + N  +   TRR LR +   K+   PC+ATNP+D+CWRC+ADW+   NR
Sbjct  70    ATISIKGGYRPNKNTTS---TRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWAQ--NR  124

Query  1225  FRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMT  1046
              RL  C  GF   TTGG  G+ Y V D SDDD+Q PK GT+RHAVIQK PLWI+FA SM 
Sbjct  125   KRLVSCVRGFGHKTTGGFSGKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIFARSMH  184

Query  1045  IKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCV  866
             I+L  EL++  NKTID RGA V+IA GAG+T+Q   NVIIH + +  I +S GG+IRD V
Sbjct  185   IRLKQELMITSNKTIDARGANVHIAFGAGITIQFAQNVIIHGLHIHHIVTSNGGMIRDSV  244

Query  865   DHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVL  686
             DH G+RT  +GDGI++FGS +VW+DH+SM  C+DGLID   G+TA+T+SNCHFT H+ V+
Sbjct  245   DHIGIRTQADGDGISVFGSSNVWLDHLSMSRCQDGLIDVIQGSTAITISNCHFTHHNDVI  304

Query  685   LFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGA  506
             L GA+++ S D  MQ+T+A+NHFGK L QRMPRCRWG  H+VNNDYTHWEMYA+GGS   
Sbjct  305   LLGASDQFSGDSIMQVTIAYNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAIGGSQHP  364

Query  505   TIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVE  329
             TI+SQGNR+IA P  ++ K+VT RD    S WK+WTW S  DVFMNGA+F  SGDP    
Sbjct  365   TILSQGNRFIAPPHISWAKQVTKRDYAQPSEWKRWTWQSEMDVFMNGAYFVESGDPNFKH  424

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             K+  +D +R   G     L RY+G L  C  G+ C
Sbjct  425   KFTRQDIIRAKHGMAASMLTRYAGSL-HCFAGKPC  458



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   429 bits (1103),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 233/451 (52%), Positives = 296/451 (66%), Gaps = 27/451 (6%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             L L  +  ++ +  A +   D+VW++R  +A++    AYHPNP+ +   LN +V   +  
Sbjct  8     LFLFVMVVLVLSIEAHIGEFDEVWRKRAEKAKKAARHAYHPNPKIVADHLNNQVDKAVRG  67

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
             + +                 RR+L R  G    C+ATNPIDQCWRC  +W+   NR +LA
Sbjct  68    SNSR----------------RRDLHRYNGQ---CKATNPIDQCWRCDPNWAR--NRMKLA  106

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
             DC LGF + TTGGKGG+IYVV D SD D+  PK GTLRHAVIQ +PLWI+FA +M I+L+
Sbjct  107   DCVLGFGRKTTGGKGGKIYVVTDNSDSDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLN  166

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              EL++  NKTID RG  V+IA G G+ LQ ++NVII N+++ D K+  GG+IRD VDH G
Sbjct  167   EELIMTSNKTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVDHYG  226

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
              RT  +GDGI+IFGS +VWIDHVSM NC+DGLIDA   +TA+T+SN HFT H++V+LFGA
Sbjct  227   YRTKSDGDGISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNSHFTKHNEVMLFGA  286

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++  S D  MQITLAFNHFG+ L QRMPR RWG  H VNNDYTHW MYA+GGS   TI+S
Sbjct  287   SDSSSRDSIMQITLAFNHFGQGLMQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILS  346

Query  493   QGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNR+IA P  N  KEVT RD  P+  WK W W S GD+ MNGAFF  SG+P        
Sbjct  347   QGNRFIAPPNPN-AKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFLRS-  404

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              D +    G  V  L R+SG L  C  G+ C
Sbjct  405   PDMISSKPGSFVSSLTRFSGSLN-CIEGKPC  434



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   429 bits (1104),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 227/455 (50%), Positives = 302/455 (66%), Gaps = 30/455 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSD-DVWKQREA-EARRGLLQAYHPNPEKITTELNERVSIGL  1400
             + +  + +A+++P   A +++ D + +++A EA    L+AY  NPE+IT   N+ V   L
Sbjct  10    LLVLFIWLASLVPHLHARIAEFDPYLEKQALEALNSSLEAYTNNPEEITNAFNKEVGNAL  69

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
                                 +  + LRR    K+ C ATNPID+CWRC  +W++  NR  
Sbjct  70    --------------------LKYKSLRRHLKEKDKCMATNPIDRCWRCDKNWAE--NRMD  107

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             L +CA GF   TTGGK G+ YVV D SDD+VQEPK GTLRHAVIQ+EPLWI+F  SM IK
Sbjct  108   LEECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIK  167

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             L  EL++  +KTIDGRG  V+IA GAG+ +Q V+NVIIHNI++ +I S+ GG+IRD ++H
Sbjct  168   LRQELMITSDKTIDGRGVAVHIAYGAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINH  227

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G+RT  +GDGI+IFGS+H+WIDH ++  C DGLIDA   +TA+T+SNC F  H+ V+L 
Sbjct  228   IGLRTVSDGDGISIFGSNHIWIDHCTLSECTDGLIDAIMASTAITISNCKFNYHNDVMLL  287

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             GA +    D  MQ+T+AFN FG+ L QRMPRCRWG FH+VNNDYTHW+MYA+GGS+  TI
Sbjct  288   GATDAFPQDAIMQVTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTI  347

Query  499   ISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY  323
             ISQGNR+ A    N  K+VT RD   +S WKKW WVS GD F+NGA+F  SG P+  +K 
Sbjct  348   ISQGNRFKASDNPN-TKQVTKRDYATESEWKKWQWVSEGDSFLNGAYFVESG-PQDKKKT  405

Query  322   GYRDN--LRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 N  ++   G   GRL R++G L +C PG  C
Sbjct  406   ALTKNHKIKFKPGSHAGRLTRFAGVL-KCKPGIPC  439



>ref|XP_009587688.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=396

 Score =   427 bits (1099),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 221/372 (59%), Positives = 267/372 (72%), Gaps = 7/372 (2%)
 Frame = -2

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR L +K   K PC A N ID+CWRC   W+D  NR + ADCA+GF +   GGKGGRIY
Sbjct  31    TRRHLSKK--YKGPCVAANLIDKCWRCDPRWAD--NRQKYADCAMGFGRTAIGGKGGRIY  86

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV D SD++V+ P  GTLRHAVIQKEPLWI+F+  M IKL+ ELL+Q  KTID RG  V+
Sbjct  87    VVTDPSDNNVENPVPGTLRHAVIQKEPLWIIFSKHMKIKLNRELLMQSYKTIDARGHNVH  146

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             I  GAG+ +Q VNN+II N+ + +I  S GG+IRD +DH G+R  DEGD I+IF SH +W
Sbjct  147   IENGAGIKMQGVNNIIITNLHIHNIGPSSGGMIRDSIDHIGIRGADEGDAISIFASHDIW  206

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM    DGLIDA  G+T +T+SNCHFTDHDKV+LFGAN+    DK+MQITLA+NHF
Sbjct  207   IDHVSMSRAADGLIDAVQGSTGITISNCHFTDHDKVMLFGANDNYLDDKKMQITLAYNHF  266

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             GKRL QRMPRCR G FH+VNNDYTHW  YA+GGSS ATIISQGNR+IAQ   +  KEVTH
Sbjct  267   GKRLDQRMPRCRLGFFHLVNNDYTHWMRYAIGGSSEATIISQGNRFIAQHNVD-IKEVTH  325

Query  436   RDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R+   +S W+ WTW+S  D   NGAFF  SGDP  + K+   + +       VG L ++S
Sbjct  326   REKAQESEWRHWTWLSRDDDMQNGAFFRTSGDPNALSKFKNLNLMPAEPSYRVGILTKFS  385

Query  259   GHLGRCTPGRKC  224
             G LG CT GR C
Sbjct  386   GSLG-CTVGRPC  396



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   429 bits (1103),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 292/450 (65%), Gaps = 33/450 (7%)
 Frame = -2

Query  1549  AAVIPATTADVS---DDVWKQREAEARRGLLQAYHPNPEKITTELNERVS---IGLNETY  1388
             AA+I     D     D+ WK+R  +A    +++Y PNPE++T E N +V    +G NET 
Sbjct  19    AAIIANAETDQPQELDEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELIMGKNET-  77

Query  1387  nnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
                               RR L+ +K    PC  TNPID CWRC  +W++  NR ++ DC
Sbjct  78    ------------------RRNLKGQKKYVGPCTVTNPIDACWRCDPNWAN--NRMKIVDC  117

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
               GF + TTGGKGG IYVV D SD D+  P+ GTLRHAVIQK PLWI FA +M IKL  E
Sbjct  118   IQGFGRKTTGGKGGPIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQE  177

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L+V  +KTIDGRGA VNI  GA +T+Q V NVII NI +  IK+  GG+IRD VDH G R
Sbjct  178   LMVASDKTIDGRGANVNIFDGACITIQFVKNVIITNIHIKQIKAKEGGMIRDSVDHFGQR  237

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
             T  +GDGI+I+GS ++WIDHVSM NC DGLID   G+T +T+SN HFT H++V+LFGA+N
Sbjct  238   TKSDGDGISIYGSSNIWIDHVSMENCTDGLIDVIMGSTGITISNSHFTKHNEVMLFGASN  297

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               + DK MQIT+AFNHFGK L QRMPRCR G FH+VNNDYTHW MYA+GGS   TIISQG
Sbjct  298   SYTQDKMMQITVAFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQG  357

Query  487   NRYIAQPGEN-FFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYR  314
             NR+IA  G N   KEVT R+   +  WK W W S GD+FMNGAFF  SG P  + +    
Sbjct  358   NRFIA--GLNSAAKEVTKREYTAEAEWKNWLWKSEGDLFMNGAFFVESGSPANL-RADKL  414

Query  313   DNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             D +    G  V +L +++G L  C  G+ C
Sbjct  415   DMIPFKPGTYVTKLTKFAGALD-CFVGKPC  443



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   429 bits (1104),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 236/459 (51%), Positives = 295/459 (64%), Gaps = 31/459 (7%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             L +A V P+  A V+  D+ W QR+A A R  +++Y PNP  +T  LN   ++ +  T  
Sbjct  18    LCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAALAMETTGA  77

Query  1384  nrelyddsnnnnndNVTRRELRRKKGSKEPCR------ATNPIDQCWRCRADWSDGPNRF  1223
             +               TRREL +  G ++  R      + N ID+CWR   +W    NR 
Sbjct  78    DNG-------------TRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHK--NRK  122

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC LGF + TTGGK G +YVV DASDDD+  PK GTLR+AV +  PLWI+F  SM I
Sbjct  123   KLADCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMII  182

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  +KTIDGRGA ++I GGAG+TLQ V NVIIHNI +  I    GG+IRD   
Sbjct  183   KLQQELIINSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEH  242

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G RT  +GDGI IFGS +VWIDHVSM NC DG+ID   G+TA+T+SNCH TDH++V+L
Sbjct  243   HFGHRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVML  302

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA  ED IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+   T
Sbjct  303   FGAREEDVIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPT  362

Query  502   IISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSG-----DP  341
             IISQGNR+IA P EN  K+VT R+    S WK W W S  D F+NGA+F  SG      P
Sbjct  363   IISQGNRFIAPPKEN-SKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSP  421

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                        ++P  G  V RL + +G LG C PG+ C
Sbjct  422   APENPIPRHFAIQPQPGTGVRRLTKDAGTLG-CRPGKSC  459



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   429 bits (1104),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 237/474 (50%), Positives = 303/474 (64%), Gaps = 32/474 (7%)
 Frame = -2

Query  1600  AASTKILWWVYLALLSIAAVI-PATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             AA   +  +V++   S  A++ P    +V+  D  W QR+++A +  + +Y P+P  +T 
Sbjct  3     AAFLNLGGYVFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTN  62

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRREL------RRKKGSKEPCRATNPIDQ  1268
               N  V+I ++ + +  +             TRREL      R+   S   C A NPID 
Sbjct  63    HFNYHVNIAVDASESRND-------------TRRELTQVRSGRKTHKSSGKCLAYNPIDN  109

Query  1267  CWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVI  1088
             CWRC  +W++  NR +LADC LGF + TTGGK G IYVVKDASD+D+  PK GTLRHAV 
Sbjct  110   CWRCDRNWAN--NRKKLADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVT  167

Query  1087  QKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVG  908
             +  PLWI+FA SM IKL  EL++  +KTIDGRGA V I  GAG+TLQ VNNVIIHNI V 
Sbjct  168   RDGPLWIIFARSMIIKLQQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVK  227

Query  907   DIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAV  728
              I    GG+IRD   H G+RT  +GDGI++ G+ ++WIDHVSM  C DG+IDA  G+TAV
Sbjct  228   HIVPGNGGLIRDSEAHIGLRTKSDGDGISLIGATNIWIDHVSMTRCADGMIDAIDGSTAV  287

Query  727   TVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDY  548
             T+SN HFTDH +V+LFGA +E  IDK+MQIT+AFNHFGKRL QRMPRCR+G  H+VNNDY
Sbjct  288   TISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDY  347

Query  547   THWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMN  371
             THWEMYA+GG+   TIISQGNR+IA P E   K++T R+  P   WK W W S GD F+N
Sbjct  348   THWEMYAIGGNMNPTIISQGNRFIAPPNEE-AKQITKREYTPYGEWKSWNWQSEGDYFLN  406

Query  370   GAFFTPSG-----DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             GA+F  SG       K       +  +RP  G  V +L   +G LG C  G  C
Sbjct  407   GAYFVQSGKANAWSSKPKTPLPNKFTIRPKPGTMVRKLTMDAGVLG-CKLGEAC  459



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   429 bits (1103),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 235/459 (51%), Positives = 295/459 (64%), Gaps = 31/459 (7%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             L +A V P+  A V+  D+ W QR+A A R  +++Y PNP  +T  LN   ++ +  T  
Sbjct  18    LCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAALAMETTGA  77

Query  1384  nrelyddsnnnnndNVTRRELRRKKGSKEPCR------ATNPIDQCWRCRADWSDGPNRF  1223
             +               TRREL +  G ++  R      + N ID+CWR   +W    NR 
Sbjct  78    DNG-------------TRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHK--NRK  122

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC LGF + TTGGK G +YVV DASDDD+  PK GTLR+AV +  PLWI+F  SM I
Sbjct  123   KLADCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMII  182

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  +KTIDGRGA ++I GGAG+TLQ V NVIIHNI +  I    GG+IRD   
Sbjct  183   KLQQELIINSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEH  242

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G RT  +GDGI IFGS +VWIDHVSM NC DG+ID   G+TA+T+SNCH TDH++V+L
Sbjct  243   HFGHRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVML  302

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA  ED +DK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+   T
Sbjct  303   FGAREEDVVDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPT  362

Query  502   IISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSG-----DP  341
             IISQGNR+IA P EN  K+VT R+    S WK W W S  D F+NGA+F  SG      P
Sbjct  363   IISQGNRFIAPPKEN-SKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSP  421

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                        ++P  G  V RL + +G LG C PG+ C
Sbjct  422   APENPIPRHFAIQPQPGTGVRRLTKDAGTLG-CRPGKSC  459



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   426 bits (1096),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 220/372 (59%), Positives = 270/372 (73%), Gaps = 10/372 (3%)
 Frame = -2

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR LR+  G   PC ATNPID+CWRC  +W+   NR +LADCALGF +GTTGGK G+IY
Sbjct  19    TRRHLRKYTG---PCLATNPIDRCWRCDRNWAR--NRKKLADCALGFGRGTTGGKDGKIY  73

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV+D+SD+D+  PK GTLRHAVIQ+ PLWI+FA  M I+LS EL++  NKT+DGRGA V+
Sbjct  74    VVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIMTDNKTLDGRGANVH  133

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             IA G  +TLQ V N+IIHN+ + DIK+  GG IRD V H G RT  +GDGI++FGS  VW
Sbjct  134   IANGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSHYGYRTQSDGDGISMFGSSRVW  193

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM NC+DGLIDA   +TA+T+SNCHFT H+ V+L GA++  S DK MQ+TLAFNHF
Sbjct  194   IDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDSYSNDKIMQVTLAFNHF  253

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             GK L QRMPRCRWG  H+VNNDYTHW MYA+GGS   TIISQGNR+IA P  N  KEVT 
Sbjct  254   GKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPN-SKEVTK  312

Query  436   R-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R    +  W+ W W S GD+ MNGAFF  SG+P  + +Y  +D +    G  V RL R++
Sbjct  313   RVYASEREWRSWNWRSEGDLMMNGAFFIQSGNP--IRRYSKKDVIHSKPGTFVTRLTRFA  370

Query  259   GHLGRCTPGRKC  224
             G L +C   + C
Sbjct  371   GPL-KCKMNQPC  381



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   429 bits (1104),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 234/469 (50%), Positives = 306/469 (65%), Gaps = 24/469 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNER-------  1415
             + +  IA +IP   AD+S  D+ W QR  EAR   LQAYH +P +I    +ER       
Sbjct  10    MLVFCIAGLIPTIQADMSELDEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYDNSTD  69

Query  1414  ------VSIGLNETYnnrelyddsnnnnndNVTRRELRRK-KGS----KEPCRATNPIDQ  1268
                    S    E   N  +    + +N+ N TRR LR K KG     K PC A+NPID+
Sbjct  70    ITPTEEASNAKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDK  129

Query  1267  CWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVI  1088
             CWRCR +W+    R +L  C  GF   T GGK GRIYVV    D+DV  P+ GTLRHAVI
Sbjct  130   CWRCRKNWAK--RRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDVVNPEPGTLRHAVI  187

Query  1087  QKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVG  908
             Q+EPLWI+F   M+I+L+ EL++   KTID RGA V+IA GAG+T+Q V +VIIH + + 
Sbjct  188   QEEPLWIIFKNDMSIRLNQELMINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIH  247

Query  907   DIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAV  728
              I  S GG+IRD  DH GMRT  +GDG++I+GS ++W+DHVSM  C+DGLIDA  G+TA+
Sbjct  248   HISESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGSTAI  307

Query  727   TVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDY  548
             T+SN HFT H+ V+L GA N   +DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDY
Sbjct  308   TISNSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDY  367

Query  547   THWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMN  371
             THWE+YA+GGS   TI+SQGNR+IA P    ++EVT RD  P++ WK W W S  D+FMN
Sbjct  368   THWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMN  427

Query  370   GAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             GA+F  SG+P     +  R+ ++P +G  V +L +Y+G L  C  GR+C
Sbjct  428   GAYFRQSGNPNYETDHTRRNMIKPKNGYAVSKLTKYAGALD-CRVGRRC  475



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 231/432 (53%), Positives = 293/432 (68%), Gaps = 26/432 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+ W+++ A AR     AY+PNPE +T   NE V   L                   N T
Sbjct  29    DEYWQKKAALARSHANNAYNPNPESVTHHFNEAVMRDL-----------------ASNST  71

Query  1333  RRELRRKKGSKE-PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             RR LR K  +++  C+ATNPID+C+RC+++W    +R +LA CA GF +  TGGK G  Y
Sbjct  72    RRGLRGKMRNEDGACQATNPIDRCFRCQSNWVH--HRKKLATCAKGFGRHATGGKNGDFY  129

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV D+SD D+  P+ GTLRHAVIQ  PLWIVFA  M I+L+ EL++  NKTIDGRGA V 
Sbjct  130   VVTDSSDADLVNPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDGRGANVQ  189

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             IA GAG+T+Q V+NVI+HNI++ DIK+  GG+IRD  +H G+RT  +GDGI+IFG+ ++W
Sbjct  190   IAYGAGLTIQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGISIFGASNIW  249

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM NC DGLIDA  G+TA+T+SN HFT H+ V+LFGA++  S D  MQIT+AFNHF
Sbjct  250   IDHVSMSNCMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQITVAFNHF  309

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             GK L QRMPRCRWG  H+VNNDYTHW MYAVGGS   TI+SQGNR+IA P   F KEVT 
Sbjct  310   GKGLVQRMPRCRWGFVHVVNNDYTHWMMYAVGGSQHPTILSQGNRFIAPPTL-FAKEVTK  368

Query  436   RD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R+  P+  WK+W+W S GD+  NGAFF  SG P  + K  Y D ++   G  V RL R++
Sbjct  369   REYSPEPVWKQWSWRSEGDLMANGAFFVESGAP--ITK-PYADLIKAKPGSFVTRLTRFA  425

Query  259   GHLGRCTPGRKC  224
             G    C P + C
Sbjct  426   GSRP-CIPNQPC  436



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   428 bits (1101),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 232/466 (50%), Positives = 302/466 (65%), Gaps = 21/466 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             +    IA +IP    ++S  D+ W QR  EAR   LQAYH +P +I    +ER      +
Sbjct  10    MFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1393  TYnnre----------lyddsnnnnndNVTRRELRRK-KGS----KEPCRATNPIDQCWR  1259
                  E                  ++ N TRR LR K KG     K PC A+NPID+CWR
Sbjct  70    VTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWR  129

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             CR+DW+    R +L  C  GF   TTGGK GRIYVV    D+D+  PK GTLRHAVIQKE
Sbjct  130   CRSDWAK--RRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKE  187

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+F   M+I+L+ ELL+  +KTID RGA V++A GAG+T+Q V NVIIH + +  I 
Sbjct  188   PLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHIHHIS  247

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
              S GG+IRD VDH GMRT  +GDG++I+GS ++W+DH+SM  C+DGLIDA  G+T +T+S
Sbjct  248   ESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITIS  307

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             N HFT H+ V+L GA N +  DK MQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTHW
Sbjct  308   NSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  367

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
             E+YA+GGS G TI+S GNR+IA P +  ++EVT RD   +D WK W W S  DVFMNGA+
Sbjct  368   ELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAY  427

Query  361   FTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  SG+P+    +  +  ++P +G  V +L +Y+G L  C  GR+C
Sbjct  428   FRQSGNPQYKCAHTRQQMIKPKNGLAVSKLTKYAGALD-CRVGRRC  472



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 238/475 (50%), Positives = 300/475 (63%), Gaps = 45/475 (9%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             + ++TK+    +  L + A VIP   A ++  DD  K +  EA +  L +Y P P  +  
Sbjct  2     VGSATKV---AFTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAH  58

Query  1429  ELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKK---GSKEPCRATNPIDQCWR  1259
             ELN  V + L  +                  TRRELR++K   G K  C+A+NPID CWR
Sbjct  59    ELNFHVHMALENS------------------TRRELRQRKLRGGGK--CQASNPIDACWR  98

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHA-----  1094
             C  DW++  +RFRLA C  GF +  TGG GG IYVV D SDDD+  PK GT+RHA     
Sbjct  99    CNKDWAN--DRFRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAPGTIR  156

Query  1093  --VIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHN  920
               V QK PLWI+F  SM I L  EL++  +KTIDGRGA V    GAG+T+Q VNNVIIH 
Sbjct  157   HAVTQKGPLWIIFGHSMIISLRQELMISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHG  216

Query  919   IKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAG  740
             +++ DI    GG+IRD  DH G+RT  +GD I+IFGS ++WIDHVS+ NC DGLID   G
Sbjct  217   VRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQG  276

Query  739   ATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIV  560
             +TA+T+SNCH T H+ V LFGA++  + DK MQIT+AFNHFG+ L QRMPRCRWG  H++
Sbjct  277   STAITISNCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVL  336

Query  559   NNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGD  383
             NNDYTHW MYA+GGSSG TI+SQGNR+IA P  +  KE+THRD    D WK W W S  D
Sbjct  337   NNDYTHWLMYAIGGSSGPTILSQGNRFIA-PNNDNAKEITHRDYAGPDVWKNWQWQSEMD  395

Query  382   VFMNGAFFTPSGDPKGVEKYGYRDNL--RPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +FMNGA F  SG P    K  Y+  L  +P  G  V RL R++G L  C  G+ C
Sbjct  396   LFMNGAKFVTSGSPI---KMTYKKGLIMKPRDGTHVSRLTRHAGAL-NCFVGKPC  446



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   428 bits (1100),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 301/469 (64%), Gaps = 24/469 (5%)
 Frame = -2

Query  1567  LALLSIAAVIP---ATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNER------  1415
             + ++ IA++IP   A  AD +D+ W  +  EAR+  L AYHP+P +I    +ER      
Sbjct  10    VCVICIASLIPTIRANVADETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNST  69

Query  1414  --VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKE---------PCRATNPIDQ  1268
                     +   + E       ++  N TRR L  +   K          PC A+NPID+
Sbjct  70    DVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDK  129

Query  1267  CWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVI  1088
             CWRC+ DW+    R +L  C  GF   TTGGK GRIYVV    DDD+  P+ GTLRHAVI
Sbjct  130   CWRCQPDWAR--RRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVI  187

Query  1087  QKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVG  908
             QKEPLWIVF   M+I+LS EL++  +KTID RGA V+IA GAG+T+Q V+N+IIH + V 
Sbjct  188   QKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVH  247

Query  907   DIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAV  728
              I  S GG+IRD ++H G R   +GDGI+IFG+ ++W+DH+SM  C+DGLIDA  G+TA+
Sbjct  248   HIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAI  307

Query  727   TVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDY  548
             T+SN HFT H+ V+L GA N +  DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDY
Sbjct  308   TISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDY  367

Query  547   THWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMN  371
             THWE+YA+GGS G TI+S GNR+IA P +  ++EVT RD   +S WK W W S  DVFMN
Sbjct  368   THWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMN  427

Query  370   GAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              A+F  SG+P     +  +  ++P +G  V +L +Y+G L  C  G+ C
Sbjct  428   NAYFRQSGNPHFKCSHSRQQMIKPKNGMAVSKLTKYAGALD-CRVGKAC  475



>ref|XP_009789922.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=396

 Score =   425 bits (1092),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 220/372 (59%), Positives = 266/372 (72%), Gaps = 7/372 (2%)
 Frame = -2

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR L +K   K PC A N ID+CWRC   W+D  +R + ADCA+GF +   GGKGGRIY
Sbjct  31    TRRHLSKK--YKGPCVAANLIDKCWRCNPRWAD--DRQKYADCAMGFGRNAIGGKGGRIY  86

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV D SD +V+ P  GTLRHAVIQKEPLWI+F+  M IKL+ ELL+Q  KTID RG  V+
Sbjct  87    VVTDPSDYNVENPVPGTLRHAVIQKEPLWIIFSKHMKIKLNRELLMQSYKTIDARGHNVH  146

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             I  GAG+ +Q VNN+II N+ + +I  S GG+IRD +DH G+R  DEGD I+IF SH +W
Sbjct  147   IEKGAGIKMQGVNNIIITNLHIHNIGPSSGGMIRDSIDHIGIRGADEGDAISIFASHDIW  206

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM    DGLIDA  G+T +T+SNCHFTDHDKV+LFGAN+    DK+MQITLA+NHF
Sbjct  207   IDHVSMSRAADGLIDAVQGSTGITISNCHFTDHDKVMLFGANDNYLDDKKMQITLAYNHF  266

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             GKRL QRMPRCR G FH+VNNDYTHW  YA+GGSS ATIISQGNR+IAQ   +  KEVTH
Sbjct  267   GKRLDQRMPRCRLGFFHLVNNDYTHWMRYAIGGSSEATIISQGNRFIAQHNVD-IKEVTH  325

Query  436   RDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R+   +S W+ WTW+S  D   NGAFF  SGDP  + K+   + +       VG L ++S
Sbjct  326   REKAQESEWRHWTWLSQDDDMQNGAFFRTSGDPNALSKFKNLNLMPAEPSYRVGILTKFS  385

Query  259   GHLGRCTPGRKC  224
             G LG CT GR C
Sbjct  386   GSLG-CTVGRPC  396



>gb|EPS62426.1| hypothetical protein M569_12361, partial [Genlisea aurea]
Length=410

 Score =   425 bits (1093),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 232/429 (54%), Positives = 289/429 (67%), Gaps = 22/429 (5%)
 Frame = -2

Query  1504  WKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVTRRE  1325
             W+QR  +ARR  + A+  NP +++ +     S  LNE  +  EL            +RR 
Sbjct  2     WEQRGNQARRDAVLAFDSNPYQVSNDRFFFFSYYLNENRSVMELDLKR--------SRRS  53

Query  1324  LRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKD  1145
             L+   G    C ATNPID+CWRCR DWSD  NR RLADCA+GF + TTGGKGGRIY V D
Sbjct  54    LKEDGG----CTATNPIDRCWRCRDDWSD--NRQRLADCAIGFGRKTTGGKGGRIYTVND  107

Query  1144  ASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGG  965
             +SD D+  PK GTLRHAVIQ EPLWIVF++ MTI+LS EL++  NKTIDGRG  + IAGG
Sbjct  108   SSDGDLVNPKEGTLRHAVIQSEPLWIVFSSDMTIRLSEELIMTSNKTIDGRGRRITIAGG  167

Query  964   AGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHV  785
             AG+TLQ V+NVI+HN+++ DIK   GG IRD   H G RT  +GD I++FG+ ++WIDHV
Sbjct  168   AGITLQYVSNVILHNLRIHDIKPGSGGTIRDSPTHFGFRTPSDGDAISMFGATNIWIDHV  227

Query  784   SMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRL  605
             S   C DGLIDA   +TA+T+SNCHF  H+ V+L GA+++ S D+ +Q+TLAFNHFG  L
Sbjct  228   SAARCSDGLIDAIQASTAITISNCHFAQHNDVMLLGASDKSSEDQILQVTLAFNHFGTGL  287

Query  604   HQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-C  428
              QRMPR RWG  HIVNNDYT WEMYA+GGS   TI+SQGNR+ A P     KEVT R+  
Sbjct  288   IQRMPRIRWGFVHIVNNDYTKWEMYAIGGSQHPTILSQGNRFHA-PDNAAAKEVTKREYS  346

Query  427   PDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY-RDNLRPLSGKEVGRLARYSGHL  251
             P+  WK W W S GD F NGAFF  SGD    + + Y  D++   SGKEVG L  ++G L
Sbjct  347   PESVWKNWNWKSQGDSFSNGAFFVESGD----KNFNYVSDSVGAKSGKEVGELTEFAGPL  402

Query  250   GRCTPGRKC  224
               C  G+ C
Sbjct  403   A-CFAGKAC  410



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   427 bits (1099),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 233/469 (50%), Positives = 301/469 (64%), Gaps = 24/469 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             + +L I  +IP   AD+S  D+ W  R  EAR   LQAYH +P +I    +ER      +
Sbjct  10    MLVLCIVGLIPTIRADMSELDEYWSGRADEAREFTLQAYHSDPYEIIDHFHERHYDNSTD  69

Query  1393  TYnnrelyddsnnnnndNV-------------TRRELRRK-KGS----KEPCRATNPIDQ  1268
                  E  +       + V             TRR LR K KG     K PC A+NPID+
Sbjct  70    VTPTEEDNNTKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDK  129

Query  1267  CWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVI  1088
             CWRCR +WS    R +L  C  GF   T GGK GRIYVV    D+D+  P+ GTLRHAVI
Sbjct  130   CWRCRKNWSK--RRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDMVNPEPGTLRHAVI  187

Query  1087  QKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVG  908
             QKEPLWI+F   M+I+L+ ELL+   KTID RGA V+IA GAG+T+Q V +VIIH + + 
Sbjct  188   QKEPLWIIFKNDMSIRLNQELLINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIH  247

Query  907   DIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAV  728
              I  S GG+IRD  DH GMRT  +GDG++I+GS ++W+DHVSM  C+DGLIDA  G+TA+
Sbjct  248   HISESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGSTAI  307

Query  727   TVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDY  548
             T+SN HFT H+ V+L GA N   +DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDY
Sbjct  308   TISNSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDY  367

Query  547   THWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMN  371
             THWE+YA+GGS   TI+SQGNR+IA P    ++EVT RD  P++ WK W W S  D+FMN
Sbjct  368   THWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMN  427

Query  370   GAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             GA+F  SGDP     +  R+ ++P +G  V +L +Y+G L  C  GR+C
Sbjct  428   GAYFRQSGDPNYETDHTRRNMIKPKNGYAVSKLTKYAGALD-CRVGRRC  475



>ref|XP_004233352.1| PREDICTED: pectate lyase-like [Solanum lycopersicum]
Length=397

 Score =   424 bits (1091),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 217/372 (58%), Positives = 267/372 (72%), Gaps = 7/372 (2%)
 Frame = -2

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR L +K   K PC ATN ID+CWRC   W+D  NR + ADCA+GF    TGGKGGR+Y
Sbjct  32    TRRHLAKK--YKGPCMATNLIDKCWRCDPQWAD--NREKYADCAMGFGSKATGGKGGRVY  87

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV D SD DV+ P  GTLRHAVIQ EPLWI+F   M IKL  ELL+QG+KTIDGRG  ++
Sbjct  88    VVSDNSDSDVENPAPGTLRHAVIQTEPLWIIFERHMHIKLQRELLMQGHKTIDGRGFNIH  147

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             I  GAG+ +Q V+NVII N+ V +I  +PGG+IRD  +H G+R+ DEGDGI++F +  +W
Sbjct  148   IEKGAGLKMQGVSNVIISNLHVHNIVITPGGMIRDSAEHVGIRSEDEGDGISLFSATDIW  207

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM    DGLIDA  G+T +T+SNCHFTDHDKV+LFGAN+    DK+MQITLA+NHF
Sbjct  208   IDHVSMSRATDGLIDAVKGSTGITISNCHFTDHDKVMLFGANDNHVEDKKMQITLAYNHF  267

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             GKRL QRMPR R+G FHIVNNDYTHW  YA+GG++GATIISQGNR+IAQ      KEVTH
Sbjct  268   GKRLDQRMPRVRFGFFHIVNNDYTHWMRYAIGGNNGATIISQGNRFIAQASP-LIKEVTH  326

Query  436   RDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R+  ++S WK WTW+S  D   NGAFF  SGD   + K    + +      +VG + +++
Sbjct  327   REKVEESEWKNWTWLSIDDDMQNGAFFKTSGDQDALSKLQDLNLIPAEPSYKVGIITKFA  386

Query  259   GHLGRCTPGRKC  224
             G L  CT GR C
Sbjct  387   GSLA-CTAGRPC  397



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   424 bits (1090),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 212/378 (56%), Positives = 274/378 (72%), Gaps = 11/378 (3%)
 Frame = -2

Query  1339  VTRRE-LRRKKGSKE---PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggk  1172
             V++ E +RR  G+K+   PC  TNPID+CWRC  +W+D  NR +L +C++GF   TTGG+
Sbjct  17    VSKNETIRRALGTKKYDGPCTVTNPIDKCWRCDPNWAD--NRKKLVECSMGFGYKTTGGR  74

Query  1171  gGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGR  992
              G  YVV D SDD    PK GTLRHAVIQKEPLWI+F  +M IKL  EL++QG+KTIDGR
Sbjct  75    DGEFYVVTDPSDD-YTTPKPGTLRHAVIQKEPLWIIFEKNMKIKLHQELIMQGDKTIDGR  133

Query  991   GAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFG  812
             GA V+I GGA + +Q   NVIIH + + DI    GG++RD VDH G+RT  +GDGI+I+G
Sbjct  134   GATVHITGGASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGDGISIYG  193

Query  811   SHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITL  632
             S ++WIDH+SM NC DGLIDA  G+T +T+SN H+TDH++V+LFGA++  SID++MQITL
Sbjct  194   SSNIWIDHMSMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQITL  253

Query  631   AFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFF  452
             AFNHFGKRL QRMPRCRWG  H+VNNDYTHW MYA+GGS   TIISQGNR+IA P + F 
Sbjct  254   AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPP-DIFK  312

Query  451   KEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY-GYRDNLRPLSGKEVG  278
             KE+T R+  P+  W +WTW S GD++MNGA+F  +GDP   +K+    D + P    +V 
Sbjct  313   KEITKREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAPAPADQVT  372

Query  277   RLARYSGHLGRCTPGRKC  224
              + R++G L  C  G  C
Sbjct  373   WITRFAGAL-NCKVGLPC  389



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   426 bits (1094),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 238/464 (51%), Positives = 304/464 (66%), Gaps = 28/464 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATT-ADVSD--DVWKQREAEARRGLLQAYHPNPEKIT  1433
             MA   + L  V L +  IA  IP T  A+++D  + W+QR AEA++   +AYH +P  +T
Sbjct  1     MAMEAEKLNVVILCVFVIAITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVT  60

Query  1432  TELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCR  1253
                N++V     +T++                TRR L +K   K PC ATNPID+CWRC 
Sbjct  61    EHFNKQVL----DTFDYANN------------TRRNLNQK--YKGPCMATNPIDRCWRCD  102

Query  1252  ADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPL  1073
              +W    NR RLADCALGF +  TGGK G IYVV D +D D+  PK GTLRHAVIQ  PL
Sbjct  103   PNWEK--NRKRLADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPL  160

Query  1072  WIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSS  893
             WI+FA  M IKL+ ELLV  +KTID RGA V+I  GA ++LQ V NVII N+ + + K  
Sbjct  161   WIIFARDMRIKLTEELLVASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPG  220

Query  892   PGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNC  713
              GG+IRD ++H G RT  +GDGI++FG+ +VWIDHVS+ NC DGLIDA  G+TA+T+SNC
Sbjct  221   NGGMIRDSINHFGQRTRSDGDGISMFGATNVWIDHVSLSNCADGLIDAIQGSTAITISNC  280

Query  712   HFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEM  533
             H T+H+ V+LFG+++ +S D+ MQITLAFNHFGK L QRMPRCRWG FH+VNNDYTHW M
Sbjct  281   HLTNHNDVMLFGSSDSNSQDQVMQITLAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLM  340

Query  532   YAVGGSSGATIISQGNRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFT  356
             YA+GGS   TIISQGNR+IA P     KEVTHR +  +  W+ W W S  D+ MNGAFF 
Sbjct  341   YAIGGSQHPTIISQGNRFIA-PSNQATKEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFV  399

Query  355   PSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              SG P  +      D ++   G  V RL R++G L +C   + C
Sbjct  400   QSGSP--IRNLPKADMIQAKPGSFVTRLTRFAGPL-KCVKNKPC  440



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   427 bits (1097),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 301/469 (64%), Gaps = 24/469 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADV---SDDVWKQREAEARRGLLQAYHPNPEKITTELNER------  1415
             + ++ IA++IP   A+V   +D+ W  +  EAR+  L AYHP+P +I    +ER      
Sbjct  10    VCVICIASLIPTIRANVAEETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNST  69

Query  1414  --VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKE---------PCRATNPIDQ  1268
                     +   + E       ++  N TRR L  +   K          PC A+NPID+
Sbjct  70    DVEGTEEEKAIASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDK  129

Query  1267  CWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVI  1088
             CWRC+ DW+    R +L  C  GF   TTGGK GRIYVV    DDD+  P+ GTLRHAVI
Sbjct  130   CWRCQPDWAR--RRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVI  187

Query  1087  QKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVG  908
             QKEPLWIVF   M+I+LS EL++  +KTID RGA V+IA GAG+T+Q V+N+IIH + V 
Sbjct  188   QKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVH  247

Query  907   DIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAV  728
              I  S GG+IRD ++H G R   +GDGI+IFG+ ++W+DH+SM  C+DGLIDA  G+TA+
Sbjct  248   HIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAI  307

Query  727   TVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDY  548
             T+SN HFT H+ V+L GA N +  DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDY
Sbjct  308   TISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDY  367

Query  547   THWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMN  371
             THWE+YA+GGS G TI+S GNR+IA P +  ++EVT RD   +S WK W W S  DVFMN
Sbjct  368   THWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMN  427

Query  370   GAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              A+F  SG+P     +  +  ++P +G  V +L +Y+G L  C  G+ C
Sbjct  428   NAYFRQSGNPHFKCSHSRQQMIKPKNGMAVSKLTKYAGALD-CRVGKAC  475



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   423 bits (1088),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 220/374 (59%), Positives = 265/374 (71%), Gaps = 7/374 (2%)
 Frame = -2

Query  1336  TRRELRRK-KGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             TRR LR K K    PC A NPID+CWRC+ +W+   NR RLA C LGF   T GGK G  
Sbjct  16    TRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAK--NRKRLAKCVLGFGHKTRGGKKGEY  73

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             Y+V D SDDDV  PK GTLRHAVIQK PLWI+FA  M IKLS EL+VQ +KTIDGRG  V
Sbjct  74    YLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKELMVQSHKTIDGRGVNV  133

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
             +IA G G+TLQ V+NVIIHNI +  +  S GG+IRD  DH G RT  +GDGI+IFGS  +
Sbjct  134   HIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGDGISIFGSSKI  193

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             W+DH+SM  C+DGLIDA  G+TA+T+SNCHFT HD V+L GA++  S D+ MQ+TLAFNH
Sbjct  194   WLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQYMQVTLAFNH  253

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPRCRWG FH+VNNDYTHW++YA+GGS+  TIISQGNR+IA P +   KE+T
Sbjct  254   FGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIA-PDDPLTKEIT  312

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLS-GKEVGRLAR  266
             HR+  P+  W+ W W S GD FMNGAFF  SG P        + ++        VGRL +
Sbjct  313   HRNYAPESEWRNWIWRSEGDRFMNGAFFVTSGPPSPPHLKLKKKDIIKAKPAIFVGRLTK  372

Query  265   YSGHLGRCTPGRKC  224
             +SG L +C  G KC
Sbjct  373   FSGTL-KCKEGVKC  385



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 229/449 (51%), Positives = 295/449 (66%), Gaps = 26/449 (6%)
 Frame = -2

Query  1561  LLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETY  1388
             L S AA+IP  +A++S  D+VW++R  EA +   Q Y PNP  I + LN +V     +T 
Sbjct  13    LFSFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQDLSKQT-  71

Query  1387  nnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
                               RR L   +  +  C ATNPID CWRC+ +W++  NR  LA C
Sbjct  72    ----------------AARRGLLNAESGQ--CEATNPIDNCWRCKENWAE--NRQALAGC  111

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
             ALGF    TGGKGG+IY V D SD+D++ PK GTLRHAVIQKEPLWI+FA  M IKL  E
Sbjct  112   ALGFGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQE  171

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L+VQG KTIDGRGA V+IA GAG  LQ V NVIIH I + +I    GG+IRD VDH G R
Sbjct  172   LIVQGKKTIDGRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVGKR  231

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
                +GD ++IFGS ++W+DH+++    DGLIDA   +TA+T+SNCHF++HDK +L GA++
Sbjct  232   GQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHFSNHDKAILLGASD  291

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               + DK+MQ+T+AFN F K L QRMP  R+G  H+VNNDY  WEMYA+GG  G TI+SQG
Sbjct  292   TFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQG  351

Query  487   NRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRD  311
             NR+ A   +N  KEVT R +C  +  K W W S GDVF+NGA+F  SGDPK   +Y   D
Sbjct  352   NRFFASDNQN-TKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPKKQIEYQMDD  410

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              ++P  G EV R+ +++G L  C PG+KC
Sbjct  411   VIKPKPGTEVERITKFAGAL-VCKPGQKC  438



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 240/458 (52%), Positives = 292/458 (64%), Gaps = 30/458 (7%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLN  1397
             +L  L   A    + AD+   DD W+++  EA      AYHP+PE +T   N+ V + L 
Sbjct  11    FLCSLIFLASAALSGADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLALA  70

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRK--KGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             E  N+               TRR LR    K  K  C ATNPID+CWRC+ +W    +R 
Sbjct  71    EARNS---------------TRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIK--HRK  113

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LA C  GF +  TGGK G  YVV D SDDD+  PK GTLR  VIQ  PLWIVFA  M I
Sbjct  114   KLATCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMII  173

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             +LS EL++  NKTID RGA V+IA GA +T+Q VNNVIIH + + DIK S GG+IRD + 
Sbjct  174   RLSEELMINSNKTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLH  233

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GDGI+I+GS  VWIDH SM NC DGLIDA  G+TA+T+SNCHFT H+ VLL
Sbjct  234   HFGLRTKSDGDGISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLL  293

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA++ +  D  MQ T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW MYA+GGS   T
Sbjct  294   FGASDSNENDSIMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPT  353

Query  502   IISQGNRYIAQP---GENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTP-SGDPK  338
             IISQGNR+IA P    +   KEVT RD   +D WK+WTW S GD+  NGAFF       K
Sbjct  354   IISQGNRFIAPPLRFAKEVTKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFASLVLKHK  413

Query  337   GVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              V +   +D +R   G  V RL R++G LG C  GR C
Sbjct  414   DVHR---KDFIRAKPGTWVRRLTRFAGPLG-CKAGRAC  447



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 241/493 (49%), Positives = 309/493 (63%), Gaps = 48/493 (10%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKI--------------  1436
             + +  IA +IP   A++S  D+ W QR  EAR   LQAYH +P +I              
Sbjct  10    MCVFCIAGLIPTIKANISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1435  --TTELNERVSIGLNETYnnrelyddsnnnnndNVTRRE----------------LRRKK  1310
               TTE +   S  +  T  +     D      D+ T+ E                 RR  
Sbjct  70    DTTTEEHSSNSTDVTATEEDNSNSTDVTATEEDSSTKPEEEGTEVIEMVGNSKNSTRRSL  129

Query  1309  GSKE---------PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
               K          PC A+NPID+CWRCR++W++   R +LA C  GF  GTTGGK GRIY
Sbjct  130   KGKGKGKWSKLKGPCTASNPIDKCWRCRSNWAN--RRKKLAKCVRGFGHGTTGGKRGRIY  187

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV    D+D+  P  GTLRHAVIQKEPLWI+F   M+I+LS ELLV  +KTID RGA V+
Sbjct  188   VVTSNLDEDMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGADVH  247

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             IA GAG+T+Q V NVIIH + +  I  S GG+IRD VDH GMRT  +GDG++I+GS ++W
Sbjct  248   IAHGAGITMQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSNIW  307

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA-NNEDSIDKRMQITLAFNH  620
             IDHVSM  C+DGLIDA  G+TA+T+SN HFT H+ V+L GA NN +  D++MQ+T+A+NH
Sbjct  308   IDHVSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAYNH  367

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPR RWG  H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P   ++KEVT
Sbjct  368   FGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVT  427

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
              RD   +D WK WTW S  D+FMNGAFF  SGDP     +  +  ++P +G  V +L +Y
Sbjct  428   KRDYASEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTRKQMIKPKNGYAVSKLTKY  487

Query  262   SGHLGRCTPGRKC  224
             +G L  C  GR+C
Sbjct  488   AGALD-CRVGRRC  499



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   425 bits (1092),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 229/449 (51%), Positives = 295/449 (66%), Gaps = 26/449 (6%)
 Frame = -2

Query  1561  LLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETY  1388
             L S AA+IP  +A++S  D+VW++R  EA +   Q Y PNP  I + LN +V     +T 
Sbjct  11    LFSFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQDLSKQT-  69

Query  1387  nnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
                               RR L   +  +  C ATNPID CWRC+ +W++  NR  LA C
Sbjct  70    ----------------AARRGLLNAESGQ--CEATNPIDNCWRCKENWAE--NRQALAGC  109

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
             ALGF    TGGKGG+IY V D SD+D++ PK GTLRHAVIQKEPLWI+FA  M IKL  E
Sbjct  110   ALGFGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQE  169

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L+VQG KTIDGRGA V+IA GAG  LQ V NVIIH I + +I    GG+IRD VDH G R
Sbjct  170   LIVQGKKTIDGRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVGKR  229

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
                +GD ++IFGS ++W+DH+++    DGLIDA   +TA+T+SNCHF++HDK +L GA++
Sbjct  230   GQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHFSNHDKAILLGASD  289

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               + DK+MQ+T+AFN F K L QRMP  R+G  H+VNNDY  WEMYA+GG  G TI+SQG
Sbjct  290   TFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQG  349

Query  487   NRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRD  311
             NR+ A   +N  KEVT R +C  +  K W W S GDVF+NGA+F  SGDPK   +Y   D
Sbjct  350   NRFFASDNQN-TKEVTKRMNCSPEEGKNWIWRSEGDVFLNGAYFNSSGDPKKQIEYQMDD  408

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              ++P  G EV R+ +++G L  C PG+KC
Sbjct  409   VIKPKPGTEVERITKFAGAL-VCKPGQKC  436



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 240/493 (49%), Positives = 310/493 (63%), Gaps = 48/493 (10%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKI--------------  1436
             + +  IA +IP   A++S  D+ W QR  EAR   LQAYH +P +I              
Sbjct  10    MCVFCIAGLIPTIRANISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1435  --TTELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKK------GSKE------  1298
               TTE +   S  +  T  +     D      D+ T+ E  R +       SK       
Sbjct  70    DTTTEEHSSNSADVTATAEDSSNSTDVTATEEDSSTKPEEERTEVIEMVGNSKNSTRRSL  129

Query  1297  -------------PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
                          PC A+NPID+CWRCR++W++   R +LA C  GF  GTTGGK GRIY
Sbjct  130   KGKGKGKWSKLKGPCTASNPIDKCWRCRSNWAN--RRKKLAKCVRGFGHGTTGGKRGRIY  187

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV    D+D+  P  GTLRHAVIQKEPLWI+F   M+I+LS ELLV  +KTID RGA V+
Sbjct  188   VVTSNLDEDMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGADVH  247

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             IA GAG+T+Q V NVIIH + +  I  S GG+IRD VDH GMRT  +GDG++I+GS ++W
Sbjct  248   IAHGAGITMQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSNIW  307

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA-NNEDSIDKRMQITLAFNH  620
             IDHVSM  C+DGLIDA  G+TA+T+SN HFT H+ V+L GA NN +  D++MQ+T+A+NH
Sbjct  308   IDHVSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAYNH  367

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPR RWG  H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P   ++KEVT
Sbjct  368   FGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVT  427

Query  439   HRDCP-DDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
              RD   +D WK WTW S  D+FMNGAFF  SGDP     +  +  ++P +G  V +L +Y
Sbjct  428   KRDYALEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTRKQMIKPKNGYAVSKLTKY  487

Query  262   SGHLGRCTPGRKC  224
             +G L  C  G++C
Sbjct  488   AGALD-CRVGKRC  499



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 239/455 (53%), Positives = 297/455 (65%), Gaps = 20/455 (4%)
 Frame = -2

Query  1561  LLSIAAVIPA------TTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             L S A +IP         AD  DDVWK+R  +A +  L AY P+PE +T++ NE V   L
Sbjct  11    LFSFATLIPTLWGGGGNIADF-DDVWKRRADQAWKNTLAAYEPSPENVTSKFNENVHKAL  69

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRK-KGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
                        +   +   +  RR LR K K    PC ATNPID+CWRCR DW++  NR 
Sbjct  70    ------VANKSNKTKDLEGSEDRRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAE--NRK  121

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             RL  C +GF   T GG+ G+ Y V D SDDD   PK GTLR AVIQK PLWI+FA  M I
Sbjct  122   RLTQCVIGFGHRTEGGEKGKYYEVTDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMHI  181

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KLS EL+VQ  KTIDGRGA V+IA GAG+TLQ V++VIIH+I +  I  S  G+IRD VD
Sbjct  182   KLSRELIVQSKKTIDGRGANVHIAHGAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSVD  241

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GDGI IFGS ++W+DH+SM  C+DGLIDA  G+TA+T+SNCHFT H+ V+L
Sbjct  242   HIGLRTTGDGDGINIFGSTNIWLDHLSMSECQDGLIDAIQGSTAITISNCHFTHHNDVIL  301

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
              GA++    DK MQ+T+AFNHFGK L QRMPRCRWG FH+VNNDYTHW+MYA+GGS   T
Sbjct  302   LGASDTYERDKLMQVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSMHPT  361

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE-  329
             IISQGNR+IA P +   KE+T+R+  P   W KW W S GD+ +NGA FT SG  K  + 
Sbjct  362   IISQGNRFIA-PDDPKAKEITNRNYAPQSEWSKWVWRSEGDLLLNGARFTKSGPDKSPQF  420

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              +     ++      V RL R++G L  C  G KC
Sbjct  421   DFTKMQMIKAKPATFVRRLTRFAGALD-CEKGNKC  454



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 236/461 (51%), Positives = 300/461 (65%), Gaps = 31/461 (7%)
 Frame = -2

Query  1585  ILWWVYLALLSIAA-----VIPATTADVSDDVWKQRE-AEARRGLLQAYHPNPEKITTEL  1424
             I   +++A+ +I A     V   TT D   D W QR+ AEA    L AYH +P ++    
Sbjct  14    IFATIFVAIPTIQANTIGHVGNHTTKDTEHDEWFQRKLAEAYNASLLAYHHDPIEVMNHF  73

Query  1423  NERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADW  1244
             N  V   L  T                N TRR L + +G    C+A NPID+CWRC+ADW
Sbjct  74    NYHVHRALEGT----------------NSTRRGLNKYQGE---CKAQNPIDRCWRCKADW  114

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             +   +R +LADC  GF + TTGGK G  Y V D SD+DV  PK GTLR AV+Q +PLWI+
Sbjct  115   A--VDRKKLADCVKGFGRQTTGGKKGAYYTVTDPSDNDVVNPKPGTLRFAVLQPQPLWII  172

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA  MTIKL  EL++  +KTIDGRGA V IA GAG+T+Q  NNVIIHNIK+ DI  S GG
Sbjct  173   FAKDMTIKLKAELMITSDKTIDGRGAQVQIADGAGITIQFANNVIIHNIKIHDIVPSTGG  232

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD  +H G+R  D+GDGI +F S ++W+DH+SM NC+DGLID    +TA+T+SN HFT
Sbjct  233   MIRDTNNHVGIRGADDGDGINVFASSNIWLDHLSMWNCKDGLIDIVKASTAITLSNNHFT  292

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
              HD VLLFGA+++D  D+ MQI+LAFNHFGK L QRMPRCR+G FH++NNDYTHW MYA+
Sbjct  293   RHDHVLLFGADDKDPADEIMQISLAFNHFGKGLVQRMPRCRFGFFHVLNNDYTHWIMYAI  352

Query  523   GGSSGATIISQGNRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSG  347
             GG+S  TIISQGNR+IA P     K +T+R +   D WKKW W S  D F+NGA+F  SG
Sbjct  353   GGTSHPTIISQGNRFIAPPNPT-AKMITNRNNVVGDDWKKWIWRSENDQFVNGAYFVESG  411

Query  346   DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              P    ++  +D ++   G  V RL R+SG L RC  G+ C
Sbjct  412   HPLDETRFK-KDFIKAKPGTYVRRLTRFSGQL-RCRVGQSC  450



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   426 bits (1094),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 231/479 (48%), Positives = 304/479 (63%), Gaps = 27/479 (6%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             M    K+++  Y     IA +IP   A++S  D+ W +R  EAR   LQAYH NP ++  
Sbjct  3     MTRLLKLMFTFY-----IAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVD  57

Query  1429  ELNER---VSIGLNETYnnrelyddsnnn--------nndNVTRRELR-RKKGS----KE  1298
               +ER    S  + ET  + +                N  N TRR LR ++KG     K 
Sbjct  58    HFHERHYDNSTDVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKG  117

Query  1297  PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEP  1118
             PC A+NPID+CWRCR++W+    R  L  C  GF   T GGK GRIYVV    D+D+  P
Sbjct  118   PCTASNPIDKCWRCRSNWA--KRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNP  175

Query  1117  KAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVN  938
             K GTLRHAVIQKEPLWI+F   M I+LS EL++   KTID RG  V+IA GAG+T+Q V 
Sbjct  176   KPGTLRHAVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGTDVHIAHGAGITIQFVR  235

Query  937   NVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGL  758
             +VIIH +++  I  S GG+IRD  DH GMRT  +GDGI+I+GS  +W+DH+SM  C+DGL
Sbjct  236   HVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGL  295

Query  757   IDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRW  578
             IDA  G+TA+T+SN HFT H+ V+L GA N++  DK+MQ+T+A+NHFGK L QRMPR RW
Sbjct  296   IDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRW  355

Query  577   GLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWT  401
             G  H+VNNDYTHWE+YA+GGS   TI+S GNR+IA P +  ++EVT RD   +  WK W 
Sbjct  356   GFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWN  415

Query  400   WVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             W S  D+FMNGA+F  SG+P     +  +  ++P  G  V  L +Y+G L  C  G++C
Sbjct  416   WRSDKDMFMNGAYFRQSGNPHFKCHHTRKQMIKPKHGIAVSMLTKYAGALD-CRVGKRC  473



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 284/444 (64%), Gaps = 29/444 (7%)
 Frame = -2

Query  1546  AVIPATTADVSDDV--WKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrel  1373
             A+ P   A ++ D   W+ R  EA++   +AY PNP  I    N+ V      +      
Sbjct  17    ALFPTLRASIAHDAQFWQTRAREAKQAAQKAYKPNPHDIALTFNKHVDKSFKSSNG----  72

Query  1372  yddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFA  1193
                         TRR L +  G   PC ATNPID+CWRC  +W    NR +LA+CALGF 
Sbjct  73    ------------TRRGLSKYTG---PCLATNPIDKCWRCDPNWEK--NRKKLANCALGFG  115

Query  1192  kgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQG  1013
              GTTGGK G+IYVV D+SD D+  PK GTLRHAVIQ EPLWI+F  SM IKLS EL+   
Sbjct  116   HGTTGGKNGKIYVVTDSSDHDLINPKPGTLRHAVIQNEPLWIIFKHSMNIKLSSELIFTD  175

Query  1012  NKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEG  833
             NKTID RGA V+I+ GA MTLQ V N+IIH + + DIK   GG+IRD V+H G R+  +G
Sbjct  176   NKTIDARGANVHISNGAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVNHYGYRSSSDG  235

Query  832   DGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSID  653
             D I++FGS HVWIDH+S+ NC+DGLID   G+TA+T+SNCH T H+ V+LFGA++  S D
Sbjct  236   DAISLFGSSHVWIDHISLWNCDDGLIDVVEGSTAITISNCHMTRHNDVMLFGASDGYSGD  295

Query  652   KRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIA  473
             K +Q+T+AFNHFGK L QRMPRCRWG FHIVNNDYT W MYA+GGS   TI+SQGNR+IA
Sbjct  296   KVLQVTVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTQWVMYAIGGSQQPTILSQGNRFIA  355

Query  472   QPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPL  296
              P     KEVT RD   +S WK W+W S  D+  NGAFF  SG   G      + +++  
Sbjct  356   -PNNPNAKEVTKRDYAAESVWKTWSWTSENDLMRNGAFFVQSGKKSGNFP---KTDIKAK  411

Query  295   SGKEVGRLARYSGHLGRCTPGRKC  224
              G     L R+SG + +C   + C
Sbjct  412   PGSYAASLTRFSGAI-KCVVNKPC  434



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   425 bits (1092),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 223/465 (48%), Positives = 299/465 (64%), Gaps = 20/465 (4%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADV--SDDVWKQREAEARRGLLQAYHPNPEKITTELNER-----VS  1409
             + ++ IA++IP   A+V  +DD W +   EAR+  L AYHP+P +I    +ER       
Sbjct  10    VCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDNSTD  69

Query  1408  IGLNETYnnrelyddsnnnnndNVTRRELRRKKGS---------KEPCRATNPIDQCWRC  1256
             +   E + + E  D   +++  N TRR LR +            K PC A+NPID+CWRC
Sbjct  70    VEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRC  129

Query  1255  RADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEP  1076
             + DW+    R +L  C  GF   TTGGK GRIYVV    DDD   P+ GTLRHAVIQ EP
Sbjct  130   QPDWAR--RRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEP  187

Query  1075  LWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKS  896
             LWI+F   M+I+LS EL++  +KTID RG  V+IA GAG+T+Q V N+IIH + V  I  
Sbjct  188   LWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVP  247

Query  895   SPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSN  716
               GG+IR+  DH G R   +GDGI+IFG+ ++W+DH+SM  C+DGLIDA  G+T +T+SN
Sbjct  248   GSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISN  307

Query  715   CHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWE  536
              HFT H+ V+L GA N++  DK+MQ+T+AFNHFGK L QRMPR RWG  H+VNNDYTHWE
Sbjct  308   SHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  367

Query  535   MYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFF  359
             +YA+GGS   TI+S GNR+IA P    ++EVT RD  P+  WK W W S  D+FMN A+F
Sbjct  368   LYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYF  427

Query  358   TPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               SG+PK +  +  +  ++P  G  V +L +Y+G L  C  G+ C
Sbjct  428   RQSGNPKFMCSHSRQQMIKPKHGSAVSKLTKYAGALD-CRVGKPC  471



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   425 bits (1092),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 223/465 (48%), Positives = 299/465 (64%), Gaps = 20/465 (4%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADV--SDDVWKQREAEARRGLLQAYHPNPEKITTELNER-----VS  1409
             + ++ IA++IP   A+V  +DD W +   EAR+  L AYHP+P +I    +ER       
Sbjct  10    VCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDNSTD  69

Query  1408  IGLNETYnnrelyddsnnnnndNVTRRELRRKKGS---------KEPCRATNPIDQCWRC  1256
             +   E + + E  D   +++  N TRR LR +            K PC A+NPID+CWRC
Sbjct  70    VEETEEHASEEEDDIEMSSSPTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRC  129

Query  1255  RADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEP  1076
             + DW+    R +L  C  GF   TTGGK GRIYVV    DDD   P+ GTLRHAVIQ EP
Sbjct  130   QPDWAR--RRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEP  187

Query  1075  LWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKS  896
             LWI+F   M+I+LS EL++  +KTID RG  V+IA GAG+T+Q V N+IIH + V  I  
Sbjct  188   LWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVP  247

Query  895   SPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSN  716
               GG+IR+  DH G R   +GDGI+IFG+ ++W+DH+SM  C+DGLIDA  G+T +T+SN
Sbjct  248   GSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISN  307

Query  715   CHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWE  536
              HFT H+ V+L GA N++  DK+MQ+T+AFNHFGK L QRMPR RWG  H+VNNDYTHWE
Sbjct  308   SHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  367

Query  535   MYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFF  359
             +YA+GGS   TI+S GNR+IA P    ++EVT RD  P+  WK W W S  D+FMN A+F
Sbjct  368   LYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYF  427

Query  358   TPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               SG+PK +  +  +  ++P  G  V +L +Y+G L  C  G+ C
Sbjct  428   RQSGNPKFMCSHSRQQMIKPKHGSAVSKLTKYAGALD-CRVGKPC  471



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   424 bits (1090),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 293/459 (64%), Gaps = 31/459 (7%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             L +A V P+  A V+  D+ W QR+++A R  +++Y PNP  +T  LN   ++ +  T  
Sbjct  18    LCLAVVAPSVQAHVAVFDEYWTQRQSDALRQTIESYDPNPFNVTDHLNYHAALAMETTGA  77

Query  1384  nrelyddsnnnnndNVTRREL------RRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             +               TRR+L      R+ K       + N ID+CWR   +W    NR 
Sbjct  78    DNG-------------TRRKLGQVGDGRKTKRRGGRYHSLNAIDKCWRGHRNWHK--NRK  122

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC LGF + TTGGK G IYVV DA+DDD+  PK GTLR+AV +  PLWI+F  SM I
Sbjct  123   KLADCVLGFGRKTTGGKKGPIYVVTDAADDDLMNPKPGTLRYAVTRDRPLWIIFGRSMII  182

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  +KTIDGRGA V+I GGAG+TLQ V NVIIHNI +  I    GG+IRD   
Sbjct  183   KLQQELIINSDKTIDGRGANVHITGGAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEH  242

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G RT  +GDGI IFGS +VWIDHVSM NC DG+ID   G+TA+T+SNCH TDH++V+L
Sbjct  243   HFGHRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVML  302

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA  ED IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+   T
Sbjct  303   FGAREEDVIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPT  362

Query  502   IISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSG-----DP  341
             IISQGNR+ A P EN  K+VT R+    S WK W W S  D F+NGA+F  SG      P
Sbjct  363   IISQGNRFTAPPKEN-CKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSP  421

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                        ++P  G  V RL + +G LG C PG+ C
Sbjct  422   APENPIPRHFAIQPQPGTGVRRLTKDAGTLG-CRPGKSC  459



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   423 bits (1087),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 231/455 (51%), Positives = 300/455 (66%), Gaps = 26/455 (6%)
 Frame = -2

Query  1585  ILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSI  1406
             ++  V++  ++I   + A  AD  D+ W+QR AEA++   +AYH +P  +T   N++V  
Sbjct  9     VILCVFVTAITIPTTVRANIADF-DEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQVL-  66

Query  1405  GLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNR  1226
                +T++                TRR L +K   K PC ATNPID+CWRC  +W    NR
Sbjct  67    ---DTFDYANN------------TRRNLNQK--YKGPCMATNPIDRCWRCDPNWEK--NR  107

Query  1225  FRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMT  1046
              RLADCALGF +  TGGK G IYVV D +D D+  PK GTLRHAVIQ  PLWI+FA  M 
Sbjct  108   KRLADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMR  167

Query  1045  IKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCV  866
             IKL+ ELLV  +KTID RGA V+I  GA ++LQ V NVII N+ + + K   GG+IRD +
Sbjct  168   IKLTEELLVASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSI  227

Query  865   DHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVL  686
             +H G RT  +GDGI+++G+ +VWIDHVS+ NC DGLIDA  G+TA+T+SNCH T+H+ V+
Sbjct  228   NHFGQRTRSDGDGISMYGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVM  287

Query  685   LFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGA  506
             LFG+++ +S D+ MQITLAFNHFGK L QRMPRCRWG FH+VNNDYTHW MYA+GGS   
Sbjct  288   LFGSSDSNSQDQVMQITLAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHP  347

Query  505   TIISQGNRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE  329
             TIISQGNR+IA P     KEVTHR +  +  W+ W W S  D+ MNGAFF  SG P  + 
Sbjct  348   TIISQGNRFIA-PSNQATKEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP--IR  404

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                  D ++   G  V RL R++G L +C   + C
Sbjct  405   NLPKADMIQAKPGSFVTRLTRFAGPL-KCIKNKPC  438



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   422 bits (1086),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 225/433 (52%), Positives = 282/433 (65%), Gaps = 30/433 (7%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D+ W++R   A     +AY P+P  +T   N  V    +                     
Sbjct  35    DEHWQKRRELAEASAREAYKPDPFNVTNSFNAAVHRSTSP--------------------  74

Query  1333  RRELR-RKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             RRE+R +KK S  PCRATNPID+CWRCR +W+   +R RLA CA GF +  TGG GG+IY
Sbjct  75    RREMREKKKKSNGPCRATNPIDKCWRCRKNWAT--DRQRLARCARGFGRAATGGLGGKIY  132

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV D +D DV  P+ GTLR   IQ  PLWI+FA SM I+LS ELLV  +KTIDGRGA V+
Sbjct  133   VVTDPTDADVVNPRPGTLRWGAIQPGPLWIIFARSMIIQLSQELLVSSDKTIDGRGAQVH  192

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             IA G G+T+Q   NVIIH + V D+K + GG++RD   H G RT  +GDGI++FG+  VW
Sbjct  193   IANGGGITVQFARNVIIHGLHVHDVKHTDGGLMRDSPTHMGPRTKADGDGISLFGATDVW  252

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDH+SM NCEDGLID    +T VT+SNCHFT+H+ V+LFGA++    D+ MQIT+AFNHF
Sbjct  253   IDHISMSNCEDGLIDVVQSSTGVTISNCHFTNHNDVMLFGASDSYPQDQVMQITVAFNHF  312

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             G+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS+  TIISQGNRYIA P     K +T 
Sbjct  313   GRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSNAPTIISQGNRYIAPP-NIAAKLITK  371

Query  436   RDCPDDSWKKWTWVSSGDVFMNGAFFTPSGD--PKGVEKYGYRDNLRPLSGKEVGRLARY  263
                 +  WK W W +  D+FMNGA F PSG   P+ + K   ++ ++P  G  V RL R+
Sbjct  372   HYADEGVWKNWVWHTEDDLFMNGAVFQPSGGAVPRKINK---KEWVKPKPGSYVTRLTRF  428

Query  262   SGHLGRCTPGRKC  224
             SG L  C PGRKC
Sbjct  429   SGTLS-CIPGRKC  440



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   419 bits (1078),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/371 (57%), Positives = 267/371 (72%), Gaps = 6/371 (2%)
 Frame = -2

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LR +K +  PC ATNPID+CWRC  +W++  NR +LADC  GF + TTGGK G  YV
Sbjct  11    RRNLRGRK-TAGPCMATNPIDRCWRCDPNWAN--NRKKLADCVQGFGRKTTGGKAGPFYV  67

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SD D+  P+ GTLRHAV +  PLWI+FA SM I+L+ EL++  +KTIDGRGA + I
Sbjct  68    VTDPSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVI  127

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A GAG+T+Q + NVIIH IKV DI    GG++RD  +H G+RT  +GDGI+IFGS ++WI
Sbjct  128   ANGAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWI  187

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM NC DGLIDA  G+TA+T+SN HFTDH++V+LFGA++    D++MQIT+AFNHFG
Sbjct  188   DHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFG  247

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             KRL QRMPRCR+G  H+VNNDYTHWEMYA+GGS   TIIS+GNR+IA P   + KE+T R
Sbjct  248   KRLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PDNGYAKEITKR  306

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             +  P+  WK W W S  DV+MNGAFF   G       +  +D +    G  VGRL RYSG
Sbjct  307   EYSPESEWKNWQWRSINDVYMNGAFFRQGGSELTNRPFSKKDMITAKPGAYVGRLTRYSG  366

Query  256   HLGRCTPGRKC  224
              L +C  G+ C
Sbjct  367   SL-KCIVGKPC  376



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   424 bits (1090),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 233/493 (47%), Positives = 307/493 (62%), Gaps = 48/493 (10%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKIT-------------  1433
             + +  IA +IP    ++S  D+ W +R  EAR   LQAYH +P +I              
Sbjct  10    MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1432  -TELNERVSIGLNETYnnrelyddsnnnn-----------------------ndNVTRRE  1325
              TE  E  ++ L E +   +  ++ +                          +   TRR 
Sbjct  70    ATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGNSTKSTRRS  129

Query  1324  LRRK-KGS----KEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             LR K KG     K PC A+NPID+CWRCR +W+    R +L  C  GF   TTGGK GRI
Sbjct  130   LRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAK--RRKKLTRCVRGFGHRTTGGKRGRI  187

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV    D+D+  PK GTLRHAVIQKEPLWI+F   M+I+LS ELL+  +KTID RGA V
Sbjct  188   YVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDARGANV  247

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
             +IA GAG+T+Q V NVIIH + +  I  S GG+IRD VDH GMRT  +GDG++I+GS ++
Sbjct  248   HIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNI  307

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             W+DH+SM  C+DGLIDA  G+T +T+SN HFT H+ V+L GA N +  DK MQ+T+A+NH
Sbjct  308   WLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNH  367

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPR RWG  H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P +  ++EVT
Sbjct  368   FGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVT  427

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
              RD  P+D WK W W S  DVFMNGA+F  SG+P     +  +  ++P +G  V +L +Y
Sbjct  428   KRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTRKQMIKPKNGMAVSKLTKY  487

Query  262   SGHLGRCTPGRKC  224
             +G L  C  G++C
Sbjct  488   AGALD-CRVGKRC  499



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   422 bits (1084),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 226/461 (49%), Positives = 291/461 (63%), Gaps = 25/461 (5%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTEL  1424
             MAA+   +      L SI+ ++ A T D  D+VW++R   ARR  L+AYHPNPE++ +  
Sbjct  1     MAAANAGILLTLFGLASISPILKANTHDF-DEVWQKRAENARRHALEAYHPNPEEVVSSF  59

Query  1423  NERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADW  1244
             N+ V +                     + TRR LR +  +   C ATNPIDQCWRC  +W
Sbjct  60    NKHVHMMFEN----------------GSSTRRYLRGRPYTGR-CAATNPIDQCWRCDRNW  102

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             ++  NR RLADCA GF +GT GGK G  YVV + +DDD+  PK GTLRHAVIQ+ PLWI 
Sbjct  103   AN--NRKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWIT  160

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA  M I+LS ELL+  +KTID RG+ V I  GA +T+Q V N+IIH + +   K+  GG
Sbjct  161   FAHDMVIRLSEELLITSDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGG  220

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD V H G R+  +GDGI++FG+ H+WIDHVSM  C+DGLIDA  G+TA+TVSN HFT
Sbjct  221   MIRDSVSHHGFRSSSDGDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFT  280

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
               D V+L GA++    D  MQ+T+AFNHFGK+L QRMPR R+G  H+VNNDYTHW MYA+
Sbjct  281   HQDHVMLLGASDSHPQDSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAI  340

Query  523   GGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG  347
             GGS   TI+SQGNR++A    +  KEVT RD  P   WK W W S  D+ MNGAFF  SG
Sbjct  341   GGSQHPTILSQGNRFLAS-NSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESG  399

Query  346   DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 V     +D +    GK   ++ R+SG L  C   + C
Sbjct  400   --SDVRNVNRQDVIPAKPGKFASQMTRFSGALN-CYVNKPC  437



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   423 bits (1087),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 236/496 (48%), Positives = 314/496 (63%), Gaps = 44/496 (9%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKIT-  1433
             MA   K+++     +  IA +IP    ++S  D+ W +R  EAR   LQAYH +P +I  
Sbjct  3     MATLLKLMF-----MFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVD  57

Query  1432  -------------TELNERVSIGLNETYnnrelydd--------------snnnnndNVT  1334
                          TE  E  ++ L E +   ++ ++                  N+ N T
Sbjct  58    HFHERHYDNSTDATETEEDGAVQLEEEHVGAQVEEEHGGAKPEEEEEEGIKMVGNSTNST  117

Query  1333  RRELRRK-KGS----KEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkg  1169
             RR LR K KG     K PC A+NPID+CWRCR++W+    R +L  C  GF   TTGGK 
Sbjct  118   RRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSNWA--KRRKKLTRCVRGFGHRTTGGKR  175

Query  1168  GRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRG  989
             GRIYVV    D+D+  PK GTLRHAVIQKEPLWI+F   M+I+L+ ELL+  +KTID RG
Sbjct  176   GRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARG  235

Query  988   AFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGS  809
             A V+IA GAG+T+Q V NVIIH + +  I  S GG+IRD VDH GMRT  +GDG++I+GS
Sbjct  236   ANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGS  295

Query  808   HHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLA  629
              ++W+DH+SM  C+DGLIDA  G+T +T+SN HFT H+ V+L GA N +  DK MQ+T+A
Sbjct  296   SNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVA  355

Query  628   FNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFK  449
             +NHFGK L QRMPR RWG  H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P +  ++
Sbjct  356   YNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYR  415

Query  448   EVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRL  272
             EVT RD  P+D WK W W S  DVFMNGA+F  SG+P     +  +  ++  +G  V +L
Sbjct  416   EVTKRDYAPEDEWKHWNWRSEKDVFMNGAYFRQSGNPHFKCTHTRKQMIKHKNGMAVSKL  475

Query  271   ARYSGHLGRCTPGRKC  224
              +Y+G L  C  G++C
Sbjct  476   TKYAGALD-CRVGKRC  490



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   419 bits (1076),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 221/375 (59%), Positives = 267/375 (71%), Gaps = 9/375 (2%)
 Frame = -2

Query  1336  TRRELRRK-KGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             TRR+LR K K    PC A NPID+CWRCR +W+   NR RLA C LGF   T GGK G  
Sbjct  16    TRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAK--NRKRLAKCVLGFGHKTRGGKKGEY  73

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             Y+V D SDDDV  PK GTLRHAVIQK PLWI+FA  M IKLS EL+VQ +KTIDGRGA V
Sbjct  74    YLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQELMVQSHKTIDGRGANV  133

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
             +IA G G+TLQ V+NVIIHNI +  +  S GG+IRD  DH G RT  +GDGI+IFGS  +
Sbjct  134   HIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGDGISIFGSSKI  193

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             W+DH+SM  C+DGLIDA  G+TA+T+SNCHFT HD V+L GA++  S D+ MQ+TLAFNH
Sbjct  194   WLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQFMQVTLAFNH  253

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPRCRWG FH+VNNDYTHW++YA+GGS+  TIISQGNR+IA P +   KE+T
Sbjct  254   FGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIA-PDDPLTKEIT  312

Query  439   HRDCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKE--VGRLA  269
             +R+   +S W+ W W S GD FMNGAFF  SG P    +  ++            VGRL 
Sbjct  313   NRNYASESEWRHWVWRSEGDRFMNGAFFVTSG-PHSPPRLKFKKKDIIKPKPAIFVGRLT  371

Query  268   RYSGHLGRCTPGRKC  224
             ++SG L +C  G KC
Sbjct  372   KFSGTL-KCKEGVKC  385



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   421 bits (1081),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 226/461 (49%), Positives = 291/461 (63%), Gaps = 25/461 (5%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTEL  1424
             MAA+   +      L SI+ ++ A T D  D+VW++R   ARR  L+AYHPNPE++ +  
Sbjct  1     MAAANAGILLTLFGLASISPILKANTHDF-DEVWQKRAENARRHALEAYHPNPEEVVSSF  59

Query  1423  NERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADW  1244
             N+ V +                     + TRR LR +  +   C ATNPIDQCWRC  +W
Sbjct  60    NKHVHMMFEN----------------GSSTRRYLRGRPYTGR-CAATNPIDQCWRCDRNW  102

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             ++  NR RLADCA GF +GT GGK G  YVV + +DDD+  PK GTLRHAVIQ+ PLWI 
Sbjct  103   AN--NRKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWIT  160

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA  M I+LS ELL+  +KTID RG+ V I  GA +T+Q V N+IIH + +   K+  GG
Sbjct  161   FAHDMVIRLSEELLITSDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGG  220

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD V H G R+  +GDGI++FG+ H+WIDHVSM  C+DGLIDA  G+TA+TVSN HFT
Sbjct  221   MIRDSVSHHGFRSSSDGDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFT  280

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
               D V+L GA++    D  MQ+T+AFNHFGK+L QRMPR R+G  H+VNNDYTHW MYA+
Sbjct  281   HQDHVMLLGASDGHPQDSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAI  340

Query  523   GGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG  347
             GGS   TI+SQGNR++A    +  KEVT RD  P   WK W W S  D+ MNGAFF  SG
Sbjct  341   GGSQHPTILSQGNRFLAS-NSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESG  399

Query  346   DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 V     +D +    GK   ++ R+SG L  C   + C
Sbjct  400   --SDVRNVNRQDVIPAKPGKFASQMTRFSGALN-CYVNKPC  437



>ref|XP_004234780.1| PREDICTED: probable pectate lyase P56 [Solanum lycopersicum]
 sp|P15721.2|PLY56_SOLLC RecName: Full=Probable pectate lyase P56; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33524.1| P56 protein [Solanum lycopersicum]
Length=398

 Score =   419 bits (1076),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 211/373 (57%), Positives = 269/373 (72%), Gaps = 9/373 (2%)
 Frame = -2

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR+L +K   + PC A N ID+CWRC   W++  +R ++ADCALGF     GGK G  Y+
Sbjct  32    RRKLTKKY--RGPCMAVNSIDKCWRCDPFWAE--DRQKMADCALGFGINAMGGKYGPYYI  87

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SDDDV +PK GTLR  VIQK PLWI FA SM I+L+ EL+V  NKTIDGRG +V+I
Sbjct  88    VTDNSDDDVVDPKPGTLRFGVIQKGPLWITFARSMRIRLTRELIVSSNKTIDGRGKYVHI  147

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A GAG+ +QS +NVII N+++ +I  + GG++R+  DH G+R  DEGD I+IF SH +WI
Sbjct  148   ANGAGIKIQSASNVIISNLRIHNIVPTAGGLLRESDDHLGLRGADEGDAISIFNSHDIWI  207

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+SM    DGLIDA AG+T +T+SNCHFTDH+KV+LFGAN+    D+ M+ITLA+NHFG
Sbjct  208   DHISMSRATDGLIDAVAGSTNITISNCHFTDHEKVMLFGANDHAEEDRGMKITLAYNHFG  267

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             KRL QRMPRCR+G FH+VNNDYTHWE YA+GGSSGATIISQGNR+IA+  +   KEVT+R
Sbjct  268   KRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGNRFIAED-KLLVKEVTYR  326

Query  433   DCPDDS---WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
             +    S   W KWTW++ GD F NGA FTPSGD   + K  + + ++P    +VG L ++
Sbjct  327   EKSTSSVEEWMKWTWITDGDDFENGATFTPSGDQNLLSKIDHLNLIQPEPSSKVGLLTKF  386

Query  262   SGHLGRCTPGRKC  224
             SG L  C   R C
Sbjct  387   SGALS-CKIRRPC  398



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   420 bits (1080),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 297/453 (66%), Gaps = 25/453 (6%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             V L  L   A     T  V D V ++RE  A    L+AY P+PE +T EL + V   +  
Sbjct  17    VILPCLKAGADSDDGTIAVFDPVLQEREKRAEIAALKAYQPDPESVTDELIKDVETSIER  76

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
             +                N TRR L +K   K  C ATNPID+CWRC  DW+   NR +LA
Sbjct  77    S----------------NTTRRHLAKK--IKAECTATNPIDRCWRCNPDWAK--NRKQLA  116

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
             +C LGF + T GGK G IYVV D+SD+D+  PK GTLRHAVIQ  PLWI+F  SMTIKL+
Sbjct  117   NCVLGFGRRTRGGKRGPIYVVHDSSDNDMANPKPGTLRHAVIQTGPLWIIFKHSMTIKLN  176

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              EL++  +KTIDGRGA V+IA GAG+T+Q V NVIIH I + DI S  GG+IRD +DH G
Sbjct  177   KELIMTSHKTIDGRGANVHIAHGAGITIQFVENVIIHGIHIHDIVSVGGGLIRDSLDHIG  236

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
             +R   +GDGIT+FGS H+W+DH+SM NC DGL D   G+TA+T+SNCHFT H+ V+LFGA
Sbjct  237   LRGQSDGDGITVFGSSHIWLDHLSMWNCYDGLTDVVQGSTAITISNCHFTRHNDVMLFGA  296

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             N+    D+ MQIT+AFNHFGK L QRMPRCR+G FH+VNNDYTHW+MYA+GGSS  TIIS
Sbjct  297   NDLYERDQIMQITVAFNHFGKGLIQRMPRCRFGFFHVVNNDYTHWQMYAIGGSSHPTIIS  356

Query  493   QGNRYIAQPGENFFKEVTHR--DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDP-KGVEKY  323
             QGNRY+A P     KE+T R    P+  WK W W S GD+  NGA+F  SG+P KG   +
Sbjct  357   QGNRYVAPPDPK-LKEITSRAYSTPEAVWKTWQWRSEGDLMENGAYFRESGEPRKGRGHF  415

Query  322   GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                D +    G  V RL R++G LG C  G+ C
Sbjct  416   SRFDVINAKPGSFVRRLTRFAGTLG-CRVGKAC  447



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 255/359 (71%), Gaps = 4/359 (1%)
 Frame = -2

Query  1297  PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEP  1118
             PC ATNPID+CWRC  +W++  NR +LADC  GF + T GGKGG  YVV D SDDD+  P
Sbjct  9     PCIATNPIDRCWRCDPNWAN--NRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMVNP  66

Query  1117  KAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVN  938
             K GTLRHAV +  PLWI+FA SM I L  EL++  NKTIDGRG  V IA GAG+T+Q V 
Sbjct  67    KPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGITVQFVK  126

Query  937   NVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGL  758
             N+IIH IKV DI    GG+IRD   H G RT  +GDGI+IFGS ++WIDHVSM NC DGL
Sbjct  127   NIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNIWIDHVSMRNCSDGL  186

Query  757   IDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRW  578
             IDA  G+TA+T+SN HFTDH++V+LFGA++  S DK MQITLAFNHFGKRL QRMPR R+
Sbjct  187   IDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQRMPRVRY  246

Query  577   GLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWT  401
             G  H VNNDYTHWEMYA+GGS   TIIS+GNR+IA P   F K++T R+  P++ W  W 
Sbjct  247   GFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIA-PDNQFAKQITKREYAPENVWANWQ  305

Query  400   WVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             W S  DV+MNGAFF  SG       +   D +    G  VGRL RYSG+L +C  GR C
Sbjct  306   WRSINDVYMNGAFFVQSGPELASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  364



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   419 bits (1078),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 222/454 (49%), Positives = 290/454 (64%), Gaps = 27/454 (6%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             V+  L+++A  IP   A ++  DD  K +  +A +  L++Y P PE + +ELN  V + +
Sbjct  9     VFSLLVTLAITIPCLEAGIAEFDDFLKAQSEKAHKIALESYVPTPEFVASELNYHVHLSM  68

Query  1399  NETYnnrelyddsnnnnndNVTRRELRR-KKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
               +                  TRR L+     +  PC ++NPID CWRC  DW++  +R+
Sbjct  69    LNS------------------TRRGLKAGNNDAGAPCDSSNPIDNCWRCNKDWAN--DRY  108

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             RLA C  GF +   GG GG IYVV D SD+D+  PK GTLR+ V QK PLWI FA SM I
Sbjct  109   RLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDMVNPKEGTLRYGVTQKGPLWITFARSMII  168

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
              L  ELL+  +KTIDGRGA V I  GAG+T+Q VNNVIIH I+V +I S  GG+IRD  +
Sbjct  169   TLQQELLISSDKTIDGRGANVQIRDGAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDSYN  228

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GD I++FG+ ++WIDHVS+ N +DGLID   G+TA+T+SNCH T H+ V+L
Sbjct  229   HVGLRTRSDGDAISVFGASNIWIDHVSLSNSDDGLIDVIQGSTAITISNCHMTRHNDVML  288

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA +  S DK MQIT+AFNHFG+ L QRMPRCR G FH++NNDYTHW MYA+GGS+  T
Sbjct  289   FGATDTYSGDKIMQITVAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAAPT  348

Query  502   IISQGNRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             I+SQGNR+IA P  +  KE+THR D   + WK W W S  D+ MNGA F  SG P    +
Sbjct  349   ILSQGNRFIA-PNNDAAKEITHRVDAEPEVWKNWQWQSDMDLLMNGATFNTSGSPI-TTQ  406

Query  325   YGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             Y     ++P  G  V RL R++G L  C  G  C
Sbjct  407   YKKGLLMKPRDGTHVSRLTRHAGAL-NCFVGLPC  439



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   420 bits (1079),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 234/433 (54%), Positives = 288/433 (67%), Gaps = 23/433 (5%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD W+++  EA      AYHP+PE +T + N+ V + +++  N+               T
Sbjct  34    DDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVHLAVSQARNS---------------T  78

Query  1333  RRELRRK--KGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             RR LR       K PC ATNPID+CWRCR +W +  NR +LA CA GF +   GGK G  
Sbjct  79    RRALRSAGVNKFKGPCVATNPIDRCWRCRENWME--NRKKLAGCAKGFGRNAVGGKDGDF  136

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV D SD+D+  PK GTLR  VIQ  PLWI+FA  M I+LS EL++  NKTIDGRGA V
Sbjct  137   YVVTDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANV  196

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
              IA GA +TLQ V+NVIIH I + DIK S GGIIRD + H G+RT  +GDGI+I+GS  +
Sbjct  197   RIAYGAQITLQFVHNVIIHGIHIHDIKPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDI  256

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             WIDH S+ NC DGLIDA  G+TA+T+SNCHFT H+ VLLFGA++ +  D  MQIT+AFNH
Sbjct  257   WIDHCSLRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNEHDSIMQITVAFNH  316

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPRCRWG  H+VNNDYT W MYA+GGS   TIISQGNR+IA P   F KEVT
Sbjct  317   FGKGLVQRMPRCRWGFVHVVNNDYTQWIMYAIGGSQHPTIISQGNRFIA-PLMQFAKEVT  375

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
              RD   +D WK+WTW S GD+  NGAFF  SG P   + +  +D ++   G  V RL R+
Sbjct  376   KRDYATEDVWKQWTWRSEGDLMQNGAFFRESGSPN-TKSFHRKDFIKAKPGTWVRRLTRF  434

Query  262   SGHLGRCTPGRKC  224
             +G LG C  GR C
Sbjct  435   AGPLG-CRAGRPC  446



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   419 bits (1078),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 229/454 (50%), Positives = 298/454 (66%), Gaps = 29/454 (6%)
 Frame = -2

Query  1576  WVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIG  1403
             ++ L +++ A +IP   A+++  D VW+QR  EA    LQAYHPNPE I    N+ V+  
Sbjct  6     YIKLLVIAFATIIPTLKANIAHFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEVAKS  65

Query  1402  LNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             LN+                 + T  +L + K    PC ATNPID+CWRC A+W+   NR 
Sbjct  66    LND----------------FSSTSSQLSQHK---RPCHATNPIDRCWRCDANWAS--NRK  104

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LA CALGF + TTGGK G  YVV D SDDD+  P+ GTLR+ VIQ  PLWI FA  M I
Sbjct  105   KLAGCALGFGRMTTGGKDGDYYVVTDPSDDDLVNPREGTLRYGVIQDRPLWITFAGDMVI  164

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
              LS EL++  NKTIDGRGA V+I+ GA +T+Q   N+IIH I + DI+   GG IRD   
Sbjct  165   TLSQELIINSNKTIDGRGANVHISCGAQITIQYARNIIIHGIHIHDIRGGSGGKIRDSET  224

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G RT  +GDGI+I+GS+++WIDHVS+ NC DGLIDA   +TA+T+SNCHFT H+ V+L
Sbjct  225   HFGKRTASDGDGISIYGSNNIWIDHVSISNCTDGLIDAIMASTAITISNCHFTRHNTVML  284

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
              G NN+ S D  MQ+T+AFNHF ++L QRMPR R+GL H+VNNDYT WEMYA+GGS   T
Sbjct  285   LGGNNKFSADSVMQVTVAFNHFDRKLVQRMPRVRYGLAHVVNNDYTSWEMYAIGGSEHPT  344

Query  502   IISQGNRYIAQPGENFFKEVTHRDC-PDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             IISQGNR++A P  +  K+VT R+  P+  WK W W S GD+ +NGAFF  SG P  +E 
Sbjct  345   IISQGNRFLAPPDPD-CKQVTKRNVEPESEWKSWNWRSEGDLMLNGAFFVESGSP--IET  401

Query  325   YGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +G ++ +  + G  V RL RY+G L  C   + C
Sbjct  402   HG-KEEVHAMPGTLVHRLTRYAGAL-HCKKQKPC  433



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   421 bits (1083),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 235/493 (48%), Positives = 310/493 (63%), Gaps = 48/493 (10%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKIT-------------  1433
             + +  IA +IP    ++S  D+ W +R  EAR   LQAYH +P +I              
Sbjct  10    MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1432  --TELNERVS-----------------IGLNETYnnrelydd-----snnnnndNVTRRE  1325
               TE  + V+                 + L E +   +  ++         N+ N TRR 
Sbjct  70    DATETEDGVAQLEEEHGGAKPEEEHGGVQLEEEHGGAKPEEEEEEGIKMVGNSTNSTRRS  129

Query  1324  LRRK-KGS----KEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             LR K KG     K PC A+NPID+CWRCR +W+    R +L  C  GF   TTGGK GRI
Sbjct  130   LRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAK--RRKKLTRCVRGFGHRTTGGKRGRI  187

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV    D+D+  PK GTLRHAVIQKEPLWI+F   M+I+L+ ELL+  +KTID RGA V
Sbjct  188   YVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANV  247

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
             +IA GAG+T+Q V NVIIH + +  I  S GG+IRD VDH GMRT  +GDG++I+GS ++
Sbjct  248   HIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNI  307

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             W+DH+SM  C+DGLIDA  G+T +T+SN HFT H+ V+L GA N +  DK MQ+T+A+NH
Sbjct  308   WLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNH  367

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPR RWG  H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P +  ++EVT
Sbjct  368   FGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVT  427

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
              RD  P+D WK WTW S  DVFMNGA+F  SG+P     +  +  ++P +G  V +L +Y
Sbjct  428   KRDYAPEDEWKHWTWRSEKDVFMNGAYFRQSGNPHFKSAHTRKQMIKPKNGMAVSKLTKY  487

Query  262   SGHLGRCTPGRKC  224
             +G L  C  G++C
Sbjct  488   AGALD-CRVGKRC  499



>ref|XP_010683248.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   419 bits (1077),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 229/432 (53%), Positives = 286/432 (66%), Gaps = 17/432 (4%)
 Frame = -2

Query  1516  SDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNV  1337
             S   W  RE EA++  ++AYHP P  +T  LN R  I L   +   ++  +         
Sbjct  29    SKKYWDMREEEAKKRTVEAYHPQPFNVTNHLNFRARI-LQSKWLESDVGTNG--------  79

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR L +K   ++ C   NPID CWRC+ DW     R RLA CALGF KGTTGGK GR Y
Sbjct  80    TRRVLAKK--YRKGCMFANPIDACWRCQPDWEK--KRRRLAKCALGFGKGTTGGKAGRKY  135

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAAS-MTIKLSGELLVQGNKTIDGRGAFV  980
             +V D SDDD+  PK GTLRHAVIQ +PLWIVF    M IKL  EL++  +KTIDGRG+ V
Sbjct  136   LVTDPSDDDMLNPKPGTLRHAVIQNQPLWIVFGKPIMRIKLKQELIMTSHKTIDGRGSHV  195

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
              I GGAG+T+Q V N+IIH IK  +I   PGG+IRD + H G+RT  +GD I+IFGSHH+
Sbjct  196   IIEGGAGITIQFVENIIIHGIKFRNIVPRPGGLIRDSLTHFGLRTPSDGDAISIFGSHHI  255

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             WIDH S   C DGLID   G+TA+T+SNCH TDHDKV LFGA+++ S D++MQIT+A+ H
Sbjct  256   WIDHCSFSRCYDGLIDVIKGSTAITISNCHMTDHDKVFLFGASDQHSEDRKMQITIAYTH  315

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPRCR G FHIVNNDYTHW MYA+GG    TIIS+GNR+IA P     KEVT
Sbjct  316   FGKGLVQRMPRCRLGFFHIVNNDYTHWLMYAIGGGMNPTIISEGNRFIAPPDLR-AKEVT  374

Query  439   HRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             HR  P+ +W   TW+S GD+ +NGA F  S     +  Y  +  + P+SGK  GR  +++
Sbjct  375   HRQKPNSAWDSGTWISHGDMLVNGATFQQSPSILQLRPYAGK-MVFPMSGKYAGRATKHA  433

Query  259   GHLGRCTPGRKC  224
             G L +C P R+C
Sbjct  434   GPL-KCIPRRRC  444



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 221/465 (48%), Positives = 297/465 (64%), Gaps = 20/465 (4%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADV--SDDVWKQREAEARRGLLQAYHPNPEKITTELNER-----VS  1409
             + ++ IA++IP   A+V  +DD W +   EAR+  L AYHP+P +I    +ER       
Sbjct  10    VCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDNSTD  69

Query  1408  IGLNETYnnrelyddsnnnnndNVTRRELRRKKGS---------KEPCRATNPIDQCWRC  1256
             +   E + + E  D   +++  N TRR LR +            K PC A+NPID+CWRC
Sbjct  70    VEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRC  129

Query  1255  RADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEP  1076
             + DW+    R +L  C  GF   TTGGK GRIYVV    DDD   P+ GTLRHAVIQ EP
Sbjct  130   QPDWAR--RRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEP  187

Query  1075  LWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKS  896
             LWI+F   M+I+LS EL++  +KTID RG  V+IA GAG+T+Q V N+IIH + V  I  
Sbjct  188   LWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVP  247

Query  895   SPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSN  716
               GG+IR+  DH G R   +GDGI++FG+ ++W+DH+SM  C+DGLIDA  G+  +T+SN
Sbjct  248   GSGGMIRNSNDHFGFRGQADGDGISLFGATNIWLDHISMSKCQDGLIDAIMGSPGITLSN  307

Query  715   CHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWE  536
              HFT H+ V+L GA N++  DK+MQ+T+AFNHFGK L QRMPR RWG  H+VNNDYTHWE
Sbjct  308   SHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  367

Query  535   MYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFF  359
             +YA+GGS   TI+S GNR+IA P    ++EVT RD  P+  WK W W S  D+FMN A+F
Sbjct  368   LYAIGGSQSPTILSHGNRFIAPPHLQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYF  427

Query  358   TPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
               SG+PK +  +  +  ++P  G  V  L +Y+G L  C  G+ C
Sbjct  428   RQSGNPKFMCSHSRQQMIKPKHGSAVSTLTKYAGALD-CRVGKPC  471



>ref|XP_006361836.1| PREDICTED: probable pectate lyase P56-like [Solanum tuberosum]
Length=398

 Score =   417 bits (1071),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 212/373 (57%), Positives = 266/373 (71%), Gaps = 9/373 (2%)
 Frame = -2

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR+L +K   K PC A N ID+CWRC   W++  +R ++ADCALGF     GGK G  Y+
Sbjct  32    RRKLTKKY--KGPCMAVNSIDKCWRCDPFWAE--DRQKMADCALGFGINAMGGKYGPYYI  87

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SDDDV +PK GTLR  VIQK PLWI FA SM I+LS EL+V  NKTIDGRG +V+I
Sbjct  88    VTDNSDDDVIDPKPGTLRFGVIQKGPLWITFAKSMRIELSRELIVSSNKTIDGRGKYVHI  147

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A GAG+ +QS +NVII N+++  I  + GG++R+  DH G+R  DEGD I+IF SH +WI
Sbjct  148   ANGAGIKIQSASNVIISNLRIHHIVPTAGGLLRESDDHLGLRGGDEGDAISIFNSHDIWI  207

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DH+SM    DGLIDA AG+T +T+SNCHFTDH+KV+LFGAN+    D+ M+ITL +NHFG
Sbjct  208   DHISMSRAADGLIDAVAGSTNITISNCHFTDHEKVMLFGANDHSVEDRGMKITLVYNHFG  267

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             KRL QRMPRCR+G FH+VNNDYTHWE YA+GGSSGATIISQGNR+IA+  +   KEVT+R
Sbjct  268   KRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGNRFIAED-KLLVKEVTYR  326

Query  433   DCPDDS---WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
             +    S   W KWTW+S GD   NGA FTPSGD   + K  + + ++P    +VG L ++
Sbjct  327   EKSTSSVEEWMKWTWISDGDDLENGATFTPSGDQNLLSKIDHLNLIQPEPSSKVGLLTKF  386

Query  262   SGHLGRCTPGRKC  224
             SG L  C   R C
Sbjct  387   SGALS-CNIRRPC  398



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   418 bits (1074),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 226/461 (49%), Positives = 290/461 (63%), Gaps = 25/461 (5%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTEL  1424
             MAA+   +      L SI+ ++ A   D  D+VW++R   ARR  L+AYHPNPE++ +  
Sbjct  1     MAAANAGILLTLFGLASISPILKANIHDF-DEVWQKRAENARRHALEAYHPNPEEVVSSF  59

Query  1423  NERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADW  1244
             N+ V +                     N TRR LR +  +   C ATNPIDQCWRC  +W
Sbjct  60    NKHVHMMFEN----------------GNSTRRYLRGRPYTGR-CAATNPIDQCWRCDRNW  102

Query  1243  SDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIV  1064
             ++  NR RLADCA GF +GT GGK G  YVV + +DDD+  PK GTLRHAVIQ+ PLWI 
Sbjct  103   AN--NRKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWIT  160

Query  1063  FAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGG  884
             FA  M I+LS ELL+  +KTID RG+ V I  GA +T+Q V N+IIH + +   K+  GG
Sbjct  161   FAHDMVIRLSEELLITSDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGG  220

Query  883   IIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFT  704
             +IRD V H G R+  +GDGI++FG+ H+WIDHVSM  C+DGLIDA  G+TA+TVSN HFT
Sbjct  221   MIRDSVSHYGFRSSSDGDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFT  280

Query  703   DHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAV  524
               D V+L GA++    D  MQ+T+AFNHFGK+L QRMPR R+G  H+VNNDYTHW MYA+
Sbjct  281   HQDHVMLLGASDGHPQDSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAI  340

Query  523   GGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG  347
             GGS   TI+SQGNR++A    +  KEVT RD  P   WK W W S  D+ MNGAFF  SG
Sbjct  341   GGSQHPTILSQGNRFLAS-NSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESG  399

Query  346   DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 V     +D +    GK   ++ R+SG L  C   + C
Sbjct  400   --SDVRNVNRQDVIPAKPGKFASQMTRFSGALN-CYVNKPC  437



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   419 bits (1076),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 223/434 (51%), Positives = 279/434 (64%), Gaps = 24/434 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD W+++  EA      AYHP+PE +T   N+ V + L +  N+               T
Sbjct  54    DDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVHLALAQARNS---------------T  98

Query  1333  RREL---RRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGR  1163
             RR L   R  K  +  C A+NPID+CWRC+ DW    +R +LA C  GF +   GG+ G 
Sbjct  99    RRGLKAVRADKFRQGQCVASNPIDRCWRCQKDWI--KDRKKLASCGKGFGRNAVGGRDGD  156

Query  1162  IYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAF  983
              YVV D SD+D+  PK GTLR  VIQ  PLWI+FA  M I+LS EL++  NKTID RGA 
Sbjct  157   FYVVTDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELIINSNKTIDARGAN  216

Query  982   VNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHH  803
             V+IA GA +++Q V NVIIH + + DIK   GG+IRD + H G RT  +GDGI+I+GS  
Sbjct  217   VHIAFGAQISIQFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGDGISIYGSSD  276

Query  802   VWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFN  623
             +WIDH SM NC DGLIDA   +TA+T+SNCHF  H+ VLLFGA++ +  D  MQ+T+AFN
Sbjct  277   IWIDHCSMRNCADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDSIMQVTVAFN  336

Query  622   HFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEV  443
             HFGK L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TIISQGNR++A P   F KE+
Sbjct  337   HFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSQHPTIISQGNRFLAPP-MRFAKEI  395

Query  442   THRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLAR  266
             T RD   +D WK WTW S GD+  NGAFF  SG P     +  +D ++   G  V RL R
Sbjct  396   TKRDYATEDVWKHWTWRSEGDLMQNGAFFRESGAP-AKNNFDKKDFIKAKPGTWVKRLTR  454

Query  265   YSGHLGRCTPGRKC  224
             Y+G LG C  GR C
Sbjct  455   YAGPLG-CRAGRAC  467



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   417 bits (1073),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 222/455 (49%), Positives = 288/455 (63%), Gaps = 29/455 (6%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             V+  L ++A  IP   A ++  D+  + +  +A    LQ+Y P PE +T +LN  V + +
Sbjct  11    VFSLLATLAITIPCLEAGIAEFDEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHVHLSM  70

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGS-KEPCRATNPIDQCWRCRADWSDGPNRF  1223
                                 VTRR L+    +  +PC ++NPID CWRC  DW+   +R+
Sbjct  71    QN------------------VTRRGLKEGNNAIGKPCESSNPIDNCWRCNKDWAK--DRY  110

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             RLA C  GF +   GG GG IYVV D SD+D+  PK GTLR+AV QK PLWI F  SM I
Sbjct  111   RLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDMINPKPGTLRYAVTQKGPLWITFERSMII  170

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
              L  EL++  +KTIDGRGA V I  G G+T+Q VNNVIIH I+V DI    GG+IRD  +
Sbjct  171   SLQQELMISSDKTIDGRGANVQIRDGGGLTMQFVNNVIIHGIRVKDIVPKEGGLIRDSYN  230

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G RT  +GD I++FG+ ++WIDHVS+ N  DGLID   G+TA+T+SNCH T H+ V+L
Sbjct  231   HIGQRTRSDGDAISVFGASNIWIDHVSLSNSADGLIDVIQGSTAITISNCHMTRHNDVML  290

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FGA +  + DK MQIT+AFNHFG+ L QRMPRCR G FH++NNDYTHW MYA+GGS+G T
Sbjct  291   FGAADSYTGDKIMQITVAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAGPT  350

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE-  329
             I+SQGNR+IA P  +  KE+THRD    + WK W W S  D+ MNGA F  SG P  ++ 
Sbjct  351   ILSQGNRFIA-PNNDAAKEITHRDYATPEEWKNWQWQSDMDLLMNGATFNSSGSPIAMKH  409

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             K G+   ++P  G  V RL R+SG L  C  G  C
Sbjct  410   KKGFI--MKPRDGTHVSRLTRHSGAL-NCFVGLPC  441



>ref|XP_009599824.1| PREDICTED: pectate lyase [Nicotiana tomentosiformis]
Length=397

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 219/375 (58%), Positives = 276/375 (74%), Gaps = 8/375 (2%)
 Frame = -2

Query  1339  VTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             + RR+L  KK  K PCRA N ID+CWRC  +W++  NR ++ADCALGF     GGK GRI
Sbjct  28    IPRRQLGNKK-YKGPCRAENAIDKCWRCDPNWAE--NRQKMADCALGFGSNAIGGKLGRI  84

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV D SDDDV +PK GTLR+ VIQKEPLWI+F  +M IKLS EL+V  NKTIDGRG  V
Sbjct  85    YVVTDPSDDDVVDPKPGTLRYGVIQKEPLWIIFGKNMKIKLSRELIVTSNKTIDGRGFNV  144

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
             +I  GAG+ +Q  +N+II N+++ +I  +PGG++R+  DH G+R+ DEGDGI+IF S  +
Sbjct  145   HIQNGAGIKIQCASNIIISNLRIHNIVPTPGGLLRESEDHVGLRSGDEGDGISIFDSRDI  204

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             WIDH+SM    DGLIDA A +T +T+SNCHFTDH+KV+LFGAN+   +DK M+ITLA+NH
Sbjct  205   WIDHISMSRATDGLIDAVAASTNITISNCHFTDHEKVMLFGANDNYVLDKDMKITLAYNH  264

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGKRL QRMPRCR+G FH+VNNDYTHWE YA+GGSSGATIISQGNR+IA+  E   KEVT
Sbjct  265   FGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGSSGATIISQGNRFIAED-ELLVKEVT  323

Query  439   HRDCPDDS---WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLA  269
             +R+    S   W KWTW+S GD   NGA FTPSGD   ++K  + + ++P    +VG L 
Sbjct  324   YREKLTASVAEWMKWTWISDGDDMENGATFTPSGDQNLLDKIDHLNLIKPEPSSKVGILT  383

Query  268   RYSGHLGRCTPGRKC  224
             ++SG L  C  GR C
Sbjct  384   KFSGALS-CVKGRPC  397



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   419 bits (1077),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 231/487 (47%), Positives = 302/487 (62%), Gaps = 35/487 (7%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITT  1430
             M    K+++  Y     IA +IP   A++S  D+ W +R  EAR   LQAYH NP ++  
Sbjct  3     MTRLLKLMFTFY-----IAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVD  57

Query  1429  ELNER---VSIGLNETYnnrelyddsnnn--------nndNVTRRELRRKKGS-------  1304
               +ER    S  + ET  + +                N  N TRR LR K          
Sbjct  58    HFHERHYDNSTDVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRK  117

Query  1303  ------KEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDA  1142
                   K PC A+NPID+CWRCR++W+    R  L  C  GF   T GGK GRIYVV   
Sbjct  118   GKWSKLKGPCTASNPIDKCWRCRSNWA--KRRKNLVKCVRGFGHSTIGGKRGRIYVVTSN  175

Query  1141  SDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGA  962
              D+D+  PK GTLRHAVIQKEPLWI+F   M I+LS EL++   KTID RGA V+IA GA
Sbjct  176   LDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGADVHIAHGA  235

Query  961   GMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVS  782
             G+T+Q V +VIIH +++  I  S GG+IRD  DH GMRT  +GDGI+I+GS  +W+DH+S
Sbjct  236   GITIQFVRHVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHIS  295

Query  781   MHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLH  602
             M  C+DGLIDA  G+TA+T+SN HFT H+ V+L GA N++  DK+MQ+T+A+NHFGK L 
Sbjct  296   MSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLV  355

Query  601   QRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CP  425
             QRMPR RWG  H+VNNDYTHWE+YA+GGS   TI+S GNR+IA P +  ++EVT RD   
Sbjct  356   QRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYAS  415

Query  424   DDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGR  245
             +  WK W W S  D+FMNGA+F  SG+P     +  +  ++P  G  V  L +Y+G L  
Sbjct  416   EHEWKHWNWRSDKDMFMNGAYFRQSGNPHFKCHHTRKQMIKPKHGIAVSMLTKYAGALD-  474

Query  244   CTPGRKC  224
             C  G++C
Sbjct  475   CRVGKRC  481



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   417 bits (1072),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 222/433 (51%), Positives = 279/433 (64%), Gaps = 27/433 (6%)
 Frame = -2

Query  1528  TADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnn  1355
             TA+++D  + W++R+  A   + + Y P+P  +T   N  V                   
Sbjct  31    TANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVH-----------------R  73

Query  1354  nnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttgg  1175
               +   T RE+ RK   K PCRATNPID+CWRC+ DW+   +RFRLA CA GF + TTGG
Sbjct  74    ATSLRRTMREMPRKHKKKGPCRATNPIDKCWRCKNDWAT--DRFRLARCARGFGQATTGG  131

Query  1174  kgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDG  995
              GG IY+V D SD DV  P+ GTLR  VIQ  PLWI+FA SM I+LS ELLV  +KTIDG
Sbjct  132   LGGPIYIVTDPSDGDVVNPRPGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDG  191

Query  994   RGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIF  815
             RGA V+IA GAG+T+Q   NVIIHN+ V D+  S GG++RD   H G RT  +GDGI++F
Sbjct  192   RGAQVHIANGAGITVQLARNVIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGDGISLF  251

Query  814   GSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQIT  635
              + +VWIDH+SM NCEDGLID    +T +T+SNCHFT+H+ V+LFGA++    D+ MQIT
Sbjct  252   QATNVWIDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQMMQIT  311

Query  634   LAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENF  455
             +AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GG    TIISQGNRYIA P    
Sbjct  312   VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGKAPTIISQGNRYIAPPNIA-  370

Query  454   FKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDN--LRPLSGKEV  281
              K +T     +  WK W W +  D+FMNGA F PSG   G  +     N  ++P  G  V
Sbjct  371   AKVITKHYAEEGEWKNWVWHTEDDLFMNGAIFEPSG---GAVQRQINSNEWVKPKPGTYV  427

Query  280   GRLARYSGHLGRC  242
              RL R+SG L  C
Sbjct  428   TRLTRFSGTLSCC  440



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   419 bits (1076),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 231/500 (46%), Positives = 305/500 (61%), Gaps = 55/500 (11%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKIT-------------  1433
             + +  IA +IP    ++S  D+ W +R  EAR   LQAYH +P +I              
Sbjct  10    MFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTD  69

Query  1432  -TELNERVSIGLNETYnnrelyddsnnnn-----------------------ndNVTRRE  1325
              TE  E  ++ L E +   +  ++ +                          +   TRR 
Sbjct  70    ATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGNSTKSTRRS  129

Query  1324  LRRKKGS------------KEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgtt  1181
             LR K               K PC A+NPID+CWRCR +W+    R +L  C  GF   TT
Sbjct  130   LRGKGKGKWSKGKGKWSKLKGPCTASNPIDKCWRCRTNWAK--RRKKLTRCVRGFGHRTT  187

Query  1180  ggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTI  1001
             GGK GRIYVV    D+D+  PK GTLRHAVIQKEPLWI+F   M+I+LS ELL+  +KTI
Sbjct  188   GGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTI  247

Query  1000  DGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGIT  821
             D RGA V+IA GAG+T+Q V NVIIH + +  I  S GG+IRD VDH GMRT  +GDG++
Sbjct  248   DARGANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLS  307

Query  820   IFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQ  641
             I+GS ++W+DH+SM  C+DGLIDA  G+T +T+SN HFT H+ V+L GA N +  DK MQ
Sbjct  308   IYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQ  367

Query  640   ITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGE  461
             +T+A+NHFGK L QRMPR RWG  H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P +
Sbjct  368   VTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHK  427

Query  460   NFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKE  284
               ++EVT RD  P+D WK W W S  DVFMNGA+F  SG+P     +  +  ++P +G  
Sbjct  428   PHYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTRKQMIKPKNGMA  487

Query  283   VGRLARYSGHLGRCTPGRKC  224
             V +L +Y+G L  C  G++C
Sbjct  488   VSKLTKYAGALD-CRVGKRC  506



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   416 bits (1069),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 224/428 (52%), Positives = 285/428 (67%), Gaps = 23/428 (5%)
 Frame = -2

Query  1504  WKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVTRRE  1325
             W+Q+ + A     +AY P+P  ++  L+  VS                      N  RR 
Sbjct  44    WQQKASAAAMKNDKAYTPDPYAVSGNLSHSVS-----------------EMIIGNQGRRN  86

Query  1324  LRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKD  1145
             L   K ++ PC ATNPID+CWRC  +W++  NR +LADC  GF + TTGGKGG IYVV D
Sbjct  87    LAGGK-ARGPCMATNPIDRCWRCDPNWAN--NRQKLADCVKGFGRKTTGGKGGPIYVVTD  143

Query  1144  ASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGG  965
              SD D+  P+ GTLR  V +  PLWI FA SMTI+L+ EL++  +KTIDGRGA V IA G
Sbjct  144   PSDSDMVNPRPGTLRFGVTRNGPLWITFARSMTIRLNQELIMTSHKTIDGRGADVTIASG  203

Query  964   AGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHV  785
             AG+T+Q + NVIIH IK+ DI    GG+IRD  DH G RT  +GDGI+IFGS ++WIDHV
Sbjct  204   AGITIQFIENVIIHGIKIFDIVVGSGGLIRDGQDHFGQRTMSDGDGISIFGSSNIWIDHV  263

Query  784   SMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRL  605
             SM NC DGL+DA  G+TA+T+SN HFTDH++V+LFGA++    D++MQIT+AFNHFGKRL
Sbjct  264   SMRNCRDGLVDAIMGSTAITISNSHFTDHNEVMLFGASDGYGGDEKMQITVAFNHFGKRL  323

Query  604   HQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCP  425
              QRMPRCR+G  H++NNDYTHWEMYA+GGS   TIIS+GNR+IA P     KE+T R+  
Sbjct  324   IQRMPRCRFGFIHVLNNDYTHWEMYAIGGSMHPTIISEGNRFIA-PNNGHAKEITKREYV  382

Query  424   DDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLG  248
             D+S WK W W S  DV++NGAFF   G       +  +D ++   G  VGRL RYSG L 
Sbjct  383   DESVWKSWQWRSINDVYLNGAFFRQGGPELKDRPFSRKDMIKSRPGTYVGRLTRYSGSL-  441

Query  247   RCTPGRKC  224
             RC  G+ C
Sbjct  442   RCIVGKPC  449



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   416 bits (1068),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 224/434 (52%), Positives = 282/434 (65%), Gaps = 30/434 (7%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD  ++R+  A     +AY P+P  +T   N  V   ++ +                   
Sbjct  37    DDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSS-------------------  77

Query  1333  RRELR---RKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGR  1163
             RRE+R   RK   + PCRATNPID+CWRCR DW+   +R RLA CA GF   TTGG GG+
Sbjct  78    RREMRERPRKHKKRGPCRATNPIDKCWRCRRDWAT--DRQRLARCARGFGHATTGGLGGK  135

Query  1162  IYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAF  983
             IYVV D +D DV  P+ GTLR  VIQ  PLWI+FA SM I+LS ELL+  +KTIDGRGA 
Sbjct  136   IYVVTDPTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQ  195

Query  982   VNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHH  803
             V+IA GAG+T+Q   NVIIHN+ V D+K + GG++RD   H G RT  +GDGI++F + +
Sbjct  196   VHIANGAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATN  255

Query  802   VWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFN  623
             VWIDH+SM NCEDGLID    +T +T+SNCHFT+H+ V+LFGA++    D+ MQIT+AFN
Sbjct  256   VWIDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFN  315

Query  622   HFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEV  443
             HFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GG    TIISQGNRYIA P     K +
Sbjct  316   HFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPP-NIAAKVI  374

Query  442   THRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGD-PKGVEKYGYRDNLRPLSGKEVGRLAR  266
             T     +  WK W W +  D+FMNGA F PSG  PK V+   +   ++P  G  V RL R
Sbjct  375   TKHYAEEGVWKNWVWHTEDDLFMNGAIFNPSGGAPKQVDTNEW---VKPKPGTYVTRLTR  431

Query  265   YSGHLGRCTPGRKC  224
             +SG L  CT G+ C
Sbjct  432   FSGTLSCCT-GKPC  444



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   416 bits (1070),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 215/372 (58%), Positives = 264/372 (71%), Gaps = 9/372 (2%)
 Frame = -2

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR L++K   K PC ATNPID+CWRC  +W    NR +LADCA GF   TTGGK G+IY
Sbjct  116   TRRNLKQKY--KGPCLATNPIDRCWRCDPNWET--NRKKLADCAKGFGHKTTGGKAGKIY  171

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV D SD+D+  PK GTLRHAVIQ  PLWI+FA  M IKL  EL+V  +KTID RGA V+
Sbjct  172   VVTDNSDNDMVNPKPGTLRHAVIQTGPLWIIFARDMRIKLREELMVTSDKTIDARGANVH  231

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             I  GA +TLQ V NVIIHN+ + D K   GG+IRD V+H G RT  +GDGI+++G+ +VW
Sbjct  232   IEDGAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVW  291

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVS  NC DGL+DA  G+TA+T+SNCHFT+H+ V+LFG+++ +S D+ MQITLAFNHF
Sbjct  292   IDHVSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITLAFNHF  351

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             G+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TIISQGNR+IA P  N  KEVT 
Sbjct  352   GQGLIQRMPRCRWGFFHVVNNDYTHWIMYAIGGSQHPTIISQGNRFIA-PSNNASKEVTK  410

Query  436   RDC-PDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R    ++ WK W W S  D+ MNGAFF  SG P  +      D ++   G  V RL R++
Sbjct  411   RTSGAENEWKSWNWRSENDLMMNGAFFVESGSP--IRNLPKADMIKAKPGTFVTRLTRFA  468

Query  259   GHLGRCTPGRKC  224
             G L +C  G+ C
Sbjct  469   GPL-KCIKGKPC  479



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score =   414 bits (1065),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 222/448 (50%), Positives = 295/448 (66%), Gaps = 25/448 (6%)
 Frame = -2

Query  1561  LLSIAAVIPATTADV-SDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             L S   +IP  +A   +D+VW++R  EA +   Q Y P+P  + + LN +V     +T  
Sbjct  11    LFSFIILIPCLSAIAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQDLSKQT--  68

Query  1384  nrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCA  1205
                              RR L   +  +  C ATNPID+CWRC+ +W++  +R  LA CA
Sbjct  69    ---------------AARRGLLNAESGQ--CEATNPIDKCWRCKENWAE--DRQALAGCA  109

Query  1204  LGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGEL  1025
             LGF    TGGKGG+IY V D+SD++++ PK GTLRHAVIQKEPLWI+FA  M IKL  EL
Sbjct  110   LGFGSKATGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQEL  169

Query  1024  LVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRT  845
             +VQGNKTIDGRGA V+IA GAG+ LQ V NVIIH I + +I  + GG+IRD VDH G R 
Sbjct  170   VVQGNKTIDGRGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVGNRG  229

Query  844   HDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNE  665
               +GD +++FGS ++W+DH+++   +DGLIDA  G+TA+T+SNCH ++HDK +L GA + 
Sbjct  230   PSDGDAVSVFGSSNIWLDHLTLSKAQDGLIDAIQGSTAITISNCHLSNHDKAILLGATDT  289

Query  664   DSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGN  485
              + DK+MQ+T+AFN F K L QRMP  R+G  H+VNNDY  WEMYA+GG  G TI+SQGN
Sbjct  290   FTEDKKMQVTVAFNRFDKGLVQRMPCIRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQGN  349

Query  484   RYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDN  308
             R+ A   +N  KEVT R DC  +    W W S GDVF+NGA+F  SGDPK   KY   D 
Sbjct  350   RFFASDNKN-AKEVTKRMDCSPEEGNGWIWRSEGDVFLNGAYFNASGDPKKQIKYELNDV  408

Query  307   LRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             ++P  G EV R+ +++G L  C PG++C
Sbjct  409   IKPAPGTEVQRITKFAGAL-VCKPGQQC  435



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   414 bits (1064),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 224/451 (50%), Positives = 281/451 (62%), Gaps = 21/451 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             +Y  L   AA +        D+ W++R+ EAR      YHPNP ++   LN  V   L +
Sbjct  14    LYAVLFLSAAAVSEANIGEFDEHWQRRKLEARARAEATYHPNPIEVANSLNRAVHRSLRD  73

Query  1393  TYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLA  1214
                +R               R+ L   K    PC ATNPID+CWRCR DW+   +R RLA
Sbjct  74    ESGSR---------------RKLLGLHKKFAGPCTATNPIDRCWRCRKDWAT--DRMRLA  116

Query  1213  DCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLS  1034
              CA GF +  TGG GG+IY+V D +DDDV EP+ GTLR  VIQ EPLWI+FA  M IKL 
Sbjct  117   RCAQGFGRNATGGLGGKIYIVTDGTDDDVLEPRPGTLRWGVIQNEPLWIIFARPMLIKLK  176

Query  1033  GELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKG  854
              ELLV  +KTIDGRGA V IA GA +T+Q  +NVIIHNI V D+    GG IRD   H G
Sbjct  177   EELLVGSDKTIDGRGAQVRIADGAQVTVQYSHNVIIHNIHVNDLIVGKGGRIRDSPQHAG  236

Query  853   MRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGA  674
              RT  +GDG+++FGS +VW+DH+S+  C+DGLID  A AT VT+SNCH T+H+ V+LFG+
Sbjct  237   FRTQSDGDGVSVFGSTNVWLDHLSLATCQDGLIDVIAEATGVTISNCHLTNHNDVMLFGS  296

Query  673   NNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIIS  494
             ++ +  D+ MQ+T+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TIIS
Sbjct  297   SDSNPKDQIMQVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIIS  356

Query  493   QGNRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGY  317
             QGNRYIA P     K +T R    +  WK W W S  D+ +N A F  SG      K+  
Sbjct  357   QGNRYIAPPNLA-AKLITKRLGASEAEWKNWVWHSQDDLLLNDAVFADSGGANE-RKFDK  414

Query  316   RDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              D + P  G  V RL R++G L  C PG+ C
Sbjct  415   DDLITPKPGSYVTRLTRFAGCLP-CKPGKPC  444



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   414 bits (1063),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 287/461 (62%), Gaps = 26/461 (6%)
 Frame = -2

Query  1600  AASTKILWWVYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELN  1421
             AA + +L+ V+L  LS AA   A   D  D+ W++R+  A       Y  +P ++T + N
Sbjct  10    AAGSLVLYAVFL--LSAAATSEANIGDY-DEHWQKRKLMADAAAEATYKRDPFEVTNDFN  66

Query  1420  ERVSIGLNETYnnrelyddsnnnnndNVTRREL--RRKKGSKEPCRATNPIDQCWRCRAD  1247
               V                   +      RR L   ++K    PC+ATNPID+CWRCR D
Sbjct  67    RAVH-----------------RSEEKETARRSLMLSKRKKFAGPCKATNPIDRCWRCRDD  109

Query  1246  WSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWI  1067
             W+   +R RLA CA GF + TTGG  G+ YVV D +DDDV  P+ GTLR  VIQ EPLWI
Sbjct  110   WA--TDRKRLARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQDEPLWI  167

Query  1066  VFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPG  887
             +F  +M I L  EL++  +KT+DGRGA V I  GA +T+Q+ NNVIIHNI V DI    G
Sbjct  168   IFGKNMIINLKEELMIGNDKTVDGRGAQVRITNGAQVTVQNSNNVIIHNIHVHDIVLGKG  227

Query  886   GIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHF  707
             G+IRD  +H G RT  +GDGITIFGS +VW+DH+S+ NC+DGLID  A +T VT+SNCH 
Sbjct  228   GMIRDSPEHFGFRTQSDGDGITIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHL  287

Query  706   TDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYA  527
             T+H+ V+LFG+++  S D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA
Sbjct  288   TNHNDVMLFGSSDSFSEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYA  347

Query  526   VGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSG  347
             +GGS   TIISQGNRYIA P     +        +  WK W W S  D+FM GA+FT SG
Sbjct  348   IGGSKNPTIISQGNRYIAPPNLAAKQITKQLGAEESEWKNWVWHSEEDLFMEGAYFTTSG  407

Query  346   DPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                       +D ++P  G  V RL R++G +  C PG+ C
Sbjct  408   GAIRTS-INKKDLIKPKPGSYVTRLTRFAGSI-PCRPGKPC  446



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   413 bits (1061),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 219/449 (49%), Positives = 296/449 (66%), Gaps = 26/449 (6%)
 Frame = -2

Query  1561  LLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETY  1388
             L S A ++P  +A +++  +VW++R  EA +   Q Y PNP  +   LN +V        
Sbjct  11    LFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ-------  63

Query  1387  nnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
                       + +   + +R L   +  +  C ATNPID+CWRC+ +W++  +R  LA C
Sbjct  64    ----------DLSKQAIAKRGLLNAESGQ--CEATNPIDKCWRCKENWAE--DRQALAGC  109

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
             ALGF    TGGKGG+IY V D SD+D++ PK GTLRHAVIQKEPLWI+FA  M IKL  E
Sbjct  110   ALGFGSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQE  169

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L+VQG+KTIDGRGA V+IA GAG+ LQ V NVIIH I + +I    GG+IRD VDH G R
Sbjct  170   LIVQGSKTIDGRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKR  229

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
                +GD ++IFGS ++W+DH+++    DGLIDA   +TA+T+SNCH ++HDK +L GA++
Sbjct  230   GQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASD  289

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               + DK+MQ+T+AFN F K L QRMP  R+G  H+VNNDY  WEMYA+GG  G TI+SQG
Sbjct  290   TFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQG  349

Query  487   NRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRD  311
             NR+ A   +N  KEVT R +C  +  K W W S GDVF+NGA+F  SGDPK   +Y   +
Sbjct  350   NRFFASNNQN-TKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPKKQIQYQMDN  408

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              ++P SG EV R+ +++G L  C PG++C
Sbjct  409   VIKPESGTEVERITKFAGAL-VCKPGQEC  436



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   413 bits (1062),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 226/466 (48%), Positives = 290/466 (62%), Gaps = 41/466 (9%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVSDD---------------VWKQREAEARRGLLQAYHPNPEKI  1436
             +  L  +  +IP   A+V +D                W++R + A +   QAY  +P  +
Sbjct  7     FYLLTCLVVMIPTLYANVKEDEAYWKRQSEVLLVDSYWQERASIAEKENQQAYTSDPYSL  66

Query  1435  TTELNERVS-IGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWR  1259
             T  L   VS I + E                    +   R  +G    C ATNPID+CWR
Sbjct  67    TKNLTFSVSEIIIGE--------------------KSGRRNLRGRGGKCMATNPIDRCWR  106

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             C  +W++  NR +LADC  GF + T GGK G  YVV  + D+D+  P  GTLRHAV +  
Sbjct  107   CDPNWAN--NRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPAPGTLRHAVTRSG  164

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+FA SM I+LS EL++  +KTIDGRG  V IA GAG+T+Q + NVIIH IK+ +I+
Sbjct  165   PLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITIQFIKNVIIHGIKIFNIQ  224

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
                GG+IRD   H G RT+ +GDGI+IFGS +VWIDHVSM NC+DGLIDA  G+TA+T+S
Sbjct  225   VGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSMRNCKDGLIDAIQGSTAITIS  284

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             N HFTDH++V+LFGA++    DK MQITLAFNHFGKRL QRMPRCR+G  H+VNNDYTHW
Sbjct  285   NGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHW  344

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAF  362
             EMYA+GGS   TIIS+GNR+IA P   + KE+T R+  P+  WK W W S  D +MNGAF
Sbjct  345   EMYAIGGSKHPTIISEGNRFIA-PNNVYAKEITKREYSPEQEWKNWQWRSINDEYMNGAF  403

Query  361   FTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F   G       +  +D +    G  VGRL RY+G L RC  G+ C
Sbjct  404   FREGGSQITDRPFSRQDMITAKPGSYVGRLTRYAGSL-RCIVGKPC  448



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   413 bits (1061),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 226/455 (50%), Positives = 302/455 (66%), Gaps = 30/455 (7%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             + L+++    +IP + A ++  DD  +++  E+    L+A+ PNPEK+  ELNE+V   L
Sbjct  13    LLLSMIYFVTLIPKSHAAIAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQVGETL  72

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
                              ++N++RR L+ +      C+ATNPID+CWRC  DWS   NR +
Sbjct  73    ----------------VHENLSRRHLKEE----NDCKATNPIDRCWRCDGDWS--KNRKK  110

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             LA+C  GF   TTGGK GR Y+V D SDDD+ +PK GTLRHAVIQ EPLWI+FA SM I+
Sbjct  111   LAECVRGFGHRTTGGKDGRYYLVTDPSDDDMDKPKNGTLRHAVIQSEPLWIIFARSMVIR  170

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             L  EL+   +KT+DGRG  V IA GAG+TLQ V+NVIIHNI++ +I S+PGG+IRD VDH
Sbjct  171   LKQELIFASDKTVDGRGVRVRIAYGAGLTLQFVHNVIIHNIRIHNIVSTPGGMIRDAVDH  230

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G+RT  +GDGI +F S+++WIDHVS+    DGLID   G+TA+T+SNC F +H+ V+L 
Sbjct  231   IGLRTVSDGDGINVFSSNNIWIDHVSLSKGTDGLIDVIEGSTAITISNCKFNNHNTVMLL  290

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             GA++  + D  MQ+T+AFN FGK L QRMPRCRWG FH++NNDY+ W MYA+GGSS  TI
Sbjct  291   GAHDNSTKDTIMQVTVAFNRFGKGLVQRMPRCRWGFFHVINNDYSKWLMYAIGGSSNPTI  350

Query  499   ISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPK---GVE  329
             ISQGNR+ A     F K+VT R+  +  WKKW W S GD F+NGA+F  SG PK    + 
Sbjct  351   ISQGNRFKASDNP-FTKQVTKRESTESEWKKWQWRSEGDKFVNGAYFRESG-PKVKHTIS  408

Query  328   KYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                 ++ ++   G   GRL RY+G L  C  G+ C
Sbjct  409   PLKEKNLIKFKPGSYAGRLTRYAGALN-CVAGKSC  442



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   413 bits (1061),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 223/434 (51%), Positives = 281/434 (65%), Gaps = 30/434 (7%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD  ++R+  A     +AY P+P  +T   N  V   ++ +                   
Sbjct  37    DDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSS-------------------  77

Query  1333  RREL---RRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGR  1163
             RRE+    RK   + PCRATNPID+CWRCR DW+   +R RLA CA GF   TTGG GG+
Sbjct  78    RREMWERPRKHKKRGPCRATNPIDKCWRCRRDWAT--DRQRLARCARGFGHATTGGLGGK  135

Query  1162  IYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAF  983
             IYVV D +D DV  P+ GTLR  VIQ  PLWI+FA SM I+LS ELL+  +KTIDGRGA 
Sbjct  136   IYVVTDPTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQ  195

Query  982   VNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHH  803
             V+IA GAG+T+Q   NVIIHN+ V D+K + GG++RD   H G RT  +GDGI++F + +
Sbjct  196   VHIANGAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATN  255

Query  802   VWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFN  623
             VWIDH+SM NCEDGLID    +T +T+SNCHFT+H+ V+LFGA++    D+ MQIT+AFN
Sbjct  256   VWIDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFN  315

Query  622   HFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEV  443
             HFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GG    TIISQGNRYIA P     K +
Sbjct  316   HFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPP-NIAAKVI  374

Query  442   THRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGD-PKGVEKYGYRDNLRPLSGKEVGRLAR  266
             T     +  WK W W +  D+FMNGA F PSG  PK V+   +   ++P  G  V RL R
Sbjct  375   TKHYAEEGVWKNWVWHTEDDLFMNGAIFNPSGGAPKQVDTNEW---VKPKPGTYVTRLTR  431

Query  265   YSGHLGRCTPGRKC  224
             +SG L  CT G+ C
Sbjct  432   FSGTLSCCT-GKPC  444



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score =   412 bits (1060),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 221/448 (49%), Positives = 294/448 (66%), Gaps = 25/448 (6%)
 Frame = -2

Query  1561  LLSIAAVIPATTADV-SDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             L S   +IP  +A   +D+VW++R  EA +   Q Y P+P  + + LN +V     +T  
Sbjct  11    LFSFIILIPCLSAIAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQDLSKQT--  68

Query  1384  nrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCA  1205
                              RR L   +  +  C ATNPID+CWRC+ +W++  +R  LA CA
Sbjct  69    ---------------AARRGLLNAESGQ--CEATNPIDKCWRCKENWAE--DRQALAGCA  109

Query  1204  LGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGEL  1025
             LGF    TGGKGG+IY V D+SD++++ PK GTLRHAVIQKEPLWI+FA  M IKL  EL
Sbjct  110   LGFGSKATGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQEL  169

Query  1024  LVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRT  845
             +VQGNKTIDGRGA V+IA GAG+ LQ V NVIIH I + +I  + GG+IRD VDH G R 
Sbjct  170   VVQGNKTIDGRGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVGNRG  229

Query  844   HDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNE  665
               +GD +++F S ++W+DH+++   +DGLIDA  G+TA+T+SNCH ++HDK +L GA + 
Sbjct  230   PSDGDAVSVFSSSNIWLDHLTLSKAQDGLIDAIQGSTAITISNCHLSNHDKAILLGATDT  289

Query  664   DSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGN  485
              + DK+MQ+T+AFN F K L QRMP  R+G  H+VNNDY  WEMYA+GG  G TI+SQGN
Sbjct  290   FTEDKKMQVTVAFNRFDKGLVQRMPCIRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQGN  349

Query  484   RYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDN  308
             R+ A   +N  KEVT R DC  +    W W S GDVF+NGA+F  SGDPK   KY   D 
Sbjct  350   RFFASDNKN-AKEVTKRMDCSPEEGNGWIWRSEGDVFLNGAYFNASGDPKKQIKYELNDV  408

Query  307   LRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             ++P  G EV R+ +++G L  C PG++C
Sbjct  409   IKPAPGTEVQRITKFAGAL-VCKPGQQC  435



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   414 bits (1063),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 219/466 (47%), Positives = 295/466 (63%), Gaps = 21/466 (5%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADV--SDDVWKQREAEARRGLLQAYHPNPEKITTELNER-----VS  1409
             + ++ IA++IP   A+V  +DD W  +  EAR+  L  YHP+P  I    +ER       
Sbjct  10    VCVVCIASLIPTLRANVAETDDYWVNKANEARKRTLSVYHPDPYAIVDHFHERHYDNSTD  69

Query  1408  IGLNETYnnrelyddsnnnnndNVTRREL------RRKKGS----KEPCRATNPIDQCWR  1259
             +   E +      ++ +     + T          R K+G     K PC A+NPID+CWR
Sbjct  70    VEEREEHEATAFAEEDDTEMISSSTNSTRRSLSGNRGKRGKWSKLKGPCTASNPIDKCWR  129

Query  1258  CRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKE  1079
             C+ADW+    R +L  C  GF   TTGGK GRIYVV    DDDV  PK GTLRHAVIQKE
Sbjct  130   CQADWA--KRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDVVNPKPGTLRHAVIQKE  187

Query  1078  PLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIK  899
             PLWI+F   M+I+L  EL++  +KTID RGA V++A GAG+T+Q V+N+IIH + V  I 
Sbjct  188   PLWIIFKHDMSIRLKQELMINSHKTIDARGANVHVAYGAGITMQYVHNIIIHGLHVHHII  247

Query  898   SSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVS  719
                GG++R+ VDH G R   +GDGI+IFG+ ++W+DH+SM  C+DGLIDA  G+T +T+S
Sbjct  248   EGSGGMVRNSVDHFGFRGKADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITIS  307

Query  718   NCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHW  539
             N HFT H+ V+L GA++ +  DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTHW
Sbjct  308   NSHFTHHNDVMLLGAHDSNKDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHW  367

Query  538   EMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMNGAF  362
             E+YA+GGS G TI+S GNR+IA   +  + EVT RD   +S WK W W S  DVFMN A+
Sbjct  368   ELYAIGGSQGPTILSHGNRFIASLHKPQYNEVTKRDYASESEWKNWNWRSDRDVFMNRAY  427

Query  361   FTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             F  SG+PK    +  +  ++P  G     L +Y+G L  C  G+ C
Sbjct  428   FRQSGNPKFKCTHTRQQMIKPKHGVAASMLTKYAGALD-CRVGKPC  472



>gb|KDO49230.1| hypothetical protein CISIN_1g036607mg [Citrus sinensis]
Length=436

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 219/449 (49%), Positives = 295/449 (66%), Gaps = 26/449 (6%)
 Frame = -2

Query  1561  LLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETY  1388
             L S A ++P  +A +++  +VW++R  EA +   Q Y PNP  +   LN +V        
Sbjct  11    LFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ-------  63

Query  1387  nnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADC  1208
                       + +   + +R L   +  +  C ATNPID+CWRC+ +W++  +R  LA C
Sbjct  64    ----------DLSKQAIAKRGLLNAESGQ--CAATNPIDKCWRCKENWAE--DRQALAGC  109

Query  1207  ALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGE  1028
             ALGF    TGGKGG+IY V D SD+D++ PK GTLRHAVIQKEPLWI+FA  M IKL  E
Sbjct  110   ALGFGSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQE  169

Query  1027  LLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMR  848
             L+VQG+KTIDGRGA V+IA GAG+ LQ V NVIIH I + +I    GG+IRD VDH G R
Sbjct  170   LIVQGSKTIDGRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKR  229

Query  847   THDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANN  668
                +GD ++IFGS ++W+DH+++    DGLIDA   +TA+T+SNCH ++HDK +L GA++
Sbjct  230   GQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASD  289

Query  667   EDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQG  488
               + DK+MQ+T+AFN F K L QRMP  R+G  H+VNNDY  WEMYA+GG  G TI+SQG
Sbjct  290   TFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQG  349

Query  487   NRYIAQPGENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRD  311
             NR+ A   +N  KEVT R +C  +  K W W S GDV +NGA+F  SGDPK   +Y   D
Sbjct  350   NRFFASNNQN-AKEVTKRMNCSPEEGKSWIWRSEGDVLLNGAYFNSSGDPKKQIQYQMDD  408

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              ++P SG EV R+ +++G L  C PG++C
Sbjct  409   VIKPESGTEVERITKFAGAL-VCKPGQEC  436



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 221/453 (49%), Positives = 283/453 (62%), Gaps = 22/453 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSD--DVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             +Y+    ++A  P + A++ D  + W+QR+A AR      Y  +P ++   LN  V    
Sbjct  15    LYVVFFFLSASAPVSQANIGDFDEHWQQRKAAARAAAEAIYQSDPLEVANSLNRAVHRAT  74

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
              E               +    R  L + K    PCRATNPID+CWRCR DW+   +R R
Sbjct  75    KED--------------DAGTRRSMLGKHKKFAGPCRATNPIDRCWRCRKDWAT--DRKR  118

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             LA CA GF +  TGG  G+ Y+V D SDDDV  P+ GTLR AVIQ EPLWI+FA SM IK
Sbjct  119   LARCAQGFGRNATGGLAGKFYIVTDGSDDDVLAPRPGTLRWAVIQAEPLWIIFARSMLIK  178

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             L  ELL+  +KTIDGRGA V IA GA +T+Q  +NVIIHNI + D+    GG+IRD   H
Sbjct  179   LKEELLIGSDKTIDGRGAQVRIADGAQVTVQYAHNVIIHNIHINDLIVGKGGMIRDSPAH  238

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G RT  +GDG+ +FGS  VW+DH+S+  C+DGLID  A +T VT+SNCH T+H+ V+LF
Sbjct  239   FGFRTQSDGDGVNVFGSTSVWLDHLSLATCQDGLIDVIAESTGVTISNCHLTNHNDVMLF  298

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             G+++ +  D  MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   TI
Sbjct  299   GSSDSNPKDVIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKDPTI  358

Query  499   ISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPS-GDPKGVEKY  323
             +SQGNRYIA P     +        +  WK W W S  D+ MNGAFFT + GD K   K+
Sbjct  359   LSQGNRYIAPPNLAAKQITKQIGAAEPEWKNWVWHSQEDLLMNGAFFTETGGDIK--RKF  416

Query  322   GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                D ++P  G  V RL RY+G +  C PG+ C
Sbjct  417   DKDDLIKPKPGTYVTRLTRYAGCI-PCRPGKPC  448



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   412 bits (1058),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 221/432 (51%), Positives = 280/432 (65%), Gaps = 26/432 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVS-IGLNETYnnrelyddsnnnnndNV  1337
             D  W++R + A +   QAY  +P  +T  L   VS I + E                   
Sbjct  26    DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEIIIGE-------------------  66

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
              +   R  +G    C ATNPID+CWRC  +W++  NR +LADC  GF + T GGK G  Y
Sbjct  67    -KNGRRNLRGRGGKCMATNPIDRCWRCDPNWAN--NRKKLADCVQGFGRNTIGGKNGPFY  123

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV  + D+D+  P  GTLRHAV +  PLWI+FA SM I+LS EL++  +KTIDGRG  V 
Sbjct  124   VVNSSLDNDMVNPAPGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVY  183

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             IA GAG+T+Q + NVIIH IK+ +I+   GG+IRD   H G RT+ +GDGI+IFGS +VW
Sbjct  184   IANGAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVW  243

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM NC+DGLIDA  G+TA+T+SN HFTDH++V+LFGA++    DK MQITLAFNHF
Sbjct  244   IDHVSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHF  303

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             GKRL QRMPRCR+G  H+VNNDYTHWEMYA+GGS   TIIS+GNR+IA P   + KE+T 
Sbjct  304   GKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PNNVYAKEITK  362

Query  436   RD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R+  P+  WK W W S  D +MNGAFF   G       +  +D +    G  VGRL RY+
Sbjct  363   REYSPEQEWKNWQWRSINDEYMNGAFFREGGSQITDRPFSRQDMITAKPGSYVGRLTRYA  422

Query  259   GHLGRCTPGRKC  224
             G L RC  G+ C
Sbjct  423   GSL-RCIVGKPC  433



>ref|XP_003571658.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=432

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 215/425 (51%), Positives = 277/425 (65%), Gaps = 31/425 (7%)
 Frame = -2

Query  1486  EARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVTRRELR-RKK  1310
             +A+   L AYHP+P  +    N  V    +                     RR L+ +KK
Sbjct  35    DAKARALAAYHPDPIAVANSFNRAVHRSTSP--------------------RRALKGKKK  74

Query  1309  GSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDD  1130
              S  PC ATNPID+CWRCR DW+   +R RLA CA GF + TTGG GG+IY+V D +D D
Sbjct  75    QSNGPCEATNPIDRCWRCRKDWAT--DRMRLARCAKGFGQNTTGGLGGQIYIVTDPTDAD  132

Query  1129  VQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTL  950
             VQ P+ GT+R  VIQ +P+WI+FA +M I L+ EL++  + TIDGRGA V+IA GAG+T+
Sbjct  133   VQNPRPGTIRFGVIQPQPIWIIFAKNMVITLTQELIINSDTTIDGRGAQVHIAKGAGLTV  192

Query  949   QSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNC  770
             Q+ +NVIIHN+ V DIK + GG++RD  DH G RT  +GDGI++F + +VWIDH+S   C
Sbjct  193   QNRSNVIIHNLHVHDIKHTDGGMVRDSPDHIGYRTRADGDGISLFTATNVWIDHISTSMC  252

Query  769   EDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMP  590
             EDGL+D    +TA+T+SNCH T H+ V+LFGA++    DK MQ+T+AF HFG+ L QRMP
Sbjct  253   EDGLVDIVQSSTAITISNCHLTSHNDVMLFGASDSYPDDKIMQVTVAFTHFGRGLVQRMP  312

Query  589   RCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSW  413
             RCRWG FH+VNNDYTHW MYA+GGSS  TIISQGNRYIA P +   K++T RD  P+  W
Sbjct  313   RCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRYIAPPNKA-AKKITKRDYAPESEW  371

Query  412   KKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDN--LRPLSGKEVGRLARYSGHLGRCT  239
             K W W S  D+ MN A F P+G   G   Y +     ++P  G  V RL RY+G L  C 
Sbjct  372   KNWVWHSEDDLLMNEAVFDPTG---GAVTYKFDSTKLIKPKPGTYVTRLVRYAGTLA-CK  427

Query  238   PGRKC  224
             PG  C
Sbjct  428   PGCPC  432



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 289/456 (63%), Gaps = 25/456 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             +YL    ++A +        D+ W+QR+  A       Y  +P ++  +LN  V   + +
Sbjct  15    LYLVFFFLSAALSEANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRSVEK  74

Query  1393  TYnnrelyddsnnnnndNVTRREL----RRKKGSKEPCRATNPIDQCWRCRADWSDGPNR  1226
                             D  TRRE+     RK     PCRATNPID+CWRCR DW+   +R
Sbjct  75    ---------------EDIGTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWA--TDR  117

Query  1225  FRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMT  1046
              RLA CA GF + TTGG  G+ YVV D +DDDV  P+ GTLR  VIQ EPLWI FA +M 
Sbjct  118   KRLARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMI  177

Query  1045  IKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSS--PGGIIRD  872
             I L  EL+++G+KTIDGRG  V I  GA +TLQ VNNVIIHNI + DI SS   GG +RD
Sbjct  178   ITLKEELIIRGDKTIDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRD  237

Query  871   CVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK  692
               DH G RT  +GDGIT+FGS +VW+DH+S+ NC+DGLID  A +T VT+SNCH T+H+ 
Sbjct  238   SPDHFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHND  297

Query  691   VLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSS  512
             V+LF ++++   D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS 
Sbjct  298   VMLFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSK  357

Query  511   GATIISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGV  332
               TIISQGNRYIA P     +     D P+  WK W W S  D+FM GA+FT +G     
Sbjct  358   APTIISQGNRYIAPPNLAAKQVTKQHDTPESVWKNWVWHSENDLFMEGAYFTVTGGQIN-  416

Query  331   EKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              ++  +D ++P +G  V RL RY+G L  CTPG+ C
Sbjct  417   RQFNKKDLIKPRNGSYVTRLTRYAGSLA-CTPGKPC  451



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   411 bits (1056),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 290/456 (64%), Gaps = 25/456 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             +YL    ++A +        D+ W+QR+  A       Y  +P ++  +LN  V   + +
Sbjct  15    LYLVFFFLSAALSEANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRSVEK  74

Query  1393  TYnnrelyddsnnnnndNVTRRELR----RKKGSKEPCRATNPIDQCWRCRADWSDGPNR  1226
                            +D  TRRE+     RK     PCRATNPID+CWRCR DW+   +R
Sbjct  75    ---------------DDIGTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWA--TDR  117

Query  1225  FRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMT  1046
              RLA CA GF + TTGG  G+ YVV D +DDDV  P+ GTLR  VIQ EPLWI FA +M 
Sbjct  118   KRLARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMI  177

Query  1045  IKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSS--PGGIIRD  872
             I L  EL+++G+KTIDGRG  V I  GA +TLQ VNNVIIHNI + DI SS   GG +RD
Sbjct  178   ITLKEELIIRGDKTIDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRD  237

Query  871   CVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDK  692
               DH G RT  +GDGIT+FGS +VW+DH+S+ NC+DGLID  A +T VT+SNCH T+H+ 
Sbjct  238   SPDHFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHND  297

Query  691   VLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSS  512
             V+LF ++++   D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS 
Sbjct  298   VMLFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSK  357

Query  511   GATIISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGV  332
               TIISQGNRYIA P     +     D P+  WK W W S  D+FM GA+FT +G     
Sbjct  358   APTIISQGNRYIAPPNLAAKQVTKQHDTPESVWKNWVWHSENDLFMEGAYFTVTGGQIN-  416

Query  331   EKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              ++  +D ++P +G  V RL RY+G L  CTPG+ C
Sbjct  417   RQFNKKDLIKPRNGSYVTRLTRYAGSLA-CTPGKPC  451



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   410 bits (1055),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 230/433 (53%), Positives = 290/433 (67%), Gaps = 23/433 (5%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD W+++  EA      AY+P+PE +T + N+ V + L+E  N+               T
Sbjct  32    DDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVHLALSEARNS---------------T  76

Query  1333  RRELR--RKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             RR LR   +   K PC ATNPID+CWRC+ +W +  +R +LA CA GF +   GGK G  
Sbjct  77    RRTLRSVHRNKFKGPCVATNPIDRCWRCQKNWIN--HRKKLATCAKGFGRNAIGGKNGDF  134

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV D SDDD+  PK GTLR  VIQ  PLWI+FA  M I+LS EL++  NKTIDGRGA V
Sbjct  135   YVVTDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANV  194

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
             +IA GA +T+Q V++VIIH I + DI+ S GGIIRD + H G+RT  +GDGI+I+GS  +
Sbjct  195   HIAFGAQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDI  254

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             WIDH S+ NC DGLIDA   +TA+T+SNCHFT H+ VLLFGA++ +  D  MQ T+AFNH
Sbjct  255   WIDHCSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNH  314

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPRCRWG FH+VNNDYT W MYA+GGS   TIISQGNR++A P   F KEVT
Sbjct  315   FGKGLVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVA-PRMLFSKEVT  373

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
              RD   +D WK+WTW S GD+  NGAFF  SG+P    K+  +D ++   G  V RL R+
Sbjct  374   KRDYATEDVWKQWTWRSEGDLMQNGAFFRESGNPN-ARKFDRKDFIKAKPGTWVRRLTRF  432

Query  262   SGHLGRCTPGRKC  224
             +G LG C  GR C
Sbjct  433   AGPLG-CRAGRPC  444



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   409 bits (1052),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 223/431 (52%), Positives = 278/431 (65%), Gaps = 31/431 (7%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             ++ W +R   AR   L AY  +P   T   N  V                         T
Sbjct  38    EEYWAERAEVARSRNLAAYVSDPVAATNRFNADV---------------------LRATT  76

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR L R  G   PC ATNPID+CWRCRADW+   +R RLA CA GF   T GG  G++YV
Sbjct  77    RRALARYDG---PCMATNPIDRCWRCRADWA--TDRKRLAQCARGFGHRTVGGAAGKLYV  131

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V+D SDD++  P+ GTLRHAVIQ  PLWIVFA  M I+L  EL+V  NKTIDGRGA V+I
Sbjct  132   VRDPSDDEMIIPRKGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRGAQVHI  191

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
                A +TLQ+V NVI+HN+ + D K+  GG+IRD   H G+RT  +GDG+++  S +VWI
Sbjct  192   MF-AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWI  250

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM +C DGLID   G+TA+TVSN HFTDHD V+LFGA+N+   D  MQ+T+AFNHFG
Sbjct  251   DHVSMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQVTVAFNHFG  310

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             + L QRMPRCR+G FH+VNNDYTHW MYA+GG+   TIISQGNR+IA P +   KEVT R
Sbjct  311   RGLVQRMPRCRYGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIA-PDDPNAKEVTKR  369

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             +  P   +K+W W S GDV MNGAFF  SG  +   KY   D +    G+ VG+L R++G
Sbjct  370   EYTPYKDYKEWVWKSQGDVMMNGAFFNESGG-QNERKYDRFDFIPAKHGRYVGQLTRFAG  428

Query  256   HLGRCTPGRKC  224
              L +C  G+ C
Sbjct  429   PL-KCIVGQPC  438



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   418 bits (1075),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 265/389 (68%), Gaps = 24/389 (6%)
 Frame = -2

Query  1336  TRREL------------RRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFA  1193
             TRREL            RR  G K  C A NPID+CWRC   WS   NR +LADCALGF 
Sbjct  327   TRRELLQVGQSRGQHPKRRNLGGK--CVAYNPIDRCWRCDPGWSK--NRKKLADCALGFG  382

Query  1192  kgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQG  1013
             + TTGGK G  YVV DASDDD+  PKAGTLRHAV ++EPLWIVFA SM IKL  EL++  
Sbjct  383   RKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAKSMVIKLQQELIMTS  442

Query  1012  NKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEG  833
             +KTIDGRG  V+I GGAG TLQ VNNVIIHNI + +I    GG+IRD   H G+RT  +G
Sbjct  443   DKTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDG  502

Query  832   DGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSID  653
             DGI IFG+ +VWIDHVSM +C DG+IDA  G+T +T+SNCH TDH +V+LFG  ++D ID
Sbjct  503   DGINIFGATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVID  562

Query  652   KRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIA  473
             K+MQIT+AFNHFGKRL QRMPRCR+GL H+VNNDYTHWEMYA+GG+   TIISQGNR+IA
Sbjct  563   KKMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIA  622

Query  472   QPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVE-----KYGYRD  311
              P E   K+VT R+  P   WK W W S GD F+NGA+F  SG    +          + 
Sbjct  623   PPNEE-AKQVTKREYTPFTEWKSWNWQSEGDYFLNGAYFVQSGRANALSAAPKNPVPSKF  681

Query  310   NLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              +RP  G  V +L   +G L  C   + C
Sbjct  682   AIRPQPGTLVRKLTMDAGVLS-CKKRKPC  709



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   410 bits (1054),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 216/434 (50%), Positives = 281/434 (65%), Gaps = 29/434 (7%)
 Frame = -2

Query  1519  VSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndN  1340
             V D V + R  ++      AY P+PE ++  L   V + L                    
Sbjct  73    VDDSVLEARAHQSWLEAQAAYEPDPEAVSRNLTHLVHMELP-------------------  113

Query  1339  VTRRELRRKKGSK--EPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgG  1166
              +   +RR+ G +   PC ATNPID+CWRC   W    NR +LADCA+GF +   GGK G
Sbjct  114   -SGNHMRRQLGRRWHGPCVATNPIDRCWRCDQKWH--TNRKKLADCAMGFGQQALGGKYG  170

Query  1165  RIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGA  986
             R YVV D SD+D+  PK GTLRHAVIQ EPLWI+F   M IKL+ EL+V   KT+DGRGA
Sbjct  171   RYYVVTDPSDNDLLNPKPGTLRHAVIQNEPLWIIFQRDMVIKLTEELMVNSFKTVDGRGA  230

Query  985   FVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSH  806
              V+IA GA +T+Q V NVIIH + + D K+  GG+IRD  DH G+RT  +GDGI+I+GS 
Sbjct  231   NVHIAYGACITIQYVKNVIIHGLHIHDCKAGNGGMIRDSEDHFGIRTRSDGDGISIYGST  290

Query  805   HVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAF  626
             +VW+DH ++  C+DGL+DA  G+TA+T+SN HF+ HD+VLL G ++   +DK MQ+T+AF
Sbjct  291   NVWVDHNTLSKCQDGLVDAIMGSTAITISNNHFSKHDEVLLLGGSDLYPMDKVMQVTVAF  350

Query  625   NHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKE  446
             NHFGK L QRMPRCR+G FH+VNNDYTHW  YA+GGS   TI+SQGNR++A P + +FKE
Sbjct  351   NHFGKGLSQRMPRCRFGYFHVVNNDYTHWGKYAIGGSMNPTILSQGNRFVA-PLDPYFKE  409

Query  445   VTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLAR  266
             +T R  PD  W  W W S GD+F NGA FT SG+ +   KY  + ++R   G  VG L R
Sbjct  410   ITKRFGPDLDWGSWNWKSEGDLFKNGAIFTQSGNGR---KYERKISIRAKPGSYVGILTR  466

Query  265   YSGHLGRCTPGRKC  224
             +SG L +C  G  C
Sbjct  467   FSGAL-KCKTGTPC  479



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   409 bits (1051),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 226/431 (52%), Positives = 286/431 (66%), Gaps = 26/431 (6%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD  ++R  +A +  L+AY+P+PE +T     +V   L                   N T
Sbjct  40    DDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVGKMLE----------------GGNET  83

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR+L  K G    C ATNPID+CWRC  +W+   NR RLA CA GF + T GG  G+ YV
Sbjct  84    RRQL--KAGG---CVATNPIDRCWRCDPNWAK--NRKRLAKCARGFGRQTKGGMHGKYYV  136

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V D SDD+VQ+P+ GTLRHAVIQ+EPLWI+F  SM IKL+ ELL+  +KTIDGRG  V+I
Sbjct  137   VVDPSDDNVQDPEPGTLRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRGVEVHI  196

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
             A GAG+++Q V NVIIHNIK+  I    GG++RD   H G+RT  +GDGI+IFGS+HVWI
Sbjct  197   AYGAGLSIQFVQNVIIHNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGDGISIFGSNHVWI  256

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVS+  C DGLIDA   +TA+T+SNC F +H+ V+L GA++E S D  MQ+T+AFN FG
Sbjct  257   DHVSLSKCSDGLIDAIMASTAITISNCKFNNHNDVILLGASDEHSEDAIMQVTVAFNRFG  316

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             K L QRMPRCRWG FHIVNNDY+ W+MYA+GGS+  TIISQGNR+ A   + F KEVT R
Sbjct  317   KGLVQRMPRCRWGFFHIVNNDYSQWQMYAIGGSAHPTIISQGNRFKASKNQ-FTKEVTKR  375

Query  433   DCPDDS-WKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             D  + S W  W W S GD F+NGAFF  SG P     +  ++ L+   G   GRL RY+G
Sbjct  376   DYAEKSQWMGWQWRSEGDKFLNGAFFVESGPPLKKSPFTGKNKLQFKPGSYAGRLTRYAG  435

Query  256   HLGRCTPGRKC  224
              L +C  G+ C
Sbjct  436   AL-KCREGKPC  445



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   409 bits (1052),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 225/463 (49%), Positives = 294/463 (63%), Gaps = 18/463 (4%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNER-------  1415
             + ++ IA++IPA  ++++  D+ W+QR  EA +  L AYH +P +I    +ER       
Sbjct  10    ICVVCIASLIPAIRSNIAELDEYWQQRSEEAEKHSLAAYHSDPFEIVDHFHERHYDNSTD  69

Query  1414  -----VSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRA  1250
                        E          ++   +    RR   +    K PC A+NPID+CWRC  
Sbjct  70    IETERQDDQEEEDSIAMLTGSINSTRRSLRGGRRGRGKWSKLKGPCSASNPIDKCWRCMP  129

Query  1249  DWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLW  1070
             DW+    R +LADC  GF   TTGGK GRIYVV    D+D+  P+ GTLRHAVIQKEPLW
Sbjct  130   DWAR--RRQKLADCVRGFGYKTTGGKLGRIYVVTSNLDNDLINPRPGTLRHAVIQKEPLW  187

Query  1069  IVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP  890
             I+F   M I+L  EL++  +KTID RGA V+IA GAG+T+Q V N+IIH + +  I SS 
Sbjct  188   IIFKNDMNIRLQQELMINSHKTIDARGANVHIAYGAGITMQFVTNIIIHGLHIHHIVSSN  247

Query  889   GGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCH  710
             GG+IRD VDH G RT  +GDG++IFG+ ++WIDHVSM  C+DGLIDA  G+T +T+SN H
Sbjct  248   GGMIRDSVDHYGFRTRADGDGLSIFGASNIWIDHVSMSRCQDGLIDAIDGSTGITISNSH  307

Query  709   FTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMY  530
             FT H+ V+L GA+N    DKRMQ+T+A+NHFGK L QRMPR RWG  H+VNNDYTHWE+Y
Sbjct  308   FTHHNDVMLLGAHNVIDKDKRMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELY  367

Query  529   AVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTP  353
             A+GGS   TI+S GNR+IA P    +KEVT RD  P+  WK W W S  D+FMNGAFF  
Sbjct  368   AIGGSQSPTILSHGNRFIAPPHIPQYKEVTKRDYAPEAEWKNWNWRSERDIFMNGAFFRQ  427

Query  352   SGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             SG+P     +  +  ++P  G  V  L +Y+G L  C  GR C
Sbjct  428   SGNPNFRCTHTRQQMIKPKHGLAVSMLTKYAGALD-CKVGRPC  469



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   408 bits (1049),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 224/434 (52%), Positives = 280/434 (65%), Gaps = 29/434 (7%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             D  WK R   A      AY P+P  ++  L+  VS                       V 
Sbjct  39    DPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVS--------------------ELIVG  78

Query  1333  RRELRRKKGSKE--PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             + + R  KG +   PC ATNPID+CWRC  +W++  NR +LADC  GF + T GGKGG  
Sbjct  79    KDKRRNLKGQRYTGPCMATNPIDRCWRCDPNWAN--NRQKLADCVQGFGRNTVGGKGGPF  136

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV D SDD++ + K GTLRHAV +  PLWI+F  SM IKL  EL++  +KTIDGRG  V
Sbjct  137   YVVTDPSDDNMVDLKPGTLRHAVTRTGPLWIIFERSMMIKLKQELIMTSDKTIDGRGVEV  196

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
              IA GAG+T+Q + NVIIH IKV DI+   GG+IRD   H G+RT  +GDGI+IFGS ++
Sbjct  197   YIASGAGITVQFIRNVIIHGIKVYDIQVHGGGMIRDSETHYGLRTQSDGDGISIFGSSNI  256

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             WIDHVSM NC DGLIDA  G+TA+T+SN HFTDH++ +LFGA++    DK MQITLAFNH
Sbjct  257   WIDHVSMRNCYDGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQITLAFNH  316

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGKRL QRMPRCR+G  H+VNNDYTHWEMYA+GGS   TIIS+GNR+I  P     KE+T
Sbjct  317   FGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIG-PDNVHAKEIT  375

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEK-YGYRDNLRPLSGKEVGRLAR  266
              R+  P+  W  W W S  D +MNGAFF  SG P+ V++ +  +D ++   G  VGRL R
Sbjct  376   KREYSPESEWSSWQWRSINDEYMNGAFFVQSG-PELVDRPFSRQDMIKAKPGSYVGRLTR  434

Query  265   YSGHLGRCTPGRKC  224
             Y+G L  C  G  C
Sbjct  435   YAGSLS-CRVGLPC  447



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   409 bits (1050),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 299/469 (64%), Gaps = 24/469 (5%)
 Frame = -2

Query  1567  LALLSIAAVIP---ATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNER------  1415
             + +  IA++IP   A  AD +DD W  +  EAR+  L AYHP+P +I    +ER      
Sbjct  10    VCVFCIASLIPTIRANVADETDDYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNST  69

Query  1414  --VSIGLNETYnnrelyddsnnnnndNVTRREL---------RRKKGSKEPCRATNPIDQ  1268
                     +   + E       ++  N TRR L          +    K PC A+NPID+
Sbjct  70    DVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLKGPCTASNPIDK  129

Query  1267  CWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVI  1088
             CWRC+ DW+    R +L  C  GF   TTGGK GRIYVV    DDD+  P+ GTLRHAVI
Sbjct  130   CWRCQPDWAR--RRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVI  187

Query  1087  QKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVG  908
             QKEPLWI+F   M+I+L+ EL++  +KTID RGA V+IA GAG+T+Q V+N+IIH + + 
Sbjct  188   QKEPLWIIFKHDMSIRLNQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHIH  247

Query  907   DIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAV  728
              I  S GG+IRD +DH G R   +GDGI+IFG+ ++W+DH+SM  C+DGLIDA  G+TA+
Sbjct  248   HIVQSSGGMIRDSIDHFGQRGRADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAI  307

Query  727   TVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDY  548
             T+SN HFT H+ V+L GA + +  DK+MQ+T+A+NHFGK L QRMPR RWG  H+VNNDY
Sbjct  308   TISNSHFTHHNDVMLLGAQDNNMDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDY  367

Query  547   THWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWTWVSSGDVFMN  371
             THWE+YA+GGS G TI+S GNR+IA P +  ++EVT RD   +S WK W W S  DVFMN
Sbjct  368   THWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMN  427

Query  370   GAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              A+F  SG+P     +  +  ++P  G  V +L +Y+G L  C  G+ C
Sbjct  428   NAYFRQSGNPHFKCSHSRQQMIKPKHGVAVSKLTKYAGALD-CRVGKAC  475



>ref|XP_009101245.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   408 bits (1049),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 232/459 (51%), Positives = 294/459 (64%), Gaps = 31/459 (7%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             LS+A V P+    V+  D+ W QR+ +A R  +++Y PNP  +T   N   ++ +  T  
Sbjct  18    LSLAVVAPSVQGHVAVYDEYWTQRQTDALRETIKSYDPNPFNVTDHFNHHAALAMETTGA  77

Query  1384  nrelyddsnnnnndNVTRRELRR------KKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
             +               TRRELR+       +       + N ID+CWR   +W    NR 
Sbjct  78    DNG-------------TRRELRQVRRGRKTRRRGGRHHSLNAIDKCWRGDKNWHK--NRK  122

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC LGF + TTGGK G+ YVV DASD D+  PK GTLRHAV +  PLWI+F  SM I
Sbjct  123   KLADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHAVTRDRPLWIIFGRSMII  182

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  +KTIDGRGA V+I GGAG+TLQ V NVIIHNI +  IK   GG+IRDC  
Sbjct  183   KLQQELIITHDKTIDGRGANVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGGMIRDCEH  242

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G R+  +GDGI IFG+ ++WIDHVSM +C DG+IDA  G+TA+T+SN H TDH++VLL
Sbjct  243   HVGQRSKSDGDGINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLL  302

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FG  + D IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+   T
Sbjct  303   FGGKDGDVIDKKMQITVAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAIGGNKNPT  362

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG-----DP  341
             IISQGNR+IA P +   K+VT R+  P   WK W W S  D F+NGA+F  SG      P
Sbjct  363   IISQGNRFIA-PHKETCKQVTKREYTPYTEWKSWNWQSERDYFLNGAYFVNSGRANAWSP  421

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                     +  +RP SG  V RL + +G LG CTPG+ C
Sbjct  422   APKNPIHRKFAIRPQSGTGVRRLTKDAGTLG-CTPGKSC  459



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score =   406 bits (1044),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 216/442 (49%), Positives = 291/442 (66%), Gaps = 26/442 (6%)
 Frame = -2

Query  1540  IPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyd  1367
             +P  +A ++  D+VW++R  EA +   Q Y PNP  +   LN +V               
Sbjct  1     MPCLSAHIAEVDEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ--------------  46

Query  1366  dsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkg  1187
                + +   + +R L   +  +  C ATNPID+CWRC+ +W++  +R  LA CALGF   
Sbjct  47    ---DLSKQAIAKRGLLNAESGQ--CEATNPIDKCWRCKENWAE--DRQALAGCALGFGSK  99

Query  1186  ttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNK  1007
              TGGKGG+IY V D SD+D++ PK GTLRHAVIQKEPLWI+FA  M IKL  EL+VQG+K
Sbjct  100   ATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSK  159

Query  1006  TIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDG  827
             TIDGRGA V+IA GAG+ LQ V NVIIH I + +I    GG+IRD VDH G R   +GD 
Sbjct  160   TIDGRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSDGDA  219

Query  826   ITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKR  647
             ++IFGS ++W+DH+++    DGLIDA   +TA+T+SNCH ++HDK +L GA++  + DK+
Sbjct  220   VSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASDTFTEDKK  279

Query  646   MQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQP  467
             MQ+T+AFN F K L QRMP  R+G  H+VNNDY  WEMYA+GG  G TI+SQGNR+ A  
Sbjct  280   MQVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASN  339

Query  466   GENFFKEVTHR-DCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSG  290
              +N  KEVT R +C  +  K W W S GDV +NGA+F  SGDPK   +Y   + ++P SG
Sbjct  340   NQN-AKEVTKRMNCSPEEGKSWIWRSEGDVLLNGAYFNSSGDPKKQIQYQMDNVIKPESG  398

Query  289   KEVGRLARYSGHLGRCTPGRKC  224
              EV R+ +++G L  C PG++C
Sbjct  399   TEVERITKFAGAL-VCKPGQEC  419



>emb|CDY45202.1| BnaA06g34060D [Brassica napus]
Length=459

 Score =   408 bits (1048),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 235/459 (51%), Positives = 295/459 (64%), Gaps = 31/459 (7%)
 Frame = -2

Query  1558  LSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYn  1385
             LS+A V P+    V+  D+ W QR+ +A R  +++Y PNP  +T   N   ++ +  T  
Sbjct  18    LSLAVVAPSVQGHVAVYDEYWTQRQTDALRETIKSYDPNPFNVTDHFNYHAALAMETT--  75

Query  1384  nrelyddsnnnnndNVTRRELRR------KKGSKEPCRATNPIDQCWRCRADWSDGPNRF  1223
                          DN TRRELR+       +       + N ID+CWR   +W    NR 
Sbjct  76    -----------GADNGTRRELRQVRRGRKTRRRGGRHHSLNAIDKCWRGDKNWHK--NRK  122

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
             +LADC LGF + TTGGK G+ YVV DASD D+  PK GTLRHAV +  PLWI+F  SM I
Sbjct  123   KLADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHAVTRDRPLWIIFGRSMII  182

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  +KTIDGRGA V+I GGAG+TLQ V NVIIHNI +  IK   GG+IRDC  
Sbjct  183   KLQQELIITHDKTIDGRGANVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGGMIRDCEH  242

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G R+  +GDGI IFG+ ++WIDHVSM +C DG+IDA  G+TA+T+SN H TDH++VLL
Sbjct  243   HVGQRSKSDGDGINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLL  302

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
             FG  + D IDK+MQIT+AFNHFGKRL QRMPR R+GL H+VNNDYTHWEMYA+GG+   T
Sbjct  303   FGGKDGDVIDKKMQITVAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAIGGNKNPT  362

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSG-----DP  341
             IISQGNR+IA   EN  K+VT R+  P   WK W W S  D F+NGA+F  SG      P
Sbjct  363   IISQGNRFIAPHQEN-CKQVTKREYTPYTEWKSWNWQSERDYFLNGAYFVNSGRANAWSP  421

Query  340   KGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                     +  +RP SG  V RL + +G LG CTPG+ C
Sbjct  422   APKNPIHRKFAIRPQSGTGVRRLTKDAGTLG-CTPGKSC  459



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 222/431 (52%), Positives = 274/431 (64%), Gaps = 31/431 (7%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             ++ W +R  EAR     AY  +P       N                            T
Sbjct  38    EEYWAERAEEARANNRAAYVSDPIAAMNRFNTET---------------------LRATT  76

Query  1333  RRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYV  1154
             RR LRR +G   PC ATNPID CWRCRADW+   +R RLA CA GF   TTGG GG+IY+
Sbjct  77    RRSLRRYQG---PCAATNPIDSCWRCRADWA--TDRQRLALCARGFGHKTTGGAGGKIYI  131

Query  1153  VKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNI  974
             V DASDD++  P+ GTLR+ VIQ  PLWIVFA  M ++L  EL+V  NKTIDGRGA V+I
Sbjct  132   VTDASDDEMIIPRKGTLRYGVIQGRPLWIVFARDMVVRLRQELIVSDNKTIDGRGAQVHI  191

Query  973   AGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWI  794
              G A +TLQSV++VIIHN+ +       GGIIRD   H G+RT  +GDGI++  S +VWI
Sbjct  192   TG-AQITLQSVSHVIIHNVHIHHSAPHSGGIIRDSKRHYGLRTRSDGDGISVLSSSNVWI  250

Query  793   DHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFG  614
             DHVSM+ C DGLID   G+T +TVSN HFT HD V+LFGA+N++  D+ MQ+T+AFNHFG
Sbjct  251   DHVSMYRCSDGLIDVVNGSTGITVSNSHFTKHDHVMLFGASNDNPQDRMMQVTVAFNHFG  310

Query  613   KRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHR  434
             K L QRMPRCR+G FH+VNNDYTHW+MYA+GG+   TIISQGNR+IA P +   KEVT R
Sbjct  311   KGLVQRMPRCRYGFFHVVNNDYTHWQMYAIGGNKNPTIISQGNRFIA-PDDPNAKEVTKR  369

Query  433   D-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSG  257
             +  P   +K W W S GDV MNGAFF  SG  +   KY   D +    G  VG L +++G
Sbjct  370   EYTPYSEYKDWVWKSQGDVMMNGAFFNESGG-QNERKYDQLDFIPARHGSYVGELTKFAG  428

Query  256   HLGRCTPGRKC  224
              L  C  G+ C
Sbjct  429   TLN-CRAGKPC  438



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 222/454 (49%), Positives = 298/454 (66%), Gaps = 29/454 (6%)
 Frame = -2

Query  1564  ALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNET  1391
             +LL IA++IP   A+++  D   +++  EA +  L AY+ NPE++T   N+ V     ET
Sbjct  14    SLLCIASLIPNLHANIAEFDPYLEKKAEEALKSSLAAYNENPEELTDTFNKEVG----ET  69

Query  1390  YnnrelyddsnnnnndNVTRRELRRKKGSKEP----CRATNPIDQCWRCRADWSDGPNRF  1223
               N               TRR L+ +    +     C+A NPID+CWRC  +W++  NR 
Sbjct  70    IFNG--------------TRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKNWAN--NRK  113

Query  1222  RLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTI  1043
              LADCA GF  GTTGGK G+ YVV D SDD+V+EPK GTLRHAVIQ+EPLWI+F  SM I
Sbjct  114   ALADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPKPGTLRHAVIQEEPLWIIFEKSMII  173

Query  1042  KLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVD  863
             KL  EL++  +KTIDGRG  V++A GAG+T+Q V+NVI+HNI+V  I S+ GG+IRD +D
Sbjct  174   KLQQELMINNDKTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSID  233

Query  862   HKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLL  683
             H G+RT  +GD I+IFG++ +WIDH ++    DGLIDA   +TA+T+SNC F  H+ V+L
Sbjct  234   HIGLRTVSDGDAISIFGANRIWIDHCTLTKGADGLIDAIMASTAITISNCKFNHHNDVML  293

Query  682   FGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGAT  503
              GAN+    DK MQ+T+AFN FGK   QRMPRCRWG FH+VNNDY  WEMYA+GG++  T
Sbjct  294   LGANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPT  353

Query  502   IISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             IISQGNR+ A    N  KEVT+R+  P+  W+ W W S GD+F+NGA+F  SG       
Sbjct  354   IISQGNRFKASNNPN-TKEVTNRNGAPESLWRNWQWRSEGDLFLNGAYFRESGPDIKHTP  412

Query  325   YGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +    +++    K VGRL R +G + +C  G+ C
Sbjct  413   FTEHTSIKFEPAKFVGRLTRKAGVI-KCKIGKAC  445



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 226/425 (53%), Positives = 286/425 (67%), Gaps = 22/425 (5%)
 Frame = -2

Query  1513  DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVT  1334
             DD W+++  EA      AY+P+PE +T + N+ V + L+E  N+               T
Sbjct  32    DDHWQKKAEEALARSRAAYNPDPEAVTHDFNKAVHLALSEARNS---------------T  76

Query  1333  RRELR--RKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRI  1160
             RR LR   +   K PC ATNPID+CWRC+ +W +  +R +LA CA GF +   GGK G  
Sbjct  77    RRTLRSVHRNKFKGPCVATNPIDRCWRCQKNWIN--HRKKLATCAKGFGRNAIGGKNGDF  134

Query  1159  YVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFV  980
             YVV D SDDD+  PK GTLR  VIQ  PLWI+FA  M I+LS EL++  NKTIDGRGA V
Sbjct  135   YVVTDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANV  194

Query  979   NIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHV  800
             +IA GA +T+Q V++VIIH I + DI+ S GGIIRD + H G+RT  +GDGI+I+GS  +
Sbjct  195   HIAFGAQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDI  254

Query  799   WIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNH  620
             WIDH S+ NC DGLIDA   +TA+T+SNCHFT H+ VLLFGA++ +  D  MQ T+AFNH
Sbjct  255   WIDHCSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNH  314

Query  619   FGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVT  440
             FGK L QRMPRCRWG FH+VNNDYT W MYA+GGS   TIISQGNR++A P   F KEVT
Sbjct  315   FGKGLVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVA-PRMLFSKEVT  373

Query  439   HRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARY  263
              RD   +D WK+WTW S GD+  NGAFF  SG+P    K+  +D ++   G  V RL R+
Sbjct  374   KRDYATEDVWKQWTWRSEGDLMQNGAFFRESGNPNA-RKFDRKDFIKAKPGTWVRRLTRF  432

Query  262   SGHLG  248
             +G LG
Sbjct  433   AGPLG  437



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   408 bits (1048),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 227/454 (50%), Positives = 291/454 (64%), Gaps = 23/454 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGLNE  1394
             +Y  +L ++A +        DD W+QR+  A       Y  +P ++  +LN  V   + +
Sbjct  52    LYAVVLLLSAAVSEANIGEFDDYWRQRKLMADAAAEATYQHDPIEVPNQLNRAVHRSIKK  111

Query  1393  TYnnrelyddsnnnnndNVTRRE-LRRKKGSKE-PCRATNPIDQCWRCRADWSDGPNRFR  1220
                             D  TRRE L +KKG    PC+ATNPID+CWRCR DW+   +R R
Sbjct  112   ---------------EDISTRREMLGQKKGKMNGPCKATNPIDRCWRCRKDWAT--DRKR  154

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             LA CA GF + TTGG  G+ YVV D +DDDV  P+ GTLR AVIQ EPLWI FA +M I 
Sbjct  155   LARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFAKTMIIT  214

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSP--GGIIRDCV  866
             L  EL+++G+KTIDGRG  V IA GA +T+Q  NNVIIHNI + DI SS   GG IRD  
Sbjct  215   LKEELIIRGDKTIDGRGVQVRIANGAQLTVQFANNVIIHNIHINDIISSNKNGGNIRDSP  274

Query  865   DHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVL  686
             DH G RT  +GDGIT+FGS +VW+DH+S+ NC+DGLID  A +T VT+SNCH T+H+ V+
Sbjct  275   DHFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHMTNHNDVM  334

Query  685   LFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGA  506
             LF ++++   D+ MQIT+AFNHFG+ L QRMPRCRWG FH+VNNDYTHW MYA+GGS   
Sbjct  335   LFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAP  394

Query  505   TIISQGNRYIAQPGENFFKEVTHRDCPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEK  326
             TIISQGNRYIA P     +     D P+  WK W W S  D+FM GA+FT +G      +
Sbjct  395   TIISQGNRYIAPPNLAAKQVTKQHDAPESEWKNWVWHSEDDLFMEGAYFTVTGGQIN-RQ  453

Query  325   YGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             +  +D ++P  G  V RL R++G L  C PG+ C
Sbjct  454   FNKKDLIKPKPGSYVTRLTRFAGSLD-CKPGKPC  486



>ref|XP_006579282.1| PREDICTED: probable pectate lyase P59-like [Glycine max]
Length=420

 Score =   405 bits (1042),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/350 (60%), Positives = 250/350 (71%), Gaps = 16/350 (5%)
 Frame = -2

Query  1297  PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEP  1118
             PC+ATNPID+CWRC  +W    NR RLADCALGF  GTTGGK G+IYVV D+SD+D+  P
Sbjct  18    PCKATNPIDKCWRCDPNWEK--NRKRLADCALGFGHGTTGGKDGKIYVVNDSSDNDLVNP  75

Query  1117  KAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVN  938
             K GTLRHA IQ+EPLWI+F  +M IKL  EL++  NKTID RGA V+I+ GA +TLQ V 
Sbjct  76    KPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNKTIDARGANVHISEGAQITLQYVK  135

Query  937   NVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGL  758
             N+IIH + + DIK   GG+IRD +DH G+R   +GD I++FGS +VWIDHVS  NC+DGL
Sbjct  136   NIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDAISVFGSTYVWIDHVSFTNCDDGL  195

Query  757   IDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRW  578
             ID  + +TAVT+SNCH T H+ VLLFGA++  S DK MQ+TLAFNHFGK L QRMPRCRW
Sbjct  196   IDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKIMQVTLAFNHFGKGLIQRMPRCRW  255

Query  577   GLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWT  401
             G FHIVNNDYTHW MYA+GGS   TIISQGNR+I          VT RD  P+  WK W 
Sbjct  256   GFFHIVNNDYTHWLMYAIGGSQQPTIISQGNRFI----------VTKRDYAPESVWKNWN  305

Query  400   WVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHL  251
             W S GD+ MNGAFF  SG  K V K   +  +    GK V  L R++G L
Sbjct  306   WRSEGDLLMNGAFFVQSG--KNVAK-NPKAEIIAKPGKAVSSLTRFAGPL  352



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 232/453 (51%), Positives = 299/453 (66%), Gaps = 24/453 (5%)
 Frame = -2

Query  1573  VYLALLSIAAVIPATTADVS--DDVWKQREAEARRGLLQAYHPNPEKITTELNERVSIGL  1400
             + L  L +  +IP+  A ++  DD W++RE +A+  L +AY+PNPE++T   N+ V+  L
Sbjct  11    LILYFLCLGVIIPSLEAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQHFNDHVARIL  70

Query  1399  NETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFR  1220
                                N TRR L+++KG   PC ATNPIDQCWRC  +W    NR +
Sbjct  71    --------------MGFRTNSTRRMLKKRKGG--PCEATNPIDQCWRCDRNWEK--NRKK  112

Query  1219  LADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIK  1040
             LADCALGF +GTTGGK G IYVV D +DD V  P  GTLRHAVIQ  PLWI FA  M I+
Sbjct  113   LADCALGFGRGTTGGKDGPIYVVTDPTDD-VLNPSRGTLRHAVIQNRPLWITFARGMIIR  171

Query  1039  LSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDH  860
             L  ELL+  NKTIDGRGA V+IA GAG+T+Q   NVIIHNI + +I  S GG I+D  +H
Sbjct  172   LKEELLMTSNKTIDGRGANVHIAYGAGITIQFAKNVIIHNIHIHNIFPSKGGKIKDGENH  231

Query  859   KGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLF  680
              G+RT  +GDGI++FG+ +VW+DH+S++ C DG+IDA  G+TA+T+SNCHFTDH+ V+LF
Sbjct  232   LGLRTRSDGDGISLFGATNVWLDHLSVYKCSDGIIDAIQGSTAITISNCHFTDHNDVMLF  291

Query  679   GANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATI  500
             GA++  S D++MQIT+AF HFGK L QRMPR R+G  H+VNNDY HW M A+GGSS  TI
Sbjct  292   GASDSYSADEKMQITVAFTHFGKNLVQRMPRVRFGFVHVVNNDYRHWIMSAIGGSSHPTI  351

Query  499   ISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKY  323
             IS GNR+ A P     KEV  R+   +  WK W W S GD+ +NGA FT SGDP+  +K+
Sbjct  352   ISHGNRFRA-PRNIAAKEVCKREYATEQEWKNWDWRSEGDLMLNGAIFTQSGDPRAAKKF  410

Query  322   GYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             G    +       V  L R+SG L  C P + C
Sbjct  411   GGDKMIAYKPAHMVPLLVRWSGTL-ECRPNKPC  442



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score =   409 bits (1050),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 213/377 (56%), Positives = 266/377 (71%), Gaps = 9/377 (2%)
 Frame = -2

Query  1336  TRRELRRK-KGS----KEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggk  1172
             TRR LR K KG     + PC A+NPID+CWRCR+DW+    R +L  C  GF   TTGGK
Sbjct  139   TRRSLRGKGKGKWSKLRGPCTASNPIDKCWRCRSDWA--KRRKKLTRCVRGFGHRTTGGK  196

Query  1171  gGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGR  992
              GRIYVV    D+D+  PK GTLRHAVIQKEPLWI+F   M I+LS ELL+  +KTID R
Sbjct  197   RGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMHIRLSQELLINSHKTIDAR  256

Query  991   GAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFG  812
             GA V+IA GAG+T+Q V NVIIH + +  I  S GG+IRD VDH GMRT  +GDGI+I+G
Sbjct  257   GADVHIAHGAGITMQFVRNVIIHGLHIHHIFESSGGMIRDSVDHFGMRTRADGDGISIYG  316

Query  811   SHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITL  632
             S  +W+DH+SM  C+DGLIDA  G+TA+T+SN HFT H+ V+L GA N +  DK MQ+T+
Sbjct  317   SSKIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTNEADKHMQVTV  376

Query  631   AFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFF  452
             A+NHFGK L QRMPR RWG  H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P +  +
Sbjct  377   AYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHY  436

Query  451   KEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGR  275
             +EVT RD   +D WK W W S  DVFMNGA+F  SGDPK    +  +  ++P  G  V +
Sbjct  437   REVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGDPKYKCAHTRQQMIKPKHGLAVSK  496

Query  274   LARYSGHLGRCTPGRKC  224
             L +Y+G L  C  G++C
Sbjct  497   LTKYAGALD-CRVGKRC  512



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   403 bits (1036),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 197/359 (55%), Positives = 256/359 (71%), Gaps = 4/359 (1%)
 Frame = -2

Query  1297  PCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEP  1118
             PC A+NPID+CWRC+ DW+    R +L  C  GF   TTGGK GRIYVV    DDD+  P
Sbjct  10    PCTASNPIDKCWRCQPDWAR--RRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNP  67

Query  1117  KAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVN  938
             + GTLRHAVIQKEPLWIVF   M+I+LS EL++  +KTID RGA V+IA GAG+T+Q V+
Sbjct  68    RPGTLRHAVIQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVH  127

Query  937   NVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGL  758
             N+IIH + V  I  S GG+IRD ++H G R   +GDGI+IFG+ ++W+DH+SM  C+DGL
Sbjct  128   NIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGL  187

Query  757   IDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRW  578
             IDA  G+TA+T+SN HFT H+ V+L GA N +  DK+MQ+T+A+NHFGK L QRMPR RW
Sbjct  188   IDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRW  247

Query  577   GLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRDCPDDS-WKKWT  401
             G  H+VNNDYTHWE+YA+GGS G TI+S GNR+IA P +  ++EVT RD   +S WK W 
Sbjct  248   GFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWN  307

Query  400   WVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             W S  DVFMN A+F  SG+P     +  +  ++P +G  V +L +Y+G L  C  G+ C
Sbjct  308   WRSEKDVFMNNAYFRQSGNPHFKCSHSRQQMIKPKNGMAVSKLTKYAGALD-CRVGKAC  365



>gb|AGT16687.1| pectate lyase [Saccharum hybrid cultivar R570]
Length=441

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 212/372 (57%), Positives = 265/372 (71%), Gaps = 10/372 (3%)
 Frame = -2

Query  1336  TRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIY  1157
             TRR L R  G   PC ATNPID+CWRCRADW+   +R RLA CA GF   T GG  G++Y
Sbjct  79    TRRALARYNG---PCMATNPIDRCWRCRADWA--TDRKRLAQCARGFGHRTVGGAAGKLY  133

Query  1156  VVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVN  977
             VV+D SDD++  P+ GTLRHAVIQ  PLWIVFA  M I+L  EL+V  NKTIDGRGA V+
Sbjct  134   VVRDPSDDEMIIPRKGTLRHAVIQDRPLWIVFARDMVIRLRQELMVSSNKTIDGRGAQVH  193

Query  976   IAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVW  797
             I   A +TLQ+V++VI+HN+ + D K+  GG+IRD   H G+RT  +GDGI++  S +VW
Sbjct  194   IVH-AQITLQNVHDVILHNLHIHDAKAHSGGMIRDSKRHTGLRTRSDGDGISVLSSSNVW  252

Query  796   IDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHF  617
             IDHVSM +C DGLID   G+TA+TVSN HFT HD V+LFGA+N++  D+ MQIT+AFNHF
Sbjct  253   IDHVSMSSCADGLIDVVNGSTAITVSNSHFTRHDHVMLFGASNDNPQDEVMQITVAFNHF  312

Query  616   GKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATIISQGNRYIAQPGENFFKEVTH  437
             G+ L QRMPRCR+G FH+VNNDYTHW MYA+GG+   TIISQGNR+IA P +   KEVT 
Sbjct  313   GRGLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGNKNPTIISQGNRFIA-PDDPNAKEVTK  371

Query  436   RD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYS  260
             R+  P   +K+W W S GDV MNGAFF  SG  +   KY   D +    G+ VG+L R++
Sbjct  372   REYTPYKDYKEWVWKSQGDVMMNGAFFNESGG-QNERKYDKFDFIPAKHGRYVGQLTRFA  430

Query  259   GHLGRCTPGRKC  224
             G L +C  G+ C
Sbjct  431   GPL-KCIVGQPC  441



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score =   405 bits (1040),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 283/457 (62%), Gaps = 57/457 (12%)
 Frame = -2

Query  1567  LALLSIAAVIPATTADVSDDVWKQREAEARRGLLQAYHPNPEKITTELNERVS---IGLN  1397
             L + S+   + A      D+ W+ R  EA++    A++ NPE +T  LN  VS   +G N
Sbjct  7     LFVCSLLFFVVANANVDEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTMLGHN  66

Query  1396  ETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRCRADWSDGPNRFRL  1217
              T                   RR LR+K   + PC ATNPID+CWRC  +W+   NR +L
Sbjct  67    ST-------------------RRSLRKKY--RGPCLATNPIDRCWRCDRNWAK--NRRKL  103

Query  1216  ADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEPLWIVFAASMTIKL  1037
             A+C LGF   T GGK G IYVV DASDDD+  PK GTLRH VIQK PLWI+F  SM I+L
Sbjct  104   AECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRL  163

Query  1036  SGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKSSPGGIIRDCVDHK  857
             S EL++  +KTID RGA V+IA GAG+T+Q VNNVIIHN+ + DI S  GG+IRD VDH 
Sbjct  164   SQELMISSHKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHY  223

Query  856   GMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSNCHFTDHDKVLLFG  677
             G RT  +GDGI+IFGS HVWIDHVSM NC+DGLIDA  G+TA+T+SNCHFT H       
Sbjct  224   GFRTQSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHH-------  276

Query  676   ANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWEMYAVGGSSGATII  497
               NE +I  +           K    +MPRCRWG FH+VNNDYTHW MYA+GGS   TI+
Sbjct  277   --NERAIATQ-----------KTKLCKMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIV  323

Query  496   SQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFFTPSGD-----PKG  335
             SQGNR+IA P  N  K++T R+   +D WK W+W S GD  MNGA F  SGD      KG
Sbjct  324   SQGNRFIAPPNPN-AKQITKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKG  382

Query  334   VEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
             + +Y   D +    G  V RL R SG +  CTPG+ C
Sbjct  383   LSRY---DMISFKPGTYVRRLVRLSGTI-ECTPGKPC  415



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   406 bits (1043),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 230/480 (48%), Positives = 289/480 (60%), Gaps = 46/480 (10%)
 Frame = -2

Query  1603  MAASTKILWWVYLALLSIAAVIPATTADV-------------SDDVWKQREAEARRGLLQ  1463
             MA S  I+    L LL +A + P   A+               D  W++R   A+     
Sbjct  1     MARSLDII----LFLLCLAVLTPTLNANPLEKNEYWEEHVPEFDSYWQERAKVAKEANQA  56

Query  1462  AYHPNPEKITTELNERVSIGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRAT  1283
             AY  +P  ++      VS                         RR LR        C AT
Sbjct  57    AYFVDPYAVSGNFTATVS-----------------EIIAAKSARRSLRGNNNGT--CMAT  97

Query  1282  NPIDQCWRCRADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTL  1103
             NPID+CWRC  +W++  NR +LADC  GF + T GGKGG  YVV D SD+++ +PK GTL
Sbjct  98    NPIDRCWRCDPNWAN--NRQKLADCVQGFGRNTRGGKGGPFYVVTDPSDNELLDPKPGTL  155

Query  1102  RHAVIQKEPLWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIH  923
             RHAV +  PLWI FA SM I L  EL++  +KTIDGRG  V IA GAG+T+Q V N+IIH
Sbjct  156   RHAVTRNGPLWITFARSMVITLQQELIMSSDKTIDGRGVEVYIANGAGITVQFVKNIIIH  215

Query  922   NIKVGDIKSSPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAA  743
              IK+ +IK   GG+IRD   H G RT  +GDGI+IFG+ +VWIDHVSM NC DGLIDA  
Sbjct  216   GIKIYNIKVKEGGMIRDSESHYGFRTKSDGDGISIFGASNVWIDHVSMRNCTDGLIDAIM  275

Query  742   GATAVTVSNCHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHI  563
             G+TA+T+SN HFTDH++V+LFGA+++ S DK MQITLAFNHFGKRL QRMPR R+G  H+
Sbjct  276   GSTAITISNGHFTDHNEVMLFGASDDYSDDKIMQITLAFNHFGKRLVQRMPRARFGFVHV  335

Query  562   VNNDYTHWEMYAVGGSSGATIISQGNRYIAQP------GENFFKEVTHRDCPDDS-WKKW  404
             VNNDYTHWEMYA+GGS   TIIS+GNR+I          +   KEVT R+  D+S WK W
Sbjct  336   VNNDYTHWEMYAMGGSQNPTIISEGNRFIGPDNVMVGGNQLNLKEVTKREYTDESVWKNW  395

Query  403   TWVSSGDVFMNGAFFTPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
              W S  D F+NGA+F  SG       +  +D +    G  VGRL RYSG+L +C  G+ C
Sbjct  396   QWRSINDEFLNGAYFIQSGPELKNRPFSKKDMITAKPGSYVGRLTRYSGNL-QCRVGKPC  454



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   405 bits (1041),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 222/465 (48%), Positives = 288/465 (62%), Gaps = 40/465 (9%)
 Frame = -2

Query  1570  YLALLSIAAVIPATTADVSDD--------------VWKQREAEARRGLLQAYHPNPEKIT  1433
             +  L  +  +IP   A+V +D               WKQ+ + A +   QAY  +P  +T
Sbjct  7     FFLLTCLIVIIPTLHANVKEDEIYWKRQSQILNDSYWKQKASVAEKENKQAYTSDPYSLT  66

Query  1432  TELNERVS-IGLNETYnnrelyddsnnnnndNVTRRELRRKKGSKEPCRATNPIDQCWRC  1256
               L   VS I + E                    RR L+ K G+   C ATNPID+CWRC
Sbjct  67    KNLTYSVSEIIVGEQNG-----------------RRNLKGKGGN---CMATNPIDRCWRC  106

Query  1255  RADWSDGPNRFRLADCALGFAkgttggkgGRIYVVKDASDDDVQEPKAGTLRHAVIQKEP  1076
               +W++  NR +LA+C  GF + T GGK G  YVV    D+D+  P  GTLRHAV +  P
Sbjct  107   DPNWAN--NRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHAVTRTGP  164

Query  1075  LWIVFAASMTIKLSGELLVQGNKTIDGRGAFVNIAGGAGMTLQSVNNVIIHNIKVGDIKS  896
             LWI+FA SM I+L+ EL++  +KTIDGRG  V +AGGAG+T+Q + NVIIH +K+ DI+ 
Sbjct  165   LWIIFAHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKNVIIHGVKIFDIQV  224

Query  895   SPGGIIRDCVDHKGMRTHDEGDGITIFGSHHVWIDHVSMHNCEDGLIDAAAGATAVTVSN  716
               GG+I D  +H G+RT  +GDGI+IFGS ++WIDHVSM  C+DGLIDA  G+TA+T+SN
Sbjct  225   GNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRKCKDGLIDAIQGSTAITISN  284

Query  715   CHFTDHDKVLLFGANNEDSIDKRMQITLAFNHFGKRLHQRMPRCRWGLFHIVNNDYTHWE  536
              HFTDH++V+LFGA++    D  MQITLAFNHFGKRL QRMPRCR+G  H+VNNDYTHWE
Sbjct  285   SHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWE  344

Query  535   MYAVGGSSGATIISQGNRYIAQPGENFFKEVTHRD-CPDDSWKKWTWVSSGDVFMNGAFF  359
             MYA+GGS   TIIS+GNR+IA P     KE+T R+  P+  WK W W S  D ++NG FF
Sbjct  345   MYAIGGSKHPTIISEGNRFIA-PDNINAKEITKREYSPEQEWKSWQWRSINDEYLNGGFF  403

Query  358   TPSGDPKGVEKYGYRDNLRPLSGKEVGRLARYSGHLGRCTPGRKC  224
                G       Y   D +    G  VGRL RY+G L +C  G+ C
Sbjct  404   REGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSL-KCMVGKPC  447



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5144842398758